5I3UA

Structure of hiv-1 reverse transcriptase n-site complex; catalytic incorporation of aztmp to a dna aptamer in crystal
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
550
structure length
550
Chain Sequence
b'PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
total genus 148
structure length 550
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i3uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i3uA05
3KLEB 1RT2B 5J2MA 3GIMA 4QWBA 1IKXA 3TARA 4TY8A 2OPQA 5L1IA 3CG7A 2JEGA 4XIUA 5KRSA 4FLZA 1RDDA 1Z4UA 3H59A 4F50A 2JEJA 5KT2A 3KHLA 4W5NA 3KK2B 5D3GA 1S4FA 4R8UA 3S9HA 2GIRA 3AO3A 5DGBA 1CXQA 4FVMA 4TXSA 3LPTA 3E01B 3M9NB 1B9DA 1LAVA 5KFGA 4CFDA 3QEWA 2YNHB 4MIAA 3AO5A 2D7SA 3NGIA 4FJMA 4DL2A 5KT4A 4Y2CA 3DM2B 4BWJA 5HBMB 3SI6A 4E7KA 4L8RB 3ISND 4NCBA 4URSA 2XY5A 3UR0A 4AHTA 2DFFA 4QWEA 4B3OA 1RILA 3T5KA 4PUOB 4BWMA 4NLGA 4FS1A 1IO2A 3QYYA 3OYIA 4WFYA 5KFLA 2IBKA 3MEDB 3HP9A 5FROA 4NLQA 1TVRA 4FYDA 4Y1CA 2EC0A 5F8MA 3KNAA 2B4JA 2QXFA 5C42B 1EETA 3AO4A 4DU3A 3T3FA 4DLEA 3SV3A 1XHZA 1RYSA 4HYKA 1IKYB 3LP2A 2F8SA 4FCYA 3L2UA 3HVWA 4J9QA 2CKWA 1LWEB 4CJKA 2VA3A 3V81A 1KLMA 4ZPBA 1RT6B 3D45A 1DTTB 5C5JA 3AVIA 4BDPA 3QINA 4CF8A 2IM3A 3NH1A 4HVJA 1RT7B 2WCXA 4KHWA 4ZVEA 4O3QA 4BE1A 5EWGA 4IRDA 4DQRA 5J2QA 3PV8A 1XR7A 3MTKA 4NLTA 5F8HA 5K14B 2WB4A 5HRRA 3SNNA 4ECZA 3UDLA 2E6LA 1C0TA 2KTQA 4EBDA 3JSMA 4YR2A 1QSLA 1JLCA 3PZPA 2YNGA 3V1RA 1VK0A 4FZZA 1RTDB 2ZD1A 4DQPA 3QERA 3KKRA 4CIGA 1S0NA 3O4NA 3OHBA 3OYJA 4FLTA 4ZPDA 4FK4A 2DPIA 4HHTA 2VG7B 1BI4A 3K5OA 5KFMA 4FW2A 3KKSA 3QEVA 3AVGA 3HYFA 3T1AA 1DLOA 3DLEB 2ALZA 1TL3A 3I5BA 2BR0A 1JLEB 2QV6A 3MEGB 4GMJB 4KPYA 1C6VA 2OPPB 3HPOA 4Q0BA 1X1PA 1F21A 2PYJA 4J9RA 5CYQB 4KHSA 4DS5A 3KLGA 3NBPB 2NUBA 3LAKA 1QSSA 2PY5A 4PA1A 4J2EA 2HHWA 4KBIA 3RMCA 3QZ7A 4NCGB 1A5VA 4FBUA 1NK8A 4AHRA 2XC9A 4M3XA 4I2PB 3OYDA 3QNNA 3K57A 1TKZA 3ASMA 1S1UA 5KG3A 1SV5A 1K6YA 5DQGA 1LW2A 2XRIA 1SH3A 1HQEB 1RT4A 3SYZA 3DOKB 2HMIA 4Z4HA 2OH2A 3OYGA 4O3RA 2WOMB 4OJRA 4RNHA 3K59A 4M3TA 3Q8RB 3G10A 4CEQA 2KZMA 1S1VB 3RB0A 4C8OA 2B5JB 5DQIA 3NL0A 3CM6A 1TKTA 3RWUA 2R2TA 1D0EA 2FLPA 1EKEA 3DRRA 1ZBHA 4EP5A 3O3GA 4N5SA 3QGIA 1RTIA 4ZHRA 1C1BB 3P1GA 1EP4B 4NLRA 1JKHA 2AJQA 2YV0X 3UPFA 1W0HA 5KFXA 2ZE2A 4FM0A 2FVCA 3K58A 3NGDA 4EYHB 3LP0A 4KB1A 3ZSWA 1TKXA 1XR6A 1ZTTA 4JV0A 1RT1A 1HMVA 4DG1A 3QZ8A 4DL3A 4J9SA 3DI6A 1N48A 3H98A 3QIPA 3G0ZA 4B8AB 4CGFA 3MR3A 3SQ2A 2IGIA 2YHBA 3RAQA 2YKNB 1HQUA 3PHEA 1BL3A 1G15A 4M94A 2DFHA 5DG9A 4DL6A 1QAJA 4N76A 1CLQA 1SKWA 2R8GA 1SL1A 3I5AA 3DLKA 2G8FA 2BRLA 4O0IA 4Q44A 4ICLB 4I7FB 4KTQA 3MR2A 1XC9A 3WNGA 3OYMA 4CGIA 3OYAA 3AVKA 4IDKA 4CEOA 5F8IA 4RNNA 3IRXB 1LW0A 4M3YA 3ITHA 1CZ9A 4KO0B 4DL7A 3AVJA 1RBSA 2JGUA 4F2RA 1UA0A 5F8NA 3RRHA 1C0UB 3CDEA 3BREA 4CJLA 1HNIA 5F9LA 5CY4A 1UA1A 1JLAB 2FLNA 4FZYA 2R8KA 2YNFA 3PW2A 4AHVA 4H4MB 1JLQA 1S97A 3QIOA 1EX4A 2X6SA 3QNOA 1UWBA 3TAMA 4ZVFA 4F4ZA 3KLVA 3BQ0A 1D8YA 2G8HA 1Q8IA 3V6DA 3K2PA 4QWCA 1L3UA 3D28A 4FJNA 3G6XA 1REVB 4I9QA 3OLAA 3M8PB 4C8KA 5KG0A 4RW6A 2OPRA 3ZT2A 2C2EA 3ISNC 3SUQA 4FZXC 1ZYQA 2YHAA 4WE1A 3TR8A 1VSDA 3OJSA 4K4XA 2HNDA 3AVCA 3AVLA 1TGOA 4CJWA 1C1CA 3N6LA 4FXDA 2ATLA 2FJWA 5I3UB 1TL1B 4LSNA 1S1WB 3RTVA 4DFKA 1JIHA 4CESA 3BSCA 1VSKA 5JS1A 1RT3A 3O4QA 4OKEA 5C24A 1N6QB 1NK9A 1KFDA 1K1QA 1S6PA 1RDAA 4CK2A 4M95A 3LANA 3PR4A 4HTUA 2G8UA 2Z1GA 2XWYA 3OYKA 4URQU 4YR3A 2HVHA 3CFPA 5C25A 3C6TA 2HNZA 4ZP6A 4B9TA 4CF2A 1YVFA 4QWDA 3EPGA 4B9UA 1XWLA 2YKMA 4CEZA 3DLGB 5J1EB 4PQUB 1RYRA 3D0PA 4IR9A 5KFIA 1QE1B 4DF4A 3MR5A 5T7BA 2BANB 3I0SA 1T05A 4RNOA 3KIOA 5KFWA 1MU2A 3IAYA 4CF1A 4CFCA 4C8NA 1RT5B 3DYAB 4KV8A 4CECA 4CJUA 1WSEA 2Z1HA 1NHVA 4M42A 5KGWA 1TQLA 3UQSA 4QW9A 4CHNA 4FBTA 1JL2A 4WYWA 4BACA 1T03A 3MAQA 3LP1B 2FLLA 3BGRB 1LAWA 4RW4A 4B9LA 1HRHA 1D5AA 3ZCMA 3VQ9A 4EO8A 3KLEA 2OZMA 1RT2A 2E9RX 4JRQA 5KFQA 4N56A 4CIEA 4KTWA 4YR0A 2XY8A 2Q3SA 2HNYA 3OHAA 2XGQA 1GOAA 3U3YA 3OYLA 1KVAA 2V4RA 4O0JA 1KHVA 4ID5A 1D9FA 3KK2A 1ZBLA 4CEAA 4O3OA 4DTSA 2PZSA 3BQ1A 3RB4A 5L9XA 4KFBA 4CJ4A 2AWZA 1RNHA 3MECB 3G6YA 3AA3A 3CFRA 4ZP9A 2HHQA 1RA7A 2YNHA 4F3OA 3JYTB 5J2NB 3DM2A 5HBMA 3FDSA 3NF6A 4DLGA 3S3OA 2IJNA 2HHUA 2D3ZA 4IH7A 2W7PA 4KKOB 4Z0UA 1X9MA 5KFFA 4IG3A 1HNVB 4CJVA 2RDIA 3M8RA 1C0MA 2IM0A 4PUOA 1EXQA 1TKDA 3CFOA 3OYHA 4E7LA 1HJRA 1QQCA 1NK4A 1HYVA 3SFUA 3MEDA 4MQ3A 4EP4A 4DWIA 4LQ9A 1ZTWA 3DLBA 3OYEA 3PVXA 4CGDA 3H4BA 2FVPA 1VRTB 2BGGA 4ED1A 4W5RA 1S0MA 2HWIA 4K8ZA 4M3RA 1J53A 1IKYA 2I1RA 5KT7A 1Q9YA 2D0BA 1J5OB 1LWEA 2Z1IA 4WZMA 3KLIB 1S6QA 3KJVA 3V1OA 2X6NA 4ED0A 1RT6A 1DTTA 1TV6B 3HP6A 1L3SA 4K4TA 3BJYA 3OL8A 4YFUA 4KB7A 3N6NA 3GV5B 1FKOB 3NCIA 3AVAA 2BDPA 2BQ3A 3IS9B 4LH5A 2R8IA 5K14A 5HRPA 3QETA 2EHGA 4IH6A 1RTJB 4DF8A 4NYFA 5HROB 4ECQA 5EDWA 4CJTA 3WNHA 2JEIA 4O55A 1RTDA 1B92A 4M3UA 3DRPB 3T19A 4JLHA 3HPGA 3OS1A 2GV9A 2OZSA 5CZ2A 2VG7A 2C28A 2R2SA 4TSXA 1SKRA 3FFIB 5HLFB 3CWJA 4ED3A 4ED7A 3V6HA 4K4ZA 3OSPA 4CJ5A 3OVNA 2XY7A 3KK1B 2G8WA 2G8VA 2RDJA 3DLEA 5KFOA 4RW8B 4IRCA 1JLEA 3B6PA 2FBYA 