5I3UA

Structure of hiv-1 reverse transcriptase n-site complex; catalytic incorporation of aztmp to a dna aptamer in crystal
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
550
structure length
550
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
total genus 148
structure length 550
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i3uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i3uA05
3DM2A 1LWCA 1YTUA 3LPTA 2OYQA 5F8NA 1RT1B 4J9LA 1RILA 4PQUA 4PY5A 4RUCA 4RNOA 4RW6B 4RNNA 3KLFA 4O55A 1NK4A 1I6JA 1JLAA 3ZSXA 2YNFA 1KFSA 3KHRA 4J9NA 5KFPA 3LZIA 1S9GA 1RT7A 1QAIA 3TAPA 4HCBA 4DTPA 1RT4A 1C1BA 4O3NA 2VG5A 1T05A 3I0SA 2D3UA 4IH5A 3LWLA 4CEQA 3FQLA 1S1TA 4Z4GA 3U3YA 3HPOA 1HQUA 4CJUA 2G8WA 1BCMA 1HMVA 2VG5B 1T05B 4KV8A 3RMDA 1W25A 1C2PA 2Q3SA 3BREA 1L3SA 4DSFA 3C6UB 4CIEA 2B5JA 4CJKA 4R0EA 4DG1B 3CO9A 1TL1B 3T5KA 4O3RA 3TANA 1NJXA 3MR6A 4PWDA 2YNFB 3KLEA 1VRUA 4CK2A 3KLFB 4DTOA 4IFYB 4CJEA 3UIQA 3NBPA 4X2BA 4M95A 4KO0B 3F73A 3DM2B 2HMIA 4IRCA 4Q0BA 4TY9A 4ID1A 4BE1A 1LWEB 4NLWA 3RTVA 3KNAA 4ZPCA 5CYMB 2KQ2A 4CK3A 2GC8A 3KMSA 1LAVA 1VSDA 4I9LA 4OLBA 1S9EA 3H59A 4PQUB 5KFGA 4QWDA 3O3HA 3SQ4A 1HNVA 2Y1IA 3QEWA 4AHTA 3DYAA 1DTTB 1T94A 1KSPA 3KKSA 3B6PA 3HXMA 5C42B 4URSA 3LP2A 4PUOA 2W9AA 4PA1A 4FJGA 4DL6A 4TXSA 3E51A 2EHGA 3OL6A 3HKWA 1S1WA 5KG2A 4RW8B 1YVFA 3G10A 3VQCA 4LH4A 4Q8FA 3TAMB 3NL0A 1JL2A 3MFHA 5DG9A 4N5SA 4EZ6A 5DMRA 1RTDA 4RW4B 4DF8A 3KK3A 2QKBA 5HRRA 4DSJA 3DLKB 1J5OA 4CF2A 2YKNA 1IKVB 5KFZA 4CEFA 3K5MA 1KHWA 4DTMA 3HPGA 3I5BA 1JLEB 4DQIA 4DLEA 3KOAA 4CHZA 3AVBA 3MEEB 3B6OA 4K4YA 3CJ4A 3IAYA 2R2SA 3H08A 1C0UA 4IR9A 3AA5X 2ZE2A 2VG7A 4FJMA 2IJNA 2IGIA 1QS4A 2UVRA 3H5SA 2WONA 4IG3A 5KFBA 4B08A 4DQPA 2PY5A 3O4NA 1X9SA 4WYWA 1BQMB 4O5BA 4CF8A 4ECQA 3BSOA 4ED2A 4RW9B 2C2DA 5CY4A 4EO6A 1NHVA 3PUFA 1S4FA 1IKWA 1UWBB 1KFDA 3VQ6A 1Z4UA 1NNDA 4DFMA 1NKBA 2J6TA 3MF5A 2BQRA 3MTKA 1REVB 5J2QA 3DLGB 1RBTA 5EUHA 5KFWA 3QGHA 3GV8B 3V1QA 1UAXA 1RTHA 4FBTA 3K57A 4DL3A 4Y34A 3GYNA 1SL1A 4B8CA 2VG6B 4QWAA 4DS5A 4ZVGA 1ZBHA 4ZP8A 4ZPAA 5KFCA 4IKFA 1HYZA 4FJIA 1LW2A 3DRSA 2HNZB 4CESA 3VQQA 5HP1A 1JX4A 4ECWA 1D8YA 1A5VA 4FM2A 2NUBA 2J6SA 1VRTA 1QE1A 4NCGA 3GIKA 4WXOA 1S1WB 4NYNA 4KHRA 3RBDA 4OKEA 5CYQA 3OYBA 3O3GA 1JXLA 1N6QA 4CJLA 1KLMB 3OHBA 5CYQB 4CEBA 1XHXA 4ECXA 4LSLB 1WSJA 2KW4A 4W5RA 1ZBIA 2UVWA 4DQRA 4ZVEA 4HVJA 1WLJA 2YNHA 2OPPB 2QK9A 3CG7A 1D0EA 5K14A 3MXIA 2AGQA 1SV5A 3IRXB 3DMJA 4FJ5A 3OLBA 3C95A 3S3OA 5J2QB 1CZ9A 1REVA 3DOKA 2W9BB 1EXQA 2D0BA 1MU2A 1YT3A 2IOCA 2RF2A 3MR3A 1RYSA 4TN2A 4EBCA 4CFCA 3V6DA 3I5CA 3FRZA 1C1CB 5D3GB 4DEZA 1F21A 3OYMA 4RZRA 3GV5B 3VQAA 1LAWA 3QEIA 3RRHA 4MQ3A 2XY7A 1HJRA 1IO2A 5E41A 3T1AA 3KD5E 3Q8RB 3IS9A 4LSNA 2OPQB 4TYAA 2WHOA 4CJ3A 4DQSA 1TL3A 3MEEA 4BDZA 3PY8A 2FBXA 2HB5A 3TQ1A 4ED0A 1RBUA 4FJ7A 2YKNB 2YNGB 1RT7B 3OYKA 1BISA 3RRGA 3FDSA 1KCFA 3AVCA 5T14A 1JLBA 3QIPB 4KRFA 1K1QA 1GX5A 4FXDA 2JEJA 2FBTA 3OLAA 3SZ2A 1LW0A 2FJVA 4GW6A 3ZT0A 1IKVA 4TQSA 3P1GA 4J2AA 3GQCA 2QE5A 3BQ1A 4FJ8A 1HQEA 4E1NA 2HNYA 4R5PB 2AWZA 4FYDA 5KG1A 4FJJA 5KT2A 3ITHB 5DK5A 3DOLA 4H8KA 1D5AA 2IM2A 3LPUA 1Z26A 1S9EB 3ZT3A 5KRSA 4OVLA 4R5PA 1GOCA 3AVLA 4NLQA 3AV9A 4GMJB 4K50A 3QLHA 4I7FA 4Q0BB 4KBIA 3DYAB 5L1JA 2DFHA 2QKKA 2YKMB 4YP3A 3DRPB 4B3OA 1D9DA 3UR0A 2HAIA 1KVCA 3QEVA 4Y1CA 3LWMA 3I5AA 4ED1A 3ALYA 3CIZA 1WAFA 4Q43A 3PW0A 4CHOA 1SKSA 2O5DA 4B8AB 1N56A 5C24A 2W42A 3RB6A 5J2PA 1SL0A 4KI4A 5L9XA 4ED6A 2XY5A 1S10A 3VN5A 2FC0A 5HRNA 4DSLA 1D9FA 4ZMMA 3DLRA 3CFRA 4M42A 3UPFA 2OPQA 1TL1A 1RBVA 1Q8IA 3F9KA 3ICLA 4WZMA 1XR5A 4H54A 3VQSA 1S0NA 4MIAA 1CXUA 1TL3B 3ZCMA 2BRLA 1ZETA 2IJFA 3LP1B 4RG8A 3QYYA 1XR7A 2RDIA 5KFUA 4RW6A 1HRHA 1RDAA 3PO5A 4OL8A 3VQ9A 4L8RB 4QOZB 4QPXA 1UOCA 1MU2B 1S9GB 4FLVA 2XY6A 1W0HA 2R7YA 4ED7A 3DLBA 3QLHB 4I7FB 1TP7A 2Z1IA 3M8SA 4KE5A 4N76A 2HVHA 1RA7A 4C8LA 3SPYA 2E9TA 5KRTA 2DPIA 4CFDA 2B6AB 3DOKB 5KFDA 3QGIA 2CJQA 2OZMA 4JRPA 2QV6A 1C0TB 3P83D 5HBMA 2JGUA 5C25B 1RCHA 2RN2A 2AU0A 1S97A 3DLEB 4E7IA 1IKYB 4LSLA 3NDKA 4IKAA 1B9FA 4NCGB 4KHUA 3PW7A 2FVPA 2WB4A 3KD1E 3FFIB 1JLBB 2FVSA 1NOZA 1LW2B 1DLOB 4KTWA 4Q8EA 4AHUA 4FLTA 3AVFA 2ILZA 1RTJA 4NLGA 3QZ7A 5KFAA 1X1PA 1JLFB 1ZBUA 4W5TA 4E7KA 4B9SA 1VRTB 3MXJA 4DL5A 1JLCA 1U04A 1X9MA 4TY8B 4OKJA 2ASLA 4Z4CA 5KFVA 1KTQA 1VSFA 3OS2A 3OYAA 4NLRA 2X78A 1ZBLA 1RA6A 1T03A 2D7SA 3H4DA 2V9WA 3VQBA 1VK0A 3V81A 4ZP7A 2JC1A 2J6UA 4MKBA 1RBSA 1JLGB 2R8JA 4MK7A 1UA0A 2E9ZA 4HTUA 2XCPA 3NH0A 4BWMA 2R2TA 1QSYA 4U6PA 1NHUA 4IDKB 3LP0A 2R8HA 2X6NA 4IH6A 4LH5A 2IC3A 3NF7A 3A2FA 3H5YA 1S0OA 4ECYA 2F96A 3OJSA 5DGAA 3S3MA 1ASVA 2GIRA 4NYFA 2YNHB 3KJVB 1MMLA 3RMAA 4NLUA 4N56A 1ZBFA 3DLHA 4B9MA 3JSMB 3SQ1A 4Y2CA 1BGXT 4M3YA 2F8SA 1U48A 2G8UA 3V4IA 4CJFA 2XY8A 3SUOA 3NH2A 3RBEA 1RTIA 4MK9A 4KAZA 3KTQA 4HUFA 1NKEA 2OZSA 1C0MA 1RTDB 4CECA 4O44A 4EYIB 3L3VA 4G3IA 5KG4A 3H2LA 4LQ9A 3EPGA 2W8LA 5JS1A 1CZBA 4NLPA 1HNVB 1ZYQA 4Q44A 2XWYA 4OGEA 4NLDA 5C42A 4K4XA 2C22A 4FLZA 5CYMA 1S49A 5J2MB 3DRSB 2Z1HA 5DG7A 1LWEA 5DQIA 4KTZA 2Z1JA 4NZ0A 