5I3UA

Structure of hiv-1 reverse transcriptase n-site complex; catalytic incorporation of aztmp to a dna aptamer in crystal
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
550
structure length
550
Chain Sequence
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 SUBUNIT
publication title Conformational States of HIV-1 Reverse Transcriptase for Nucleotide Incorporation vs Pyrophosphorolysis-Binding of Foscarnet.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase/dna
total genus 148
structure length 550
sequence length 550
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5i3uA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i3uA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5i3uA05
4CGHA 2XY8A 4ZPAA 4CK3A 1DTQB 3V6JA 4B08A 1NJZA 4E1NA 1HNVA 2FC0A 3RMBA 2YKMB 4KKOB 4KBIA 4EBDA 2B43A 3KLVA 3C6UA 3KD1E 4OKJA 3PX6A 4ECRA 1YVUA 4IH5A 2IOCA 4CF9A 2BGGA 4PA1A 1TL1A 3RBDA 2WCXA 2ASLA 3ZT2A 4CEBA 5KFSA 3OL7A 3O4NA 1L3VA 3KJVA 3OYEA 1IKXB 4MQ3A 4FLWA 4WZMA 4FK4A 4ECTA 3G6YA 2WONA 2AGOA 4CJ3A 2ITGA 2QE5A 4BE2A 2W9BB 3CJ5A 3H5XA 4DTJA 4FYDA 1ASUA 2XGPA 2B5JA 2YNIB 1QS4A 2J6TA 1JKHB 2RF2B 1NJYA 4IRKA 4I2PA 4QW9A 3TWHA 2JGUA 4ECWA 4FZZA 3H5YA 3EY1A 4NLSA 5HROB 3F73A 3MEDA 4CHYA 1RDDA 1QSSA 4N76A 3NBPA 3ICLA 1S1VB 2B4JA 4DTUA 4URGA 4CF1A 3H40A 1T05B 2HHUA 4F8RA 3MECA 3OYHA 4DLGA 4CGGA 1UWBA 4O3NA 4AILC 3T19A 4O5BA 1RDAA 4IH7A 4RNNA 4LSNA 3V81A 4IR9A 5KG3A 4JRPA 1S9EA 3LP1B 4W5OA 1SUQB 1JLCA 4MKBA 2ASJA 2O4IA 4CJQA 4RW9A 2XCAA 3BJYA 4ELVA 4J9SA 1NOZA 3ZSVA 4CF2A 4EO6A 2XY5A 3KKSA 2C2DA 4J9PA 3OHAA 4ECYA 3SI6A 4IKAA 2WK4A 1S97A 1S6PA 3PJXA 3OJSA 3DYAB 1TKZA 1RT4A 1HQEA 5HRPA 1YT3A 2Y1JA 1RT5B 1QSLA 1TKTA 3EZUA 4RNMA 4RNFA 4CJVA 5C24B 4PUOB 1W25A 3KKRA 1RBTA 3KMSA 3DLHA 1RTDB 4RW6A 4B9MA 1BQMB 3HHKA 5F8NA 3OLBA 2C28A 3ZSZA 1SKSA 2W8KA 2HAIA 1EETA 5KT4A 2IM3A 3OYJA 2V4QA 3CVKA 4CIGA 2VG5A 3IGVA 1XHXA 1QUVA 5JXSA 4ED1A 2AX1A 3LZIA 3OYGA 2GV9A 2NUBA 2E9TA 5CZ2A 2W8LA 3IRXA 2HWIA 5HP1B 5DG9A 3TAPA 2V9WA 3ZT3A 3FDSA 2F96A 3ZT4A 3H2LA 1QE1A 3PO4A 3GV8B 2UVUA 4Z4CA 3OS2A 3K2PA 1S1XA 1RA7A 1HYSB 3ZSOA 2ZE2B 4X2BA 5DLFA 1LAWA 3KK3B 1F21A 3HVWA 1JLGA 3BSNA 2VA2A 2FVSA 4E7KA 4DMNA 1ASWA 2FBXA 4NLGA 3TAMB 1VSIA 1DTTA 1RT1A 3RR7A 1MU2B 4KTWA 3NAHA 2XRIA 3DLKA 4NYZA 1S0NA 2XY7A 4O4GA 3MTKA 3K5LA 2HHWA 2JEFA 4OJRA 3BQ1A 1ZBFA 3QEIA 3V9UA 2YHAA 1FKOB 3JSMA 3ZSWA 1ZYQA 1S1UB 5KFLA 3HPGA 4OKKA 5L1JA 4RU9A 4KSEB 1GOAA 1Z26A 4Q8EA 4ID5B 4GW6A 3OHBA 1HPZA 4CGJA 5EWFA 1RT3A 2BR0A 1HJRA 1KCFA 1MMLA 2W9CA 4CHQA 3NF6A 4J9OA 3QO9B 2G8UA 3RMDA 5L9XA 1U47A 4I9QA 4NCBA 5FDLA 4Z4EA 4ECSA 2I5JB 1WSIA 3L2VA 4JUZA 3TAEA 3MEEA 4M94A 5KGWA 3P83D 2BQ3A 1KHWA 1TL3A 3T5HA 4DQRA 4CHNA 1X9SA 4RUAA 4E89A 2ATQA 3V4IB 3LP0B 2PY5A 4J9MA 4NLQA 1I3AA 3CFRA 1R0AB 4R5PB 1NJXA 4CGIA 3A2FA 1TK8A 3CFOA 4KTQA 3VQ4A 2R8GA 4Y2AA 4ED6A 2BRLA 2VG7B 4R8UA 2JEIA 3AO5A 2JC1A 3TAGA 1X9WA 3DLGB 4OGEA 3OS1A 3LPTA 2QKBA 2E4LA 2R8JA 4ECXA 2AGQA 5KG1A 4ICLB 3AO4A 1W0HA 4AHUA 4O3RA 3NKYA 2FJXA 2HNZB 4KB1A 1C0MA 4O44A 1VRTA 5KG2A 1XWLA 5J1EB 4QWBA 4ECQA 3UDLA 3ZT1A 4Q43A 3KLHB 3IG1A 2O4GA 1VSJA 3SQ4A 5L1KA 4Q0BB 4I7FA 4KPYA 3VA0A 3LALA 2ZD1B 4TYBA 4WXOA 4CJKA 1EX4A 2XWYA 2HMIB 4HKQA 4N5SA 1ZBIA 3PHEA 3QESA 4GC6A 1ZETA 4LH5A 2X6SA 4FJ5A 3KK1B 1T3NA 4CESA 5KFQA 2HNDB 4H4MA 2IC3B 4CJ4A 3SQ1A 2GIRA 4FW2A 2P5GA 3DOLA 3CM5A 3QEWA 2E6MA 4NLYA 1RILA 4K4YA 4M3RA 3L8BA 2W42A 1U4BA 2YHBA 4TQRA 4I2QB 4H4OB 3KLGA 4KRFA 5E41A 2G8KA 2OPPB 3WNEA 5DQHA 3ITHB 4DTMA 4MK9A 4F50A 1BIZA 3BGRB 1Q8IA 2JLEA 3NGYA 4YQWA 4CFCA 4CF0A 3PY8A 3QLHB 1Z25A 3D28A 1C0UA 4DL4A 4DSKA 4K4WA 3ALYA 1OS5A 3DLBA 3H59A 2DFEA 4K4XA 3S3OA 5KFRA 3OYAA 3C94A 5CY4A 4O4RA 3AO1A 3T5LA 1CLQA 3QIPA 3SV4A 1VRUB 3HVTB 1TGOA 3CO9A 3T1AA 2IS3A 5J2MB 1N56A 3ZSQA 2ETJA 3H4DA 1KLMB 1RT2A 1HQUA 1D5AA 4CJEA 3Q8QB 5C42A 1VSMA 1IKYB 3K57A 2YNGA 1L3UA 5I42B 1JLAA 1XR7A 4BDZA 2IDOA 3G10A 4FLZA 3M9OB 1D9DA 4KO0A 2YKMA 5F8GA 4NLDA 3PR5B 4MKAA 5JUMA 1JLQB 1LWCA 2VWKA 2B6AB 3NCIA 1B9DA 3EPGA 4URQU 4WFYA 1S49A 4KAIA 2X78A 3HM9A 4CEEA 1KFSA 1TKXA 1U49A 1IKXA 2AWZA 2XO7A 3LANA 2G8WA 1Z4UA 5KFMA 1S5JA 4NYFA 3I0RB 1IKVB 2W9BA 1LWEB 4DL3A 3CWJA 3MXMA 4IG0A 4FS1A 2RKIB 2WHOA 1C0TB 2OPQA 2GBZA 3QETA 1HNIB 5KFUA 3S9HA 4BE1A 1IH7A 4CERA 3OL9A 1T7PA 4G1QA 1EP4A 1RTIA 4RUCA 3H5SA 2YKNA 4O3PA 2OZMA 3I5CA 1ZBUA 1VSFA 5J2NA 3KLIA 3DMJB 1RT6B 1JLEB 3V1OA 3KHHA 2BDPA 1TV6B 3DI6B 3N6LA 1T05A 4EO8A 4OVLA 4NCAA 4LY7A 4O3OA 4FVMA 3E51A 4KE5A 2VWJA 1XR5A 4Y1DA 5KFOA 1JLBA 5K14B 4DQQA 3HSTB 1NJWA 2YNFA 4RW7A 3V6DB 1S9GB 3LPUA 2XI3A 4EBEA 3DRPA 1A5XA 3PX4A 4GVMA 5KFCA 3VQQA 1LW0B 1RYRA 1NKBA 1SUQA 3TANA 2FVPA 4DL6A 4YNQA 3TAQA 3H98A 3DDKA 4Y2CA 1N6QB 1QQCA 3D0PA 3SUPA 4WXWA 2V4RA 2RDJA 1LWFA 4FJNA 2O5DA 5DG7A 4KFBB 5JS2A 3F9KA 1QSYA 4FM1A 3M8QA 1XHZA 4RNHA 4DL7A 2A1RA 3KLFB 5C24A 4PUOA 3BSAA 2QKKA 4OLBA 1TVRB 4OLAA 3OL8A 3RTVA 1HYZA 4ZP6A 5CYMA 1JLFB 4QAGA 4ECZA 1C1CA 4MIAA 3ZT0A 4TXSA 2VA3A 1U48A 3B6OA 4WE1B 4MK7A 3OYLA 2ASDA 3RR8A 4PY5A 3PVXA 3MR5A 4HHTA 1KSPA 2FVQA 2R7YA 3U6FA 