4IOBA 4ZVGA 4QAGA 3V9UA 4WFXA 3FSIA 3KK3B 3BSAA 3VQCA 4CJ3A 2OPPA 3GILA 4OPKA 4TYAA 3S3MA 4CK3A 3ULDA 1W9HA 2Y1IA 4RNMA 4JUZA 3HVTB 5F8JA 5CYQA 1LWCA 3QGGA 3C6UB 1SUQB 3BSOA 3H40A 2VG5A 3OL6A 3VQ8A 2GIQA 4CCHA 3KHGA 4NCGA 1TAQA 4R8UB 2BQUA 4IH5A 4KHUA 4I2PA 3CYMA 4AHCA 1SL2A 4AILC 2X74A 5CYMB 1S1TB 1U47A 4CHPA 2HHTA 1S1XA 3NF9A 4R5PB 1HQEA 3EYZA 4JS5A 2W8LA 1S9GB 1RBUA 3DOKA 1NOYA 1SH0A 2HB5A 5KFUA 2AGOA 1T3NA 2ILZA 2WOMA 1WNSA 4DFJA 3KOAA 1RCHA 2RN2A 1SKSA 3TABA 4IFVB 4WYLA 3DMJB 4B3OB 2J6UA 1S1VA 3OS2A 4O5BA 2B5JA 1SL0A 4MKBA 2E4LA 3MXMA 1ZBUA 4CEEA 1Q9XA 1FKPA 3H5UA 3KLFB 4IFYB 1RDRA 1S0OA 1JX4A 4CK1A 1U04A 1ITGA 4GVMA 5KFRA 5J2PB 2FC0A 1VSFA 4DS4A 3LWMA 4C8LA 2IOCA 3NF8A 1WSHA 2Y1JA 1WNEA 3WNFA 4FJ5A 2FBXA 1C1BA 4MK8A 1HYSB 3GV7B 1I3AA 1EP4A 1WSFA 2W9CA 4F8RA 1BQMA 4KSEB 4MFBB 3ZT3A 3LP2B 3I5CA 1YTUA 2EX3A 2ASLA 4Z4EA 2IDOA 3V9WA 2WK4A 4BE2A 1S48A 3G86A 5KFJA 2W8KA 5KG4A 1GOCA 3NAIA 4KB0A 3V9XA 3LALA 2D41A 3RMDA 4E7IA 1BGXT 4HCBA 2XGPA 1NJYA 5L1KA 4FM1A 2HVIA 2YKNA 4H4OA 3PY8A 3PUFA 3HHKA 3T5HA 1L3VA 4N47A 4FJ7A 3NGYA 4LQ3A 2IM2A 4MIBA 2W9BB 4GC6A 2JEFA 4RU9A 5KFVA 5KFZA 4ICLA 4I7FA 4ELUA 4J2DA 3QLHB 4QWAA 3VQEA 4PWDB 1VSMA 1N5YB 1X9WA 3TVKA 3IRXA 3CJ2A 3VQSA 2JLEA 2W9AA 3HT3A 4KO0A 4IBNA 2XI2A 1I6JA 1R0AB 1C0UA 4E3SA 1ZETA 3AV9A 4G1QB 3OL9A 1JLAA 4C8MA 2IMWP 1DLOB 5CZ1A 3N6MA 1TL3B 2VWKA 3QGHA 4EYIB 1BISA 3HK2A 4TY9A 4F2SA 5KFCA 1VSIA 2IAJA 4ECXA 3HL8A 1FXXA 2YNIB 4ELVA 1TK5A 3KD1E 4CHYA 1T7PA 3HXMA 5L1JA 3TI0A 3HKWA 2IC3A 4DTPA 5FDLA 2G8IA 3M8QB 1REVA 2CJQA 5KGXA 3M8PA 3H2LA 3MEEB 4KREA 1MMLA 1GOBA 2C22A 3NGZA 4DTXA 1GX6A 4I2QB 1S1UB 1SV5B 2J6SA 3THVA 1C2PA 3SPYA 5HRSA 4N41A 1CZBA 4IG0B 1B9FA 4DTRA 5KFHA 4RNFA 3ZSZA 3SQ4A 3MXIA 3GIIA 5KRTA 3AO2A 5F8GA 1S1WA 3OYFA 5JS2A 3QO9A 4CHOA 4ZTJA 2RF2B 1N4LA 4J9MA 4ZP7A 1N6QA 5EWFA 2QKBA 3WNEA 1O1WA 3FQLA 3SI8A 3KLHB 4CEDA 4EZ9A 2JC0A 4ED6A 5F8LA 2XHBA 1NK6A 2VG6B 3DRRB 3NH0A 3PJWA 5EU7A 2WONB 1IKVB 4HUFA 4LH4A 3RB3A 2ILYA 2D0AA 5KFDA 3K5LA 1FK9B 2LSNA 4Q45A 2A1SA 1QS4A 2AQ4A 5KFBA 3FRZA 4EBCA 4YP3A 3ZSQA 5J1EA 4PQUA 1BIZA 4CHQA 3DDKA 2UVVA 5T14A 1JLGA 2IM1A 4ZPCA 1QE1A 2ZE2B 2KW4A 4EEYA 1A5XA 5SZTA 4DSFA 5KG6A 1RT1B 4FLYA 3NAHA 4NYZA 3DI6B 4FJKA 3H08A 3T5LA 1RT5A 1WN7A 3RMBA 4F4WA 1BQNB 4LD0A 3UIQA 1VSLA 1HQUB 4O3NA 3QEIA 3LP1A 3BGRA 1U48A 4CF0A 4DTNA 3SCXA 4NLOA 2D0CA 1KFSA 3RBEA 5F9NA 3BDPA 3L3VA 3EZ5A 5EUHA 4E7JA 4HCCA 3OL7A 4E19A 3DLHA 1WLJA 3KTQA 4CJQA 1VRUB 1HARA 2QKKA 3BQ2A 4Z4FA 4HUEA 1KVCA 4O44A 1JXEA 3CDWA 4J2AA 2UVUA 1S9EB 2HHXA 2BE2B 2C2RA 3S3NA 2HW3A 3AVMA 2OPSB 2YNFB 3L8BA 4FLXA 1RA6A 1LWFB 3DOLA 3CIZA 4DTMA 4GW6A 4FW1A 3ZSRA 4DSLA 1DTQB 3PX6A 4GC7A 1NKEA 3JYTA 5J2NA 3LAMA 1Z25A 4TQRA 3L3UA 3OS0A 3V1QA 4OLBA 3ZT1A 4HKQA 1HNVA 4XO0A 4AHUA 4BE0A 3VQAA 4ECUA 4RG8A 4DSEA 5DLFA 1T94A 4CJRA 4CIFA 3AVNA 4ECVA 2O4GA 2O5DA 1JLFB 1VRTA 3HM9A 2KFNA 3OLBA 2QK9A 1RT3B 4O4RA 3V4IB 3PW0A 5HP1B 4Y3CA 4CJPA 4CGHA 4KRFA 3PW4A 1J5OA 3SZ2A 5FRNA 5I42B 4M3ZA 4EO6A 2KQ2A 4J2BA 4RZRA 2XCAA 1TV6A 4ZPAA 3ALYA 3SUNA 2HNZB 1HPZB 3E01A 4FJIA 4ID1A 2UVWA 4NLXA 3V9ZA 3QEXA 4MH8A 3H5YA 5L1LA 3I0RB 2Z1JA 2YKMB 3M9MB 3DRSB 1FKOA 4ED8A 3HO1A 1NKBA 3IS9A 3GQCA 2FBVA 2AX1A 2RKIB 5E41A 3NKYA 4O3SA 4TYBA 4H8KA 3K5NA 3ZSVA 4MKAA 1XHXA 5HROA 1QTMA 4YQWA 3IG1B 4RW9B 4Y2AA 1KHWA 5KFAA 3DRPA 3RMAA 4BDYA 3P5JA 2DTUA 2E9ZA 3L2QA 2I5JB 4O4GB 4IRKA 3CQ8A 4U7CA 3VQ7A 3OSNA 1L3TA 5C42A 4DEZA 3HSTB 4DSJA 1XI1A 1QHTA 4RW4B 3QEPA 2VWJA 1U09A 3GIKA 3KK1A 4KI6A 4YMEA 4FLVA 3TWHA 4RW8A 3RR7A 1KSPA 4WFZA 3KK3A 2R2UA 5KFKA 4FS2A 4MK9A 5KI6A 4ZTFA 4FK2A 2ASDA 1J9AA 4RW7B 3SUOA 3HVTA 4ZVHA 1RTHB 2HNYB 4R0EA 3C6UA 1RT7A 1SUQA 4Z4CA 5DQHA 3PO4A 4CJSA 1TK0A 1KVBA 3IN5A 4ID5B 4LSLB 4CGJA 2W42A 2DPJA 4F4XA 4Q8FA 1BIUA 4KTZA 3A2FA 4Z4IA 3LZJA 1IKWB 2XCPA 3P83D 2IJFA 3O3FA 4E89A 4KFBB 5CYMA 1S1TA 1X9SA 5KFEA 4B08A 3SJJA 1JLBB 4R5PA 3TAEA 3TQ1A 1S9GA 2WHOA 3F9KA 4WXOA 4DSIA 3NF7A 3ZSOA 4KAZA 2B6AB 4IG3B 3NH2A 2HAIA 4IFVA 3MR6A 3DMJA 3VA3A 5KFTA 3RAXA 1RDBA 3PO5A 4NRUA 4FJ9A 4OGEA 2ASJA 4KI4A 3QIDA 3V6JA 3KHHA 4OKJA 3KLFA 4IFYA 1VSJA 1YT3A 5J2PA 5J2MB 4JRPA 3MEGA 2HWHA 1IKXB 2ATQA 4TY8B 2OPQB 1HYSA 1NKCA 1BCMA 2E6MA 4NLDA 4MFBA 5DMRA 3HVAA 3ZT0A 3NBPA 3U6FA 5KT3A 1S6QB 3RR8A 3KJVB 4B9VA 4J9KA 3VQPA 5D3GB 4OVLA 2KFZA 5KT5A 4K8XA 5DG8A 1WAJA 3C95A 3NDKA 3I8DA 2R8HA 4Q8EA 3BSNA 2O4IA 4AH9A 4K4UA 1J54A 3CJ4A 1S5JA 1WAFA 3VQ6A 4CF9A 5KG2A 4IKFA 4NCAA 1S49A 2D5RA 4K50A 3ZT4A 4J9OA 4NLYA 3QESA 3U3GA 1GX5A 4XPCA 3H4DA 4TQSA 2W9BA 2R2RA 3RBDA 2C2DA 4KHMA 3SV4A 3OYCA 2ZKUA 3QLHA 5KFYA 3E51A 1TP7A 3AA5X 2OA8A 4PWDA 3SPZA 3L2WA 1N5YA 1TVRB 3CJ3A 4ECSA 4NZ0A 4RUCA 2BQRA 4OGCA 4AHSA 1WSJA 1EETB 3EZUA 3NFAA 3M8SA 1R0AA 3M9OB 4M3WA 3TAPA 4G1QA 1ASUA 4ED2A 3AVHA 1BCOA 3DLRA 2R8JA 3G6VA 4FLUA 3CO9A 3KD5E 3V81B 1KLMB 3GIJA 2P5OA 4OKKA 2UUWA 1NK5A 4J9PA 1NJXA 2YNIA 3CJ0A 1LWCB 1WSIA 4Y34A 4UQGA 4OPJA 4I9LA 4TN2A 3NE6A 4K4SA 2VG5B 3GYNA 3O3HA 3M8QA 4IKAA 5J2QB 3TAGA 4FK0A 2OYQA 3LWLA 3MEEA 2V0NA 4XPEA 4I2QA 2V9WA 3RB6A 1C0TB 