5HROA 4MK8A 1N5YB 1BI4B 2B6AA 4RNMA 3V6KA 1WN7A 1JIHA 3V9ZA 5KFNA 2Y1JA 1RT2B 4ZTFA 1S1VB 1EETB 3QETA 3DLGA 3KLEB 3IN5A 1HNIB 4ZPBA 2P51A 4BDPA 4ICLB 3SUPA 4QCLA 4ECRA 4KO0A 5KFQA 2I5JB 2RKIB 4DTSA 3S3NA 3HSTB 3DI6A 1S5JA 4M3XA 4LY7A 3GIIA 1UWBA 1IKWB 3KK1A 3IG1A 3V9SA 3RAXA 2D41A 2DY4A 1VRUB 4JRQA 3TR8A 4RNFA 4NCBA 2HW3A 3EZ5A 4ZVFA 3S9HA 1QQCA 1S1TB 5KFTA 4HYKA 3TAQA 2GIQA 5DLGA 3I0SB 3QGGA 2VWKA 4IG3B 1C1BB 2OPRA 4EBDA 4AILC 4DTNA 4B9NA 1S48A 3M8QB 4KV8B 1J5OB 3HL8A 4ECVA 2XRIA 4FW2A 3NGYA 1HNIA 4JV0A 1JLAB 4J2BA 1S1VA 3KHGA 3NFAA 2P5OA 4KB7A 3SYZA 1WSFA 2JEGA 3AA4A 3H98A 2DFFA 3FSIA 5KI6A 5KGXA 1S6QB 4CE9A 3DLKA 3NF6A 3TABA 2FLPA 3L3UA 1WNEA 3VQEA 2KTQA 4DL4A 4TSXA 3G0ZA 4WFXA 5KTQA 3KKRA 4FLWA 5JS2A 3RMBA 3PO4A 3D0PA 3PZPA 2V4QA 4FCYA 1NOYA 1TKDA 4E89A 1X9WA 5F8IA 1ASWA 4KAIA 4YFUA 3AVKA 4EEYA 2IM3A 4ZVHA 1VSLA 4OGCA 2FBVA 4OKKA 1RTIB 3U6FA 4H4MB 3HJFA 4KREA 5EWGA 4JS4A 3HP9A 1NK5A 3PVXA 1DTQB 2WCXA 4CEZA 3L8BA 1S1XB 4O44B 3RB3A 3NAEA 4NRUA 3QO9A 4CF0A 4K4WA 3TVKA 2HMIB 5KG5A 2HHQA 4FZXC 4GC6A 1U45A 3UQSA 3Q8QB 3ZT2A 3T19A 3RAQA 3I0RA 3ZSOA 2ETJA 3MECA 2FVRA 4EZ9A 2BDPA 3G6YA 3KJVA 5J1EB 4DU1A 3NE6A 1HMVB 4QWCA 1HYSB 3JSMA 3IS9B 4LSNB 5KT5A 4QAGA 1SUQA 4AHSA 2JLEA 3M8PA 3V6JA 1KHVA 2E4LA 2QXFA 4W5QA 3NGIA 2AJQA 4HUEA 2BR0A 3T5LA 3LP0B 4IDKA 3N6LA 3L2WA 3K5NA 3V6DB 4U7CA 3VQPA 2RDJA 1KLNA 1U4BA 3IG1B 2ZQBA 3ZSVA 2ZD1A 3L2QA 3N6MA 2R8GA 3TI0A 4KHNA 2BRKA 2IM1A 3C6TB 4Z4EA 3AO4A 4ICLA 4CGIA 4C8MA 5KG0A 3KIOA 2HHTA 2ATLA 3T5JA 1BQNA 4I9QA 4O0JA 3CJ3A 4O4GB 4ZHRA 4TYBA 3NH1A 3SUNA 2YV0X 2UUWA 3NGZA 5F8JA 4ZP9A 2Z1GA 1NK0A 4RNHA 3DMJB 3NAHA 1K1SA 3TAFA 2UVUA 1JLCB 3O4QA 4Z4FA 5F9LA 1YVUA 3AVGA 3IGNA 5CZ2A 3TAEA 4GC7A 4MH8A 4I2PB 2BQ3A 2UUTA 4M45A 1HPZA 3PX4A 1IKXB 2FVCA 3DRRB 4URQU 3HO1A 1VSMA 3SQ2A 2C28A 1IKYA 4Z0UA 3ZSQA 1FKOB 2HWIA 4MIBA 3OSNA 1JL1A 5KG3A 5F9NA 4DL7A 2HVIA 4NLSA 3V1RA 3C6TA 3EY1A 1LWFB 4CJPA 4NRTA 2ATQA 3MEDB 3SFGA 3L2RA 1TGOA 2A1SA 4NLVA 5KG6A 3LALA 4YR2A 3HT3A 4RW9A 3Q8PB 3THVA 4FW1A 3CDUA 1RYRA 5HRPA 1OS5A 3FQKA 3RWUA 4DWIA 3KLGB 4DU4A 1QHTA 3AVNA 3PV8A 2OA8A 2G8VA 4J9MA 3LDSA 4KHSA 3QIOA 3D45A 1FK9B 3UDLA 2EC0A 5KFMA 3SV4A 4IG0B 1G15A 4FK0A 2HWHA 3AA2A 3D28A 5J1EA 4K8ZA 4DSIA 4HKQA 2BQUA 2VG7B 5C24B 1GX6A 2F8TA 1QUVA 3OYJA 1SKWA 1Q9XA 3ISND 4B9VA 4KKOB 3HVAA 4Z4HA 3QO9B 1RT3B 4IFVA 3DDKA 3ISNC 2EX3A 4HUGA 4KFBA 2WK4A 3RR8A 3BGRB 5KFEA 5EDWA 4F4KA 4DMNA 2HNDA 5I3UB 3DLEA 1ASUA 3PX6A 4C8KA 1JKHA 1IKXA 4F50A 4CJVA 4FK4A 4PUOB 4CJRA 5HRSA 4I2PA 3TAMA 2IMWP 2R2RA 4O3QA 3N6NA 4FM0A 4O3PA 4CJ4A 2YKMA 2OPSA 3ITHA 1T3NA 1TQLA 2FJXA 5C25A 4O3OA 2XGPA 3KLVA 2GBZA 3SUQA 3LP2B 1FKPB 4C8OA 4ECTA 1HQEB 1WSGA 1VSJA 3KLIA 4KI6A 4J9PA 2C2RA 3KLHB 3RR7A 1RDCA 5F8GA 1S6QA 4CIFA 4ZHRB 4FJNA 2VA3A 3M8RA 1TVRA 4NLTA 5JUMA 2O4GA 4F3OA 5FRMA 1CXQA 4CEAA 1B92A 3QERA 1JXBA 4NCAA 4WXWA 2YHBA 3H4BA 3BQ2A 1S0MA 3ASMA 3QZ8A 2LSNA 5T7BA 1RT6A 1SH2A 3RB0A 1C1AA 4E19A 1D1UA 2R8KA 4IFYA 4DTRA 5EWEA 4RW7A 2OH2A 4ID5A 3OYEA 4B9UA 3LP1A 3KK2B 1L3VA 3MR5A 1TKXA 4O3SA 4CGFA 1NK9A 1BIUA 2YNGA 3NHGA 3QNOA 3M8QA 4ID5B 1BHLA 3C6UA 1TAQA 2FBYA 1J53A 4K8XA 2P5GA 2WOMA 4E0DA 1J9AA 3VQDA 3T5HA 3MAQA 1TKXB 1HQUB 2FLNA 4CJ5A 3KK2A 1QSSA 3M9MB 1EETA 2BGGA 1A5WA 4E7JA 4DQQA 4CF1A 1RAJA 3SI6A 1VSKA 1RDDA 1EX4A 3T3FA 3MEDA 3PJXA 4MKAA 3PR5B 1JLQA 5J2MA 3NGDA 4N41A 1QAJA 4H4OB 1SV5B 3IRXA 3OVNA 4F4WA 1S1XA 2F8EX 4LQ3A 3K5LA 1TVRB 1I3AA 1VSEA 1FKOA 1RT1A 4ED3A 4DFJA 3G86A 4EP5A 2D3ZA 3KLIB 3MXMA 1SH3A 3RMCA 1HPZB 4JV1A 2VWJA 1WAJA 4B9LA 1IG9A 2BANB 2PZSA 2KFNA 3JYTA 3SQ0A 3P5JA 1HARA 3HPHA 4QW8A 2KZMA 3PW2A 4CF9A 2CKWA 4FZYA 4R8UA 3OS1A 3OS0A 3SFUA 3VA3A 3OL9A 1RT3A 1N6QB 1RBRA 4KKOA 2KFZA 5FDLB 1NKCA 3BJYA 4G1QB 2HNDB 5I3UA 3L2VA 5KT4A 4FVMA 4K4ZA 3AO3A 4AHVA 3K2PA 5KFXA 2IBKA 1K6YA 1KRPA 3CJ0A 3L2UA 3CM5A 1NJZA 5SWMA 2XI2A 4CHQA 3QINA 1XHZA 3G6VA 3NF9A 1XWLA 4JLHA 1O1WA 4MFBA 2B43A 2ASDA 2JEFA 3KMQA 1JLGA 3VQ8A 5L1IA 2V4RA 2IS3A 1FK9A 4M3RA 4FLUA 1C6VA 3MFIA 3AVJA 4IQXA 4YR3A 3KK1B 1RT5B 4J2EA 4Y3CA 3KLGA 4IOBA 4F2SA 3WNHA 3PW4A 3EYZA 3CJ2A 2I1RA 4YMEA 2BE2A 3CDWA 1BQMA 3OJUA 2RF2B 1CLQA 4XPCA 3AO5A 4IRKA 3VQ4A 4K4TA 4ECZA 3Q8SB 4FM1A 4O4RA 2AGOA 4KSEB 3CM6A 5L1LA 4KHQA 2ZE2B 5KT6A 4G1QA 5DLFA 4I2QB 4E3SA 3G6XA 2P1JA 3QESA 4F2RA 2YNIA 1JLFA 1BIZA 1NK6A 3PW5A 4M3UA 3V9UA 1Z25A 4QWBA 2IDOA 1U09A 1W9HA 5J2NB 5KFFA 2XHBA 4H4MA 1R0AA 4FBUA 2XC9A 2YNIB 1RNHA 5FDLA 1KLMA 3CWJA 2HHWA 4DL2A 3KK3B 4HCCA 2YHAA 1YTAA 4RW4A 4I2QA 4FJHA 5HP1B 4NLXA 3SPZA 4F4YA 3PX0A 1KVAA 3CQ8A 3V4IB 3HM9A 2AGPA 4J9SA 5DGBA 4CJQA 3JYTB 3OL7A 4M41A 5DG8A 4Q45A 3HP6A 4O4GA 3H5UA 4O0IA 3GV7B 1S9FA 1J54A 4YQWA 5CZ1A 3BSCA 1TK8A 3HK2A 2HNZA 4E7LA 3NF8A 1TKTB 5HLFB 3ZSYA 1EP4B 1XR6A 3QNNA 2W9CB 3OYIA 4DSEA 4M3ZA 5DQHA 3OSPA 2G8IA 1TK5A 1TV6B 4W5NA 4TLRA 1NJYA 4DSKA 4EO8A 1KVBA 1BQNB 5JXSA 3U3GA 4F8RA 5KFJA 4GVMA 3PHEA 5KFKA 3HHKA 1RDRA 2E9RX 2ZD1B 4ZPDA 4K4SA 3I8DA 3WNFA 4DTUA 3AVIA 5FRNA 2ILYA 3RB4A 4N47A 4PWDB 1XI1A 3VQ5A 1T8EA 4CJTA 3HVTB 3EZUA 4J9OA 3MR2A 