1DLOB 1S0OA 1RYSA 4FJIA 4F2RA 2F8TA 5HRNA 1TAUA 3V9ZA 3Q8SB 4DFKA 1Y97A 1EKEA 1X1PA 5HLFB 2Z1HA 4F4ZA 4JS5A 4Q5VA 3VQCA 3K5NA 4TY8B 2W7OA 4URSA 4F4WA 2JEJA 3GIMA 5I3UB 2BQRA 2AQ4A 3KHLA 4ZPDA 5FRNA 4DL5A 2E9ZA 5C25A 3PR4A 3V9XA 3FQLA 4C8MA 3DOKB 2IM0A 5KFIA 1G15A 5DG8A 4YR0A 1HRHA 1LW2A 3EPIA 2PYJA 2R8KA 2OYQA 4DFPA 1S1WB 3TAMA 3KIOA 4Z4FA 3GILA 4XIUA 2FLNA 1MU2A 3DRRB 2RPIA 3KLEB 3AVBA 4DSFA 5KFAA 1T8EA 4QOZB 4KHYA 3K5MA 4M3ZA 3MFIA 5KFDA 1IO2A 3N6NA 1FKOA 5SZTA 4B8AB 2VG6B 4JV2A 3HVAA 4NLUA 1D9FA 4QWDA 3AVKA 1I6JA 5DGBA 1RDCA 5KG6A 3BQ0A 3E01B 3FFIA 1S1UA 4K4UA 5J2PB 4QWEA 4ID5A 2HWHA 4EP5A 3NL0A 4DSIA 1S48A 1BI4B 4FJXA 3SNNA 2E9RX 3O4QA 4DU3A 4DFMA 1SL1A 4DG1B 1RBSA 3L2RA 4CEAA 1HNVB 4HYKA 3OYKA 4FM2A 1RBUA 1RDBA 4ZP7A 3SYZA 3QZ8A 4DSEA 4FBTA 2YV0X 3PX0A 2PZSA 3UPFA 4FS2A 3C6UB 5CYQA 4YFUA 3I0SA 2DTUA 3SFUA 4F4KA 2XHBA 4NRUA 1K6YA 2GUIA 4TSXA 1TL1B 3RRHA 3IS9B 3LP0A 4FLTA 2IAJA 4J9NA 3KJVB 1LV5A 4N41A 4CJFA 3PW0A 4J2EA 2WONB 1R0AA 2Q3SA 3D5MA 5F9LA 3U3GA 1WSJA 3VQ5A 2VG7A 2B5JB 5FROA 4IR1A 2W7PA 3DLRA 4FJHA 4DFJA 3KD5E 4I2PB 1T03A 3QEPA 4DSJA 2EC0A 2D7SA 4ICLA 4EP4A 3SPYA 1RA6A 4Y1CA 4FJJA 1YTAA 2YNHB 3LP2A 1S6QA 3Q8RB 4XPCA 1S4FA 3PUFA 1NK9A 2ZKUA 3S3NA 4DU1A 2AU0A 4PQUA 3V9SA 1RTJB 4HCCA 2BQUA 2KFNA 4MFBA 3SQ2A 5CZ1A 4ID1A 4I9LA 4TLRA 3OL6A 5KFNA 1SKWA 3OYDA 1Q9YA 1U45A 2OZSA 3MR3A 3NAEA 3WNGA 4LSNB 1QAJA 5KI6A 3V81B 1TK5A 4ZVEA 5L1IA 3T3FA 3LZJA 5DK5A 4CEFA 1S9EB 2OPSB 3ISNC 1ASVA 2XCPA 1JLCB 2G8HA 4KV8A 3SFGA 2G8IA 3C6TA 2IC3A 4EBCA 5KRTA 3OYBA 2OPRB 4KHNA 2ILYA 1NHVA 1TAQA 3PZPA 3NGZA 1RNHA 3AO2A 4IOBA 1TKZB 1RT4B 4FCYA 4IFVA 4LD0A 3K5OA 3KK2B 1KVAA 4CEZA 5J2QA 1WAJA 4DQPA 4NLOA 1XR6A 1TKTB 1SH0A 2D3ZA 4DQIA 1QTMA 4RW6B 3QLHA 1REVA 1WNSA 4ED0A 1EETB 3QEXA 1WAFA 1N5YA 1RTHA 4DTSA 4J2AA 3HKWA 3CG7A 4HTUA 2VG5B 1SV5A 3CJ0A 4CJRA 1NK8A 5JS1A 3SJJA 4U7CA 4E1MA 4EZ9A 3VQBA 5J2MA 1NK0A 5EU7A 4YR2A 2FBYA 3SZ2A 4B3OB 3RAXA 3MXJA 2CJQA 3AO3A 3OYNA 2R2RA 4HUFA 1QE1B 3BR9A 2XY6A 4U6PA 2FBVA 5I42A 2R2UA 2XC9A 4RZRA 3BDPA 3K58A 3DM2B 1WSHA 3PW4A 1S1XB 4TQSA 4NRTA 1J5OB 4C8OA 1NKEA 4IDKB 3DLEB 4IFYA 3GV7B 1FXXA 4NCGB 3GYNA 3L2WA 5F8IA 1JLGB 4M3XA 4PWDB 5KT7A 1L5UA 1I39A 4N56A 3MXIA 2WTFA 3VQDA 4E7IA 1WSGA 1RT1B 4FJKA 3DLKB 4ZPBA 2D5RA 2ILZA 4MK8A 3GIKA 3G6VA 3CQ8A 3AVFA 2BRKA 4ZTFA 2KQ2A 3AVIA 3I0RA 4F3OA 1IKVA 3NAIA 5KFZA 3AA5X 2BANB 2OH2A 4CCHA 4FM0A 5HBMA 4B9UA 3QYYA 1ITGA 4YMEA 2R8HA 4QPXA 1HPZB 1WN7A 1WNEA 1RT3B 3QGHA 4W5RA 4TY9A 2W9CB 4KB7A 1RT6A 4Z4IA 3DI6A 1BQNA 3PJWA 5F8MA 3KNAA 3LWLA 4KI6A 2HVHA 1K1SA 5KFTA 2FJWA 2UVWA 3NGIA 3MEEB 5K14A 4QWAA 3TR8A 2UVRA 3HYFA 4CJWA 2HHVA 4E3SA 3G0ZA 3LDSA 4C8LA 4Z4GA 3SUQA 1TL3B 5T14A 2HHSA 1YTUA 2PYLA 1A5WA 4QWCA 1FKPB 3OLAA 3C95A 3RMAA 5D3GA 3HO1A 3CJ2A 1GOBA 4RW4B 2ATLA 4CF8A 3TVKA 1JIHA 4Q45A 4R0EA 4LSLB 2P51A 3JYTB 4CJTA 4IG3A 1DTQA 4DTNA 1BGXT 1RBVA 1RT7B 4KFBA 4YR3A 1BL3A 4N47A 4KKOA 3AVAA 3MEGB 4YP3A 3NDKA 3KLFA 2A1SA 1ZBLA 1KTQA 4DLEA 1W9HA 4ZTJA 1KFDA 2HNYB 3M8PB 3QERA 4J2DA 1VRTB 5KFVA 3CDUA 1X9MA 1JLFA 5DMRA 5KFYA 5KFGA 3EYZA 4LQ9A 4KHRA 1QAIA 3BREA 3OYFA 4WE1A 4I7FB 1TKDA 3QEVA 1QHTA 5EWEA 2YNIA 1XC9A 1JKHA 2RF2A 3QZ7A 2KFZA 4ECVA 4FLUA 5HLFA 2GC8A 4CIFA 3QIOA 4ED3A 4KTZA 4Z4HA 5HROA 3CJ4A 4H4MB 5I3UA 4FJMA 3QGGA 3RBEA 1J54A 1S1VA 3DOLB 3H5UA 4O55A 4CJPA 5C5JA 2E6LA 2HHQA 3OJUA 1NK7A 4K4SA 1S1TB 4IQXA 3RRGA 4B8CA 4TN2A 4JLHA 1HMVB 1S1WA 4ZHRB 3NH2A 2G8FA 1C0UB 4RW8B 2R2TA 3DRRA 4B9LA 4W5TA 3LP1A 2IJNA 1UA0A 3L3UA 2D0BA 5HRRA 2VG6A 5KFJA 3QIPB 4JV0A 1C6VA 3VA3A 4OGCA 4CGFA 3DYAA 4E19A 1ZTTA 1RT2B 1HQUB 2JEGA 4O3QA 1RT5A 1BI4A 3O3GA 4FZYA 1KHVA 3QNNA 1HYVA 1FK9B 4Y3CA 4C8KA 3LAKA 1RTDA 1BQMA 1VK0A 1BISA 4DG1A 1BIUA 2C2RA 4LQ3A 4KO0B 4GC7A 3FSIA 3CDEA 1WSFA 3M8SA 1LWCB 4WFXA 2Z1IA 4M3YA 4M41A 5KRSA 4DS5A 2BE2B 2IJFA 1VSDA 3QGIA 2KTQA 2IM1A 2GIQA 4DQSA 2HHTA 3DRSB 3IS9A 2KW4A 2C22A 2UUWA 1U09A 4BACA 1TKXB 3OY9A 5HP1A 3BSCA 3EZ5A 4J9LA 1IM4A 1SL2A 3HP6A 3AVJA 2UUTA 3M9NB 3PW2A 4IG0B 4E7HA 2OPQB 1HYSA 1CZBA 1VSKA 1Q9XA 3AVGA 2ZE2A 3FQKA 1NK6A 1C1BB 1RCHA 3KK3A 4G1QB 1EXQA 4CEOA 1EP4B 1RTIB 2YKNB 4KHUA 4CIEA 4ZMMA 5KFKA 2YNHA 5J2NB 3KLIB 4G3IA 2WOMB 5KGXA 3H4BA 4OPJA 4KHSA 4AHRA 1C2PA 3PV8A 3OS0A 1UAXA 3UR0A 1B92A 3P5JA 1RTJA 4DTOA 4AHTA 4WZQA 1JLBB 4CEDA 2KZZA 3B6PA 4BWMA 2YNFB 4RW7B 2HW3A 4XO0A 3AVCA 2AX0A 4JS4A 5KTQA 3DRPB 3GIJA 3RAQA 4J2BA 3OSPA 3NMAA 4CHPA 1YVFA 1ZBHA 1GX6A 5KT6A 2OPSA 3I8DA 1CSJA 1IKWB 4FJGA 1RBRA 3SCXA 3HPHA 3L2UA 1S0MA 3NF9A 2EHGA 1GX5A 1BCMA 1KRPA 4BE0A 2D0CA 2OPRA 4WYLA 3QO9A 4FLXA 1LWFB 3O3HA 2I5JA 2P5OA 2J6UA 3LP3A 4ZP9A 3H08A 3WNHA 3KK2A 4K4ZA 3M8QB 1S10A 2RN2A 4FK0A 1JXLA 3VQ7A 5F8JA 5KT5A 2R2SA 3AVHA 4NLTA 4DL2A 3SV3A 1NKCA 4KHWA 3RB4A 4DF4A 4KHQA 4H8KA 3D45A 4Q8FA 4F2SA 2IA6A 3V4IA 5CYMB 5L1LA 1C1CB 4J9KA 4ECUA 1NK4A 4LH4A 3T5KA 5SWMA 4R5PA 1CXQA 4CJLA 3KMQA 5DQGA 2DPJA 2D41A 4DTRA 3TARA 2OA8A 4CJSA 2RDIA 3QINA 3DLGA 3ASMA 4O3SA 2QK9A 4B3OA 4ED8A 2J6SA 5KFEA 2IM2A 4M95A 3PW7A 2AJQA 4NZ0A 3AV9A 3MEDB 3WNFA 3NBPB 2HNZA 3DM2A 3NE6A 3T5JA 4K4TA 2Z1JA 4JV1A 5J1EA 