4YNQA 1S1XB 3VQDA 3JSMB 3IGVA 4ZP8A 2F96A 1JLCB 2YNGB 3LDSA 4H54A 4IG0A 2ZD1B 3PW5A 3Q8SB 1U45A 1A5WA 4JV2A 3AO1A 4DU1A 2F8TA 3HVRA 4EZ6A 3GV8B 4CJEA 5HRNA 4E1NA 5KTQA 2RF2A 1BI4B 2VA2A 4CE9A 1TAUA 3K5MA 3KLHA 1RBTA 1FKPB 4CFBA 1RAJA 4DSKA 1IH7A 4ECWA 3OYBA 2VG6A 4H4MA 4OLAA 2WONA 1QUVA 1IKVA 3SFGA 3BR9A 4JV1A 4Q0BB 1FK9A 4ECYA 2RPIA 3RRGA 3SQ1A 4NLUA 2IA6A 3SQ0A 1XR5A 2W9CB 5EWEA 1BQMB 4RUAA 3KLGB 2R7YA 3OJUA 3PX4A 1RBRA 4QCLA 2D3UA 4DL4A 3TANA 3VQBA 1LV5A 1NOZA 4DQSA 1TKZB 3D5MA 4E7HA 4QPXA 3EY1A 4Y1DA 3TAQA 1LW2B 4CGGA 1RT4B 3CJ5A 4WZQA 1D9DA 4IQXA 2ETJA 4MK7A 1BQNA 2HMIB 4QW8A 5I3UA 1TL1A 4H4OB 3ZSXA 4F3TA 3MXJA 2F8EX 1IM4A 1JXLA 3HJFA 2BRKA 4FJJA 4K4YA 4PY5A 3EPIA 3NHGA 4QOZB 1TKTB 2A1RA 3VN5A 1W25A 2P5GA 5DGAA 5JUMA 3MFIA 4G3IA 4J9NA 2V4QA 1RTIB 3AVFA 4NYNA 1VRUA 4ZHRB 4X2BA 4FJHA 1NHUA 1JKHB 4TLRA 1ZBIA 4F4KA 1WSGA 4M41A 4FJ8A 3DLGA 1ASWA 4IR1A 4NRTA 1S9EA 4NLVA 2BE2A 3PW7A 4E0DA 3T5JA 2DFEA 2OPSA 4KE5A 1LWFA 1TK8A 1IG9A 3LP0B 2BANA 1YVUA 4OL8A 1TKXB 1DTQA 2IAJB 4URGA 2G8KA 1HMVB 4DG1B 2HHVA 3L2RA 3SUPA 3VA0A 4CEFA 4FJGA 3QIPB 3KMSA 3VQ5A 4KHNA 2IC3B 3DYAA 5FDLB 1HYZA 2GBZA 2X78A 1S9FA 1C1AA 1NJWA 3C94A 4JS4A 3B6OA 1K1SA 2UVRA 2W7OA 4W5OA 4NLSA 4CHZA 1KCFA 3DLKB 1UAXA 2ZQBA 3LP3A 3PR5B 4KHRA 4CFAA 1JLFA 2FJVA 4IDKB 3AA2A 1I39A 3QO9B 1KLNA 4NLWA 4DTOA 2JC1A 1LW0B 3KHRA 4DQQA 3ITHB 1CSJA 4DMNA 2AGPA 3V4IA 4KHYA 5HP1A 1CXUA 3NMAA 3ICLA 1BHLA 5I42A 1HNIB 2FJXA 3FQKA 2FVQA 3LPUA 5DG7A 1YTAA 1JLQB 2KZZA 4Q43A 3Q8PB 3AVBA 1HPZA 1U49A 3Q8QB 3F73A 3MECA 4ECTA 4BDZA 4HUGA 3I0RA 1UWBB 3TAMB 1RBVA 2FBTA 3DRSA 4ECRA 5SWMA 4B8CA 3V6DB 1JLGB 4W5TA 2RKIA 1S10A 2P1JA 1U4BA 4ZMMA 4KKOA 2ITGA 4FLWA 3CDUA 3VQ4A 4FM2A 1QSYA 4DTJA 4RW6B 2OPRB 4CERA 1JXBA 1ZBFA 4O3PA 3IG1A 4K4VA 3AA4A 4RW9A 1T8EA 4WE1B 3V6KA 4DFMA 2FVSA 4B9NA 2HNDB 1ASVA 2FVRA 1C1CB 4NLPA 3V9SA 4CJFA 1RDCA 2I5JA 4LSNB 4O4GA 5KG1A 1JL1A 5DK5A 4WXWA 4EBEA 3HPHA 1UOCA 5C24B 1D1UA 3IGNA 3MF5A 1Z26A 5JXSA 4DU4A 1S6PB 2QE5A 1Y97A 3KLIA 2WTFA 2AX0A 5KT6A 2XY6A 1NK7A 5FRMA 3H5SA 1SH2A 2DY4A 4M45A 4Q5VA 4FJXA 2P51A 1VSEA 4LY7A 4DTUA 1NNDA 5C25B 3C6TB 4RW7A 3H5XA 4U6PA 2XO7A 5KG5A 5KFSA 3VQQA 4ELTA 1RTHA 4Z4GA 2UUTA 3TAFA 4K4WA 4O44B 4J9LA 4B9MA 4E1MA 4B9SA 2HHSA 4CEBA 4KHQA 4DFPA 4LSLA 3ZSYA 3CM5A 1QAIA 1IKWA 1NK0A 2XI3A 3OYNA 4FJLA 3DOLB 1RTJA 1OS5A 5KG7A 3I0SB 2B43A 3L2VA 3PX0A 1VSHA 1T05B 2GC8A 1L5UA 1KRPA 4F4YA 1JLBA 5KFPA 4DQIA 1MU2B 2IS3A 5DLGA 4DL5A 3LZIA 2GUIA 4KV8B 3MFHA 2AU0A 2E9TA 2AGQA 2PYLA 3KMQA 3PJXA 2B6AA 2J6TA 4KAIA 3NAEA 1KTQA 3CVKA 5KFNA 1T03B 1N56A 3FFIA 5HLFA 4W5QA 2WRMA 3OY9A 1NJZA
chains in the Genus database with same CATH superfamily
4GO7X 3KLEB 2M4MA 1RT2B 5J2MA 1IKXA 3TARA 4TY8A 1N0VC 1JJ2R 3CG7A 5H9EK 2AYEA 3WXMB 1Z4UA 2XLJA 3LGNA 1FDBA 2N3OA 1X31C 3KHLA 4X62J 3KK2B 2VH7A 4HT5A 4R8UA 4DHYA 5CAAA 2GIRA 4FVMA 1K8KA 3M9NB 3X3UA 3VEYA 3QEWA 1WHWA 4OYZA 4A4JA 1D09B 2DKOB 5AXKA 5KT4A 1XMBA 3OXGA 5HBMB 4B3RF 4L8RB 3A8KA 1MWKA 5IM0B 1P27B 3KVGA 3QGPA 1Y5LB 4QWEA 4B3OA 1RLDA 1IVZA 1F2GA 4FS1A 3IXQA 1BWEA 5DM7Q 4LF6F 3HP9A 2VC0A 2ASPA 5E33A 4LF2A 5FROA 3RSEA 3OR2B 4KH5A 2NSBA 5C42B 2PO4A 3T3FA 3SV3A 1LOUA 3LOUA 4HYKA 2F8SA 3L2UA 4CJKA 4XK8C 3CJRA 4PG8A 1Y0HA 5AE1A 1YITS 3AD8C 3VAIA 4BGAA 3QINA 3R2DJ 1RUSA 4DZ6A 4H0TB 1RT7B 3THYA 4FVUA 2A6OA 4O3QA 4YUDA 3CMQA 4NE9C 4DQRA 3IAM9 1PBUA 1RE1B 5K14B 2LEPA 1HD0A 1NWKA 3HOSA 4DX7A 4WU3A 1Q4RA 5D77A 4JKGB 4UY8T 3FVYA 4K0KJ 2KTQA 3JSMA 4YR2A 4GVEA 4UW2A 1LOTB 1VK0A 4FZZA 2ZD1A 3KUHA 2BKNA 2CQ3A 5LY3A 5HL7L 3HSZA 3C66A 5AQJA 3KKRA 4CIGA 2W4DA 3O4NA 4WF9L 2GGPB 2PEBA 1S72N 2XS2A 3TZXA 5KFMA 1RU1A 3AJDA 3AARA 1I94K 1AZSB 2V8PA 4OI1A 2KG1A 2RIJA 1XIQA 3HYFA 4QBUA 3T1AA 3I5BA 2ROEA 4FDFA 2HVZA 4KPYA 4GMJB 1RHUB 2F8MA 1ATRA 2OPPB 2B8PA 2CPZA 4Q0BA 3J7ZT 3Q0AA 5GAGP 4KHSA 4PG4A 1P9QC 4ITSA 4ZVPB 1IBLJ 1BWFO 3KLGA 4O5FA 3PRDA 3C65A 4PA1A 2HHWA 4KBIA 4RWWA 1XJWB 4X4SA 1NK8A 1NAQA 3BKFA 3R6MA 3KKFA 3K57A 3P6YC 1KQSM 4DUYK 1TKZA 4GV6A 5DQGA 3S01A 4K41A 2XRIA 2VF3A 4M8LA 2RB7A 2WVCA 1VBKA 3TU5A 2RQKA 2KFYA 4OJRA 3W63A 1YJ7A 2NXNA 2RMLA 4AFFA 4P7VA 3W2WB 3K59A 3J80O 4PHTX 3Q8RB 4CEQA 1S1VB 4C8OA 4P52A 2B5JB 1UFKA 3OTOF 3NL0A 3H0PA 4L74A 5E84A 2R2TA 2J8AA 1EKEA 3DRRA 5DM7L 3ZEUA 4N5SA 2E7VA 2OO4A 2KT2A 1JKHA 2AJQA 5KQDA 2HF4A 1BD6A 4IOXA 3VMFB 4C9DA 1GLCG 3GJQB 2NZTA 1IJFB 1MDUB 2QIFA 2R7VA 4EYHB 4KB1A 4P2MA 4IOAQ 3SCKE 3AOCA 2Q43A 2ZBPA 4NLBA 2KXHA 1WUUA 4C11B 1FRMA 5MLCV 1M90T 3QIPA 2P9SB 4F26A 4CGFA 2W24A 1WHXA 3V4MA 2KHCA 2V4JA 1HQUA 3PHEA 1G15A 4IXCA 5KQ8A 4BC9A 1QAJA 3T9ZA 4N76A 3QBXA 2ZWPA 1JWWA 4K5SA 3I5AA 2YH1A 4Q44A 4I7FB 2DGWA 3EGVA 5RUBA 4LRFA 2QL7B 2PT0A 3UE5A 4OYXA 5K8OA 4K5RA 4DOZA 3D0GE 1RCOB 1CZ9A 2JGUA 1UA0A 3Q89A 1IM6A 2WFBA 3H20A 5F9LA 4FZYA 2IRYA 5ADZA 3R7BB 4H4MB 1JLQA 1S97A 2UUBK 2HQCA 3OA9A 1GFWB 1ICEB 1AB8A 1UWBA 1BDGA 4KGZB 3KLVA 1Q8IA 4QWCA 1DRZA 2CJKA 4HLBA 2YWWA 1HQ2A 1FTRA 1REVB 4JK7A 4ZCLA 5IWAJ 4NXNK 4RW6A 2OPRA 1X4BA 1RU2A 1H7WA 2LA6A 1OPZA 3UNGC 3FKBA 1WEYA 1HWLA 3W9JA 3AVCA 