5KT7A 1JLEA 3LAMA 5KFHA 4XPEA 4ELVA 4OLAA 3V6HA 5KFRA 4DS4A 3MECB 4DTXA 2W8KA 1NK7A 4ECSA 4CJSA 3OL8A 4DF4A 1HYSA 4URGA 1SKRA 2G8FA 2GV9A 2XO7A 3K58A 3M9NB 1GOAA 3CFPA 3CFOA 4XIUA 1RT4B 2FVQA 1RTJB 3AA3A 3MEGA 3ZT1A 4CGJA 2HHXA 3QIDA 4BE2A 1N5YA 5HROB 4AHCA 2IA6A 4BE0A 3OYCA 5SZTA 2ALZA 1TKZB 3QEXA 4KHWA 3AVHA 2IAJA 4BWJA 2X6SA 4RW8A 4BACA 4DFPA 4E7HA 2GUIA 3V9XA 5I42B 3VA0A 4Y1DA 4JV2A 4F3TA 2IAJB 4RU9A 1TKZA 1C0TA 5KFYA 4ELUA 4ZTJA 4K4UA 3DOLB 3NBPB 4CHNA 2ASJA 4OPJA 5KFIA 3OYDA 3MEGB 1NK8A 2FJWA 1RDBA 2W7OA 3NMAA 2JC0A 1NJWA 4KFBB 4CJWA 5C5JA 4E1MA 4H4OA 4AH9A 4WFZA 1WSEA 3TWHA 2D0AA 2ITGA 3TAGA 5F8HA 1JKHB 4RUAA 3WNEA 4FJLA 3O3FA 2AQ4A 4ZP6A 3E01B 4FJKA 4W5OA 3HVRA 1WSHA 4OPKA 3EPIA 2B4JA 3BSNA 4IFVB 1A5XA 1IH7A 3HVTA 3QIPA 4FLXA 3AO1A 4DG1A 2B5JB 2WOMB 4WYLA 4LD0A 2ZKUA 4RW7B 3ZSWA 2OPRB 3OY9A 1CSJA 1N4LA 3WNGA 1VSIA 3LANA 3DI6B 4F4XA 3BDPA 4DU3A 3IGVA 2DPJA 3ZSZA 2I5JA 2RKIA 4AHRA 2HHVA 5EU7A 1EKEA 1C1CA 4NLYA 4FS1A 2KZZA 4TQRA 1SL2A 4CFAA 4KB0A 4FK2A 2D5RA 4ECUA 1L5UA 1RT2A 1BL3A 1TV6A 5J2PB 4HHTA 4DFKA 1RT6B 1LWFA 3K5OA 5EWFA 4TY8A 3K59A 2RPIA 3KLHA 4DTJA 3V9WA 1QTMA 3VQ7A 4KB1A 4FZZA 1N48A 3OYLA 1Y97A 1WNSA 3NKYA 4QW9A 1HYVA 3BR9A 3BSAA 3TARA 5K14B 3DRPA 4B3OB 3NAIA 4J2DA 4EBEA 1B9DA 2OPPA 2G8KA 4Y2AA 1BI4A 2W9CA 3CYMA 1LWCB 1EP4A 4M3TA 1TKTA 5HLFA 4XO0A 4DLGA 4NYZA 4M94A 4CHYA 1FKPA 5KFSA 3PJWA 2UVVA 2WRMA 5F8LA 4CEEA 4CERA 2O4IA 4KPYA 2OPSB 4Q5VA 1U49A 4CFBA 3BQ0A 3ULDA 4J9KA 3KHLA 2HNYB 3CVKA 1QE1B 5HBMB 2E6MA 3C94A 5KG7A 1R0AB 4JUZA 5J2NA 3HVWA 4CIGA 3SJJA 4CEDA 1S6PB 4CGDA 1LV5A 2VG6A 4FLYA 2JEIA 3BGRA 2VA2A 1IM4A 1LW0B 2WTFA 4WE1A 3LAKA 3OHAA 3GIJA 2DFEA 4IG0A 2D0CA 4K4VA 2IC3B 4Z4IA 4EP4A 1JXEA 2BE2B 4QWEA 3HYFA 4FJXA 3AO2A 2IM0A 5KFLA 3M9OB 4J9QA 4OJRA 4CGGA 3OYNA 3LZJA 4C8NA 4NLOA 4WZQA 4F4ZA 2FLLA 1RTHB 3H5XA 1RT5A 2V0NA 4UQGA 4JS5A 4J9RA 4IR1A 4CCHA 4CEOA 3LP3A 3ZT4A 4YNQA 5KFOA 1S1UA 4FS2A 1SH0A 1ZTTA 2XCAA 4BDYA 3SV3A 4CHPA 2WONB 3M8PB 3CJ5A 3PR4A 4MFBB 3GILA 5D3GA 3D5MA 5KGWA 4IBNA 1S1UB 1VSHA 1QSLA 1L3TA 3V81B 2AX1A 2XI3A 1ITGA 2G8HA 2XGQA 3SCXA 1T03B 2AX0A 5FROA 3OYGA 4YR0A 1XC9A 1TAUA 3OYHA 2C2EA 3AVMA 2W9BA 1L3UA 2R8IA 1Q9YA 2W7PA 5L1KA 2PYJA 2HHUA 3E01A 3V1OA 1S6PA 1SUQB 1DLOA 4IRDA 1UA1A 1T7PA 2R2UA 1WSIA 3DRRA 1C0UB 3QEPA 1U47A 4KTQA 3ZSRA 1I39A 4KHMA 3CDEA 3KHHA 1TK0A 4WE1B 3SI8A 4ED8A 5F8MA 3I0RB 4FJ9A 1FXXA 4B9TA 3SNNA 3AVAA 1ZTWA 1GOBA 3FFIA 4IH7A 2A1RA 3GIMA 4ELTA 4R8UB 2E6LA 4WFYA 2DTUA 5DQGA 1DTQA 3NCIA 3OYFA 4M3WA 1DTTA 1BCOA 4CGHA 2HHSA 5KT3A 2X74A 2PYLA 5I42A 4EYHB 2BANA 4KHYA 3H40A 4CK1A 1JLQB
chains in the Genus database with same CATH superfamily
3DM2A 2B9WA 1YTUA 1Y10A 1RT1B 1VQSA 1T95A 2Y1RI 1Q95G 2VASA 4QIGA 3MM8B 4QZVB 3IWXA 3GONA 4QIFA 2ITMA 1WHYA 2YNFA 2J0WA 1QDUB 4J9NA 5H1SV 4C3LA 5KFPA 3LZIA 3OW2R 4QYZJ 3CJBA 4HCBA 2HBMA 1RB0A 3WEEB 4IQMA 1H7WA 1KR4A 4O3NA 2VG5A 1T05A 3I0SA 2OHDA 3DLJA 4USTA 1S1TA 4Z4GA 2DKOB 4LFAJ 1RKIA 2G8WA 4ALZA 4BC4A 5L8RC 1L3SA 3BREA 1KAXA 3TSUA 3C66A 4DSFA 2ASOA 1MN7A 5EX0A 3I9V9 3C6UB 2F9DA 4CJKA 4WBFA 3VAGA 4R0EA 2DY1A 2HFSA 1Y0HA 4O3RA 4BRLA 1LXNA 3ENBA 5BR8J 2B56A 4F04B 4PWWA 3OFFA 5DDRC 4RKUC 4OI1A 4OLPA 2G2ZA 3A12A 3NCRA 1W2IA 3NBPA 3T1HJ 4X2BA 1P9QC 4WWSA 1H73A 2KJWA 1LWEB 2YQ3A 3KNAA 2BJ9A 1VBXA 3MM8A 5ETTA 3H25A 3PIPL 5AXNA 1S9EA 2YWGA 3DFEA 4LRAA 2CA9A 2YX7A 5JMNA 3QEWA 4C11A 3VGKA 1WKKA 3KKSA 4U7BA 2ZNZA 2MQ8A 3UNYA 3JAMY 2DY9A 2JWLA 2MJUA 4K7QA 1Q7LB 3GLJA 4LR7A 2CJKA 1SIWB 1QTNB 1YVFA 3AD8C 5T7LB 2NQPA 4FN5A 2QTDA 5DM6L 1RTDA 1G6BA 4DSJA 4MO5A 3MM7B 1CJVB 1J5OA 2ZH8A 4CF2A 1IKVB 3NRBA 3MAAB 5KFZA 1JLEB 5AZIB 3KOAA 1KOHA 1WACA 1XMOF 4EFHA 2R2SA 5EX3A 1TYQA 3AA5X 3VGSA 4FJMA 2IJNA 2IGIA 4L76A 3VGUA 2UVRA 2XYGB 1WHXA 3EZOA 2H5EA 3FMBA 2WB1D 4EHTA 2I7NA 2J4RA 4JEPA 2DK2A 3P3DA 3BSOA 2W25A 1M0SA 2QFIA 3CI5A 1EQ0A 1KFDA 1RCOB 4FNHA 4MLHA 1NNDA 2BJ7A 4U8VA 4EGLA 5A0YA 3PKMA 2WSEC 4I6WA 3UD5A 3DLGB 1IBKK 5IV4A 5CD4H 1RDWX 1TYQB 3QGHA 3GV8B 2HPUA 2R9LA 5LXRA 1VQMS 3H90A 3THXA 1M5HA 3QFWA 2B4OA 1TL4A 2KKHA 1IJEB 5KFCA 3G82A 1NDLA 1HYZA 3MM7A 4IKFA 3TNVA 3DRSA 5HP1A 3U27A 4FM2A 2NUBA 4DV3J 3GIKA 3OTCA 2O3DA 3NVKA 2GFFA 2HK2A 3CF5Q 4HH1A 2AEFA 4I68A 1N6QA 4CJLA 4PG5A 2GJ2A 3WBZA 1NGEA 1N52B 4CEBA 2FD2A 9RUBA 4ECXA 4LSLB 5IQ6A 1WSJA 2OEKA 1ZBIA 1WLJA 4LFBK 2OPPB 4O5FA 1BUPA 2WBNA 4L3KA 2AGQA 3IRXB 4F36A 1XIQA 3OLBA 5EVZA 1REVA 3VEXA 1CJUA 3THYB 3ZLJA 1U8SA 2NXNA 3MR3A 4PPDA 1IR2A 4EBCA 1XBWA 2KG0A 2UXCJ 3I5CA 3MDFA 5D3GB 4X62J 2G1DA 2UUAF 1YKWA 3EGVA 2CDQA 5ITHA 4RZRA 1CG2A 3GV5B 5MLCV 3VQAA 3HM8A 5HK4A 1OYDA 1VRQC 2WVEA 1HJRA 2KH9A 4CRJA 1OQ6A 2N82B 2P5VA 4DJBA 2OPQB 2UU9F 4HHJA 4BDZA 1VK8A 3A13A 3HSJA 4MYUA 3HHDA 4K5SA 1SVDA 3MTJA 1FW6A 2F4VK 3NWRA 5BJRA 2HS0A 2W2PP 2WVDA 3VAFA 1HW8A 3M8YA 2GQCA 4G1PA 2Y3YA 3RSEA 1QY7A 4YEAA 1D3WA 5LMUK 1HQ2A 4P7TA 4DV6F 1HD1A 3ZT0A 3BGLA 4M5GA 1J5EF 4X4TA 3C19A 3AOAA 2QE5A 1NSAA 3DU5A 4OLOA 1NDKA 3FK4A 4FJ8A 3IAM9 2ZZTA 3CJKB 3ZZZA 2W40A 3MX5A 4IJAA 4FJJA 5KT2A 4KH5A 4B3RK 1IBMF 5DK5A 