5C25B 1J5OA 1LAVA 3TAFA 1CXUA 3VQAA 3MR6A 4IDKA 3MECB 2P1JA 3DLEA 4DU4A 4M3UA 3KLHA 4NCGA 2FLLA 4Q0BA 4PWDA 1UWBB 1LW2B 1HARA 3M9MB 2ZD1A 4CHOA 3I5AA 2IGIA 3NGDA 4K8ZA 4FLYA 1CZ9A 2HMIA 3NF8A 3NH0A 4F4XA 1J53A 5KFBA 3MR2A 4ELUA 1JXEA 1ZTWA 3Q8PB 4L8RB 3V1QA 2G8VA 4NLVA 4ELTA 4RW9B 3OVNA 3V1RA 3KK1A 3P1GA 2HNDA 3RB6A 2IBKA 2FVCA 3PW5A 5KT2A 2BANA 4ZVGA 5EDWA 2XGQA 2EX3A 4KI4A 3V6KA 4AHVA 4HUGA 3FFIB 1S9FA 4IKFA 1S6PB 4MIBA 5F9NA 3N6MA 1HQEB 4I2QA 4H4OA 3IN5A 2DY4A 2OPPA 3ITHA 3MF5A 4AHSA 5KG7A 2DFHA 1RAJA 3BGRA 3AVNA 2HB5A 3SQ0A 2F8EX 2FVRA 2WRMA 1D0EA 3ISND 3HVRA 4FZXC 3AA3A 4M3TA 3AVLA 3SUOA 3OYCA 5CYQB 3I0SB 4FK2A 2LSNA 5EWGA 4CEQA 3GIIA 1VRUA 3HVTA 3QIDA 5KFWA 5KG4A 5HRSA 1FKPA 3O3FA 3IRXB 2IAJB 4IH6A 1KLMA 4J9QA 3U3YA 1IKYA 4RW4A 4ZVHA 4Q44A 2DFFA 4LSLA 3JYTA 4F4YA 4NLWA 1NK5A 4OPKA 3ULDA 5DGAA 4CFAA 4W5QA 4ED7A 3UQSA 1RT7A 3TABA 1T03B 3V9WA 1JLQA 3CFPA 2B6AA 3NFAA 3MEGA 4W5NA 4FJLA 4FJ7A 3OSNA 1SH3A 4GMJB 3LP2B 1S6QB 3UIQA 4B9NA 3VQEA 2HNYA 3M8PA 1DTTB 2ZQBA 4F3TA 1WSEA 4AHCA 4CJUA 4BDYA 2QV6A 4NLXA 4B9VA 4QCLA 4PQUB 1XI1A 4O4GB 1RDRA 4Z0UA 4MFBB 3RB3A 4CFDA 4ED2A 1TP7A 3OYMA 3SI8A 4IBNA 3NHGA 4KHMA 3PO5A 1KVCA 1B9FA 3NH1A 4H54A 3VN5A 1LWEA 1N48A 3GQCA 3JSMB 4ZVFA 1SL0A 3VQ8A 3TQ1A 3AVMA 1UA1A 2RKIA 1C0TA 4FJ8A 1HNIA 4E7JA 2KZMA 1L3TA 2HVIA 5KFXA 4EYHB 4KV8B 3KHGA 4M3WA 2X74A 3C6TB 3HL8A 5F8HA 4K4VA 1J9AA 4CK2A 4DSLA 3DMJA 1JLEA 4FXDA 2FLPA 1TV6A 1T94A 3G6XA 3VQ6A 4EZ6A 5KFFA 5FDLB 3AA2A 4M42A 4IFVB 3RWUA 3LWMA 4UQGA 5FRMA 5J2QB 1BCOA 2UVVA 3SUNA 4EEYA 1S1TA 3SPZA 4OL8A 4BDPA 1HMVA 4MH8A 3V6DA 1S9GA 5KG5A 4OKEA 3BQ2A 2QXFA 4WYWA 4ZHRA 3CYMA 4IRCA 2ALZA 1REVB 1SKRA 4RW8A 2X6NA 4B9SA 2D3UA 2DPIA 4DWIA 1O1WA 1LW0A 4FW1A 4DS4A 2JC0A 3GV5B 4DTXA 4KAZA 3HK2A 1N5YB 2D0AA 1RTHB 3L2QA 5EUHA 1SV5B 1K1QA 3CDWA 1N6QA 4B9TA 1JXBA 4WFZA 1IG9A 4R8UB 4CECA 3HP9A 4J9RA 4BWJA 4HVJA 3CJ3A 4O0IA 3VQSA 4CHZA 3S3MA 4KREA 4O0JA 1GOCA 3LAMA 4CE9A 3NF7A 1SH2A 1BHLA 3VQ9A 2IMWP 4TYAA 1FK9A 4KB0A 1TVRA 4K50A 3RB0A 4O44B 4NLPA 3ZSRA 1NOYA 1U04A 4RG8A 4CFBA 5KFHA 4Y34A 4FJ9A 4IFYB 3MFHA 4FLVA 3IG1B 4E7LA 3CM6A 1TQLA 3M8RA 4RNOA 3QNOA 4NYNA 3HT3A 2BE2A 4AH9A 4EYIB 3ZSYA 4ZP8A 3RMCA 1DLOA 3G86A 3L3VA 1NNDA 5KG0A 1KVBA 3ZCMA 3DRSA 3IGNA 4DEZA 3KHRA 2WB4A 1NHUA 3CIZA 4TY8A 5DLGA 4C8NA 1JL1A 1TK0A 3HPOA 4HUEA 2V0NA 4DTPA 1JX4A 4QW8A 5HBMB 1A5VA 3MAQA 1C1BA 4CJ5A 1UOCA 4DF8A 3DOKA 3KLGB 5DQIA 4JRQA 1VSHA 1D1UA 4M45A 3HJFA 3TI0A 3BSOA 2WOMA 3VQPA 3KOAA 2R8IA 5F8LA 4CK1A 1D8YA 3IAYA 4K8XA 1BQNB 4XPEA 3I5BA 2W9AA 1KLNA 2I1RA 3KLEA 2XI2A 3KTQA 4CGDA 4IRDA 5KT3A 1VSLA 1C1AA 5T7BA 3OYIA 5KFPA 3ZSXA 4NLRA 3HXMA 1JL2A 3K59A 2FBTA 3E01A 2F8SA 3V6HA 3AA4A 2Y1IA 1L3SA 1N4LA 2CKWA 4HCBA 5J2PA 5D3GB 2HHXA 2AGPA 2C2EA 3THVA 4ZPCA 4FBUA 1IKWA 5C42B 3FRZA 2Z1GA 2FJVA 2YNGB 1JLAB 1WLJA 4IG3B 1VSEA 4E0DA
chains in the Genus database with same CATH superfamily
4QIFA 2G2YA 3F9MA 2RMLA 1YXQA 3F0NA 4E1NA 1HNVA 1K73O 4Y2IA 1SI9A 3FNNA 1R43A 2MMYA 2CJAA 5C2FA 4EBDA 3KLVA 4PG7A 3OXGA 3OVAA 3R2CJ 2C1EB 2ZDPA 3TZXA 4OKJA 1V3ZA 4CF9A 1J6ZA 2BGGA 5B7WA 1KNZA 2Y3YA 1L3VA 3AH6A 5DM7Q 5LSOA 4WZMA 3DRXA 2RRBA 2QE5A 2W9BB 3H90A 4HT5A 2B5JA 2YNIB 3VR1A 2MQMA 1HBUA 3HHLB 3J7Z5 3R6GB 3ZXWA 4ECWA 2FHJA 5A6PA 2MLXA 5HROB 1QSSA 4N76A 3R6MA 4FO0A 1YI2N 3NBPA 1ZH5A 1DQ9A 1RAOA 2AHOB 1IBMF 3UKUA 1YBAA 2ZBCA 3RYLA 2PEBA 3J7YU 4CGGA 3BH6B 3RUBL 4B3TF 3DOMB 4WKRA 3ID6A 4O3NA 5DDOC 5LM7E 1MMDA 4O5BA 3CJ9A 1JCEA 1RGVA 2UUAK 5KG3A 4C23A 2DY9A 1S9EA 1V5IB 2W4DA 3LP1B 2YKQA 2R7TA 4RKUC 3WHIA 5D0HA 4RW9A 4J37A 2FDNA 4JI0F 2AT1B 5A8RA 5M1NA 3W2VA 4EO6A 2EG2A 4OX9J 4ECYA 4YN3B 1HX1A 4DR1K 2F4VF 1WC3A 1YT3A 5HRPA 3CJ8A 2Y1JA 4DR7J 2B8QA 4CJVA 1WB9A 1B0PA 3VMFB 4H5TA 3R2DJ 4CBUA 4RW6A 1BQMB 1X4DA 1ZM4A 1N5SA 2C28A 4FYYB 3UKRB 1SKSA 1S6OA 1SZ2A 1EETA 2IM3A 2V4QA 3G82B 4X66K 1F2HA 2P9UA 2VG5A 4DUYJ 2DNKA 3IGVA 2O8BA 1XHXA 4C1NI 2N4DA 1S4EA 3D6HB 1VC6A 2K7KA 1VHFA 5DJBA 2R3VA 2IHR1 3ZT3A 3FKBA 5IT4A 5C10A 3ZT4A 3H2LA 1QE1A 4NB4A 2V7ZA 4LRBA 2DGTA 2E1ZA 3E9OA 4MAKA 1RA7A 2WUSA 2CFXA 1H1VA 4DV5K 4MMOA 4UUXA 3IAM9 1YIJN 1LAWA 1F21A 3BSNA 2BJ3A 3BGFA 4DMNA 2DGVA 1PC5A 2APOA 3TAMB 1RT1A 1QUPA 3RR7A 3R7NB 4NYZA 1S0NA 1X4HA 4O4GA 2NRWA 4Q2LA 1ZBFA 4NA1A 3QEIA 2YHAA 5GADI 2BJ1A 4EHUA 2HG4A 4KSEB 4N77A 1IV0A 5AJ3J 4BGBA 2K8GA 4JD2B 1UJ5A 4CZEA 4KC5A 1Y9OA 1HPZA 2CQ3A 1VQ4S 1HJRA 2XMMA 3LDNA 2W9CA 3NP5A 4KR0B 1F1BB 4OIXA 2LCWA 3BM7A 3RMDA 4OYXA 2Q79A 1FVSA 4LRFA 2PE8A 5IZHA 2IDLA 1QVFR 3MEEA 4M94A 4IFEA 4JV5F 3P83D 4A8KA 1KHWA 2EK1A 4JOUA 5HMYA 3D3CJ 4DQRA 4CDIA 4RJVA 3MK6A 4DUZK 2YWHA 4E89A 3BN4A 4KIAA 5A0YA 4DV0J 4JI1K 1R0AB 3M6UA 1FI4A 2CQPA 4Y2AA 4ED6A 1YJ9N 2CQBA 1X9WA 2ZHBA 1VQSA 4QS8A 3LPTA 3JXUA 2E4LA 1AUSL 1QZ5A 2PN6A 4ECXA 2AGQA 4QOTA 3GJRB 4ICLB 1BLUA 3AO4A 4AHUA 3VF4A 4CNZA 4O3RA 1AA1B 2FJXA 1C0MA 1RWOB 5GAHU 4O44A 3T6JA 1OYEA 4QWBA 4LF5K 1JJCB 4FWNA 3IG1A 2O4GA 5L1KA 1NJIT 4Q0BB 3LALA 2JFDA 4CJKA 4CLYA 1EX4A 3KWMA 2XWYA 4N8OA 2Q1LA 4CYUA 3QESA 2QYCA 1ZETA 2QTWA 4ZOSA 3DFEA 4LH5A 3M6VA 2CQ2A 2X6SA 3EE9A 1VAZA 3KK1B 