3EGNA 3AVLA 1TGOA 1HW8A 1VQSA 2AMCB 2XMVA 5A6WA 2FJWA 4DFKA 3ENOA 4CESA 3BSCA 2P9LB 1VSKA 5TKYA 2ZGZA 1T9XA 4HR2A 2IMOA 3G71N 1Q81T 4LF7K 2RE2A 4W92B 3E1YA 3LANA 5B0BA 3PR4A 4QYZK 3CMAS 3AY9A 2EVZA 4EGLA 1OSDA 5JMVA 4YR3A 3CFPA 2OEMA 4ZP6A 5HOOA 2MSTA 3W5YA 4B9UA 3M7VA 3BS9A 5ETKA 2GQCA 2YKMA 4CEZA 4JI1J 4PQUB 2VQEF 3ZXWA 3BO2A 4DX8H 3OBWA 3UB5A 3C8YA 1NMDA 4GY2B 5DDRC 1ZAWA 2Z8QA 5T7BA 5M1KA 1TFWA 2BANB 5IT9O 2QI2A 2P9UA 3UW1A 3Q8VA 2KU7A 4FPAA 2QW9A 3A4TA 4IOAL 4WFNL 1MU2A 3ZZYA 4G1IA 1V6HA 3UN2A 4CFCA 2ASYA 1E6YB 3ILOA 2U1AA 3TX8A 4CM2A 5KGWA 1VK3A 3MMJA 3U7JA 1GTHA 1N52B 3AD7C 4CHNA 3VV2B 3HRGA 4LF8F 4I56A 4BACA 1T03A 3LP1B 1LAWA 2RS8A 1CG2A 4EO8A 2PFDA 1NGCA 1NBWA 3SQOP 4JRQA 2Z2LA 1Q7YT 4R0JA 4KTWA 5GAHP 2L9NA 1ZC6A 2HNYA 2KB2A 2CADA 1GOAA 3EXCX 3L95X 3FRYA 1D9FA 2CQDA 4DV7K 4Y6IA 3K8VA 3ZLJA 5LJ3Y 4DUZF 4N8NA 1BWVA 3RB4A 1YZ6A 4KFBA 3HHLC 1P8GA 3ZZZA 2HVEA 1XNQK 3KUGA 1X4GA 2C1EB 1KQFB 3JYTB 1VQKS 3G87A 1DEJA 3NF6A 2FZKB 2G2ZA 2H3EB 2IJNA 1X5SA 5ETVA 4MMOA 1X9MA 2NXUA 2BXJA 1FNOA 1KDNA 1NK4A 1PYTA 4MQ3A 4EP4A 3VR1A 2FVPA 2BGGA 1X0FA 4FSVA 4ZDNA 1ZAVA 2GW8A 3UKRB 3PFOA 3HSJA 3MX5A 2O3DA 4M3RA 2CNKB 3EKSA 1M1GA 4P6QA 3CW2C 1RP5A 1H98A 1IKYA 3D1QA 3GLJA 4Y28C 4WWSA 5I9EB 2XNRA 4LIRA 4I69A 4LF9F 2X6NA 1TR0A 3VGTA 4BRAA 2X1FA 2E8AA 1DTTA 1TV6B 4N8OA 1L3SA 1W26A 1N8RO 2NRRA 3CJCA 3OL8A 5IV4A 4DB3A 1IBMF 1DT9A 3GV5B 2UU9F 2ZEJA 4AF1A 3VEZA 3Q7CA 1FKOB 3NCIA 3AVAA 4DR4K 1RABB 2R42A 2OKQA 3IS9B 2BA9A 4LH5A 5A6PA 3C7NB 1JJ4A 1IBKF 1F3VA 4IH6A 1RTJB 3ILIA 3PIPQ 4LRDA 4DF8A 5LM7E 1F2HA 4YORA 2MKCA 4ECQA 5EDWA 4CJTA 4JI8K 3WNHA 5B0EA 3TR5A 4LF4F 3ZETA 5LOQA 5AQPA 1KAZA 2DR9A 3DRPB 3I31A 2NREA 3SAFA 4X66F 2E2OA 5CZ2A 3MURP 2Q2RA 4JI2J 5L9NA 2F9DA 2YH0A 2AP1A 2H5IB 2JWKA 3V6HA 2OD4A 3D0HE 4QR2A 4K4ZA 4CJ5A 3KDNA 2G8WA 2ZWOA 4BHQA 2RDJA 4RW8B 1JLEA 3B6PA 4IOBA 4PXBA 5F0UA 3VETA 3V9UA 3BSAA 4H0VB 3VQCA 3ELHA 1CJVB 3ULDA 2X7IA 4OHVA 2Y1IA 4M7YA 4ZVTB 3HVTB 4JUZA 5CYQA 1Z6RA 2ZDOA 2DITA 1S3XA 3VQ8A 4JBCA 4CNZA 3KHGA 4NCGA 1NJIO 2DCLA 5C10A 4IH5A 3CYMA 1SL2A 1VQNS 2X74A 1S1TB 1HNZF 4R5PB 1HQEA 1FVQA 3EYZA 1S9GB 1NOYA 1SH0A 2F1FA 2HZVA 3J7YU 3PSIA 4LFAF 1N32F 4KPCA 4QU6A 4IFVB 1YKWA 3DMJB 4LF5K 4ILRA 1Y5NB 5LXYA 2J6UA 2D1KA 2FGCA 4MKBA 4ER8A 4LR7A 1Q9XA 3QDKA 2OGUA 1HBUA 1JX4A 4CK1A 4GVMA 2ZVIA 2JVRA 4DS4A 3LWMA 2Z56B 3OQ2A 5F0WA 4X65K 4QS9A 1IR2A 4EIAA 3GV7B 3EX7B 4NYPA 1WSFA 2D9PA 1V3ZA 2KXFA 4JK9A 1FHTA 4JYAF 4EAHD 3V9WA 5DZ7A 1F9EB 1Q8LA 2F7VA 2WTUA 2CGJA 1Y64A 3WEEB 4HH0A 3V9XA 3LALA 5E3RA 3OXLA 1KKHA 3VGSA 4OYOA 4Q7AA 4DR3J 4HCBA 1VQON 2YKNA 3EZOA 1DGKN 3T5HA 1X3NA 1JB0C 2MJUA 2FLOA 2MKSA 3PIPL 5AZIA 5KFVA 3CCVS 5IS2A 4ELUA 4A46A 4QWAA 4B3TJ 1U1LA 4B17A 1VLYA 5F3ZA 4JI7F 4LRBA 4WP8A 3NS5A 2JLEA 3C2PA 2VWBA 4B3RK 2DB1A 1HNXJ 5F3TA 4KO0A 3NY0A 1QVGR 3DDNA 3CJQA 2DISA 3EM1A 4G1QB 4A5BA 1JLAA 4C8MA 2IMWP 4YB6A 2ZJQQ 4DV5J 2HHHJ 3TUIC 2LA4A 2VWKA 3QGHA 3HK2A 1PSDA 2QTWA 1HBOA 2ZOMA 1VBZA 4LRAA 1FXXA 4ELVA 4HEA9 1IQTA 1VQ7S 2AYMA 2PMZD 4J90A 3HKWA 1OKJA 5FDLA 2E1ZA 4BRFA 3UCGA 2Q1NA 1VQMN 5KGXA 3VALA 4KREA 2C22A 4LVOP 2W2NP 4JI6F 3TTCA 4WBFA 2JFKA 4IG0B 3M30B 3THPA 3GIIA 4BRKA 2HSEB 3QO9A 4CHOA 3EVOA 3HZEA 2AP6A 2CZ9A 3C16B 3MAAB 2RF2B 2UUCJ 4Z7CA 4J9MA 5EWFA 1V9OA 2JC0A 5ETPA 4JV5K 3GCXP 2XHBA 1NK6A 4USTA 3N0VA 1E4GT 3CJ1A 3VGKA 3S7RA 1YX2A 3WQPA 3IM9A 5C0YA 4Q45A 1URRA 3O1BA 1KVKA 5LSOA 1QS4A 2AQ4A 3ZSQA 2KDOA 2UVVA 2YWEA 3ZZUA 2ITMA 5F41A 2ZE2B 4Z94A 3BZCA 4DR6F 3Q23A 3R8YA 1XQIA 1OYEA 2MKKA 4V19S 2CJXB 1A5XA 5SZTA 4USHA 1JQGA 1RT1B 2E2NA 4HWIA 1FJGK 4FLYA 3AHPA 2EK1A 4E8UA 3T5LA 3EGZA 2P2CB 1Q86O 2DCUB 2NZCA 4PABA 1WBBA 3C46A 4O3NA 2KJWA 3IBWA 4V1Ak 1VHIA 1JCGA 2RS2A 3HLUA 4EMDA 4PKHA 3TSPA 2AA4A 3SCXA 5A0YA 2M3DA 1KFSA 2XZDB 4IZ9A 5EUHA 2DNKA 4E7JA 1YJ9S 1QY7A 3OL7A 4PPZA 3R6GB 3MCMA 4CLSA 1WLJA 2VFTA 1NEEA 2QA2A 1HARA 3UWTA 3CD0A 3I56N 4BS2A 1GLFO 1LK5A 4CZFA 1Q5YA 5FLXO 1S9EB 2HHXA 5G4DA 2N3LA 2HW3A 3L8BA 4FLXA 4M5MA 2ZJQL 3OTOK 1TELA 4DTMA 4A8MP 4DSLA 4GW6A 3ZSRA 3O8MA 4GC7A 1VQ9N 1GLDG 4PWUA 1N36J 2PSZA 3BM7A 3W3DA 1NJIT 1GLLO 3M6UA 1HNVA 5FPEA 4M5IA 4H5TA 3VQAA 3SMZA 4BE0A 2A6AA 5DLFA 2BUNA 2FHMA 5K8MA 4ES2A 3LTOA 1UETA 2O5DA 3MEKA 2ZUGA 4RKUC 3U1LA 3HM9A 1NDPA 4AM6A 2QGFB 3CGIA 1N33J 4WFAQ 3V4IB 3PW0A 2IJRA 5HP1B 3PW4A 4KGVB 3THTA 4CZKA 3UVJB 4RBTA 3R1LA 4EO6A 4RZRA 4ISFA 2XCAA 4ZPAA 1HR0J 4CP5A 4RUBA 5LMUK 3V9ZA 4BR7A 3W7BA 3K7RA 4U95A 2H1YA 1U1OA 4N77A 1NKBA 4H0YB 3VVTA 5E41A 3NKYA 5L39A 4DPTA 3NWGA 4IYQA 3MM8A 4MKAA 5HROA 4RBUA 4ZPWR 4EWTA 2L08A 4IEIA 2HBRB 4RW9B 4NLCA 3SDEB 4P74A 2RRBA 4BDYA 4PRFA 3GR1A 3W9IA 2I5JB 4CVNE 5AJ3F 3NMUA 2QFIA 4O4GB 3VQ7A 1I1GA 1UVLA 3HSTB 1XI1A 1S72S 4RW4B 1U09A 2YX7A 3R9PA 2DGVA 3RR7A 2QRRA 2P9EA 3SBTA 3KK3A 2R2UA 5KFKA 4ZTFA 4FK2A 3JS9A 3ETMA 1FD8A 3NNCA 2IDLA 5DQHA 4YOXA 2RUSA 1TK0A 4DL0C 1OJ4A 2MXYA 1BIUA 3HFZB 3LZJA 2XCPA 3P83D 3QT7A 4JD2A 2V34A 2LCWA 3SJJA 4ES1A 3TAEA 4V19X 1E3MA 4PKDB 2QLFB 1H6KX 3EL2A 3M2UA 4H4KA 4AL6A 4OHZA 3IWLA 4KAZA 2B6AB 1CBKA 3O5TB 