2HHHK 4IO9L 5E3PA 1D5AA 1B70B 5KRSA 2YPYA 2HHHF 4BREA 3SMSA 1CJKA 1KQGB 3QLHA 4I7FA 4KBIA 2DFHA 2F7VA 1M1KO 3HZGA 4JI0J 4YP3A 3LDPA 3DRPB 4B3OA 2AT1B 2HAIA 5GADI 1HWUA 4JI8F 3CIZA 5IOLA 1XNQK 1WAFA 3M05A 3VEWA 1HFEL 2UV8G 2BJ3A 1RHRB 1WTFA 5J2PA 2J0QD 4KI4A 3MMCA 5BN8A 6FD1A 4K2XA 3VN5A 2V50A 4OZJA 4Y6IA 5HRNA 2V68A 2OPQA 1VQON 4F26A 1RBVA 4B1XB 3EJMA 1S0NA 5FPDA 3ISZA 3SDEB 4LF5K 1TL3B 1ESVA 1QQOA 4ZA1A 1DRZA 4B3SJ 2BRLA 2BXJA 3QYYA 2LU1A 1M1KT 2UUAK 3PO5A 1RDAA 4QPXA 1FTCA 4OJ3A 5H9EJ 3N4PA 1S9GB 2HHPA 5M1QA 2Z1IA 4N76A 1RA7A 2GGPB 1PCAA 5KRTA 4CFDA 1S0VA 2AF6A 3MMJA 3L7UA 1N8RT 2V8PA 1VQLN 5KFDA 2ZJRQ 4OYZA 3QGIA 4JRPA 1C0TB 3F41A 5EXWA 5C25B 2MQLA 4Y2KA 5BYRA 4P2MA 4E7IA 1M5VC 3NGKA 3WXLA 1B9FA 4FPBA 4KHUA 2D9OA 5MAOA 1P90A 1X4HA 3KD1E 2PC6A 3PYFA 2AEMA 3DXKA 3A1YG 1WHVA 3OTOJ 4AUKA 1NOZA 1DLOB 4Q8EA 3K5PA 1PBAA 4HTLA 1FVSA 3NS7B 1Z05A 3QZ7A 1ZBUA 3L6QA 1SZ2A 3M6XA 2HEKA 1X9MA 3D1HA 2KG1A 5DJBA 4K59A 4WFBL 2GHVC 4B3TF 3GZ7A 1YXQA 3THXB 2ASLA 3OS2A 3OYAA 2P9UA 1ZBLA 1RA6A 2QX0A 1PJ6A 3H4DA 2V9WA 2PSZA 5IM0A 3Q0AA 2DNHA 2V6AA 4FL9A 1JLGB 1UA0A 3FZ2A 2IRYA 2VONA 3U7JA 5AQKA 1TFWA 2R2TA 4K5RA 1GLCG 1QSYA 3KFWX 1NHUA 3LP0A 2R8HA 2VBYA 4C3KA 2UXDJ 3FMWA 3NF7A 3H5YA 1RTZA 3TSQA 2GIRA 4F0HA 3RMAA 2WC9A 1B0VA 1R8AA 3C14A 4JHDA 4ZVRB 1M1HA 3D68A 4B9MA 3JSMB 3SQ1A 4ES2A 1BGXT 4Y2CA 3U9ZA 1WOPA 2MY8A 5A6WA 1RAGB 2HQGA 7AT1B 1WG5A 4FF3A 2ZJPQ 1NMNA 3O44A 4C7QA 3I4HX 1FT8A 2XY8A 1MMNA 3SUOA 3NH2A 5M2UA 4BC5A 1T9YA 4UZBA 1EAYC 4HUFA 1C0MA 4CECA 4CP5A 1ZC6A 4EYIB 1Q79A 3EPGA 2DR7A 1E3MA 1CZBA 1H7XA 2OTJS 2B9YA 2XWYA 4OGEA 4LRCA 1EWQA 3T9ZA 3L4IA 4NLDA 1WB9A 4WKYA 2Q43A 2C22A 4FLZA 2Z1HA 3W9HA 5DQIA 1VQKS 2Z1JA 5A0YB 3E9OA 4MK8A 2NPIA 2Q0UA 4RNMA 3V6KA 1WN7A 5E84A 3V9ZA 5KFNA 2F9JA 3M2VA 1CZAN 1RT2B 4ZTFA 2FC9A 3UDVA 5DZ7A 1OO0B 5F1XA 3QETA 2MKSA 1Q8LA 3KLEB 2IVOA 2YHYA 4ICLB 3ATVA 3ZZTA 1RGIA 3S3NA 3CD0A 1CS4A 3W2WA 1UWBA 3G8QA 1IKWB 1SBRA 5AJ3J 2RVJA 4J9VA 4CW7B 1HW9A 2E1RA 4K2JA 3S9HA 2A5XA 1S1TB 2ZC4A 2EG1A 2QXLA 1YUWA 3I0SB 3QRRA 3MEKA 3R8EA 4WFNL 1WC1A 4EBDA 3TTCA 4AILC 1IQZA 1YBUA 2QLWA 3R6GB 3W7BA 3HL8A 5ETVA 2E66A 3UO0A 3CGIA 4ECVA 4DV4F 3RW6A 5KPZA 4J2BA 2O67A 1HI8A 3VERA 2IIHA 1LK5A 3T1HF 3VENA 4BR2A 4LF4F 3SYZA 5AQMA 4LF9K 5E3QA 4FPAA 2HLTA 2HBRB 4GKJJ 2LA6A 3AB2B 3KJNB 3TABA 1R43A 3VQEA 4TSXA 1FX4A 3G0ZA 3SLCA 4ZVOB 2DHGA 5KTQA 4PKDB 3QJPA 2AIRB 5JS2A 2HVEA 3D0PA 1WJ9A 3PZPA 2A2CA 2V4QA 3CCES 1S59A 2JVRA 2CPZA 3ZZYA 4C6AA 5BR9A 5F8IA 2MZJA 3D3BJ 4EEYA 1VSLA 4OGCA 1P1LA 4BR0A 3HJFA 1H3DA 3JSBA 4JS4A 4LBHA 3PVXA 2R7VA 2WCXA 3FCVA 3L8BA 3NCQA 1UL3A 4B17A 1RWXB 1V6HA 3RB3A 1IJJA 4LF5J 3EE9A 4TU8A 2HHQA 3HOTA 1P8ZA 4GC6A 3UDEA 4I67A 3OUYB 1YITS 4ED4A 1N34J 2ETJA 3MECA 4OJGA 2FVRA 3G6YA 1B64A 1HL6A 3D0HE 3Q83A 3RSEB 4QWCA 4DMZA 3IS9B 5H1SQ 2V67A 3SBTA 1KHVA 1E6VB 3NGIA 3LUYA 2GJFA 3L7OA 3MWTA 1L3KA 3AD7C 4X64F 2DGWA 4FYWB 3T5LA 4IDKA 3K5NA 4U7CA 3NS6A 1N36J 3T41A 1GNKA 3L2QA 3N6MA 2R8GA 4KGZB 2K2PA 3AO4A 1UPPA 3KIOA 2RQCA 4JYAF 3MI7X 2RD5C 3NNCA 3QBWA 3CJ3A 3BBBA 1F9FA 3R5BA 2DHAA 2YV0X 3B4DA 2AJ0A 5L39A 4CNZA 4KQZA 1NK0A 2NRZA 4JYAK 3DMJB 4BGBA 1HWLA 1XQIA 4Z4FA 2JVOA 5GAEP 4WK3A 1YVUA 1YIJS 2P9GA 5TKWA 2JLFA 3IFRA 5IT9O 4MH8A 4I2PB 3FGUA 4PRFA 4DPTA 3MCAB 1S7HA 1VSMA 3CJSA 3GOIA 1CPZA 4ES3A 2QEXS 2JFKA 4A47A 1REGX 3OSNA 3GWCA 2P2CB 5KG3A 4FDFA 4A61A 2RAQA 2ZJPL 1SQFA 1JCGA 2ZH6A 4IEEA 4YOUA 2IBOA 2IA0A 3QQCD 3K7RA 4NLSA 2QLXA 2J7WA 2VDIA 4HACA 3CCQN 1FE0A 1AA1B 1HBUB 1UJ4A 3SFGA 1B7FA 3H1QA 3BZQA 1NPPA 2A1SA 4MIWA 5HQMA 1VQOS 3HT3A 1SI9A 4RW9A 1GEHA 3CDUA 3HHNB 2BM0A 1OS5A 2CWXA 4DN9A 3KLGB 1I51B 2IYIA 2C3UA 5LSOA 2OA8A 3CW2C 5GIOA 2NXJA 1M90T 3NOCA 1FK9B 3NNAA 2CNNB 5KAKA 4IG0B 3VV2B 4B3RJ 2HWHA 1DEJA 3FSYA 4ERDA 3N5FA 1YI2N 1Y3JA 2CAJA 8AT1B 5C24B 2GELA 1VQ6N 2QWLA 1XMBA 5HI7A 4KKOB 1RHMB 2HBZB 4IFVA 2EX3A 4LF9F 1T9XA 3MAAA 3T1HK 3NG8A 2HZVA 3MUTP 1MG7A 2OFHX 1ASUA 1ZBSA 4C8KA 1P9YA 4F50A 4FK4A 5I4MA 4DR4J 5HRSA 2IMWP 4J5OA 1KVJA 2DNLA 2OD6A 1IBMK 4O3PA 2DEIA 2LMIA 3HZ6A 2J9EA 4CO4A 3FC9A 3CETA 1VI7A 1T3NA 2FJXA 2XGPA 4C8OA 4UUXA 2C2RA 3VMFB 3KLHB 3RR7A 4U95A 2B3TB 4JP8A 4BC3A 4MT1A 2Z57B 3M8RA 4NLTA 5HQLA 1CXQA 4JI0K 3CXCR 2F4VF 1K8KB 4DR5J 2YHBA 3M1VA 1VQ5S 3FZHA 1WD6A 4K8RA 3I56S 3AJ1A 4IFYA 4DTRA 4R25A 4RW7A 3UVJB 1KP6A 3ILIA 4B9UA 2QGFB 2KRRA 1L3VA 1CVJA 4FWNA 1X0PA 3MR5A 2YHWA 4LVNP 4P10A 5D0EA 2YNGA 1TAQA 2FBYA 1J53A 1SKUB 4K8XA 2AYEA 2WOMA 1HNXF 1NLVA 2NXEA 3MAQA 1HQUB 4CO1A 3M9MB 3CCSS 4ISGA 4DPUA 4CF1A 1VSKA 1EX4A 5LSRA 3MEDA 4ZJLA 3P6YC 1X4EA 4DOZA 3TA1A 1NGFA 1RBOB 1JLQA 5J2MA 3NGDA 3IRXA 2ZBPA 1VJWA 1TR0A 2DT9A 5IT9U 2O8DB 3JQKA 4Y28C 4CLZA 2WVFA 3MXMA 1K9MO 3QT7A 4JV1A 2VWJA 4KH6A 4GO5X 2BANB 2DCUB 5BRFA 1HARA 1YSJA 4AE5A 1EWRA 2KZMA 3PW2A 4CF9A 4DR4F 4R8UA 4CLUA 3PFEA 3ATUA 3FLCO 1X7VA 5ETKA 2UUCF 4O8KA 3CF5L 1N33J 1NKCA 4G1QB 1X4GA 2BACA 1ULRA 3T69A 4B3TK 5KT4A 4LF6J 3T1YJ 4AHVA 1Y00A 1JCFA 2HF3A 5SWMA 1Y5LB 2XI2A 1SB6A 4CHQA 4JHDB 1YJTA 3C14B 3A5OC 4CLFA 1O1WA 4MFBA 2B43A 2HFOA 