4CESA 2HNDB 1P9YA 1IJFB 4FW2A 2GAHC 3L09A 2IRUA 3QEWA 4I69A 2JX2A 4K4YA 1X4AA 3KWGA 4N8NA 4LT6A 3P8BB 2X1FA 2OPPB 2Z2MA 3MMJA 5M1QA 1BIZA 3TUPA 3EN9A 2VHGA 2QIFA 1M1HA 4CO3A 5CAAA 3SCLE 2IRXA 3U27A 1Z25A 3SSRA 4DL4A 3A12A 5D78A 4BRNA 1UEUA 5F0UA 4DR7F 2DFEA 5JVGL 3I8BA 3MURP 3C94A 1Q81O 3GZ7A 2GQCA 1K44A 2VKZG 3NNAA 1RTZA 2CQIA 3HVTB 1TGOA 2KKHA 2V4JA 2YHXA 2HQ3A 3UVJA 2OAUA 1KLMB 1RT2A 1HQUA 1D5AA 3CJAA 1IKYB 4JKCA 4LBPA 1LXJA 2BE9B 2HBQB 4DUYF 1L3UA 2YNGA 4BC5A 3AAQA 2J9CA 3M32B 2C42A 1JLAA 1XR7A 4WFAQ 3DNCA 2VIHA 4BDZA 2NS1B 1UL3A 2LQ8A 3B6BA 4DBQA 1WEYA 4EAHD 1LWCA 2VWKA 1N36K 3NCIA 3MUMP 2QWNA 2I6WA 4PL8A 2C2MB 4WFYA 3LPYA 2X78A 1RAFB 2QLWA 3L9ZA 4I56A 1KVIA 2KXHA 3W5ZA 2MKIA 2LEPA 1B99A 4I6WA 1IKVB 3HX9A 5TKWA 2W9BA 4DL3A 3CWJA 4FS1A 5ETLA 3TTFA 2OPQA 3S9HA 1MNEA 4BE1A 4CERA 3OL9A 1WI8A 1Z6RA 3POTB 5EY4A 5LL6Z 3WIVA 3DXSX 4RUCA 4O3PA 1NMDA 2KG0A 1ZBUA 3GE9A 4C1NK 1JLEB 2BDPA 5C0YA 4EO8A 2BVZA 2YX7A 4FVMA 4O3OA 4KE5A 3UCGA 1ITPA 4UY85 2FD2A 1JLBA 5AJ3F 2X1AA 5GMKa 2VBWA 3OXLA 3LO3A 1S9GB 1M5PC 2D74B 3BEGB 5ETMA 2QWMA 2XWXA 3PX4A 5ETOA 4GVMA 1X4CA 2IVNA 3WQPA 3VQQA 1LW0B 4P2FA 3OUYA 1NKBA 4CZFA 2WBNA 9RUBA 3TANA 2YX6A 3H98A 2B4PA 3IR6B 4USIA 3CIMA 3CE8A 2VQFK 3QRRA 2MSTA 3SCIE 3FCVA 3VGVA 5HSPA 4OFZA 5DG7A 2VICA 1M5OC 1VOMA 4RR5A 4G65A 4DV0F 4RNHA 3S8SA 4DL7A 1P6TA 3R5BA 3KLFB 3BSAA 2J7UA 5LT5A 3QICA 1DZ5A 3RTVA 1HD0A 4IO9Q 4ZP6A 4F7VA 3UKRA 1YRTA 3BKUA 3TEGA 3EZWA 1C1CA 5HQMA 1WHXA 4TXSA 5M1KA 2VA3A 1HHQA 4NA3A 2ZH6A 4K25A 2LDYA 4WE1B 3G82A 1JNZB 1QVFM 4NE9C 1DLOB 1S0OA 1RYSA 4FJIA 2F8TA 2HYIB 3Q8SB 3LW5C 4F4ZA 1DAXA 2RE1A 4DPOA 3G25A 3HDSA 3VQCA 3K5NA 3A5LC 1BWFO 3CCLS 2W7OA 4F4WA 2JEJA 1DQAA 2BQRA 3PEHA 4ZPDA 5FRNA 9ATCB 2Q3PA 1ZAVA 4DL5A 1W2IA 2E9ZA 5C25A 2YJFA 2MY8A 3V9XA 1NDKA 3FQLA 4C8MA 4B1UB 5KFIA 1I94F 1KONA 1NH8A 2LA6A 2E1CA 1HRHA 3PJ9A 3QBWA 4KH4A 1A7GE 4EFAC 4QYZK 4DFPA 3TAMA 2K2PA 2PI5A 3KIOA 2NXNA 4EFHA 3KLEB 3AVBA 1ICEB 1OO0B 4QOZB 4ZPTR 4CO0A 3K5MA 1CBKA 4KHYA 4U67L 1VQOS 4LR8A 5KFDA 2KL8A 1D9FA 3HVAA 4NLUA 1UW4A 5DGBA 3DLJA 4MTPA 4ENOA 3FFIA 2CAJA 4QWEA 3VGLA 1DHMA 2CJKA 4JD2A 4DSIA 2E2NA 4O8UA 3AXKA 3GL1A 1NMEB 4DU3A 1QVGR 2DH7A 2Y1LB 3IWXA 2EG1A 3FJ2A 5BR8K 1RBSA 2RS2A 3SYZA 3IM8A 2HK3A 2DNOA 1VQLS 4FBTA 3PX0A 2H5EA 3SQGA 2XMVA 3Q89A 1T95A 1YG0A 3IS9B 4K8RA 3N4PA 4CJFA 3JS9A 4ZS6A 2WONB 1R0AA 2Q3SA 2GJIA 3SAFA 4RBUA 1U2FA 2CPYA 1YJUA 1E3MA 4I64A 2EK6A 2H65B 3W9JA 3KD5E 4I2PB 1T03A 3K8VA 3CIPA 1Q95G 3QEPA 1GLJO 4ICLA 1K8KA 3SPYA 2YNHB 1S6QA 4NX9A 2G2ZA 3RGIA 3AB4B 2QI2A 2AU0A 1G2EA 2CNOB 3BB5A 3V9SA 1RTJB 3L7PA 1X4BA 3OBWA 4V1Ak 2XMAA 4M5MA 3SQ2A 1M1KO 3AJ1A 2J0SD 1Q9YA 2C2ZB 2QWOA 1RHRB 4LSNB 5KI6A 1TK5A 2VQEF 4ZVEA 2YTCA 1Y0HA 3CDAA 3Q7CA 3TU5A 5DK5A 3GDQA 2GX9A 5GAGP 3ILOA 1ASVA 4BC2A 2E7WA 4WP9A 4KV8A 2I38A 1XMOK 2G8IA 3C6TA 4ISFA 2GQQA 4BRFA 4KHNA 3QATA 1VQ6N 2QA2A 3PZPA 2V67A 3THWA 1E6VB 4IOBA 1TKZB 5DM7L 4FCYA 1M5KC 1QTNB 1RK8A 3KK2B 1VQKS 3W8GA 3C8YA 4NLOA 1Q53A 2E5IA 2U1AA 1TKTB 2YWEA 5E7OB 2RUSA 4OYPA 1JK9B 3CB4A 1VS3A 1AB8A 4ILMA 3M30B 4AL6A 2QL5B 3KHYA 2M70A 1OH6A 4ED0A 1YX2A 1Z05A 3QEXA 3W2WA 3LDPA 4WCEL 2NZTA 4J2AA 2BACA 2DT9A 5B0AA 1OY8A 3FBBA 5DDRC 4NXNJ 2ZITA 2XZTB 4E1MA 3J7YI 4ED4A 3R97A 2FBYA 4B3OB 3DCAA 3AO3A 3T1YK 4UQTA 2CGKA 1GEHA 3M1VA 1VCTA 4U6PA 3M32A 3DHXA 3K58A 3CCMN 1FJGK 2XLKA 2KVIA 2P8IA 3TX8A 3J8AA 4C8OA 3MMBB 1NKEA 3ZEUB 4IDKB 3DLEB 4IFYA 3MI7X 3L2WA 4FDFA 4H5VA 4M3XA 1KAYA 5KT7A 3M2VB 1U2RA 4OZ2A 1L5UA 4ZVPB 1I39A 1IVZA 3U9DA 3EGNA 3VQDA 4XAKA 1WSGA 3N5BA 1A6LA 2OEMA 3A8IA 4ZPBA 4MK8A 4D3HA 3GB0A 3OT9A 1CLFA 2BRKA 1PJ7A 3AVIA 3PIOQ 1IKVA 3EX7B 5M2UA 3AA5X 1YJVA 2BANB 2D69A 2OD6A 4BQZA 5HBMA 2VDIA 4AFFA 3THXA 2LKZA 4B9UA 2AJ1A 3FE1A 3QYYA 2VWBA 3CJTA 4ZPVR 2JJ4D 1VBZA 3HHLC 4EGLA 4C7QA 4A57A 1IBKK 1NU4A 3QGHA 4LIWA 4W5RA 3CC4N 1S59A 1NBEB 1NLKL 5JVHL 4Z4IA 1Y3JA 2B56A 2XZDB 2F3JA 4CH0S 2QA1A 2XNQA 1PSDA 3U7JA 1VBKA 1URRA 4QWAA 2UVRA 3A0IX 3TYTA 2KM8C 2VH7A 3LDSA 4X62J 4CI0B 3QWUA 3EKSA 2HWTA 1SJFA 2DJWA 5KOXA 3RMAA 1VISA 2YY3A 5D3GA 3HHLD 4PCQA 3NY0A 3QT8A 4H0OA 4RW4B 3TVKA 3CPWM 4M63C 3HOTA 4OJ1A 2L9DA 4DR2J 2JNJA 4DV6J 1BGXT 1RT7B 3B82A 1Y7PA 2DIUA 2HVEA 4OYIA 4ZLPA 3MEGB 3PYDA 1Z2ZA 4JI3J 1TZ0A 1WHVA 3KLFA 2FJAB 2AEFA 3ILLA 2VOOA 2ZKTA 1HHTP 4BRPA 1ZBLA 4DLEA 1W9HA 1KFDA 3M8PB 3QERA 3D68A 2CJBA 3JAMY 5KFVA 1QVGM 2QEXS 5KFGA 3CCWA 2GWJA 3EYZA 4KHRA 4WE1A 1TKDA 1QHTA 4DN9A 1BD6A 2YH0A 4RCHA 4ANDA 3U9ZA 5D0EA 1RGIA 4C9DA 1YSJA 2BOAA 2CQCA 1LQ9A 4KGXB 2HFVA 5IT9Y 2EKNA 3CCQN 5AFUH 1YK9A 2GC8A 3OA9A 2HZCA 2Z56B 4CIFA 1WTBA 2M8HA 4P2SA 4Z4HA 5BRDA 4LFCF 4TKTA 1P90A 1SBRA 4RLEA 5G4DA 1S1VA 1RHKB 1V4TA 4M8LA 4O55A 2RSQA 1EX8A 2KHDA 5C5JA 1GK8A 4MLEA 4CO4A 1UFLA 2GUPA 3CCUS 1X3NA 1H2TZ 1TL7A 1P8ZA 1YF5L 4B8CA 1XMQK 4TN2A 2UXCJ 4JLHA 4ETXA 1HMVB 4NZ7A 1XNRJ 3G96A 5K8MA 2R7SA 3MGJA 4ZHRB 3NH2A 4BLGA 1C0UB 4RW8B 1CULB 4B9LA 1CPZA 3C16A 3LGNA 5LJ5Y 4OPHA 1MG7A 4A8QA 2D0BA 1RU2A 5HRRA 1HA1A 4CH1A 4KT0C 3QIPB 3HFZB 2VGMA 2J9DE 1C6VA 1FFGB 2VDHA 1E4GT 2HSEB 1ZTTA 1CJUB 3HMJG 2OD4A 3MM9A 