3B78A 2VQEK 3BR8A 7AT1B 1RDBA 4U67Q 4KI4A 3UNYA 2OCEA 3GYXB 1FFSB 1A9NB 2YHYA 2APOA 1XMQF 5J2MB 4F0HA 4BQLA 3MEGA 2HWHA 1IKXB 2ATQA 3IFRA 4TY8B 1NKCA 1BCMA 1UMJA 1RACB 1KAXA 5DDOC 4MFBA 3TOQA 2X1GA 3NBPA 1LXNA 2O8DA 1RHQB 3KJVB 4GV9A 4K8XA 1K8KB 4C0BA 3C95A 2EBEA 3VQ6A 5F0XA 4U7BA 4CZCA 4ZOSA 5AQOA 3EUNA 4IKFA 1VLOA 4NLYA 3QESA 4XPCA 3H4DA 4V19J 2R2RA 4QPTA 2B8QA 2ZKUA 1GLAG 3A0IX 4DUZK 3DNCA 4OX9J 3AA5X 3CCUN 2GA7A 4PWDA 1ZA2B 3NP5A 2W2MP 3CJ3A 4Y00A 4ECSA 3AFGA 1KOOA 1YDLA 1GLEG 3RSEB 1N0UA 2BQRA 3M6WA 4FWSA 3DHXA 1WSJA 2XMMA 2VDIA 3NFAA 1OH7A 3GJTB 2ZH7A 1T3OA 4QS7A 3AVHA 1BCOA 3B54A 4WFBQ 3KD5E 2YX6A 1A0OB 1WOOA 2NUUG 2ZM6J 3H46O 4J9PA 2YNIA 5B0CA 1WSIA 1QVFM 4M5DA 1LFWA 4OX7A 1O0PA 3GYNA 3EVMA 3O3HA 2PI5A 2EPIA 4LSZB 2RDDA 2V0NA 3D3BJ 2OI2A 4IO1A 2C2OB 5D4NA 2CQHA 4LF9K 3VQDA 3JSMB 4ZP8A 2X3GA 3C6AA 4X4OA 2R7SA 4B1WB 2ZD1B 3Q8SB 1FRIA 4LC9B 4DU1A 3VAHA 3TTDA 2F8TA 1IBMK 3VERA 4RR5A 4HL9A 5C2CA 2UU9K 1FEHA 2Q66A 2ZH8A 3D68A 3L09A 5E0OA 2YPZA 2YVSA 2VA2A 1TAUA 3K5MA 4JI0F 2VASA 3KLHA 2DHXA 1IBKK 4ZPVR 4PPDA 4CFBA 2BKOA 3G71S 3R97A 4DSKA 4ECWA 2JNJA 4I4BA 4OLAA 1IKVA 4LF4K 2EFVA 2YWHA 4Q0BB 3RRGA 2IA6A 1PAEX 3EE8A 4PYAA 4G65A 4CH0S 2W9CB 1BQMB 4PEOA 4X66K 1V3RA 2Q97A 3KLGB 3CE8A 3OJUA 3IMXA 5MLCQ 3OFGA 3G8QA 1FXRA 1TKZB 5BYSA 4AQYF 3EY1A 3KYLA 3ZZ0A 1QM9A 4WZQA 1D9DA 4L6V3 3G8SA 4PG7A 1BQNA 2QJ3A 4H4OB 3ZSXA 3FCVA 1GXLA 2F8EX 3MXHP 1IM4A 2MGZA 4K4YA 4PY5A 2PA8D 5IC4B 5C2GA 5H9EJ 1XNRF 4I6WA 3RW6A 3MN5A 5AXMA 1HNZK 4DV1J 1MWYA 1H2UX 4Q2MA 4FJHA 2E88A 1NHUA 2VBXA 1JKHB 3EN9A 1N32K 4M41A 4NLVA 4E0DA 2EXUA 2BABA 3O2IA 1IBCB 3T69A 2EG1A 1IG9A 4BRLA 2Z2YB 2QWRA 9RUBA 4WFBL 4CLYA 1DTQA 2HHVA 3L2RA 3D1HA 4CEFA 2DY9A 4FJGA 3QIPB 6FDRA 1FT8A 3WXJA 4FWKA 4U7UD 2V4JB 3B6OA 1K1SA 4JYAK 2N7YA 3C19A 3VPZA 2DPNA 2DNPA 3LDQA 2CZ4A 1O5JA 2PMWA 1RBLA 4KHRA 4YOTA 1WI6A 2VFSA 3V2UC 4CO4A 4NYOA 1KLNA 4DTOA 2JC1A 4A5AA 3KHRA 2MYFA 2U2FA 4OYIA 3ICLA 2I2YA 3TYTA 3FQKA 1X8DA 1JLQB 4Q43A 1PO6A 3AVBA 1RAGB 1HPZA 1U49A 1GMWA 2EKNA 4BDZA 4HUGA 3SBGA 3ET6A 1UWBB 1WD6A 2ASMA 3GSDA 1RBVA 3CCWA 4JI7K 5SWMA 4B8CA 1X4DA 1JLGB 1LEOA 2QM1A 2RKIA 2P1JA 1U4BA 2R7WA 1RGVA 2VD3A 1NGDA 2Z2MA 4RW6B 2OPRB 4MT1A 2KN4A 4QU7A 4K4VA 3CCES 4GVBA 4DFMA 4OYPA 2FSNA 1I94J 1MSWD 2ZHAA 2QXLA 3CCZA 2H3GX 4F25A 1RDCA 3NRBA 4NXMF 3E9LA 2C2NA 1RXOB 4W90B 4LFCF 4KH6A 1JL1A 4FYVB 5DK5A 4EBEA 2P9CA 1UOCA 1D1UA 3CCJN 3IGNA 1Z26A 2WVFA 5JXSA 3I4HX 4DU4A 3DRXA 4OYBA 3KLIA 5KT6A 3MUMP 3I8BA 2CPJA 3B4DA 3IO1A 4JI6K 1VSEA 1KBRA 1MA9B 2NRXA 4RW7A 1J2VA 4CLUA 4DUYJ 1VQ4N 1RWNB 4ELTA 1UVJA 1WDTA 4B9MA 1NLKL 4E1MA 4KJIA 1OY6A 3WT0A 4BRCA 2W6LA 2ATCB 1QAIA 4B3MK 3OYNA 4MO4A 3DOLB 2GWKA 2P9UB 1VSHA 3VTHA 2WVDA 4NPOA 5KFPA 1MU2B 4KGMA 1WTBA 2GUIA 2QMUB 1KC8T 4NI2B 3TSUA 3PJXA 2G0JA 1W7WA 2J6TA 1WG4A 2DIUA 1T03B 3F0NA 1XN9A 1H72C 3AY0A 4H0XB 1VQYA 3QMLA 2HQ3A 3ONQA 2DXFA 1FRHA 1YJNN 2OPQA 5L1IA 4XIUA 1IUJA 1XERA 3BN4A 4FLZA 1RDDA 3GTYX 1SQKA 3WQTA 1ZM3A 5F1XA 1JCFA 3VAJA 2DO4A 4W5NA 4D3GA 1RAOA 4YOVA 5D3GA 1S4FA 2D9OA 5FJ4A 1WC4A 3AO3A 1KQSR 2ZH5A 1QZ5A 4QIFA 1B9DA 5KFGA 2XULA 4J7CA 3QJPA 2YPYA 1HHSA 3JQMA 3AT1B 2YWGA 3ISND 3H3NO 1VQOS 2XY5A 1KD1T 4AHTA 1XQSC 3T5KA 1T95A 3QYYA 3OYIA 3JSRA 3G6EN 5KFLA 5LJVA 2IFXA 2ZJPQ 1TVRA 2VOPA 3J8AA 2EC0A 4A8XA 3OV7A 3CJ7A 2YBVA 2CYYA 2B4JA 2UUBJ 2CGLA 2QXFA 1EETA 5HMXA 4DU3A 1TUUA 1XHZA 1IKYB 3LP2A 4FCYA 3HVWA 2UP1A 1O6XA 2QLXA 2VJUA 5ETOA 3B82A 1DTTB 4BDPA 4NXNJ 4PXDA 2IM3A 3NS6A 4ISGA 2F9JA 2DNNA 4CO3A 4HVJA 3U9DA 4J9VA 4ZVEA 2VFUA 5EWGA 3CIMA 5BPMA 1HNWF 3SXLA 2A18A 3TP2A 1XR7A 3MTKA 1U1NA 2DH7A 4L3QA 4CBWA 2WB4A 2I7PA 1R6VA 3SNNA 1VQMS 1VYAA 2AJ4A 3P38A 1YG0A 4UQTA 5CHIA 1C0TA 1F60B 3W60A 1EQ0A 1QSLA 4UOCA 3ZETB 2W6KA 4LF7J 3KG1A 2HHPA 4A59A 3HF5A 3JTNA 3ZFVA 4QYZJ 2JOQA 2CDRB 3OYJA 4FLTA 2IRXA 1LXJA 3Q22A 5GAEI 4ZPDA 3FZ2A 4OYWA 2BOPA 3E2EA 2R7RA 2D0PA 3K5OA 4FXVA 1C0GA 2DO0A 3MDQA 3CC2N 1DLOA 2YHXA 2ALZA 1TL3A 3FBEA 1CLFA 2BR0A 3ID6A 1JLEB 1XMOF 3LA0A 3BBCA 3HPOA 1S22A 1X1PA 3DXKA 1F21A 2PBDA 2PYJA 4J9RA 5CYQB 3POTA 4DS5A 2HOEA 2EC2A 4PKIA 4X64K 2FXUA 5JJBA 1QSSA 3BY5A 2LQ8A 2HEKA 2X1BA 2MEWA 4NCGB 3QZ7A 2YKPA 2BE9B 2Y0BB 3NGRA 3BBFA 1S1UA 5C7PA 4Y2KA 1SV5A 1PYSB 1LW2A 3SYZA 1SH3A 1HQEB 3AAPA 2HS3A 1PG5B 1HBMB 2OH2A 2V51B 1JK9B 3QICA 4KBOA 4M3TA 3HHDA 4MO5A 2QWLA 3UKUA 2O8BB 2KZMA 4RTFD 3RB0A 1NGJA 3CM6A 2ROGA 4CM0A 1HBUB 3NGKA 1ZBHA 4DV7J 2ZBIA 3O3GA 3QGIA 1TL7A 2ZJPL 3D3CJ 4ZHRA 2HF3A 1YIJS 3P1GA 2F9WA 1XNQJ 4IO9Q 4UOFA 2YV0X 2WVEA 3I56S 1FRXA 5KFXA 3H7HB 2FVCA 3K58A 3VEXA 4MKVA 2Z57B 4EFHA 3NOGA 1Y11A 5A2QO 4BC7A 2QTDA 4CNYA 2IYGA 2D3OR 1XMQK 4JV0A 2KKZA 1VC6A 2HBZB 1N48A 1T9WA 3G0ZA 1VQ9S 4B8AB 3MR3A 2BKPA 2IGIA 3RAQA 1NZ8A 2YKNB 3DGPB 1L3KA 2DFHA 4DR7J 3HM8A 4GKKF 4DL6A 2AEFA 1RTZA 1SL1A 1Z05A 2UUAF 5AZIB 2CQBA 3DLKA 2HIYA 2G8FA 3O9UA 4O0IA 3UCZP 4KTQA 4BRHA 3OYMA 2A0FB 3AVKA 3HT0A 5IQQA 3GWCA 4E98A 4LFBF 4DV6F 5L46A 2G1HA 3RUBL 1LQ9A 3ITHA 5E7OB 3QT5A 4LR9A 5GADU 3AVJA 4KO0B 2L9DA 3CDEA 1UA1A 1JLAB 3IWXA 3OFFA 5KOWA 4DR4J 