1HNZJ 3SCJE 3VQ8A 1FK9A 2M0GB 4OYPA 5F0WA 2XSFA 4YR3A 3UN3A 1RKJA 4TU7A 4LFCJ 4J2EA 4FWQA 3M5RA 4Y3CA 3KLGA 5AQFA 3CJ2A 1UMJA 1XMOK 4W4MA 2IIRA 2I1RA 2BE2A 1FXLA 1BQMA 3TWZA 1KKHA 3AO5A 2VDHA 4OI0A 2MQQA 1WF1A 4WFAQ 4IRKA 3VQ4A 4FM1A 2XG8A 2AGOA 1R0BG 4BHQA 1N5VA 2BE7D 4M7YA 3DXMA 4I2QB 1TUWA 3HSGA 1OSDA 2DGVA 1GLFO 3QESA 1HNXK 1NK6A 3PW5A 3WDOA 2HZCA 3MOZA 2LA4A 4DCHA 3MM5A 1KVKA 5IC6B 2A2DA 4PCQA 4DUYJ 1W9HA 4C1NK 5J2NB 5KFFA 2XHBA 2UXDF 1RHKB 2YNIB 2XC9A 3X3UA 2H3GX 4DL2A 3KK3B 1YTAA 4YOEA 2DNMA 2E8AA 4CBWA 4F3QA 3MUMP 1UEKA 2DRDA 2OLWA 2VIHA 2AGPA 4J9SA 4QPTA 1Q7YT 3R27A 2ROEA 5M1PA 1OY6A 4O4GA 3VWSA 5IXUA 1X60A 4O0IA 3W9IA 1J54A 2WBRA 4JN4A 2JWNA 3HK2A 2H48B 4YY3F 3CPWM 2VUGA 1OJ4A 3QNNA 1T3OA 5LJWA 1HHSA 1RWNB 2X1AA 4UZCA 3ULEA 4DSEA 3AAWB 3UKUB 3VF2A 5ETRA 2GNKA 3BO4A 4RR5A 1XNQF 4TLRA 1NJYA 1U7LA 4WCEQ 3U3GA 1RAAB 4DN0A 4DV7K 3MCNA 2MPUA 2V2ZA 4KPCA 1WORA 4DCJB 4JV5J 2YWEA 2E2PA 2FIUA 4K4SA 2AMCB 3TOQA 2X51A 3RB4A 1Q86O 4N47A 2N3OA 4XEIA 4CJTA 2QA4N 1VR6A 2PI4A 1O0PA 4U8YA 5GADP 4ELVA 3CCRS 3V6HA 2PN6A 1EKSA 2W8KA 2KXNB 5IV3A 3DRYA 2EG2A 5LM7E 3S6EA 1NGJA 2GV9A 1J5EK 5LOQA 3CMAS 3MMCB 3QT6A 1RTJB 3AA3A 4LRDA 4NZ7A 2IA6A 4BR5A 3O8WA 1D09B 3OYCA 5SZTA 1TKZB 4JOUA 3QEXA 2ZC3A 2RT3A 4BWJA 3POTA 3W63A 3PRDA 2V8GA 4RW8A 1X5SA 3V9XA 1XJWB 2C1EB 3W1YC 1TKZA 2AZ1A 4DV3F 4DV1J 1FWLA 1F5BA 3R5CA 2VZ9A 1RDBA 3NMAA 4IO1A 4KFBB 2NRXA 5C5JA 4E8UA 1WSEA 1KBRA 4HDGA 4I1TA 1N0UA 3CJ8A 4LIRA 4AQYF 2DGUA 5B0GA 2YKPA 2AQ4A 3E01B 3FVYA 4FJKA 4W5OA 3VQTA 5HJYA 4OPKA 3BSNA 3ILOA 1EIYB 4NE9C 1U1QA 4DV2K 1J6ZA 3QIPA 4H5RA 5AJ3K 2GAGC 4BG8A 4ETZA 4OPHA 1C4CA 3B82A 4LD0A 4M5DB 3ZSWA 3Q24A 1CSJA 1N4LA 1RLDA 3BDPA 2RKIA 1VLYA 1EKEA 4EMDA 2Y9HA 1ZM2A 1WDDA 2EI5A 2CPXA 3C6HA 4C9DA 4KB0A 4FK2A 4ECUA 3JAMO 3IFEA 4DFKA 3US5A 1RT6B 1LWFA 3D54A 5EWFA 2G2OA 4DBQA 4QS7A 2QWMA 3K59A 4DUZJ 2RPIA 2FGCA 4KB1A 2GS8A 1N48A 1Y97A 3QGPA 1AT1B 3NKYA 4QW9A 1SJ1A 3TARA 2OIHA 5MLCQ 2G8KA 1MWKA 1S7IA 3VEYA 2MQPA 3M2RA 5CZXA 2V8VA 4UOCA 3B6BA 2GIFA 1VS3A 3N0VA 1FKPA 1OH6A 3PJWA 2O4IA 1KDNA 2GHWA 4KPYA 5BN9A 3D4JA 1H2VZ 3ULDA 7FDRA 1TMJA 2V63A 1KAYA 2B7BB 5HVHA 2HNYB 1RUSA 3BGOP 3C7NA 3MN5A 4ILHA 3THTA 5KG7A 1TUVA 3WXKA 4YOVA 2UUBK 2ZH9A 2FQQB 1T9TA 1LV5A 2JEIA 4EHUA 1LW0B 1F5CA 3TX0A 4WE1A 2V8DA 3EWGA 2DFEA 3HSCA 3SQOP 1V3RA 2HQDA 2BE2B 2KM8B 2K3IA 3HYFA 1XMOJ 5LMNK 3M9OB 4J9QA 2ZF5O 2O8BB 1O6XA 2VQFJ 1ZZNA 3OYNA 3TTDA 3VAKA 4JS5A 4J9RA 4KHPF 5KFOA 1S1UA 4FS2A 1O8BA 3LPEA 3ENAA 1RU1A 1F3FA 2EBEA 2WONB 5L9NA 1VQPN 3M8PB 3PR4A 4MFBB 1DURA 4L74A 5IM0B 1S1UB 2HGMA 4GVEA 5AT1B 2BV3A 1ITGA 2QLJB 3DCAA 4DZDA 3OYGA 2HK3A 1RACB 1GMVA 4DR7K 4C0OC 2C2EA 4IXCA 4YDUA 2W9BA 4RUHA 4UT4A 3D66A 1Q9YA 4LF4K 2HIQA 2PYJA 2CGKA 1S6PA 3W2VB 1T7PA 4BQZA 2EFVA 3DRRA 4BBYA 2BOPA 1U47A 1ATNA 3RU0A 2WZ1A 3W65A 4DV4K 4KHMA 4ZPVR 1TK0A 2XS7A 3C15A 2CQ4A 1FD8A 5TKYA 2CQGA 4Z2XA 1GOBA 3J80Y 1NMDA 1MROA 4R8UB 4BRMA 3NCIA 2O8FB 5B0CA 1BCOA 2M8HA 4CGHA 1NEEA 1ZAXA 3BPSP 1HUXA 1VBYA 2ALYB 4EYHB 4CZEA 1U25A 1HWIA 4I6MB 1LKZA 2CQIA 1OPZA 5AXKA 2OYQA 2QYCA 4HT7A 1N54B 3QSYB 1UFWA 4KGKA 4J9LA 1RILA 2I0XA 4JK8A 2QWNA 4HI1A 4RUCA 1N0VC 4I6YA 3E8OA 2RE2A 2CWKA 2ERRA 1JLAA 1KFSA 3KHRA 2DITA 1RT7A 1QAIA 2VOOA 1RWMB 3MMVA 5BXIA 1UJ5A 3L9ZA 3GR0A 4JI1K 1FWKA 3PYDA 3ZYYX 2D3UA 2FY1A 2VFVA 2VODA 2M3DA 1GXUA 3CMAN 1HQUA 1EX8A 2VG5B 1T05B 4KV8A 3H2UB 4BLGA 1C2PA 3TO8A 3VETA 4AL7A 4JAXA 1NH7A 4CIEA 1N32J 3CO9A 3T5KA 5E3AA 4CZIA 1NJXA 3MR6A 2YNFB 1FF2A 1V5VA 3KLEA 3K8VA 5HAOA 1FD2A 3HD1A 4CK2A 4GKJK 4IFYB 4M95A 4OHYA 4IRCA 3DM2B 2HMIA 2CJBA 4Q0BA 2COLA 2QMUB 3RTVA 4BE1A 2EFNA 2Q97A 1WI8A 2KQ2A 1LAVA 4OLBA 1ZOTA 3H59A 3R3TA 5KFGA 3SQ4A 3BF3A 4PG8A 4HWIA 4JYAJ 1T94A 5C42B 4K0KF 1U6BA 2ZBQA 3FRYA 2W9AA 3IWLA 1KC8T 4FJGA 4USWA 5CQGA 3E51A 3O9TA 3LGNA 2EHGA 3OL6A 4OZNA 1H2TZ 3D6RA 5AQYA 3HKWA 4G9ZA 3AJ2A 1S1WA 4RW8B 3R97A 4EI2A 3O9UA 2BVZA 3G10A 4Y00A 4LH4A 1WKJA 2V5HG 2W6LA 3NL0A 5G4DA 4CZLA 5DMRA 3TVYA 4RW4B 2L08A 2QKBA 5AJ3F 4DV2F 3DLKB 4DR2J 3CMEN 1TELA 2YKNA 1KHWA 1NGCA 4AXJA 4DQIA 4DLEA 2DBBA 3AVBA 4X66K 3HX9A 5IFMA 1DJ0A 3IAYA 1CULB 3H08A 5JLFA 2GMJA 4WQ5A 5EX5A 5F2RA 3H5SA 2WONA 2XZWA 4B08A 2PY5A 1VFJA 3EGWB 2FSJA 2VQEK 1BC6A 4WYWA 2MGZA 1EJ7L 4O5BA 1S77D 4CF8A 3EX7B 4ED2A 4PKIA 3D2WA 5CY4A 3PUFA 2XS5A 1VCTA 3VQ6A 1NWKA 1YAGA 4DFMA 4DUYK 1N34K 5M2RA 2J6TA 2M7SA 3MWPA 1H6KX 3MTKA 3GL1A 4H4KC 5J2QA 5ETMA 2VICA 2P8IA 4B3MF 1F9EB 3CCUS 3CIMA 2Q6BA 2W2OP 4CLKA 4PYDA 4DL3A 4CYUB 2E5GA 3GYNA 2SXLA 1NDCA 3L4QA 3VALA 2UUBJ 1ZBHA 4ZP8A 2UZAA 4CESA 5HOOA 1FXRA 1Q16B 4LF5F 3TPQA 3PACA 4FYXB 2KVQE 3OYBA 3O3GA 2WTUA 2HWTA 1FXDA 4Z94A 2ZUGA 1XMQK 3EVMA 1WC4A 2MZRA 4DPOA 4DQRA 4NYOA 1IJFB 5M2PA 3PKYA 2YNHA 2IVFB 2NRTA 1D0EA 5AQQA 5K14A 4WFAL 2DGXA 1YHQN 4J7CA 3DMJA 3S3OA 3ZNJ1 5J2QB 4OYMA 4DV0J 3AY0A 1NGBA 3DOKA 1QZ6A 1MNEA 2K3KA 3UB5A 2YQ0A 1XC3A 1IBCB 1YT3A 4FWMA 3FEZA 1RAFB 3K0JA 3A3PB 2IVPA 3V6DA 4ZITA 1C1CB 1DAXA 4PPZA 4FNIA 1F21A 4OHWA 4DV7J 3OXGA 1YHQS 1LAWA 2CQ3A 4MKYA 5RUBA 4MQ3A 2XY7A 4Z7CA 