1VQ8N 4FZYA 5AFUA 1X4GA 4Y3CA 4PYAA 4QPTA 1VK8A 4NXNF 3LAKA 1CJKA 2CJYB 2R7WA 4ATNA 3MM8B 4DOZA 3FSIA 3L0QA 2PMZD 3LF0A 2Z1IA 3EGVA 5KRSA 2BE2B 3BBFA 2RQ4A 1MWZA 1U1LA 1KD1T 1ULRA 3IS9A 1R3NA 4DR5J 1C0GA 1TKXB 3GCWP 2F4FA 2OTJN 3B78A 3KUGA 1IG8A 1VSKA 2G0IA 1QAXA 1S6UA 1NGIA 5GIPA 1EXQA 1RTIB 2YKNB 3TW0A 4FOIA 2B4UA 2DXEA 2YNHA 3LGHA 3Q2TC 3KLIB 4G3IA 2EW9A 5KGXA 3H4BA 4AHRA 1S57A 2ZM6K 4LFBK 1X5OA 1C2PA 1UAXA 3UR0A 1B92A 2DBBA 1RTJA 2F65A 4DTOA 4A2BA 1NUEA 3KFWX 2PMHA 1YLXA 1VHXA 2A40A 4ZITA 4WFAL 2MGZB 1F5AA 4RW7B 1VQYA 3QBCA 4WQ4A 3QGPA 3WUHA 5KTQA 3DRPB 1KN6A 5BPMA 3GIJA 4J2BA 3OSPA 1VIXA 4CHPA 3I8DA 2QSFA 2LMIA 2XYPB 2O8EB 1CSJA 4DU7A 4FJGA 1RBRA 3L6QA 2VC1A 4KH5A 1HIYA 3MPWA 2IVPA 3SAGA 1BCMA 1U1OA 2J8AA 4X62F 3IC1A 2ZBPA 3QO9A 1FEHA 2QJ3A 4PPDA 4X65K 2JH3A 3O3LA 4L3QA 3O3HA 4AM7A 1ZOTA 4FVCA 2J6UA 3KK2A 1WDTA 5SUHA 4IJAA 2PD1A 1PKUA 4FK0A 2HF4A 2P2CB 4A8OA 1APSA 1WHYA 3QJLA 2R2SA 3AVHA 1DFDA 3MMAB 4JBCA 3PTWA 3SV3A 5CYMB 4DR2F 4DV6F 1GH8A 4DV4K 2J9EA 3BYPA 1FNOA 4R5PA 1UZDA 3O80A 1B4SA 3Q8VA 1RAAB 3QSIA 2JLGA 3TARA 2OA8A 1UFWA 2CVEA 4CJSA 3P5TL 3QINA 3NWGA 3ASMA 2PEHA 4OYMA 2I8EA 2QK9A 2HURA 4B3OA 4BCAA 3AB2B 3M5RA 3CGIA 4Y0WA 2HOEA 2LU2A 2G2OA 3A3PB 5C7PA 2AJQA 5H9FK 1ZS6A 4Z7CA 3MEDB 4NOHA 1YRUA 2ZWHA 2KT5A 2V69A 2M7SA 4IDKA 3DLEA 3LDOA 4DU4A 4M3UA 1G99A 3I4PA 4LSZB 2J0XA 4KH1B 3I5AA 4FLYA 5T7LB 4EU0A 3CW2C 2CH5A 5GAEU 4TU9A 2HMIA 3NF8A 2XYGB 5JJBA 3V1QA 1WBBA 3MN5A 2QLBB 5E5NA 4L73A 4C6AA 3P1GA 3GU0A 2UXCF 1XNRF 1CZAN 2BANA 1LFWA 2PIIA 3BYRA 4IO9L 3V6KA 4HUGA 4PAAA 3X1LB 1HBOB 1S6PB 2YX1A 2NSCA 2LVWA 4DV5J 5HAOA 1HQEB 4I2QA 4H4OA 5EGYA 3VEXA 4DR4K 1MN9A 1S77D 4DCJB 1P27B 3ITHA 4PKHA 1XJWB 3GR1A 1OQ3A 2A41A 4F4AA 2WRMA 3FMWA 3VGMA 3CMES 1U1RA 1LOUA 2VOPA 3HVRA 1TYQB 2V8PA 3MMVA 3AVLA 3DXMA 4FK2A 2CXEA 3BZCA 1VQNS 5AZIB 2BM1A 3CCVN 2VU5A 3V5RA 2H5IB 5KFWA 3A3OB 5KG4A 3PG9A 4IH6A 1UMJA 4J9QA 1DY3A 4RW4A 1WTFA 5A6WA 3QAEA 4BRKA 4I6YA 3LA0A 2CNNB 1VYAA 3HHNB 3ULDA 3H1VX 2N3LA 4DR5F 1N8RT 5IQ6A 1RT7A 2YKOA 3ULHA 1JLQA 1Q5VA 3FGUA 3NFAA 3MEGA 4PZVA 3RW6A 3AARA 3UIQA 4B9NA 3HSZA 4W90B 3M8PA 5E84A 2LA4A 3C66A 1DTTB 4F3TA 4PWWA 2QG9B 4J9UE 2QV6A 2A6MA 4NLXA 4QCLA 1RDWX 4PQUB 2V52B 5GIOA 3HFKA 2MSSA 1VJWA 4MFBB 3MPDA 4CFDA 1RJJA 4WBFA 2DNMA 2DH9A 3FUYA 3SI8A 3NHGA 3KK7A 4H54A 3VN5A 1LWEA 1C0TA 1TU0B 3V2UC 3EO3A 4BVOA 2KZMA 2IY5B 4EYHB 3HZEA 1W7AA 5AXNA 2R42A 4USJC 1ZPVA 2BJ8A 1TUVA 1BWVA 2V68A 1TV6A 4ZJLA 4A8MP 2X1GA 5B8HA 5FDLB 3AA2A 1PO6A 2DHXA 2Q66A 2QW9A 4UQGA 1U02A 5J2QB 2UVVA 1HMVA 5KG5A 3UNGC 3BQ2A 1FCAA 5JLFA 1R27B 2HBLA 4ZHRA 2HRUA 4RW8A 4B9SA 2D3UA 2DPIA 1V9OA 4YOVA 3GV5B 3HK2A 2D0AA 3IXQA 1SQKA 1F3VA 2HLUA 2RHKA 1SV5B 4JKBA 3CDWA 1N6QA 3D67A 3H45C 4MDBA 1JXBA 4WFZA 2B4VA 2WW4A 3O08A 2DCLA 4PG8A 3GFYA 3JB9k 2A2CA 5AXKA 1MDUB 3VQSA 3CC7N 4O0JA 1GOCA 4ZIWA 1S76D 5K8NA 3TA2A 2BKOA 1TVRA 5ETSA 1KR4A 4NLPA 1NOYA 4Y34A 2WAQD 4FJ9A 3VV2B 3MM8A 3ETMA 1RWPB 2HGMA 4F0HA 4FLVA 4DR6K 2WFBA 1TQLA 3M8RA 3CPEA 1CVJA 3QNOA 4LUBA 2MKKA 3O1LA 2BE2A 4AH9A 1RBAA 4ITSA 2QX0A 3D6MB 1W97L 1TFWA 3G86A 4F36A 3L3VA 4JI2J 1H7WA 2ZZMA 2Z58B 2VFSA 3CIZA 1RAEB 3W61A 4TY8A 4C8NA 2YQ3A 3UE5A 5U47A 1JL1A 2BJ9A 3HJVA 3ZYYX 1S99A 4WIQA 1LCUA 1JX4A 3CF5Q 1A5VA 3GOIA 4ED5A 4DF8A 2KHOA 3J80O 3S7RA 3KLGB 4PXBA 3C14A 3CMQA 1N36J 2VB6A 2I0XA 3HJFA 2F7TA 3BSOA 3J81O 1WG1A 5AE3A 3MX5A 2GVDB 5F8LA 4CK1A 5D4NA 4LREA 3N79A 3ILJA 5F0XA 3QFHA 1RBOB 2HEKA 2QLFB 1KC8T 3THPA 3UD3P 5DZ7A 1M90T 3OW2R 2UU9K 2VONA 4NLRA 3HXMA 3K59A 2LQ9A 2FBTA 3E01A 2F63A 3V6HA 1OYDA 3AA4A 3S6EA 2Y1IA 1L3SA 3ULEA 4HCBA 2HHXA 3THVA 2O8EA 4ZPCA 5IXUA 3O1WA 2DR8A 3UO0A 1C4CA 2CPIA 3ENBA 4WPAA 4CGHA 3LGMA 4ZPAA 4OI2A 4B08A 3V6JA 1NJZA 4P71A 2MXYA 3AHPA 3GLJA 3LDLA 2ZUAA 1UEVA 3PIOL 2B43A 1RWNB 1HL6A 5D77A 3MMAA 1RACB 3FZLA 1FESA 3PFEA 5E3CA 1YVUA 4GO5X 4IH5A 1HPMA 1TL1A 3RBDA 3JSRA 3HSDA 4Y0FA 2WCXA 3ZT2A 5THWA 2ASMA 4CEBA 5KFSA 2RQKA 4KHPJ 1GLCG 4ZCMA 4MKYA 3N9UC 3KJVA 3LTOA 1TL4A 4NEYA 2W2NP 3CQYA 1HWLA 4CD1A 3CJ5A 2ZH9A 2AA4A 1ASUA 2XGPA 2M9KA 5FLXO 4LRDA 2R7XA 1YWXA 1NG9A 4IRKA 4B17A 4FZZA 5AQIA 1OH8A 1SIWB 3CCLN 2AYMA 3A8YA 3MEDA 4CHYA 1YI2S 4B1XB 5L39A 3ICLA 1C0FA 2C2OB 1NJIO 2B4JA 1NXIA 1IJJA 3H40A 2J4RA 1T05B 4F8RA 4ZJOA 3OYHA 4J5OA 4DLGA 2ZC4A 3FVYA 2YWFA 4ALZA 5EN1A 2IYIA 3T19A 2GZOA 3FGVA 4R25A 4JK9A 1CQNA 3V81A 1FA0A 1X5SA 2HFSA 5HJXA 1EQYA 1PJ6A 3IBFB 4W5OA 4BR7A 1JLCA 4KGVB 4FWMA 2CPZA 2O4IA 4X4PA 2B0GA 4ELVA 4DZ6A 4J9SA 5IWAJ 4CF2A 2YHWA 3KKSA 4NYPA 2UXDK 1LKZA 2WK4A 4IKAA 1S6PA 2I7PA 4DKWA 3OJSA 3C7NB 4H5WA 1ILYA 1HQEA 1QSLA 1NNEA 4PUOB 4BRMA 3FC9A 1HR0J 4B02A 3KMSA 4YOTA 4B9MA 4WP8A 2JDJA 2BMBA 3VEYA 3TRGA 3EZOA 1VRQC 1VQLN 3CC2N 3F5TA 3P96A 2ZOGA 2CIMA 1NGAA 5AZIA 5JXSA 3CTRA 4H0XB 2GV9A 2NUBA 4CRJA 2E9TA 4FWPA 5CZ2A 2W8LA 1O51A 2O01C 2HWIA 5HP1B 1R8HA 2L9WA 1IBLJ 3FDSA 3WIUA 3FBEA 5JLHA 4C98A 3PO4A 2VFRA 1Y3KA 2UVUA 2HFUA 1Q4RA 1RAHB 2N82B 2HIYA 2P9KB 3OS2A 4JI2F 2WBRA 3K2PA 2BUNA 1VMBA 3ZSOA 2DEIA 2QMXA 4CLKA 4JI7F 4P75A 1HNWK 5DLFA 2SXLA 1I1GA 2VA2A 3U1NA 4ZIVA 4K2JA 4QQBA 2FBXA 