2YQ3A 1B0TA 2YNFA 3SCIE 3N9UC 3WC0A 1PJ5A 2GNKA 4WTYA 3IBCB 2H51B 3EWGA 4UUWA 4BG9A 3E66A 3NEKA 4JI8J 4N7TA 2XS5A 5B8HA 1D8YA 1PBAA 2MSSA 1S6UA 3V6DA 3D28A 1WSVA 1WHVA 4FJNA 4I9QA 2MHNA 1VQPN 2HQGA 2VICA 2YKQA 3NG8A 3SUQA 4AD6A 4FZXC 1WEXA 2JLGA 5CXTA 2E2QA 2QLBB 4RUHA 3MCOA 3FK4A 2CZVC 3AAQA 4CJWA 5HSPA 2ATLA 3O4WA 1YZ7A 2QL9B 3VAFA 3O4QA 5C24A 1RWMB 1BU6O 2UXBJ 1KFDA 3OVBA 1B0PA 3SCJE 2CPDA 2R7TA 3FGUA 1S6PA 1UPPA 1X5OA 2OSQA 2OFHX 4HTUA 3ZTPA 2XWYA 1ZPWX 5IFMA 5AQXA 3OYKA 2N4DA 2DR8A 1VS3A 2HNZA 1WC5A 2VPXB 2GUPA 1HI8A 1YVFA 3MDFA 3EPGA 1XWLA 3FE1A 2V8GA 3DLGB 3OT9A 1RYRA 4IR9A 2I8EA 4IO9L 1KNZA 3I82A 3UO0A 2MKYA 2L3MA 1T05A 4RNOA 3P45B 4LF5J 1Q79A 3IA0A 5KFWA 2ZJRQ 3MN6A 2JWLA 4KV8A 2C3YA 1WSEA 4NZ7A 4FBTA 1WKJA 4X65J 1JL2A 4WYWA 3CCTA 2FLLA 2A40A 3W61A 2V7YA 4I67A 3O3LA 1D5AA 3ZCMA 4JN4A 3VQ9A 3HTVA 5A0YB 4MDBA 2E9RX 4OPHA 4AQYK 1NGAA 4DV4F 3NLCA 2J7KA 2JH3A 5KFQA 2XNQA 2WW4A 1OY9A 3W65A 2XY8A 1M5OC 1M1KO 3OHAA 3MMCB 1EWQA 2GJFA 1KVAA 4O0JA 4ID5A 1ZBLA 2XHCA 4O3OA 3IAS9 4ZLNA 3BQ1A 4M5NA 4CJ4A 3CETA 1RNHA 3AA3A 2HHQA 3FBFA 4BG8A 4F3OA 1UFLA 4BRMA 4A62A 4IH7A 5A8RA 4KKOB 4GKJF 4IG3A 3GR0A 1HNVB 3M8RA 2NCKL 4PUOA 4B3RJ 1TKDA 3CFOA 4E7LA 3A13A 1HJRA 4JKHA 1NSQA 5JLFA 2F63A 1CVJA 4DWIA 4LQ9A 1ZTWA 1TUYA 3H4BA 2G1DA 3IKMA 3CCUS 1S0MA 3NNHA 3SK3A 4ZN1A 4QIVA 3ZX0A 1IJEB 1UVIA 4OI3A 2D0BA 4WQ4A 4WCEL 1S6QA 4X4UA 3T1HF 5LXRA 3BJYA 2IIHA 3G9CA 2KH9A 4KB7A 4MLEA 3N6NA 3R1XA 2HQIA 4CO5A 1NZAA 3NWRA 5HRPA 2EHGA 1AUDA 1KWMA 3WHIA 1NGEA 3MM8B 3LW5C 1UW4A 2J9DE 5HROB 2JEIA 3RG6A 4O55A 3ZX2A 4X4TA 4OI4A 5HK4A 2MY8A 2L48A 1B92A 2BJ3A 1WBDA 2ZJRL 5K9FA 4JV5J 4PXEA 4Y65A 2FF6A 1RADB 2W01A 2LDIA 3ETOA 4CLLA 2OMLA 1SKRA 2CFXA 2E29A 1KVIA 4ED7A 4LF1A 3A8JA 2QG9B 5FPMA 3HFVA 3DWLA 2G8VA 1RWPB 4DXLA 3DLEA 3OTDA 2LQBA 3HHEA 3J80Y 4IRCA 4P71A 4LJMA 2M7SA 3KK3B 3GPAA 3GILA 3S3MA 2GELA 5HVGA 4WKRA 3RYLA 4IUFA 4DV0F 1LNQA 3PEJA 4GO5X 4NXMK 3H40A 2VG5A 2GIQA 1Q0NA 1ROFA 1S99A 1TAQA 1TL5A 4I2PA 4JD2B 3P96A 3BF4A 3FZFA 2YKOA 3QPIA 1S1XA 2XO6A 4JS5A 2YXLA 1BXNA 4GRSA 1FW6A 3M2UB 3B6BA 2RN2A 5AFUH 4PZVA 1UEVA 4RX6A 5KPZA 2QMWA 1N5TA 2PAVA 1VFJA 2E4LA 3MXMA 5I4MA 4ZJLA 4YOYA 1N34F 1S0OA 2HSTA 3GG1A 1U04A 3KXDA 3C15A 2FC0A 1VSFA 1UKUA 3MOJB 1WNEA 1APSA 3ZZTA 4C8YA 3OTOJ 1EP4A 1LK7A 1U24A 3H42A 4F8RA 3TWZA 4MFBB 3ZT3A 3I5CA 2EX3A 1GTEA 2J9CA 2O8DB 4IEEA 1U0HA 2FD2A 1S48A 5KFJA 1FJ7A 2FHKA 3NAIA 3MMBA 3CNQP 3FBCA 1VBXA 3DU5A 1Q8KA 3MOZA 4YOWA 1BGXT 4GVLA 3VCDA 1NJYA 5L1KA 2HVIA 4P2XA 1BMQB 3PUFA 4RL1A 3MZIA 1GMWD 2EFGA 3NGYA 2IM2A 2EEYA 3HDSA 4OZJA 2QFJA 1R89A 1M5KC 3ILLA 3BEGB 3UD3P 4PWDB 3C14A 3EMTA 1V3SA 3R3LA 1X9WA 3TVKA 3IRXA 3CJ2A 2QZ8A 3VQSA 2GVZA 5TKWA 2Y9HA 2W9AA 4TVAB 3HT3A 2YQ1A 1C0UA 2FTRA 5U47A 1B7FA 1OQ3A 1EX8A 3QAEA 1AT1B 2XMKA 3HL8A 2YNIB 4A61A 1TK5A 3KD1E 2RNEA 3D1OA 5L1JA 3SMSA 4NZ6A 4M5DB 1NHKL 3U1MA 1BE4A 5FD1A 4ZLLA 2G8IA 2GJIA 3W8GA 3M8PA 2F4FA 1FI4A 2LXFA 3M2RB 3NGZA 2ZH1A 1C2PA 3THVA 4QIWD 4J5OA 1CZBA 2HBYB 3CJSA 2ZH3A 3RGIA 1TUWA 5KRTA 3AO2A 5F8GA 1S1WA 1U02A 2XYGB 3T9NA 2DY1A 2DVIA 2HHHF 4HHUA 2JLFA 1N4LA 4ZP7A 1HNWK 1CJTA 2QKBA 4OJHA 3GG4A 1EJ7L 3KLHB 1AW0A 2HBKA 3CCJS 2NRWA 5F8LA 2Y3YA 3NH0A 3PJWA 4M63A 3F9MA 4UF4A 1IKVB 4HUFA 2ZOGA 2XM3A 3RB3A 2ILYA 4LH4A 5KFDA 3K5LA 3CC7N 3Q8UA 1U2FA 3FRZA 1VQ4S 5J1EA 1RJJA 3DDKA 2IM1A 4CZIA 4CD1A 2BM0A 3ZNUA 2MQOA 2P9IB 2JRSA 2V2KA 3A5OC 4BRPA 2K2PA 2FJBB 2X1AA 2VQEJ 4DSFA 5C15A 3MMAA 1YI2N 3DI6B 1J5EF 1XMOK 4FJKA 1WN7A 2C3MA 5GAEU 1UEKA 3I55S 3RMBA 1BQNB 3TW0A 3UIQA 4YB7A 1S77D 2MGZB 4ED4A 3BGRA 1GMVA 2DEJA 2CAJA 4DTNA 4ZVSB 5JVHQ 4EHTA 1O8BA 2D0CA 2UYTA 4F7VA 4BR0A 4CQ1A 4HCCA 3HHLA 3DLHA 3JAMO 5FPNA 1YJNS 2V69A 1M5HA 4HUEA 4K59A 1JXEA 4DPUA 2NXEA 3UI3A 2C2RA 3CEDA 1WF2A 3AVMA 3WBZA 1RA6A 3GFHA 3D2FA 3R2CJ 2NXJA 3CIZA 2DXDA 5J1NA 4DPWA 1DTQB 3PX6A 1R27B 2F8HA 3CJ9A 5J2NA 2V50A 1NM1A 3KK7A 3LAMA 4YN3B 1Z25A 3EE3A 4DUZJ 2XS7A 1J27A 2W2OP 2PD1A 3V1QA 4XO0A 2MJNA 2ZM6K 2JHEA 2WBRA 4DJBA 4AHUA 5EX3A 4DSEA 3GBTA 4RG8A 1T94A 3CF5Q 4QR1A 5EX0A 4ISEA 3O5BA 4EK2A 4ECVA 3DHWC 3A3PB 3G6ES 1FVSA 2QK9A 1RT3B 2BYCA 4FYWB 1NLVA 4Y0WA 4IJNA 2LLZA 4OJ1A 2XWXA 2P5VA 1W97L 3OW2R 4A48A 3SZ2A 4GKKK 2FJEB 4J2BA 2PE8A 2SXLA 3IP0A 4YHHF 1N36F 2LVWA 2J9DA 3SUNA 1HPZB 2V7ZA 4FJIA 2W4PA 2PDAA 1Y3KA 3QEXA 4MH8A 5L1LA 4LF9J 3BF3A 2XBPA 1P1LA 1QHAA 4DV6K 1D8ZA 3HO1A 4FNIA 1SJFA 2J0WA 2RKIB 1XK8A 3UN5A 1IBMJ 4O3SA 3PLAA 2V9KA 3N4WA 3K5NA 2UU9J 3LO3A 5LT5A 2FPHX 4X4QA 5D6GA 1XHXA 1HBNA 4GVBB 1KHWA 3HSGA 4PCQA 5KFAA 1IBKJ 1V5VA 3D7EO 3GE1A 2KLAA 3VZIA 2J7UA 2HZCA 4LF4J 4C4WA 1PC5A 1U2VA 3V5RA 5C42A 4DEZA 4DSJA 1QHTA 3J81O 3OR1A 3LDNA 2VWJA 3GIKA 4X66J 2VB6A 2WSFC 1DHMA 1YJ9N 3M3ZA 4B1UB 3CC2S 3FZLA 5JVHL 2LDYA 1NXIA 4WFZA 1NSKL 5KI6A 4MK9A 1NB2A 1B70B 2ASDA 4RW7B 1UVMA 2Y8WA 1J9AA 2CNNB 2F7TA 4LBIA 5AQRA 4ZVHA 1QVFR 4R0EA 1DZ5A 1RT7A 2MTLA 3KFWX 4YDXA 1ZS6A 3FC9A 1OO0B 4DV1K 4RPFA 2IJFA 1NU0A 2CVIA 2E66A 5CYMA 1X9SA 3AB4B 4K25A 3TQ1A 4JOUA 1QQOA 2WHOA 5B0GA 4EUVA 3MGJA 5H9FK 3NF7A 3Q8YA 3ZSOA 1HNZJ 