3Q8RB 3IS9A 3M30A 4C2MA 3FKBA 1O51A 2WHOA 2W24A 3Q2SC 5DM7L 5JVGL 1FRLA 4NOHA 3TQ1A 1HNWF 2XWXA 2YKNB 4M5HA 3RGIA 3RRGA 3FFKB 3HFVA 5D4PA 5T14A 1JLBA 4KRFA 1GX5A 5IWAF 2FBTA 4KC5A 3J7Z5 5FD1A 3OLAA 4H4KA 1HNXJ 2FJVA 1X5PA 2J5AA 3U8XA 1K9MT 1IKVA 2A41A 4K41A 2Q3PA 3GP9A 4J2AA 3GQCA 1UVJA 2DGOA 1LOUA 2BMBA 3BS9A 2OELA 5KPTA 2GHPA 4E1NA 4R5PB 2AWZA 4JI7K 4FYDA 2V2QA 3ITHB 4GVBA 1N33F 4H8KA 5EN1A 2PBDA 3SCKE 5FPNA 3ZT3A 3UDCA 2ZOMA 4NLQA 1MWMA 1FKAF 5C7PA 3CE8A 4Q0BB 5L1JA 1R89A 3DOMA 3OT9A 2QKKA 3B4MA 3K9KA 3K8WA 4L6V3 2QA4G 4PXBA 2A10A 4D3HA 3R1LA 2E44A 2XMJA 3I5AA 4Q43A 2E5JA 1SL0A 4DR1K 1NLKL 2NPFA 2XNRA 2E5LK 3P4IA 3IC1A 2KKZA 3QAUA 4DSLA 3CCMN 4M42A 4ZMMA 3UPFA 4CZJA 2CQ0A 2XYHB 3R2CJ 2NXCA 4H54A 1N5TA 4MIAA 1LWXA 2CPEA 2Z58B 3HHLA 4DR6F 1YJVA 4DR6K 4OX9F 3A5MC 3UNGC 3LP1B 4RG8A 4OQJA 2B8QA 5KFUA 4RW6A 3CC7N 5HVGA 2Z0GA 1ZBTA 2VPZB 1NSQA 3BYPA 4FO0A 1G99A 1GLAG 4CWBA 1PYOB 3THYA 2XY6A 3DLBA 1E6YB 4NL5A 4GKJF 2HVHA 3SPYA 1ZAWA 2F8MA 4DR2K 2RNEA 1VQ8N 3TA0A 1T0TV 1QJHA 2BE9B 1Q7YO 6FDRA 1RCHA 5DETA 4KIAA 3CDAA 2P6SA 3DLEB 2BEFA 2VGNA 3I9ZA 1IKYB 4BRQA 2DGQA 3X1LB 3HT0A 3B8AX 1SQGA 3NDKA 1ACMB 3MUVP 4UW2A 4NXMF 3R5GA 1S72S 1N33K 1MROB 1NM1A 4DKWA 2D9PA 2IVMA 1RHUB 1SJ4P 2Q0RA 3MD3A 4KTWA 4FLTA 2ILZA 4NO7A 5C2DA 1JLFB 4E7KA 4B9SA 1VRTB 3MXJA 4CD1A 1NPKA 2G0CA 1B0PA 1JLCA 1U04A 3U02A 1YJWS 4XDDA 3A8JA 1UTAA 4CD3A 1LOTB 1VC5A 4OKJA 5AQJA 2YH1A 3KDOA 3SJHA 4Z4CA 3S1TA 1VSFA 4NLRA 3LQVA 2I2YA 2D7SA 3NNHA 3M30B 2RQMA 1VK0A 2FC8A 4ZP7A 4WKRA 2NREA 3S01A 2P9UB 4MKBA 2QLFB 1BE4A 2Y1LB 3AQOA 4LFAF 4V1Ak 2DYAA 1QQMA 3UE2A 2QYGA 1VQ9N 3AOBA 1Q5YA 3D2EB 3AT1B 1S0OA 3O9QA 2H54B 5DGAA 4DB3A 1ASVA 3S3MA 1NU0A 2YQ1A 1MMLA 3HHLD 4WQ4C 4YOXA 1F9HA 4NLUA 5HJXA 4N56A 4KJIA 1ZBFA 2Q66A 3ZZ0A 1HKAA 4X4OA 4M8LA 4DR7F 1V3SA 4M3YA 5AFUA 2N7YA 3A3NB 3BBCA 3BZKA 1RTIA 1APSA 4KAZA 3G6ES 3KTQA 1NKEA 4QS9A 4O44A 1FRJA 3L3VA 1WHWA 4CO0A 4WU3A 4ANEA 2UV8A 3H2LA 4LQ9A 2W8LA 5C12A 4DCOB 3NWGA 2F8HA 3A8EA 4FYVB 4Q44A 3F56A 2ZJQL 1QVGR 3R8YA 5GAGI 4YHHF 3UCZP 1FJ7A 3FBEA 5CYMA 2MQNA 4DV1K 5J2MB 5DG7A 4IDHA 1LWEA 5GMDA 3TX8A 4NXMJ 1N5YB 3LW5C 1JIHA 2O8CA 1RAEB 2F9WA 1OQ3A 2A1BA 1D9AA 1VDHA 3IN5A 3ETMA 1HNIB 1R27B 1M1GA 4BDPA 3SUPA 4B3MK 4KO0A 5KFQA 4PWUA 3R9LA 3CUNA 1S5JA 2W2NP 5AQZA 4M3XA 1LNQA 3GIIA 1VQ4S 2GO9A 2B7CB 2DY4A 1VRUB 1DQ8A 1VQ4N 2LLZA 3VCDA 1Q86T 4JI1J 2B51A 3EZ5A 1QQCA 3M6VA 4HYKA 2FHJA 3ADAC 4DU8A 5DLGA 4BRKA 1OYEA 4IG3B 2VWKA 1QZ5A 4RLEA 3W5YA 4LF4J 1NMEB 3QBCA 2OMOA 3GFYA 2YCHA 4JV0A 1JMTA 4WK1A 1S1VA 3D6TB 4ZJOA 3KHGA 3AJDA 3NFAA 4KB7A 2FF6A 1WSFA 4FKXA 5HL7L 1OVYA 2XQCA 1U1KA 5KI6A 5KGXA 3FBFA 1S6QB 3LM2A 4CE9A 3DLKA 3NF6A 3U9DA 1X4CA 4U9RA 2E1ZA 2QL5B 2FLPA 1OIAA 1WNEA 4OHVA 4DL4A 2R3VA 3KKRA 4FLWA 4X84A 3RMBA 4ZCIA 1RSCA 1TKDA 4ZKAA 4YFUA 2P6TA 5HN0A 4X64K 4K0KK 4NLBA 2UXCF 3QATA 3HP9A 3D6MB 1DTQB 4CEZA 2W6KA 1S1XB 1UCNA 3UR3C 4JI6J 4CZKA 4JI5J 3ENWA 2JLGA 2HMIB 3TUJC 4FZXC 1U45A 2CZVC 1HWJA 5A6PA 3ZSOA 2W4CA 2RJZA 1JB0C 2EFQA 2WBMA 2NRWA 4EZ9A 1ZAVA 3KDNA 3KJVA 3NCPA 3EGNA 2C3PA 2GVZA 3QFPA 4JI4K 4DU1A 4B02A 3M32B 1HMVB 1DT9A 1HYSB 2J0SD 3JSRA 5CAAA 4X66J 1ATSA 3W9JA 1SUQA 3CQYA 4AHSA 2VQFK 3JXOA 1ZA2B 3MZIA 3NVMA 2BR0A 3L2WA 3HSDA 3V6DB 2D69A 4B3TJ 2RDJA 1RXOB 3W2WB 3J81U 4PG6A 3MN9A 4BRGA 3UKUA 4QS8A 4HACB 4JI1F 4BR4A 5E0OA 4CGIA 4C8MA 2YHXA 4CVNE 3T5JA 1IWAA 1RJJA 1S22A 2HAFA 3CXCM 4O0JA 4O4GB 2MSTA 3NH1A 3GFZA 4YHHK 2BUPA 4RWXA 2L41A 1F60B 3FCWA 2Z1GA 4P72A 4UY8O 2XB2D 3NAHA 1QQNA 3M3ZA 1JLCB 3O4QA 1WG1A 4LFCK 2XYPB 4TVAB 3PDNA 1A0OB 4UY85 1LXJA 4RO0A 5T41A 3WXIA 3VAMA 3IGNA 5CZ2A 3TAEA 2Y0BB 2LDIA 4GC7A 2GWJA 3H0PA 3HI0A 2U2FA 3P5TL 3PX4A 4DZ6A 3SQ2A 4JI3K 2DISA 4USUA 2KYZA 2BABA 4IFEA 4Z0UA 1FKOB 4NXNJ 4LF6F 4MIBA 1Q4RA 4BC2A 1JL1A 2PIIA 4P75A 2JDJA 4YY3K 2NS1B 1S6OA 1YRTA 2MYFA 2MEWA 3V1RA 4CJPA 2ATQA 2KXFA 2MKYA 5GINA 1R0CB 1VMBA 1TGOA 5HO4A 4P7VA 1PILA 1AZSB 3LALA 2VQEJ 3KZBA 1UW9A 1GTHA 2EPIA 3THVA 3I33A 5HRPA 3FQKA 3RWUA 1ITPA 4RWWA 3CCSN 1P27B 3PV8A 4L73A 3ZTQA 2E5IA 2CXEA 3GYGA 3LDSA 2V69A 3WIUA 3O5BA 1T11A 3LH2S 2EC0A 2Q36A 1X0FA 1KQSM 4FK0A 3ZX3A 1YJUA 4K8ZA 4F02A 2PT0A 2BQUA 5LSLA 2C3OA 3BP8A 3NP5A 3MD1A 2ZH4A 2GW8A 1RABB 4QIVA 2F8TA 3OYJA 3JAMU 2DGSA 3LM9A 4Z4HA 5IT0A 5LMNF 3WIVA 2M88A 5A8WB 2P9EA 2V4JB 3JTNA 2OUGA 3CCUN 3BGRB 3G87A 1Z6RA 2BH1A 5EDWA 4X4SA 2B0GA 1Y5IB 2XSJA 1CJVA 2HNDA 3DLEA 1BLUA 4DR3J 4NXMK 3PX6A 1JKHA 4CJVA 3F9MA 4M5JA 1F3VA 1YDLA 4A46A 3M4XA 3ZEUB 1FRKA 2R2RA 4UY8T 4CO5A 2ZDOA 4F7VA 3BV8A 2R7WA 2Q79A 4ZLNA 3OBYA 1S79A 4O3OA 3KLVA 3R2DJ 1NRKA 3LP2B 1FKPB 1HQEB 1WSGA 4ILGB 4JKBA 1GXLA 4CTAA 4TNOA 7FD1A 1RDCA 2MMYA 1RDUA 3EMTA 4ZHRB 2G9OA 3BN4A 1TVRA 1PAUB 5JUMA 2O4GA 4YS2A 4F3OA 4BY9C 2OEJA 1YZ6A 3QERA 3OTDA 2W4PA 4DX8H 1H1VA 2UUCK 4NWBA 2X1BA 2LSNA 4CH1A 1RT6A 1SH2A 3HRGA 1JJCB 1N5QA 2L9WA 1XNQJ 2R8KA 5EWEA 1GMUA 4BRNA 5CCMA 3CC7S 3OYEA 3LP1A 2DCLA 4N8NA 3KK2B 1LEOA 1TKXA 4O3SA 2QRRA 1NK9A 1BIUA 3NHGA 3M8QA 4CZCA 1BHLA 3C6UA 4PKGA 3BUZB 2KB2A 2KT2A 4IEIA 5AXLA 3PXGa 3CB4A 4DR1F 