4RUHA 1DTTA 3P45B 5B0BA 4EHTA 1ATRA 4RWWA 3NAHA 2YJEA 3DLKA 2NNWA 5TKYA 2RDDA 1YAGA 4OJRA 3DXKA 1DGKN 3V9UA 3TP2A 3P38A 3CI5A 2F40A 1VC0A 4PXCA 2NQPA 2MZTA 1GXUA 1ZYQA 1PYTA 4RU9A 2Y9HA 1Z26A 3IMQJ 3VOVA 4Q8EA 1BC6A 1KOHA 3TSQA 5A8WB 4ZLNA 3W64A 2NYIA 3W0LA 4USMA 4CLZA 4J9OA 2E1YA 5FDLA 5JMVA 2I5JB 2M88A 3M6WA 5EXWA 3KYLA 3TAEA 1U0HB 1VQKN 3EXCX 3EXYA 4A2AA 3A5NC 1B7YB 5BYRA 2BQ3A 4LF6J 1M5HA 1YJTA 1VBXA 4R0JA 1TL3A 4IXCA 4CJ7A 1X9SA 3V4IB 2Q1NA 3HCXA 4NLQA 1T9VA 3CFRA 3NS7B 4OHWA 1NJXA 2E5JA 3CFOA 5AQZA 3LH2S 2VG7B 1YJ9S 3AO5A 2N4CA 3DLGB 4OGEA 1Q7YT 3G8QA 3OW2M 4KHPF 1OVYA 3UE2A 3HBTA 1ZBTA 1WSRA 2QO3A 1RWKB 2HNZB 3VHQA 1ZZNA 5KG2A 1XWLA 1K8AT 3UDLA 3K2YA 5CH7B 1OVQA 3KLHB 3HSCA 2WBMA 2H51B 4I7FA 1DURA 4KPYA 3VA0A 2ZD1B 1W7WA 4DUTA 4LRCA 4P52A 1IN0A 4X64K 4CW7B 2DK2A 2DR5A 4HKQA 4N5SA 3SMSA 4P7VA 1Y11A 4QYRA 3TJ8A 4U9RA 2P9PB 2GCFA 1T3NA 5KFQA 2WVEA 2IC3B 2P9LA 2O8DB 2H48B 3CM5A 3WC0A 2HPUA 2E6MA 2RRNA 4M3RA 3L8BA 4QIWD 4TQRA 4ISGA 3KLGA 2G8KA 3NOCA 2Q0UA 3WNEA 4F50A 4EK2A 3BGRB 5IWAF 2JLEA 1U26A 2Y0BB 4YQWA 4CFCA 2GJFA 3JQJA 4CF0A 1XNQK 2X1BA 3UDVA 4DSKA 2VODA 4P7TA 4K4WA 4AM6A 4H4KC 3UN2A 3J7ZT 3S3OA 5GAEP 2I2YA 4K7QA 1XN9A 1HR0F 4UOHA 3SV4A 4GNIA 4Y2KA 5CD4H 3T1AA 1FKAF 2IS3A 5J2MB 1DRZA 1N56A 5KOWA 4TNOA 2AZ1A 5A8KA 3KJQB 3Q8QB 2JVRA 3BZQA 3L4BC 3K57A 4K0KJ 1NM2A 5GAEI 3IWLA 3G10A 1S5ZA 3M9OB 3C2PA 1D9DA 4KO0A 1GTHA 4OV6A 3PR5B 4MKAA 2HGLA 4F3MA 1IBLF 3EE8A 3ZNJ1 3KZBA 5H9EK 1SXLA 1B9DA 3E9PA 3EPGA 2FGCA 4DV7J 2XB2D 3TJ9A 4M7XA 4G1PA 3GSIA 1BUPA 1BA0A 4V19S 1U49A 2AWZA 2XO7A 2R7VA 2G8WA 1Z4UA 5KFMA 2XLJA 3L7OA 2X51A 3L95X 4P10A 4I68A 1SJRA 2RKIB 2WHOA 1WC5A 1RHJB 3WX4A 1HNIB 5KFUA 5B0EA 1T7PA 4ZLJA 4G1QA 1FO1A 1TUYA 1EP4A 2OZMA 4U8YA 3I5CA 2ITMA 3K9KA 1XIQA 4J90A 3DMJB 1RT6B 3V1OA 1FFSB 5AT1B 2XM3A 2OFGX 4NCAA 1T05A 4OVLA 3E51A 5FPNA 2VWJA 4ID8A 3DDNA 1K0VA 4JK8A 4K5SA 3O9UA 1MROB 1DEJA 4AQYK 3HSTB 3QJJA 5BYSA 3GG4A 2V2VA 3V6DB 3LPUA 2GA7A 1Y5LB 4DV3K 2XI3A 4EBEA 1A5XA 2RB7A 5KFCA 4UUWA 4JI4J 3PKMA 3OVSA 1T6CA 4LF6F 3DDKA 1UJ4A 2FHKA 1QQCA 2MJUA 3MCMA 3D0PA 4YDXA 2RDJA 1LWFA 4JKAA 1HWKA 2M0GB 3EUNA 2BZ2A 2VD3A 5JS2A 3AJDA 2AEJA 3BO2A 2BKPA 1JCFA 1XMQJ 4PUOA 1YJ7A 4OLAA 2ZGZA 2A3JA 3MCNA 2QL9B 2WB1D 1GLEG 1JLFB 4QAGA 4MIAA 1S7HA 1U48A 2V5HG 3B6OA 4PY5A 4MK7A 3OYLA 2IBOA 1R8BA 2F7VA 3MR5A 1KSPA 2FVQA 1RWXB 1HNZJ 2VPZB 2C3OA 3OR1B 1PGZA 3V9ZA 4DFKA 3J80U 1Z1ZA 1IQZA 2FC9A 3C0BA 1OSDA 1A0OB 1SC1B 1VQMN 4GO7X 3J81U 3A8KA 5AQMA 2JSXA 3DOKB 2E5LK 3WC2A 1JB0C 2JL9A 2KJVA 1SQGA 4YR0A 2YKAA 2R8KA 1HBMA 3AOAA 2OANA 1Q86T 1HJOA 4B3SJ 3QQCD 4Z4FA 5BREA 3GILA 4IOCQ 4H5RA 1AYEA 1BU6O 2ZC3A 2GMLA 3HULA 4CWBA 4LF9F 1RQ0A 2F5GA 4DSFA 5KFAA 3PYGA 4M3ZA 2P9SB 1HNXJ 1IO2A 2RJZA 4JV2A 4QWDA 3DLLL 1H72C 3HSJA 1RDCA 3JQMA 3BQ0A 1N33K 3Q8YA 1PCAA 3M4XA 2NR0A 4Q2MA 3ENQA 2Y8YA 4YHHK 1RBLA 1UAWA 1EQMA 2KKZA 2ZM6J 3M2UA 4DG1B 4NLCA 2K06A 4B3MJ 3L2RA 2IA0A 1HNVB 3OYKA 1X5PA 3OV7A 1RDBA 2OGUA 4ZP7A 3GIRA 4GKKJ 4DSEA 2UP1A 4K0KF 2ROEA 3T1HF 2DTUA 2HZAA 4I0WA 3SFUA 2QWQA 2IIHA 5AXMA 3CF5L 3O8MA 5AR0A 1V5VA 2YKPA 2HBMA 4K59A 4J9NA 4DPTA 5LMUJ 3D5MA 4DV7F 2MZQA 3D2EB 5EX5A 1WSJA 1C4AA 2VG7A 3CJKA 2B5JB 5ETVA 4U7BA 5FROA 3ZTOA 1HBUB 1RLCL 1GMWA 1HBNA 2W7PA 2BH1A 3D4JA 4DFJA 1U7LA 4NPOA 2BXJA 5H1SQ 3CETA 3HFVA 1LNQA 1RA6A 2IVMA 3Q8RB 2WSFC 4P72A 3O5BA 2JVOA 2OELA 3PUFA 2ZKUA 4X4SA 3S3NA 2J7KA 3AAPA 3LM9A 3UKUB 1N32K 3AD8C 1UVJA 3MM6A 1Q8KA 3DAWA 3SCJE 1EARA 2ABYA 4HCCA 1T9WA 2CG8A 3I87A 4ID1A 1NSQA 1F2GA 3OL6A 1R7IA 5A2QO 2UXBK 3EICA 3NAEA 4JKGB 3LZJA 3W60A 4CEFA 1S9EB 1N88A 3C65A 2A18A 2P9PA 2D0OA 2IC3A 3W2VB 4WU3A 1VQ6S 5FD1A 2O8DA 1TAQA 3D9BA 4A48A 1S12A 2P6TA 5IQQA 3NGZA 4JI4F 1ZM9A 2NRVA 1RLDA 2OTLN 3Q2SC 3B8AX 2DNPA 4DQIA 1K73T 4RW6B 1FXLA 1REVA 3IR7B 4Q7AA 2RD5C 3CMEN 1SQEA 1EHWA 1EETB 4M5KA 1WAFA 3K9JA 1N5YA 1RTHA 4IQMA 2L41A 4DTSA 4HTUA 2P9UB 2DD8S 2VG5B 3CJ0A 5AXLA 4BBYA 7FDRA 1NK8A 3NNCA 3QBXA 4XH1A 2LEAA 4U7CA 1O8BA 1IBMK 5J2MA 5EU7A 4YR2A 2IMOA 1NBWA 3SZ2A 2WVCA 4OQJA 3OTBA 3PHTA 3CD0A 3QT7A 4IOAQ 4DR4J 3OYNA 4B3TK 4UY8T 2R2RA 4O0NA 1QE1B 1FD2A 1X8DA 3BR9A 1G7CB 1HNZF 2XC9A 3CCSS 1UFKA 3BDPA 1NGFA 3SLCA 1WSHA 2NUHA 3I56N 5HATA 4BGAA 2OEKA 4HDHA 1YITN 1FXXA 1YVNA 5F8IA 1TFYA 3WXJA 4JI0K 3R9LA 1VQ5N 2FJDB 3CMAN 3W65A 2ZHOA 2WTFA 1DJ0A 4E7IA 4LRAA 3EDQB 1RT1B 1PBUA 4IYQA 4PYDA 3RJMB 5LMNJ 2ILZA 3GIKA 3G6VA 2F4VK 5KQ8A 4F26A 3VQTA 5D0GA 2ZNZA 3NAIA 3U1LA 1HKGA 4BRAA 2OH2A 4CCHA 4HH0A 5BPLA 4B3SF 5L38A 2ZVIA 1EB0A 2R8HA 1MWYA 1HPZB 3M6XA 2GMHA 4AYBD 1HNXF 3WXIA 5F1XA 4GKJJ 4TY9A 2W9CB 4KB7A 4B3RJ 2Z8QA 4EMDA 3R5JB 1RT6A 1X9JA 5AQXA 4R79A 1KWMA 4YB7A 1Q5YA 1SC4B 3KNAA 3LWLA 4DR3F 5KFTA 2FJWA 3G2XA 3MEEB 1WWHA 3TR8A 3HYFA 4CJWA 2YPZA 4LF8J 3D6FB 3AOCA 4DCOB 1FRHA 4Z4GA 3SUQA 5FJ4A 2QFJA 2H3EB 2D1KA 2CQ4A 5AQOA 1TL5A 1U8WA 3MEKA 2PYLA 4B3MF 1FKPB 3C95A 3AJ2A 1VQPN 3HO1A 2W01A 3CJ2A 3CT9A 4GKKF 1N0UA 1FDAA 4CT9A 4CJTA 4ZK7M 4IG3A 4RUBA 1DTQA 4DTNA 3T41A 3VZIA 4KKOA 2PT0A 5LMUF 1KDNA 2BJDA 2A1SA 3Q7BA 1P9QC 3CULA 1PAUB 1WEXA 2J9DA 4M5GA 4CLPA 1DARA 5CA5A 1X9MA 