5IXUA 3NH2A 2HAIA 4DX5A 1M1HA 5KFTA 3BH7B 2VOOA 1P90A 3CQXA 1K9MO 1WKLA 4CW7B 3EDRB 4DPXA 1BA0A 4LFAJ 3KLFA 4IFYA 1N32J 1VSJA 3CF5L 5J2PA 4C7QA 4LMZA 4JRPA 1Q82T 4BRNA 4JKBA 2PN6A 3QRRA 3PIOQ 2OPQB 5BXIA 4QR0A 1FRLA 5G0RA 3VEOA 5DM6Q 3HVAA 4DCHA 2OUGA 3M8YA 4QYRA 1VISA 3P31A 3U6FA 5CA5A 2N82B 4B9VA 5D3GB 1ZM4A 2AEMA 2H54B 3NGTA 3R5AA 5KT5A 5HMZA 2QYGA 4WJBA 3A5MC 4JYAJ 3GDQA 2R8HA 1S79A 4O8UA 3WUHA 3PXGa 3BSNA 4DV4K 5DETA 1K44A 2J8SA 4DR2F 4JK8A 1WAFA 4CF9A 1HKAA 5KG2A 4NCAA 1URNA 1IR1A 2D5RA 2VPZB 4NA2A 4FO0A 5B09A 3ADAC 4DUTA 4ID8A 2DRDA 4BR9A 4UT4A 1F6TA 2XB2D 3GCWP 2W9BA 5HVFA 1B4SA 3JSBA 3SV4A 3OYCA 2HAFA 3PNIA 3QLHA 3TRGA 3UN3A 1TP7A 1OVYA 3L2WA 1N5YA 1TVRB 3CJKA 2HZAA 3GP9A 4ILMA 4RUCA 1YBTA 1MWQA 2YKAA 2GVDA 3BZKA 5DDPC 1UJ6A 1EETB 2ZDPA 3M8SA 1K0TA 4CI0B 4GKJK 4OZ5A 2W7AA 3TAPA 1HHTP 4JI7J 1ASUA 2O8FB 4ED2A 3G6VA 4FLUA 2F4VF 2DHGA 3W5XA 5BR8F 5AFUA 1KEKA 1NJXA 1LWCB 1Y4ZB 4Y34A 1QLNA 4USIA 2QMXA 5KPTA 4I9LA 4TN2A 4OYMA 2HBJA 3M8QA 4IKAA 3KWMA 4I6AA 3TAGA 5ETRA 4B02A 5IC6B 4U8VA 3MEEA 5BYQA 1AUSL 2MZRA 2GMLA 2I0XA 2V9WA 4BVOA 1VQPS 3RB6A 1C0TB 3EKUA 2CXEA 2O66A 4PXCA 3LDSA 3T1HK 3PW5A 4L72B 2XMJA 4CH7A 4DZDA 1HHQA 4USJC 3AO1A 3NVKA 2J0SD 3Q2TC 2HVDA 3HVRA 4EZ6A 3GV8B 4CJEA 4E1NA 4JI6J 3VAMA 5KTQA 3IRWP 2AJ1A 1N54B 3WQUA 2KYZA 4CE9A 3OVSA 1AFIA 1RBTA 5ADXA 4PR6A 4HHJA 1FKPB 2V68A 3KNGA 2VG6A 4JHDA 4H4MA 1QUPA 2WONA 1QUVA 4B3MJ 2MLXA 4CO1A 4ECYA 4FYXB 3DXKB 3HFKA 3J81j 3SQ1A 4ED5A 1XR5A 3POTB 2WBNA 3PIOL 2MB0B 2R7YA 1H3DA 1HLWA 4RJVA 5DM6L 1BA1A 4KH1B 5ETMA 2MQLA 3DC2A 1MW7A 1VRQC 4DL4A 1WC3A 3TANA 3VQBA 1OH8A 1B99A 4FNHA 5K8PA 2EWSA 5BYRA 5FLXY 1CEZA 4QPXA 3PKMA 1LW2B 3BB5A 3CJ5A 1T11A 4MK7A 5FPDA 2DH8A 4QW8A 2FZGB 1M0SA 2E5IA 5M2RA 4DV0K 2OP5A 2QWMA 3QMQA 2P9LA 2DEIA 1M5SA 2ZC4A 4OZNA 1JXLA 3MCPA 2VQFF 4QOZB 1D4XA 3VGUA 3VN5A 2P5GA 5DGAA 4OZ0A 3MFIA 4G3IA 2HMPA 2V4QA 3AVFA 4NYNA 1TL7B 1VRUA 4ZHRB 2BJ7A 4F4KA 2YI1A 1E6VA 2BJEA 4FJ8A 1ASWA 4IR1A 2YWKA 4NRTA 5M1FA 2BE2A 3PW7A 8ATCB 3T5JA 2DR7A 2OPSA 4KE5A 1LWFA 1TK8A 1ESVA 2BANA 1N34K 4OL8A 2XG8A 2CH6A 2IAJB 1TUGB 3CD5A 4B1YB 2O01C 2VC1A 3SUPA 3VA0A 4KHNA 2IC3B 2CQ1A 1E6YA 1U1RA 1HYZA 3AB2B 3QFHA 2X78A 2VGNA 3DCAA 3AH6A 3MMVA 1R8AA 4NLSA 5GVQA 3H25A 4G9ZA 4CHZA 4GMKA 3TX0A 1V4TA 3DLKB 4RWTA 1IG8A 1UAXA 4OLPA 3AXKA 1WSRA 1R8PA 3ZNJ1 1JLFA 3RZAA 3WIUA 2FJVA 2O8CA 1NDCA 3M6VA 4NLWA 4OI0A 1UCNA 4M1KA 4DQQA 3ITHB 2WAQD 2K06A 4DMNA 2AGPA 4KHYA 1JJHA 1CXUA 1IV0A 2UXCF 1EQYA 3NMAA 1QVGM 5KPRA 5I42A 2FJXA 1S76D 1RDWX 4KR0B 2I6WA 5CCLA 2GIFA 1YTAA 3BEXA 4BR5A 1VQ6N 3Q8QB 1WG1A 5GIOA 4ZITA 4CLWA 4ECTA 1YQHA 4ZVQB 5EXWA 3AJ1A 2FBTA 4ECRA 1PIEA 3V6DB 4W5TA 5CD4A 1S10A 4CH1A 4FLWA 4FM2A 1QSYA 2YJFA 4CRJA 4DTJA 3LL3A 1X0PA 3IG1A 3OD2A 2FVSA 4ETXA 2WSEC 4B9NA 4B1ZA 3N5FA 3AOBA 2BJDA 2FVRA 4NLPA 2ZHOA 1H2TZ 4FXWA 1FX4A 5C24B 2VUGA 3MF5A 4ZN3A 2KVIA 2AIRB 3IMQJ 4XEIA 1S6PB 1Y97A 4X64J 1YJRA 4KT0C 3H5SA 4M45A 4Q5VA 1A7GE 1T3VA 4LY7A 1NNDA 4U6PA 2JL9A 3VQQA 3AQOA 3J80U 3TAFA 4O44B 4B9SA 4AM7A 2HHSA 4CEBA 2V8DA 4DFPA 4LSLA 2AD9A 2VONA 3JB9k 2XI3A 2GMJA 4ANDA 1RTJA 1SJ1A 1OS5A 3A5LC 5KG7A 2B43A 3L2VA 1T05B 3CB4A 5BR9A 2GC8A 1JLBA 4DMZA 3T6JA 3FSYA 4DQIA 4UOGA 1EARA 4DL5A 2ZFHA 2D74B 3MX2A 1VQ8N 4KV8B 3NCRA 3MFHA 2AU0A 5DRKA 2AGQA 2E9TA 2PYLA 1EHWA 4NX9A 3TUPA 4MJKA 4KAIA 2MY7A 4F0KA 4PAAA 2H5JB 3CVKA 5KFNA 1N56A 4W5QA 1SI9A 2NYIA 4WPAA 1SQGA 4DR7K 2H48B 4QWBA 4C48A 4QIEA 2LYVA 5KRSA 2WSCC 3H59A 1XMQJ 4CWBA 1LKZA 4L73A 2B4OA 2JEJA 2VL1A 1R7IA 1CQNA 4KH4A 5D4OA 3S9HA 1G7CB 5DGBA 3AODA 2CJBA 4TXSA 2HLUA 3LPTA 2DNMA 3E01B 3BGFA 1LAVA 1YRUA 2E5LF 2ZOFA 4ETZA 1PKUA 3NGIA 2FUG9 4Y2CA 5C12A 3SI6A 2GMHA 2QEXN 2AZ1A 3M05A 3GB0A 1Y7PA 5LMNK 4AYBD 5A8RB 1HA1A 1ZAXA 4URSA 2IDEA 4H03B 2VV5A 4DU8A 3P4UB 3CCEN 1RILA 4WIQA 4BREA 4PUOB 3WX8A 3LPEA 1FF2A 4WFYA 3L6QA 1EIYB 4EFAC 1G1XA 4NLQA 4FYDA 5F8MA 2MZQA 3KNAA 3AGKA 3AO4A 3W2VA 2EKYA 4BLGA 1RYSA 3R5DA 3R9LA 1OY8A 2CKWA 3SEOA 2J0XA 1FXLA 1FWKA 2HBLA 3V81A 2RH3A 4ZPBA 5C5JA 2GAGC 2UXBK 4CF8A 4AXIA 3NH1A 1K8AO 4KHWA 3ATVA 1V5IB 2DNGA 4EI2A 5AR0A 4JI5K 3SQGA 4IRDA 3EO3A 2HK2A 5J2QA 4NLTA 1X4HA 3L4BC 3TUZC 5HRRA 1T6CA 2E6LA 4JKAA 1RBOB 4EBDA 1Q5VA 1S12A 1JLCA 2YNGA 2UZAA 4BROA 3HHNB 1SC4B 4YHHK 2ZBCA 2NNWA 4NMXA 2EFQA 4XDDA 3QERA 2V8HA 2FHJA 1NGFA 2K8GA 3L7OA 2J5AA 4FK4A 2IRUA 2NRVA 3O9RA 4KRWA 4FW2A 3KKSA 4WYBA 1SQEA 3X1LB 3DLEB 1KQGB 1VGYA 4X4NA 2QA4N 3L9ZA 1C6VA 4JI0J 1R8BA 2Z2ZA 4DPYA 1T6DA 2FY1A 3GMGA 1U25A 1BO5O 3CC7S 2YX4A 4JI4F 3P4IA 2NUBA 4K42A 2PY5A 2WUSA 4J2EA 2B4UA 1FWLA 3RMCA 1BLUA 1WOPA 3DFEA 3HHLD 4FBUA 1GMUA 2XC9A 4M3XA 4I2PB 3GJSB 3OYDA 1SC3B 1GXTA 1UVKA 3ASMA 2OMOA 3THXA 5KG3A 1TMJA 3D6HB 2AZ3A 1QZ6A 3CJAA 4L75A 1RT4A 2VKRA 2AJFE 1X5PA 3MCAB 3OPKA 1YI2S 4ILHA 2V63A 4FF1A 4USUA 4HTJA 4O3RA 2N4CA 4RNHA 4AQYJ 4M5KA 2GO9A 3OBYA 3Q24A 1D0EA 2AW0A 1FXDA 3MM5A 1FNMA 2FLPA 3C15B 4EP5A 5CZVA 4CTAB 1S6OA 3G2XA 2DR5A 3FEZA 1EP4B 3HMJG 4NLRA 4ZIVA 5D15A 2COLA 2CPIA 2ZE2A 1U0HB 4FM0A 3S8SA 5BN8A 1IXKA 3LP0A 1YBUA 3PEHA 2VFVA 