4CJ5A 1QSSA 2A40A 3AD9C 1FTRA 3NLCA 3CCMS 4PG4A 2OJ3A 1RAJA 1VHIA 3W60A 3J81j 4X64J 4W98A 2YWKA 3H3NO 1U1PA 4V19J 2GZOA 4ES1A 4N41A 1QAJA 1SV5B 1IVZA 5AQWA 3K5LA 1S1XA 4F4WA 4AQYK 3SCLE 2Y8YA 1FKOA 4QU7A 1RT1A 5B0AA 3S41A 2HQFA 3G86A 3D1OA 1MMDA 4EP5A 3KLIB 3UCUP 1N32K 3BYRA 2V9KA 4CBXA 1WAJA 3H8YA 5BR8K 3G25A 4DV3K 1B0TA 4P74A 2KFNA 3JYTA 3SQ0A 3LO3A 2IRUA 3GJSB 3PTWA 3VGVA 4BRFA 4FZYA 3KYLA 3WX8A 3OS0A 3VA3A 1W97L 3OL9A 1F1BB 1RBRA 2G4BA 2NUHA 1HBMB 4KKOA 1XMQJ 3GFHA 2ROGA 3HOSA 3QFUA 3L2VA 4FVMA 3K2PA 3E66A 1FJCA 5GAEI 1YJWN 1KRPA 3CJ0A 2H3EB 1NJZA 1FFSB 4I6AA 3P96A 3CJTA 3G6VA 1GLBG 4DDFA 3ID6A 3T6BA 4NMLA 2JEFA 3N9UC 3KMQA 3ZXWA 3K17A 1JLGA 4NZ6A 5L1IA 1U2RA 2V4RA 4M3RA 1C6VA 1CQNA 3AVJA 3TVZA 2ZWOA 3KK1B 3DGPA 3T9NA 2ZOFA 2M5YA 4F2SA 3CT9A 3WNHA 8RUCA 2A3ZA 1FE4A 4B1YB 3MCOA 2V34A 4YMEA 3E9PA 2XEXA 2ZDPA 3OJUA 4DV7F 2VWBA 3O08A 4ECZA 4O4RA 3OTBA 2YXLA 3CM6A 5L1LA 2VFTA 3ILJA 5LMUF 5CCLA 2ZE2B 1YTYA 3CULA 3P4UB 5KT6A 5DLFA 3LTOA 3PEHA 2GEMA 2DNRA 1R8CA 1BIZA 3R9PA 1U26A 3V9UA 1Q5VA 4FF2A 2P9KB 4HEA9 4QWBA 2IDOA 1WG4A 3G2XA 4PXEA 1P8GA 1BOTO 4H4MA 4FBUA 1RNHA 2KL8A 3P49B 2N4CA 3PYEA 4HCCA 2YHAA 4RW4A 4FJHA 4HHHA 1QHAA 1KVAA 3CQ8A 2GMHA 3V4IB 3HM9A 3GTYX 4CJQA 3JYTB 3OL7A 5DG8A 4Q45A 4CYUA 2MQMA 1UAWA 4NMXA 3HDSA 3J81Y 4A8QA 1TK8A 3VEVA 4I0WA 4W92B 1TKTB 3TSPA 4RCHA 2W9CB 2LVWA 3RVCA 4M3ZA 3VZHA 5DQHA 1FERA 1TK5A 2DH7A 3DXBA 4EO8A 1KVBA 5KPRA 4N7TA 4PG7A 4JKEA 1HR0K 2MZSA 2DD8S 4ZPDA 2VQEF 2LQ9A 2DB1A 2UXBK 2DTJA 2OAUA 4LF1A 1T8EA 1RWWB 3TZZA 3EE8A 2DR5A 4M5LA 5KT7A 4YORA 1VJQA 1U2VA 5KFHA 3UN2A 3OVBA 3KG0A 3MECB 4DTXA 1A7GE 3IRWP 4FWSA 4ECSA 3BH7B 2M70A 3O6QA 2HURA 5AQPA 1U1RA 2N3LA 4URGA 1QAYA 3Q7BA 4CI6A 3CFPA 4XIUA 1RT4B 1F6TA 1QM9A 3CCRN 2HHXA 3QIDA 4UF4A 4L75A 1N5YA 2CJ9A 2E7XA 4AHCA 2AP1A 4BE0A 2QA4S 2ZZMA 2ZZNA 4H5NA 5JLHA 2JH3A 1E4GT 5FLXO 2CNOB 2NSBA 4BR7A 5I42B 4JI4J 1O13A 3GPAA 3EKSA 4WFBQ 4H5TA 3POTB 2A0FB 2IAJB 4RU9A 3M1FA 1H38A 5KFYA 3G71N 4ZTJA 1R6YA 1KEKA 3DOLB 3H20A 5KFIA 4CLLA 2PAVA 3OYDA 1VQ9S 2FJWA 3OFGA 1NJWA 2QWOA 3P45B 3R7BB 4AH9A 3J7YP 3KKFA 3OTOK 2D0AA 4X65K 4C1NI 1K73O 4RUAA 3U1LA 2QN6B 1BQXA 1Z2LA 2H5JB 4ZP6A 5KQ8A 3CEDA 1FFGB 2AA4A 1RHQB 3EPIA 2B4JA 1U1NA 1A5XA 1W2BM 2D3OR 2EFGA 4H03B 2MHEA 1BUXA 1Q78A 2NRHA 1VQ7N 4FLXA 3AO1A 3T1YF 5HMYA 2WOMB 3BF1A 2OPRB 1RBAA 1SIZA 5I3QA 1FEHA 3WNGA 5DRKA 2CUYA 3ZSZA 1G3OA 2HHVA 2NR0A 2OTLS 4NLYA 1UP1A 2KZZA 4YOYA 1BY9A 5K8MA 4TQRA 2APOA 2D5RA 2O8CB 1HKBA 4JK9A 2I6WA 1HNZF 1VC6A 1HHQA 4DR1J 2E5LJ 2V2KA 4C4WA 4TY8A 1YBAA 4OI6A 3VQ7A 1AFIA 1WNSA 2KVIA 2JOQA 1C0FA 1B9DA 2OPPA 4Y2AA 4ZVPB 1BI4A 3LGMA 1Y64A 4C97A 1EP4A 4IOCL 5LY3A 4NYZA 1XNRF 1UETA 4Q5VA 4K0KJ 3EVWA 4DQ8A 2WSCC 3WZ0A 3CDBA 4BRAA 2HIYA 2B9EA 2ASPA 1URNA 5GAHI 2K1RA 5B0DA 5HATA 5HBMB 5E33A 2E6MA 2IHR1 4A8KA 1R0AB 4JUZA 5LJ3Y 1SJFA 3SJJA 4CGDA 4FLYA 3BGRA 1IM4A 1YI2S 1NGHA 3KG4A 3LAKA 1H72C 2WVCA 3GIJA 4JI3J 3EEQA 1JXEA 1SC4B 2NNWA 1D8ZA 3AO2A 4L72B 2DHHA 2XM3A 2XNQA 5EOYA 5KFLA 3QMQA 2PA8D 3K2YA 3L3CA 1UWAA 2EXUA 4WZQA 4F4ZA 3EXYA 1RTHB 3H5XA 3OW2M 4FVUA 4UQGA 2Q2RA 4CCHA 4CEOA 1SH0A 4BDYA 3EVOA 3GG0A 5ETOA 2YX4A 3DGVA 3EKUA 2XMMA 1IWGA 3D5MA 4HTIA 5KGWA 4LBPA 4IBNA 4WIIA 1L3TA 1VQNN 1B4SA 1CQMA 1NCLA 2DXDA 5FROA 4Y0FA 2V52B 3CD5A 3WC2A 4FF4A 2JX2A 2KT3A 1L3UA 2R8IA 2O8BA 2XHCA 2CQHA 4IRDA 1WSIA 4PEOA 1S76D 4YOWA 3ZSRA 3HCXA 1KTVA 3KHHA 4ZVQB 4WE1B 3SI8A 2V7YA 2FLOA 4ED8A 5AQIA 1FWPA 3BBFA 3IO1A 5F8MA 1N88A 4GKKF 4M63C 3I0RB 4FJ9A 2RRNA 4JKGB 3SNNA 1ZTWA 1WC6A 1NZAA 3C7NB 1WEYA 5CA5A 4IH7A 2QWRA 3JQMA 3GIMA 2XMWA 2A1RA 1T6CA 4ELTA 4YDDB 1X8DA 5K5MA 3CPWR 4OZ1A 2DNZA 5KT3A 2X74A 1F2HA 2PYLA 5I42A 1PSDA 3MMAB 1R3NA 2O8DA 1FO1A 2OD4A 3AARA 5HQ8A 2RRBA 2P9NA 3H40A 1JLQB 1R8PA 4M5IA 4Z7YA 1T02A 1LWCA 3KVGA 4P2XA 5F8NA 2NYIA 4PQUA 1Y5NB 2MLXA 4PY5A 4RW6B 4B1WB 2FZCB 3V5RA 2QT7A 4NPOA 5K8PA 1WF0A 3ZSXA 3TEHB 2LXFA 2DEJA 2DO4A 3RRKA 1S9GA 1FFWB 2NUUG 1DKGD 3TAPA 1YJ9N 2HYIB 1WC5A 2I8EA 1AFJA 2HBLA 1RT4A 1C1BA 2EK1A 5E3RA 5IT9Y 4AYBD 4IH5A 3KWGA 3AY9A 1TUYA 4LBIA 4CJUA 1YRUA 3IBWA 1FRIA 1BCMA 1IN0A 3RMDA 1W25A 2Q3SA 4QYRA 4AM7A 2X3GA 2G2YA 3L95X 1KNZA 2F7TA 3ET6A 3MM6B 4EU0A 1GLJO 2B5JA 3G96A 1TL1B 1I94J 3TANA 3JTOA 3DHXA 4O8UA 2HQ3A 1CLFA 3M6GA 3KLFB 4DTOA 1JXVA 3JQJA 4QR1A 4HDHA 2H65B 3LOUA 4CJEA 4FSVA 3UIQA 3D0GE 4KO0B 3BEGB 1Q81T 2LEBA 2H1YA 3HHEA 4NLWA 3QAEA 3OVSA 2VL1A 4OYOA 4ZPCA 2GC8A 3KMSA 1VSDA 1IV0A 4QWDA 3O3HA 4B3SK 1HNVA 1SC1B 4C8YA 1DTTB 5AQTA 3HXMA 4E2FB 3HI9A 1ZM9A 2F1FA 3VZIA 3OR1A 2J7KA 1UVKA 3UCGA 4Q8FA 1JL2A 3MFHA 4N5SA 2D0OA 4DF8A 3KK3A 3NGRA 5HRRA 1C0GA 5B0FA 3AOCA 4WTOB 2W2QP 3K5MA 4CEFA 2CPDA 3UI3A 3W5ZA 2F65A 4D3GA 1W7AA 4QR0A 4CHZA 3PRBA 1EB0A 3B6OA 4CJ7A 4K4YA 3CJ4A 5AZJA 1C0UA 5DZ6A 4ER8A 1VBZA 4DUZK 2BJ1A 2ZE2A 2VG7A 1QS4A 3J8AA 3VGTA 2BJ8A 4IG3A 4X62F 1J2VA 4NI2B 5J1PA 1WWHA 1FJEB 3R5DA 4ECQA 1FDNA 4A62A 1PGZA 1X4BA 4RW9B 2VC1A 2DPNA 1NHVA 3W0LA 5BYSA 1UWBB 4I69A 2GWKA 2AYMA 1Z4UA 2CPHA 1NKBA 1UVNA 3H45C 2QM1A 2CVIA 4JKDA 1QVGM 2BQRA 4DV6K 4CO3A 