5I43A

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate chelator water-soluble inhibitor (dc32).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHQIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i43A00
3KMCA 2XS4A 3HBUP 5BPAA 3NX7A 2A8HA 5I0LA 1CIZA 2FV5A 2J83A 4G0DA 2WOAA 1FBLA 3ZXHA 4WK7A 4HMAA 1QICA 5D3CA 2CLTA 2AYKA 1RM8A 2E3XA 2MLSA 3OHLA 4DV8A 4GR3A 1HOVA 2WO9A 2X3BA 1G12A 2K9CA 3HDBA 2E2DA 1D8FA 2QPJA 966CA 1KUFA 3HYGA 1Y0VA 1C8TA 1IAAA 1GXDA 3N2VA 4JPAA 3L0TA 1K7IA 3AIGA 2USNA 3DWBA 3I7IA 2DW0A 2K2GA 1KAPP 3Q2GA 4L19A 1I1IP 3F18A 1GO7P 1XURA 2OVXA 4H1QA 1B3DA 2OW9A 2V4BA 4ZR5A 1EAKA 1FLSA 1SATA 3EHXA 3EWJA 2KRJA 1KUKA 1CXVA 1EB6A 2FV9A 3LMCA 2OXWA 5L79A 1XUDA 3VI1A 1J7NA 2MZEA 3GBOA 3HBVP 3LGPA 1OO9A 4A3WA 2YIGA 1R1IA 1EUBA 3LIKA 4GR8A 1JAPA 1A86A 2OW0A 3KEJA 1IAEA 2TCLA 2Y6DA 1D7XA 1PWUA 2W0DA 1UEAA 1MMQA 5LABA 1AKLA 2PJTA 1OMJA 2X7MA 1KBCA 3EDIA 4JA1A 4R3VA 1BKCA 3LUMA 3B8ZA 3F16A 3P24A 4CTHA 1ASTA 3AYKA 3BA0A 2D1OA 1BUVM 2L0RA 1ZS0A 2JT6A 2YB9A 2ERPA 1MMBA 5D1UA 1JIZA 3HY9A 3ZUKA 3O64A 3LJGA 4AIGA 1IAGA 3L0VA 4GF1A 1JH1A 1DTHA 5JMYA 3TT4A 4H84A 1BQOA 5CUHA 1ZVXA 4FXYP 5H8XA 4FVLA 3KEKA 3ELMA 2W15A 1G49A 1OM7A 1UTTA 4GUYA 5D1SA 2XS3A 2OW1A 3UVCA 4H76A 4H2EA 3WV3A 5I2ZA 1B8YA 2OI0A 3G42A 3KMEA 4IUWA 1A85A 4I35A 4IJOA 3USNA 1BQQM 3LE9A 1PWVA 2WO8A 3EHYA 1G9KA 4GR0A 4JP4A 4DD8A 1JJ9A 4H82A 1ZP5A 1JAQA 5BOTA 1D8MA 4H49A 4PKWA 4WKIA 3SHIA 3DPFA 1KUHA 4J4MA 3HDAP 1GE7A 2X3CA 1CK7A 4FU4A 3DSLA 1BM6A 2I47A 2EROA 1KUGA 2DW2A 4GWMA 1WNIA 2Z2DA 1R55A 2W12A 3V96B 1AYKA 3B92A 2ERQA 1IACA 3KHIA 4ON1A 2MZIA 3LJTA 1R54A 3HB2P 3AYUA 3DL1A 3KECA 1HV5A 1JKYA 3F1AA 1O0TA 5D2BA 1UMSA 1MMPA 3P1VA 1OM6A 4PKVA 1S4BP 1XUCA 1HFCA 1USNA 1H71P 2JSDA 1OS2A 4AXQA 1I73A 5B5OA 1ND1A 2SRTA 2DW1A 1R1JA 4PKRA 4ILWD 1QIAA 1ZXCA 1JAOA 2N8RA 3KRYA 1I76A 1BSWA 3KWVC 1GE6A 4IN9A 5D7WA 1CQRA 1BKCE 1Z3JA 3CKIA 1GKDA 1SU3A 3DPEA 4QKZA 1XFWA 2DDYA 5CZMA 3B2ZA 4PKSA 4XCTA 1UMTA 4I03A 1XFUA 