1X4AA 1GNKA 1TKXA 4LF6K 3MMBB 3J7YP 1RT1A 1HMVA 3QZ8A 4J9SA 8AT1B 4JP8A 3CPWM 2B0GA 4L3NA 4FPBA 1BL3A 4OLOA 4MDAA 2ADBA 3MPYA 4DV7F 2HFZA 5GMDA 2R8GA 5LSRA 2LXUA 1T9TA 7FDRA 3MR2A 1D3WA 1XNQF 3WNGA 1EO1A 3C14B 4K2JA 4FOEA 4CEOA 4DX6A 5F8IA 2A2DA 5K20B 3HZ6A 1GH8A 3IRXB 4DR2K 1LW0A 4M3YA 2GVZB 4FWMA 5J1PA 4DL7A 3WXIA 1VHFA 4F2RA 4LIWA 2IVNA 3JTOA 1C0UB 3BREA 4CJLA 4XDCA 5CY4A 5T7LB 2FLNA 5HQ8A 1PILA 4PG6A 3UR3C 1WUAA 3QIOA 1EX4A 4ZVOB 2X6SA 4UY8O 4CZMA 1SQFA 2A10A 3FMWA 1RI7A 2POKA 4DCPB 3KWGA 3SMPA 3KUEA 1VQLS 4F4ZA 3BQ0A 1Y5IB 3K2PA 1H73A 3G6XA 1FRKA 3H2VE 1V4SA 3K0SA 3M8PB 5KG0A 2RSQA 4USVA 3ZT2A 2C2EA 3OTEA 1N8RT 4BQZA 2M70A 1MLAA 3CUNA 5I3PA 5CE3A 2ASOA 3UCUP 3TR8A 2F4VK 4K4XA 2HNDA 5M1OA 5BR8K 2CDQA 4BC2A 5AT1B 4FXDA 2CQIA 3ZO7A 3TVZA 5I3UB 6FD1A 1TL1B 3DU6A 1S1WB 3RTVA 3J7ZO 5JS1A 4OKEA 1K73O 2AHOB 2EWHA 3A8YA 4C3KA 1CJTB 1NK9A 5D4LA 4NXMJ 1XBWA 4DV2F 1SBRA 4CK2A 4M95A 2P9NA 3NCPA 4LFCJ 2G8UA 2Z1GA 3WDOA 1AXQA 3T1YF 1YIJN 4YDUC 4URQU 3MWTA 5C25A 3C6TA 2XMWA 4B9TA 1RWWB 3SBMA 3HI0A 5J1EB 3D0PA 3HOTA 3F41A 3QFPA 4OI6A 1YUWA 3QT8A 4DF4A 4IJAA 2DTJA 3MR5A 2OLWA 4O0NA 2W4CA 3D6MB 2HBMA 3KIOA 4NA1A 1OWXA 1GAOA 3MMAB 4BY9C 2O8EA 3SDEA 4C8NA 3DYAB 4CECA 3OFHA 4CJUA 1ZOTA 1NHVA 3D67A 1T02A 2C2ZB 1VC5A 3LDPA 3N28A 2I7NA 3R5BA 3BGRB 1NGGA 3E9OA 4RW4A 4B9LA 4OFZA 2B7BB 2VODA 2LEAA 1BUPA 4XAKA 2GJ2A 4F67A 1CULA 2OZMA 3UDVA 5AQTA 2BM1A 1OH5A 3HHLB 5AQVA 3H2UB 4Z37A 2XHWA 3LQVA 5A8KB 4YR0A 1M90O 3OYLA 3U1NA 2GX8A 2PZSA 1HX1A 1KTVA 3H90A 2BE7D 3D2FB 4FPRA 4JI3F 2VQFK 2W2PP 1S0VA 1RHKB 2KT5A 2AWZA 3MECB 4ZP9A 2YNHA 4BC3A 4CLKA 3P5BP 5HL7Q 4X65F 5J2NB 4ERDA 3DM2A 1KOHA 3FDSA 4DLGA 2P9KA 2UXDF 3CQYA 4AL7A 2D3ZA 1OVQA 3GONA 1MMNA 2V2VA 2W7PA 3T7ZA 2FY8A 1QAXA 4B3SF 3JS6A 5KFFA 5AQGA 4CJVA 2CJAA 1C0MA 3I9V9 2C3OA 3F5TA 3OYHA 3IDHA 1QQCA 1MROA 1H0HB 4Y0FA 3MEDA 1CC8A 2Y1LB 1FDAA 1FWPA 2E5GA 3OYEA 4ZVRB 1RAEB 2GZOA 4F36A 4Y2MA 3QRQA 4MYUA 2HWIA 3GZ7A 1Q16B 3CSKA 3CCMN 3WXLA 1UTAA 2CUYA 1QQNA 1Q9YA 4K7QA 1LWEA 4WZMA 3VF6A 2YQ0A 2E1PA 2RHSB 3KJVA 3V1OA 5AQKA 2G0CA 4ED0A 1RT6A 3A1YG 3HP6A 4R25A 5BRHA 4YFUA 2P9PA 4DR1F 2A2CA 3MR7A 2ZGYA 4OZ3A 2R8IA 3QETA 5GAGU 2QO3A 2UXCK 3NGUA 2E5HA 2VJVA 4NYFA 4FVCA 1HBNB 1Q81O 1HNWJ 1RTDA 1U1PA 4M3UA 4JNEA 3T19A 2OIHA 4JLHA 3HPGA 3OS1A 2DGXA 1H1VA 2ZZMA 2GV9A 2VG7A 4ZCIA 2C28A 2FDNA 1U2VB 4TSXA 1OSCA 3FFIB 5HLFB 3CWJA 3OR1B 4ED3A 3OSPA 5HMWA 3OVNA 2XY7A 2KKHA 5KFOA 1UPMB 2FBYA 1GLBG 5AQSA 4RWXA 4ZVGA 2IVMA 4H5VA 3FZHA 4TYAA 1CZAN 1N5QA 4CK3A 4FP9A 2YX1A 1W9HA 4RNMA 2VDHA 3SIPB 3QGGA 4CLFA 1UAWA 2D0OA 1A6LA 3C6HA 1XMOJ 4WFAL 4LF8K 4OV6A 1JNZB 5GADI 4R8UB 2BQUA 4WQ4C 3CCSN 4KHUA 4ZK7M 3IM8A 1S59A 3ENBA 2NQPA 4TU8A 4JV5F 2VPWB 4AHCA 4M5GA 4W4MA 3LDOA 5CYMB 1U47A 1O51A 2HHTA 2C42A 4CHPA 3M1VA 4WU2A 1UWAA 3FCWA 3ZX3A 1RBUA 3DOKA 5A2QY 2HRYA 2IVFB 2OEKA 1Q7YO 2WOMA 5FLXU 3LM9A 1WNSA 4DFJA 3KOAA 4RBVA 1RCHA 1SKSA 2HFUA 4WYLA 4B3OB 4C23A 1HPMA 3OS2A 2B9YA 1U0SA 1SL0A 1ZBUA 3KLFB 4IFYB 1RDRA 2XYPB 4RLEA 3K9KA 1RZMA 4QOTA 4A2AA 1Q86T 5KFRA 5J2PB 1FJGF 2IOCA 1DJ0A 3NF8A 1WSHA 3WNFA 4FJ5A 1SAZA 4KQZA 2FBXA 1C1BA 1I3AA 4C6AA 3PACA 1K73T 2DD8S 5G0RB 2W9CA 1BQMA 4KSEB 1YTUA 2ASLA 2G9OA 4Z4EA 2IDOA 2WK4A 3G86A 2W8KA 1OIAA 2XMAA 5H1SV 4ENOA 3S41A 1GOCA 1S57A 1W2BM 3US5A 2HGMA 1BHNA 1DQ9A 3THYB 2D41A 5E26A 3TJAA 4X4RA 1GK8A 4H4OA 3PY8A 1ZM9A 3HHKA 2NR0A 2IVPA 1L3VA 4DV3F 1X9JA 2G4BA 2G13A 1SC1B 2OTLN 4FJ7A 1HWIA 3D66A 4GC6A 2XZTB 1R43A 4MIBA 2W9BB 2JEFA 4RU9A 1GXUA 1P6TA 3QNWB 2J7WA 5KFZA 4ICLA 4J2DA 2F3JA 3QLHB 3VQEA 4GKKJ 2ZVSA 1N5YB 3OVAA 2E5LK 3PSFA 1DKGD 3CJKB 3MPDA 2UUAJ 2GVDB 1SZ2A 1HKGA 1ZA1B 1I6JA 3FFKB 4A8OA 1NNEA 2HGLA 2CWKA 1ZETA 3AV9A 4U67L 4LFBJ 4DV6J 5CZ1A 1U2CA 1BISA 4IFEA 2NZ4A 3DXMA 4WFNQ 3PRVA 4F2SA 3W66A 5KFCA 1VSIA 1VQ6S 4CIOA 3HXMA 3TI0A 2OD6A 4LREA 2W41A 3H6EA 1UJ5A 3VF4A 3M8QB 3SAHA 4YY3F 4U8YA 1BQXA 2FB0A 3H2LA 3MEEB 2BX6A 4ZKAA 1GOBA 4DTXA 2CPYA 1GX6A 3RVCA 2J6SA 4QJVA 5HRSA 2AF6A 2ZNYA 2FJAB 4I64A 4FF4A 4DTRA 4RNFA 1SPBP 3ZSZA 3SQ4A 3MXIA 5LMUF 3E8OA 3L7PA 3OYFA 2JDJA 3M5RA 3E3XA 5LSLA 4ZTJA 3BDEA 4OJGA 2QX0A 2Q31A 1N6QA 4KHPF 3WNEA 1O1WA 2M9KA 3SI8A 2W2QP 5ETNA 4ED6A 3R1HA 2V2ZA 3L0QA 2VG6B 3DRRB 4JHDB 5EU7A 3ZEUB 2WONB 2VU5A 2VPYB 2Z4PA 2D0AA 2LSNA 4U9RA 3PRBA 4F3QA 5KFBA 4LFAK 4EBCA 2DYAA 4NOHA 2ZH2A 4WP3A 1JLGA 5GAHU 2LMIA 2HURA 1QE1A 3AA8A 5H9FJ 4A57A 2KW4A 1PC4A 4EEYA 1NDKA 1YSJA 3D9BA 1J6ZA 1I3OB 4HTIA 5KG6A 4RCHA 6AT1B 4NYZA 3MM9A 3QFWA 3MUVP 3PYEA 3H08A 4DR5F 1RT5A 4ZCKA 3MWPA 4F4WA 1TUVA 4LUBA 4WP9A 1VQ8S 3VEVA 1VSLA 1HQUB 1G4CA 4JI4K 4HDGA 3QEIA 2B3TB 2GTDA 3ENAA 3BN7A 1U48A 2YWFA 3VF0B 4NLOA 3D2WA 4NO7A 1KS2A 2DHSA 2QA4G 3RBEA 5F9NA 3QATA 1SJ4P 3PYDA 3L3VA 2M5YA 2WZ1A 2ZBQA 1VRUB 3B8AX 3MHYA 1KVCA 3CDWA 1E6VB 4DV4J 2B9EA 3M4XA 2UVUA 5C2DA 2BE2B 3S3NA 2OPSB 3Q86A 2JVOA 1LWFB 3DOLA 5EOYA 3H45C 2NSCA 3MD1A 4M63C 5AE2A 1NKEA 1YJVA 4BRGA 3EDQB 2C3UA 4TQRA 4NI2A 1VI7A 4OLBA 2QEXS 4HKQA 1K0VA 3HJVA 2HKEA 5HQLA 4ECUA 3BF1A 4B1XB 3CDBA 4CJRA 2J0QD 4CIFA 3AVNA 4GKJJ 4USKA