2VD3A 1NGAA 5EUHA 5KFWA 2CPIA 4WPAA 3V1QA 2LEPA 1TZ0A 3CNQP 2CQ2A 3OV7A 4Y34A 1SL1A 4QWAA 2LXIA 1ROFA 4FJIA 5GADU 2DIVA 3DC2A 1JX4A 2HS4A 1NXIA 2J6SA 1VRTA 1N36K 1SC3B 4NCGA 1GMWA 4WXOA 1S1WB 2IJRA 3AHPA 3OR2A 4NYNA 3RBDA 2P9KA 2UXDK 4HR2A 4M5NA 3PSIA 4Y65A 1JXLA 3IBFB 5D77A 5FJ4A 1KLMB 1IBMJ 5CYQB 4XH4A 3Q8YA 4C0BA 5AQXA 4W5RA 4ZVEA 4HVJA 4NA1A 3CG7A 3GG1A 3MXIA 3W3SA 4NX9A 1H2UX 4S0MA 3SCIE 3G9CA 2KHCA 2ZHBA 3U1NA 4CLWA 1HI1A 3D0IE 4LFBF 3IM8A 1MU2A 4BCAA 3THPA 2YJFA 2H4WB 3GIRA 3ONQA 4CFCA 3FRZA 1TL7A 1PIEA 2Z2YB 3RG6A 3UWTA 4DEZA 4IO9Q 5C15A 3ET6B 5CYJA 1FRMA 3TZXA 2HFVA 1URRA 2MY7A 5D78A 3T1AA 1VK3A 1D4XA 4LSNA 1GTEA 2F5GA 5IC4B 2DNNA 1K8AT 1YIJN 2GMLA 1WBDA 2YH0A 2ZH7A 2QG9B 3UKRB 1SPBP 2FBXA 5AZIA 1RBUA 4CBUA 4FJ7A 2YNGB 1SC6A 4DHVA 3OYKA 1BISA 1KCFA 4Z37A 2GQQA 2OO4A 4IOAL 4FXDA 5A2QO 3CCEN 1IBKF 1I3OB 3J7AP 3FBBA 1LW0A 4ISEA 3CCZA 4TQSA 4EWTA 4X4UA 4YOTA 3P1GA 4YDXA 4DR4K 3EN9A 3F44A 3QRQA 3C16B 2HRYA 4ZS6A 1QAXA 1SQEA 3D6FB 1NAQA 2HNYA 3HLUA 3DOLA 3LPUA 1GFWB 1Z26A 3LF0A 1RWPB 1FEEA 2JNJA 1GOCA 1NUEA 3AVLA 1TU0B 4DXLA 3LDLA 4K50A 1YJNN 3DYAB 3TU5A 1T9WA 2X1GA 5BPMA 2FJAB 2AYBA 1HJOA 3TZWA 2J9DA 1KVCA 3LWMA 4Y1CA 3GDQA 3PW0A 2O5DA 4B8AB 4ZIVA 2ZBRA 5FIIA 3WX4A 4N8OA 2O8EA 3RB6A 2OTJN 3ZTSA 3F0NA 4ED6A 2XY5A 2FC0A 2ZHAA 1D9FA 3DLRA 2MKIA 1Q8IA 3F9KA 3ICLA 4WZMA 3MDQA 2UU9J 4A8OA 3CD6N 4KGXB 1B99A 4WU2A 2YPZA 2HBKA 3PNIA 1ZETA 3T6JA 2IJFA 1I94F 3IA0A 1K8KA 3GJTB 1JNZB 2RDIA 4OI3A 4A8WA 3J7YU 1GQEA 3CJ7A 4L8RB 5U47A 4QOZB 2AW0A 1UOCA 1MU2B 4P2FA 3BGUA 2IYGA 2E1CA 3KJFB 1EQMA 5CXTA 3M1VB 4ED7A 4JK7A 1TP7A 3M8SA 2AJ1A 4KE5A 3GG4A 1WF2A 2ZITA 4LF7K 3EICA 1FRHA 2DPIA 4JKFA 4PL8A 1WUUA 4JI8K 2B6AB 3DOKB 2CJQA 2OZMA 4JI2F 2O8FA 2QV6A 1X4DA 3P83D 3BY5A 3SIPB 5HBMA 2JGUA 4PXCA 2RN2A 3GBTA 2HBQB 3C16A 2VJUA 4G65A 2NSCA 2WUSA 3OR2B 1PYSB 4NCGB 5GIPA 1DQAA 5AQVA 1RE1B 2FVPA 2WB4A 3FFIB 1GAOA 1JLBB 2E29A 1LW2B 4AHUA 5E5NA 1XUPO 4M5KA 2CH5A 4J8FA 3ZTOA 1X1PA 2VF3A 2ZM6F 2RUGA 1X5TA 2AJ4A 2MZTA 2LQ5A 4EUVA 2NCKL 3QPIA 1IBLK 4TY8B 4IYQA 1UEVA 4EK2A 5E7OB 4MAKA 5KFVA 1KTQA 4ED5A 3NOGA 5FLXU 2X78A 2LYVA 3VQBA 4MKVA 1WOQA 1CEZA 3V81A 4A48A 3BEXA 4B1VA 4JV5K 3HSZA 2J6UA 3PHTA 5C2FA 2J8AA 1ZS6A 3MMBA 2E9ZA 2XCPA 4ZLLA 3IXQA 5H9FK 4U6PA 3O3LA 4BC7A 4IDKB 4LH5A 3W3DA 3ZETB 2NXUA 4H0TB 3OJSA 4DUZF 2YNHB 3KJVB 4GRSA 3EXCX 4DR7J 5HMXA 5D0GA 2ZH1A 4LSZB 4WP9A 1YBTA 5L38A 4LUBA 3ZZUA 4MMOA 1VQNS 2HSEB 2F8SA 2FJBB 5GMEA 1XQSC 1MSWD 4BC9A 5K8NA 3EDQB 2QO3A 4YN3B 1YK9A 2G8UA 3V4IA 4CJFA 3OUYA 4CZFA 3EDRB 3IR6B 1YVNA 1HBMA 4LF8J 2OZSA 5HVFA 3J7A1 4AT1B 3TEGA 1T3VA 1ATRA 4CLTA 5F3ZA 3OR1B 2B8PA 4RTFD 5JS1A 3LPYA 1U6FA 1HNVB 1ZYQA 2MXYA 2QJ3A 2V7ZA 1JJ2M 4LR8A 1K0VA 3FBCA 4DCPB 2B4VA 3DLLQ 1S49A 3Q89A 3HMJG 3R1XA 4BRDA 3ILLA 2R7SA 2XMVA 4DUTA 3EUNA 1A9NB 3TJ8A 1DGKN 3MN7A 3AODA 2VCPA 1S1VB 1EETB 1OH7A 4ZPWR 4ECRA 3ZZPA 2RKIB 4DTSA 1KWMA 2EC2A 4LY7A 3KK1A 3FJ2A 2D41A 4RNFA 2CJXB 4BG9A 1CULA 4ZVFA 1FHTA 1B7YB 2GIQA 1M5SA 1VYAA 2RE1A 1BA1A 2E1PA 1C1BB 3BO3A 4DTNA 1S48A 4WF9Q 3M8QB 4KV8B 4ATNA 2XRIA 1J5EJ 1PC5A 1NM2A 1HNIA 2CQBA 3VPZA 2XZDB 3VTHA 3D67A 2Q1LA 2JEGA 3ENVA 4FOIA 2B9XA 3AA4A 3H98A 4BR9A 2DFFA 3FSIA 4QJVA 4XAKA 3SQGA 1Y4ZB 2R7RA 3A5NC 1PG5B 1VQ6S 5CZVA 2FDNA 4ZCLA 4O0NA 4WFXA 4DR3F 1Q0NA 2E7VA 3GCWP 2JJ4D 4V19S 2CZ4A 2BW7A 4AM6A 1NB7A 4FCYA 1NOYA 4E89A 1K73T 4J90A 1HIYA 1RAHB 2P9NB 3AVKA 4LRFA 4Y2IA 4P71A 2FBVA 1CJTA 3QICA 4OKKA 1CBKA 4H4MB 4FYYB 4KREA 4GV9A 4AXIA 1NK5A 2K06A 2J76E 3KUHA 4AQYJ 1HHTP 4O44B 3NAEA 5F0XA 2KU7A 4P2SA 1YJNS 3QO9A 4CIOA 3TUIC 4K4WA 3TVKA 3QBXA 4OFZA 3G8SA 4OMFG 3ZT2A 2VBZA 2ZH5A 4ZN1A 4U7UK 3I0RA 3ZC4A 1FDAA 1C4AA 2I9SA 1Q82O 3AA8A 2BDPA 3O9SA 4Q2MA 3NE6A 3LDOA 2XTJP 2D0PA 1GK8A 1UW4A 1NPRA 5KT5A 4QAGA 3EGZA 4ZCKA 3SMZA 4R79A 2FY8A 3V6JA 2E4LA 4NB4A 4W5QA 3UKRA 2VPXB 1EO1A 5AQRA 3I32A 3LP0B 1U4BA 3KHYA 3MM9A 3I96A 2ZD1A 1TTHB 4HLBA 2BRKA 3C6TB 1NZ8A 4U67Q 4ICLA 5AQNA 3R3LA 2QA1A 3I4PA 1BQNA 4W90B 3I6PA 1WEXA 2HFUA 2U1AA 4HI2A 4I9QA 4WP3A 4ZHRA 5EHHA 4LC9B 3SUNA 2UUWA 3NGZA 3W5XA 5DDPC 2CH6A 4RNHA 4PAAA 2UVUA 5AQLA 5IT4A 5GMKa 1FI4A 4CQ1A 2KFYA 2W2MP 3AVGA 2CPJA 2QMWA 1BG3A 3HBTA 1W26A 3UE5A 3ZEUA 3MPWA 3DXKB 2UUTA 4JI2K 2FVCA 4URQU 1BXNA 1P6TA 1BO5O 2IMOA 1RWOB 2QMXA 1IKYA 3IBCB 2IVYA 3VAJA 1KQKA 3QSIA 3ZSQA 1XNRK 3OD2A 2HWIA 5F41A 2IDEA 5F9NA 2OSQA 3DRXA 2RMLA 3VHQA 3QB0A 2HVIA 3EY1A 4MJKA 2H5IB 4KH4A 2F4VJ 4NEYA 1YZ7A 3RUBL 1PJ7A 4NLVA 5KG6A 2CQDA 2CQPA 2KXHA 3Q8PB 5B08A 3H2VE 3SAGA 4DWIA 1AUDA 2DHXA 1GLDG 1QHTA 4BS2A 1YWXA 5GAGP 1G2EA 2C2OB 4WP8A 2XMKA 3QIOA 5SUHA 2C42A 3QFHA 2CIMA 4ZVUB 1MWZA 1NGIA 3UDLA 2YX6A 2CYYA 3SV4A 1K47A 3UD3P 3VGLA 2RQKA 5LMNJ 5J1EA 3KWIA 2QIFA 2ZKTA 4FPIA 1MN9A 4HKQA 4XH1A 3M8ZA 2EEYA 2VHGA 1QUVA 4DV5F 1Q9XA 3ISND 4B9VA 4DU7A 2NRVA 3ISNC 4YB6A 4HUGA 2A6AA 2AYGA 4ZN3A 4BGAA 2UXBJ 5KFEA 1YQHA 2YWWA 5I3UB 2ADBA 2D4WA 2F9TA 4OI4A 3TAMA 4OX6A 2MLZA 4O3QA 5HANA 3N6NA 3IKMA 4FM0A 2VFUA 3RJMB 1RISA 3Q7CA 4FXWA 2XLKA 4JI7J 1TQLA 5C25A 2GBZA 2HVDA 3I87A 4ECTA 4JD2B <