5AZJB 1JLFA 2ZH4A 5DMRA 5KFYA 1PILA 2ZBRA 3O1BA 1QAIA 3P31A 3ZX3A 3BREA 2DB1A 2YQ1A 2GTDA 2DGXA 2EWHA 2E20A 2FC8A 1R0CB 1JKHA 2RF2A 2KFZA 3A5OC 2DHAA 4AXJA 4CYUB 1NDPA 3W3DA 1H2VZ 4JV5K 2Z2YB 3GP9A 2J0QD 4WQ5A 4H4KA 1W2BM 4DCHA 2G1DA 2HHQA 3R8EA 3OBYA 2GNKA 4J7CA 2CQDA 2MQPA 4IQXA 4FWOA 2EFPA 1OIAA 1RKIA 1CS4B 2H4WB 2R2TA 2IJNA 1UA0A 3L3UA 3NEKA 3NWRA 4NMLA 5HQ8A 1J2VA 3MN9A 5AQFA 1B0TA 2VJUA 2FUG9 3MM5A 1LK7A 2ADCA 3ZZOA 4RU2A 3DYAA 4E19A 1RT2B 1HQUB 2BKNA 1RT5A 3L3CA 1VQ8S 4OMFG 2D4WA 3AY9A 1HKAA 3ZTRA 4CLLA 2Q31A 2HFZA 1RTDA 3ENOA 3IUCA 4DG1A 4LQ3A 3EJMA 3CDEA 2O8FB 1LWCB 2AIRB 2FZCB 4DS5A 3BN7A 1VSDA 4BY9C 3OBIA 4LF4J 1N34J 2FB0A 4USTA 2KW4A 3VEWA 4DV2J 1RE1B 4PKDB 3OY9A 5AQKA 3BSCA 5DETA 2OTJS 5B08A 3TWZA 5KPZA 4J9LA 4FF2A 1H0HB 3D2EA 3PW2A 2CZ9A 2OPQB 1HYSA 1CZBA 2ZE2A 4JI8J 5LMNF 1KQSR 1WF1A 3KK3A 3OPKA 4DR7K 3PXGa 2K3IA 5D4PA 3R1XA 3DDIA 2HHHJ 4KHSA 2N7YA 4JKHA 3OS0A 1A9NB 3P5JA 4C3LA 4WZQA 1JLBB 5E3QA 5D15A 2E1RA 4M5JA 2FGOA 4DUYK 4GKJF 4XO0A 4B3RF 2KLAA 4YOEA 4JS4A 5AQNA 4FWLA 4JKGA 3W9HA 3RAQA 3NMAA 5JMNA 1HD1A 3OUYB 1ZBHA 1GX6A 1Q81T 1GMWD 4KGZB 2GJ2A 1IKWB 3SCXA 3GJTB 4LF8F 3L2UA 3E2EA 2GVZA 2NLWA 4CP5A 1S0MA 3NF9A 3S01A 4ZJQA 4BROA 1CJTA 2W6KA 1J5EF 3P6YC 3HKZD 2MQOA 4KGMA 3H08A 2CH6A 2W40A 2VZ9A 4K4ZA 1S10A 2A6OA 3JTNA 3NCQA 5BYQA 2HBRB 4NLTA 1NKCA 4WJBA 3UDEA 2UZAA 3I55S 4H8KA 3TOQA 4F2SA 5L1LA 3MD1A 1C1CB 3D2FA 4LH4A 1Q82T 5SWMA 2RHQB 2ZJPL 3Q23A 2ZJRQ 5H1SV 2DPJA 2D41A 4DTRA 1IXKA 3A1YG 4UOCA 4W98A 3WDOA 3AQPA 1FRIA 2RDIA 2F8HA 2QYGA 3ISZA 3D6RA 4O3SA 3H25A 1FJEB 2K3KA 1ESVA 4ED8A 4AF1A 4USHA 5AJ3K 5F2RA 4BHQA 2FZKB 2IM2A 2CUYA 4M95A 3PEJA 3PW7A 4NZ0A 1KVKA 2ROPA 2ZWOA 4FXWA 3H8YA 3QFUA 2RHSB 2GO9A 4JV1A 4BVPA 5J1EA 5C25B 1XQIA 4BRHA 4FPAA 5ETRA 1CXUA 3MR6A 2W4CA 3MECB 3QMQA 5DZ6A 2ATCB 3N01A 1AFIA 3OTEA 3FBCA 1HARA 3GJQB 5GADP 1YUWA 3P3DA 3NGDA 2WW8A 1V4SA 2DNHA 1R59O 5T41A 1FX2A 3MD3A 5KFBA 3MR2A 4ELUA 1JXEA 4L8RB 4DV0K 4NLVA 1T9YA 3V1RA 5LXYA 1RSCA 4MYTA 3MPYA 4KI4A 4AHVA 3FFIB 4PEOA 4OZ5A 3T9ZA 3N6MA 4JI5F 1XQSC 1MLAA 1BDGA 3IN5A 2MZ1A 1KXPA 3G87A 4PQAA 5KG7A 4A8WA 2DFHA 1RAJA 2HB5A 3SQ0A 1YBUA 2DNGA 1KC8O 1VIOA 5K8PA 1ZBSA 1D0EA 3ISND 4F9OA 2D3O1 4FZXC 4YDUA 3AA3A 2C2NA 3OYCA 3SQGB 2LSNA 5EWGA 1QJHA 4FWKA 1VRUA 2UUCJ 1Y5IB 2LU1A 1ZAXA 2C3YA 3CCVS 4F02A 3QIDA 2OIHA 1FKPA 1I94K 4NLBA 2RILA 4YY3J 2DFFA 1GXLA 5M1PA 1SCJB 2K7JA 3SDEA 2E29A 4X4NA 4IOCL 4LF4F 4JN4A 3G71S 1N34F 4HLBA 3ZZ0A 2DHSA 4CFAA 2MQNA 4ED7A 4DV2F 1KP6A 2F9JA 3VWSA 1T03B 2B6AA 5JICA 1K8KB 4FJLA 1SH3A 1S6QB 4HTJA 2V51B 3PSFA 5A2QU 4CJUA 4BDYA 2WSEC 2ZBQA 5AZJA 4JI8F 1XI1A 3MZIA 3RB3A 3LM2A 1B9FA 1UVMA 2CQ0A 3NH1A 1N48A 3GQCA 2HHHF 4NXMJ 1SL0A 3TQ1A 2XULA 1M0SA 4FJ8A 5AE2A 4E7JA 1HLUA 2E66A 3GG1A 4ILRA 3ETOA 4KV8B 3KHGA 3C6TB 3HL8A 1AZSA 4UT4A 3K89A 2LFVA 1T94A 3P4IA 3CCTA 4OI4A 2LQBA 4LR7A 3THWB 4DX8H 4V19X 3RWUA 4BC9A 5FRMA 3OTOJ 5RUBA 1BCOA 5FPMA 4EEYA 3SUNA 1KQSM 3O2IA 1SQFA 5AQJA 1WDDA 2B9XA 3MCPA 1YJNS 2R7UA 4LFAJ 2QXFA 1CS4A 4WYWA 4OX9F 4X64J 3CYMA 4IRCA 4RL1A 5AQUA 1SJQA 4DWIA 4DV1J 1FTRA 2P9IB 4DS4A 4J91A 5E3AA 4BRIA 1U1NA 3QFWA 3W2WB 4DTXA 3K0SA 1ZXOA 3L2QA 5EUHA 1K1QA 3I82A 2W4PA 4UZCA 3HP9A 2GHWA 1T02A 5LJVA 5ADZA 4O0IA 2MJNA 4CHZA 3CC7S 4WK3A 1T9UA 3VQ9A 3M1VB 4TYAA 4KB0A 2V2QA 3KJNB 4RTFD 2VQEK 3VF6A 4YEAA 3RB0A 2KB2A 4YUDA 4CFBA 4Y00A 5KFHA 2FY8A 2W41A 4IFYB 2DTJA 3THYB 2O8FA 4E7LA 3H20A 2HKEA 4RBTA 2RS8A 1LWXA 3ZZUA 3HT3A 4C48A 3RMCA 2XMWA 3TSUA 4HTLA 1NNDA 5KG0A 1KVBA 3N0VA 3IGNA 4DEZA 2ZH2A 2CG4A 5AQWA 1NHUA 2DO4A 2QT7A 5E0OA 1UVIA 4LMZA 4WP3A 5C2GA 1V3RA 1RHQB 2OO4A 1TK0A 3CJRA 1WI6A 2XHWA 3R3TA 5HBMB 3THXB 4Z94A 2V7YA 2BEFA 4OLOA 5CXTA 2FJEB 2NRXA 2E7XA 5DQIA 4JRQA 1VSHA 4M45A 5H9EJ 3AOBA 4YOUA 3TI0A 4ILLA 5CQGA 2R8IA 1KQFB 2W9AA 4MIWA 2I1RA 4IOAL 4JI6J 2XEXA 3KTQA 4CGDA 1KQKA 3D1OA 4FP9A 2FJBB 3JXOA 3ZSXA 1JL2A 3E3XA 2I7NA 2A5XA 5AE1A 2QXLA 2CKWA 3ZO7A 5J2PA 5D3GB 3BF1A 2C2EA 1UPMB 1IKWA 3G8TA 5AQSA 3BO3A 2OFHX 3L7UA 2FHJD 3EVWA 2IYGA 4FZVA 2C2KB 1NSKL 1ZM2A 4K43A 2O8CA 2UUCF 5B09A 1VSEA 2HQFA 3GFHA 2XY8A 3HHEA 4CK3A 5FPDA 1SKUB 3RMBA 2FC0A 2HLTA 3N5FA 2IVFB 2IFXA 3C6UA 4YY3F 3KD1E 3PX6A 2MKSA 3GMGA 2ACMA 4CZIA 4CZLA 3ELHA 3O4NA 3TNVA 2ZJQQ 3OYEA 5EHHA 2GO8A 1Q7YO 2AGOA 4TU7A 2LXFA 2AJ4A 2EWSA 3PYEA 3ZNUA 3PDNA 4CNYA 1G4CA 4FYDA 4DTJA 2HFOA 2K1RA 4GMKA 4X84A 1FXRA 2JGUA 4GV6A 2ZNYA 3O6WA 3H5YA 3EY1A 1CJVB 1R6YA 3TX0A 4B1YB 1S1VB 1WOSA 4NXMF 4DTUA 4URGA 4CF1A 1U25A 3MECA 2GELA 1HLWA 1S22A 4ZN3A 1TL7B 2OJ3A 2MQ8A 3NRBA 1RDAA 4RNNA 2VGNA 5M1OA 3G6EN 4WF9Q 3C16B 2VCPA 4I4BA 1FF2A 1SUQB 1QDUB 1ZPWX 4MKBA 3OTOF 4DHVA 1WOPA 4M5IA 4CJQA 3BJYA 1XUPO 2Q0RA 2UUBJ 1RI7A 1H98A 4E8UA 4LFAF 2XY5A 1WKJA 2W2OP 4J9PA 4DL0C 3OHAA 4W92B 2Y1RI 2CADA 3PJXA 4ZDNA 4DV1F 4W4MA 1RT4A 4X4QA 1V3SA 3MM9B 3EE3A 3EZUA 4RNMA 4RNFA 5C24B 1O5JA 1W25A 3KKRA 1KOOA 1RBTA 3SQOP 3DLHA 1CJKB 3TEHB 3D0HE 3TZYA 3CCJN 2O1PA 3DWLA 3OLBA 4USKA 4OHVA 3ZSZA 3ATVA 1FWKA 2OMLA 3CC2S 1ELOA 1X5TA 1RP5A 3CVKA 2E7VA 4LFCK 4ZCIA 2ZH5A 1QUVA 4C2MA 3JS6A 2AX1A 3GSDA 5IT0A 3LZIA 4YOYA 3VGTA 5DG9A 2V9WA 5D8HB 3QSYB 2F96A 2VFTA 4RWXA 5JVGQ 4WYBA 2NRRA 4OJ3A 3BV8A 1S1XA 4AE5A 4X2BA 3EEQA 4E2FB 1JLGA 1K9MT 1RHMB 4NLGA 3JAMU 1ACMB 4O23A 4Y65A 2RAQA 3PFOA 4LF7J 2RH3A 3MTKA 3ID8A 2HHWA 1EZZB 4E98A 5MAOA 2JEFA 4NMXA 2NZCA 1BY9A 4BS2A 2M52A 4NXNK 3ZZTA 7FD1A 3QT6A 3ZSWA 1I51B 1ZZFA 2QC3A 1S1UB 5KFLA 3VF0B 3TO8A 1GOAA 3UFCX 2FZGB 4JI6F 4KBOA 4GW6A 1YQHA 1RT3A 1TUGB 2BR0A 1KCFA 1MMLA 3CDBA 2DNZA 4CHQA 3QO9B 4NCBA 4Z4EA 1N32J 3MN7A 3M2RA 3UWTA 4XTTA 3VCDA 4JUZA 2W1BA 3EVMA 2JZ5A 1KS2A 1R8PA 3J7YP 3T5HA 4DX5A 4WK1A 4CHNA 3BPDA 2KI2A 4RUAA 2LP4A 2P9IA 1H73A 2G13A 1I3AA 4USUA 1RWMB 4R5PB 3J80Y 4USVA 1JJ4A 1TK8A 3A2FA 4KTQA 3VQ4A 2R8GA 2BRLA 2JC1A 4CVNE 3J81Y 3OS1A 2QKBA 3R1HA 1Y64A 4MO4A 1YHQS 1HI1A 2HZVA 1HWIA 2ZOMA 3CCSN 4KB1A 1NHKL 7AT1B 1VRTA 4QU7A 4P2XA 1S7IA 4FWQA 3VEVA 4LF2A 4ECQA 3EL2A 3OFFA 2HBKA 3THYA 1TMJA 2DIVA 4X62K 4EIAA 4TYBA 3KUHA 1QZ6A 4K5RA 1NZAA 2HMIB 4JNEA 2KU7A 2V63A 4GC6A 4B3TJ 4FJ5A 4H4MA 1T9XA 4CJ4A 2NPIA 2GIRA 2P5GA 3DOLA 2DRBA 2HS4A 1FDNA 4NLYA 2GS8A 1MW7A 1RILA 1U4BA 4DV6K 4DR2K 4I2QB 4H4OB 5IC4B 3ITHB 4MK9A 3HF5A 1OSCA 1KQGB 2UUBF 1N5QA 3TZZA 2W6LA 3NGYA 1Y00A 3Q8UA 3QLHB 4QR0A 1SS6A 1YBTA 1VJQA 1OS5A 1WC4A 1NPRA 3DLBA 5FLXY 3VAHA 1REGX 5ETQA 4BR5A 1X7VA 3ENVA 4K4XA 1FT8A 3R5GA 3OYAA 3DXMB 2X3GA 1UPPA 5DDQC 2PMWA 1RU1A 4BC4A 1GFWB 2XS2A 2ETJA 3H4DA 4CJEA 1VSMA 2BW7A 5CHIA 1B0VA 4U67Q 3H1QA 2LXUA 5I42B 2V34A 2IDOA 4A5AA 4IEEA 2BUPA 2ZWPA 3IRWP 1WC1A 5F8GA 3AODA 5JUMA 3NG8A 1JLQB 4RX6A 1T0TV 3AA9A 2FXUA 4K41A 2CPJA 4QIVA 4CTAA 1NO8A 4URQU 1XNRK 1X60A 1S49A 4OX7A 3MAAA 3HM9A 1NGGA 3C15B 2FQQB 4TVAB 4CEEA 4A59A 3IFRA 5HMXA 3LUYA 2C3MA 3LANA 3O8WA 2PDAA 2D1CA 1S3XA 2CJXB 4NYFA 3I0RB 3HRGA 1LWEB 2BW2A 4IG0A 1C0TB 2GBZA 3QETA 4LF7F 2V8VA 1IH7A 4IUFA 5CR4A 3PCOB 2DO0A 2WZ1A 1CJVA 2FTRA 3VVUA 3MDQA 3MWPA 1R8CA 2DNQA 5J2NA 5CABA 2KXFA 2MKYA 4HACB 3KHHA 1TV6B 1NSPA 4CLUA 3N6LA 4LY7A 2Y8WA 1IQTA 4Y1DA 4ERDA 5LJ3Y 5KFOA 3Q86A 3S1TA 4QJVA 5K14B 4DQQA 5GAHP 4N7TA 2YNFA 1CG2A 3I32A 2HIQA 3KUEA 4DR5K 1FFWB 1S72N 3NCRA 1VC5A 1RYRA 5DM6Q 3TA0A 1NGDA 1SUQA 2XSFA 4A47A 2HQCA 4YNQA 2VPWB 5HVHA 5GAHI 4Y6IA 3BS9A 1O13A 4Y2CA 4A61A 1N6QB 1EIYB 4WXWA 2V4RA 2D3OR 2O5DA 1Q7LB 4KFBB 1QSYA 4FM1A 3M8QA 1XHZA 3MOZA 5C24A 3M05A 2QKKA 3ILIA 3O44A 2JRSA 5HN0A 4XEIA 4OLBA 1TVRB 1HQ2A 1HYZA 1VK3A 3T9NA 1GXTA 3AT1B 4ECZA 2QM1A 3ZT0A 3SMPA 1G1XA 4PL7A 4I6MB 3B54A 3PVXA 4HHTA 2HAFA 2ZOFA 1U6FA 5GAGU 4UY8O 3U6FA 2O67A 4F2RA 5HRNA 2E88A 1TAUA 2ERRA 4JYAJ 4ZCKA 1EKEA 1X1PA 5HANA 4IO1A 1KAZA 2Z1HA 3E66A 3TZWA 4PRFA 4Q5VA 3HZGA 3ZX0A 1EAYC 1G3OA 2ZZTA 4TY8B 4WCEQ 3UCZP 2U2FA 4NWBA 1H74A 2E44A 2AQ4A 1VQMS 4WU2A 3E1YA 4DMZA 1UVNA 2HF3A 5F41A 3PR4A 2KM8B 1U2CA 2IM0A 2FYXA 3U02A 3C14B 5DG8A 2ZH8A 4S0MA 2MB0B 1OY9A 1LW2A 4TLQA 2PYJA 2HSTA 1XERA 2HS3A 2OYQA 1S1WB 1X0FA 1NMNA 4DPXA 3GE1A 2FLNA 2DXDA 3M3ZA 2QLXA 1U2VB 1OH7A 4JB8B 1T8EA 3MFIA 4P6QA 4C97A 2GWKA 5SZTA 1WKLA 4B8AB 1BMQB 2DGQA 4LC9B 2YX4A 3VPZA 3AVKA 2EBEA 5KG6A 3E01B 1S1UA 4K4UA 4L72B 3ULEB 5AQYA 2HWHA 4FJXA 4HI1A 3BZKA 1FNMA 3SNNA 4K42A 6FD1A 3P49B 4DFMA 4JKDA 1SL1A 4H0PA 1BO5O 2HMPA 4UOFA 4HYKA 4AD6A 2YV0X 1O0PA 3UI3A 5CYQA 3I0SA 5C2DA 4XH5A 2CNLB 2CQGA 2XHBA 3MOJB 2ASOA 2E1MC 3NGKA 4JEPA 2CPHA 2Q6BA 3NNHA 4TSXA 3I55N 2UUAJ 4P2MA 1TL1B 3RRHA 5JVHQ 1UP1A 2MYFA 3GTYX 4FLTA 1SJ4P 2IAJA 3KJVB 1LV5A 5DRKA 4N41A 4PG4A 1HW9A 4JI3F 2ZUGA 3RSEB 2G0JA 2MKJA 4OLPA 5B0CA 3D3BJ 3VQ5A 2QA4G 3DLRA 3KDNA 1BUXA 2M4MA 3DGPA 4DR1J 2EC0A 1URNA 5C2CA 4EP4A 4Y1CA 3LP2A 1WBDA 1RXOB 4XPCA 1S4FA 1VLOA 1NK9A 3ZZYA 3D2WA 1R8AA 4X66J 4I9LA 4TLRA 5KFNA 2OZSA 3V81B 1GMVA 5L1IA 1OPZA 5D4OA 2OPSB 2E1AA 4OX6A 1OJ4A 2QTDA 1JLCB 2H54B 4L76A 4M7YA 3F44A 2NRHA 4FSVA 3W8PA 3TVZA 2GX8A 2MZRA 1NGHA 4I6AA 3OYBA 2QN6B 1NHVA 3MR7A 1RNHA 4M5LA 2ZJQL 2AJ2A 5HQLA 4IFVA 4LD0A 2OSQA 4CEZA 1WOQA 4FYVB 4DQPA 1WAJA 4JKFA 2OTLS 4DPWA 2D3ZA 1SB6A 1FRLA 3NMRA 2QL7B 3QLHA 2PI4A 1WNSA 3RU0A 3TA1A 3O9TA 2BYCA 2VBYA 3CD6N 1VGYA 2CPFA 3GPAA 3CG7A 2YWGA 3CD5A 1HFEL 5G0RA 3A5MC 3SJJA 3MM7A 2NREA 2LQ5A 2HGNA 3VQBA 3IBWA 2DNNA 4QZVB 4HUFA 3AGKA 2XY6A 2B7BB 2CPDA 3FZHA 5I42A 4B9QA 3D1QA 5HL7Q 3G71N 4OJGA 3PW4A 3I56S 2R7OA 4WF9L 1HWJA 4NRTA 4KPCA 1J5OB 4JYAF 1YITS 4C3KA 4OYWA 4AL5A 3GV7B 3A3NB 4NCGB 2CPEA 3GYNA 3H2VE 4PKIA 3UB5A 2FLOA 1VQ5S 3CMAS 3VGUA 4P74A 4DUZJ 2QWRA 3C15A 3DLKB 2E2QA 5L46A 2D5RA 3MAHA 1I94J 3MPUB 3AVFA 3DXKB 3EDRB 4JI1J 2KQ2A 3I0RA 3VEOA 4ANEA 3QT5A 3O5TB 4CLTA 1NGBA 2CDQA 3UN3A 4LJMA 5AQTA 3TPQA 4ZVTB 4OZ1A 4QPXA 3SBTA 1TTHB 1WN7A 1WNEA 1R6VA 4HACA 2Q6CA 1B7FA 8AT1B 1BQNA 2FIUA 2ZH1A 5KQDA 4LF5J 4KI6A 2HVHA 2OI2A 1FDBA 1K1SA 4FWRA 2UVWA 5K14A 3VESA 1TUUA 2HHVA 2Z2LA 3G0ZA 2VFVA 4C8LA 1YJNN 1TL3B 3UN5A 4KYZA 1NM1A 4JI2K 1JJ2R 3C6AA 3WQUA 2GQ2A 2N7CA 3ZZZA 4QWCA 1A5WA 2H3GX 4F0MA 4JI7K 2RQCA 1VQPS 2MLZA 5BR9A 4CF8A 1PBAA 4QBUA 2GGPA 4R0EA 4LSLB 2P51A 3WEEA 4ZN1A 4J8FA 2UUAF 5BRFA 1BHNA 4H0YB 3IO1A 1RBVA 1FHTA 4KFBA 3C46A 1M1GA 4FF3A 4N47A 3AVAA 4YP3A 4FF4A 3IR5B 4ZTJA 3R7SB 1Z2LA 4J2DA 3R7BB 2ZZNA 1Q82O 4CD3A 2DR6A 4GRSA 4DXLA