1MNCA 1GO8P 1ROSA 4L6TA 5D1TA 3TS4A 4H3XA 1QJIA 2O3EA 3K7LA 3EDZA 3RTTA 1YQYA 1PWWA 1YCMA 2POJA 1AF0A 1K7QA 4WZVA 2RJQA 5B5PA 1GE5A 1HY7A 4PKQA 2Y6CA 3LKAA 3I7GA 4AYKA 1HTDA 1CGEA 2JT5A 3O2XA 3F15A 2OZRA 1Q3AA 1XFXA 3LQBA 1JIWP 4L63A 3RTSA 1OM8A 1XFVA 2MZHA 3K7NA 1G4KA 3LK8A 4XM6A 4HX3A 1ZTQA 2OXZA 1QUAA 3ZVSA 3TSKA 2OY4A 1ZXVA 2AIGP 1YP1A 1QJJA 1CAQA 1IABA 5I3MA 1BZSA 1JK3A 3VTGA 2OXUA 4DF9A 1BUDA 2JIHA 2J0TA 1XFZA 3N2UA 3LILA 2DDFA 4XM7A 4AUOA 3WV1A 1OS9A 1GKCA 1XFYA 3EDHA 4WF6A 3EDGA 3TVCA 1HFSA 1PWPA 2X3AA 1CGLA 1BIWA 4FXQA 2O36A 1C7KA 3F17A 1MMRA 1SLMA 4XBHA 1G05A 3Q2HA 1YOUA 5I43A 2CKIA 4GQLA 2HU6A 4JQGA 1K7GA 2MLRA 1KUIA 1L6JA 4EFSA 3LUNA 1RMZA 4WKEA 3G5CA 1R1HA 2OW2A 2JNPA 1PWQA 3LJZA 1IADA 2W13A 4G9LA 1BKCI 5CXAA 5L7FA 1C3IA 2OY2A 4JIJA 1Y8JA 3WV2A 4DPEA 1SLNA 4GWNA 4PKTA 1SMPA 5I12A 3DNGA 1QIBA 1Y93A 2RJPA 3LQ0A 4PKUA 1O0QA 830CA 4H30A 2D1NA 1UTZA 2OVZA 5BOYA 456CA 3MA2A 1SRPA 4Q1LA 3E8RA 4XM8A 2W14A 1FM1A 1ATLA 3HY7A 3OHOA 1D5JA 3LIRA 1CGFA 3U1RA 1JANA 1DMTA 4A7BA 5I4OA 3LEAA 3F19A
chains in the Genus database with same CATH superfamily
3KMCA 2XS4A 3HBUP 5BPAA 3NX7A 2A8HA 5I0LA 1CIZA 2FV5A 2J83A 4G0DA 2WOAA 1FBLA 3ZXHA 4WK7A 4HMAA 1QICA 5D3CA 2CLTA 2AYKA 1RM8A 2E3XA 2MLSA 3OHLA 4DV8A 4GR3A 1HOVA 2WO9A 2X3BA 1G12A 2K9CA 3HDBA 2E2DA 1XM5A 1D8FA 2QPJA 966CA 1KUFA 3HYGA 1Y0VA 1C8TA 1IAAA 1GXDA 3N2VA 4JPAA 3L0TA 1K7IA 3AIGA 2USNA 3DWBA 3I7IA 2DW0A 2K2GA 1KAPP 3Q2GA 4L7AA 4L19A 1I1IP 3F18A 1GO7P 1XURA 2OVXA 4H1QA 1B3DA 2OW9A 2V4BA 4ZR5A 1EAKA 1FLSA 1SATA 3EHXA 3EWJA 2KRJA 1KUKA 1CXVA 1EB6A 2FV9A 3LMCA 2OXWA 5L79A 1XUDA 3VI1A 1J7NA 2MZEA 3GBOA 3HBVP 3LGPA 1OO9A 4A3WA 2YIGA 1R1IA 1EUBA 3LIKA 4GR8A 1JAPA 1A86A 2OW0A 3KEJA 1IAEA 2TCLA 2Y6DA 1D7XA 1PWUA 2W0DA 1UEAA 1MMQA 5LABA 1AKLA 2PJTA 1OMJA 2X7MA 1KBCA 3EDIA 4JA1A 4R3VA 1BKCA 3LUMA 3B8ZA 3F16A 3P24A 4CTHA 1ASTA 3AYKA 3BA0A 2D1OA 1BUVM 2L0RA 1ZS0A 2JT6A 2YB9A 2ERPA 1MMBA 5D1UA 1JIZA 3HY9A 3ZUKA 3O64A 3LJGA 4AIGA 1IAGA 3L0VA 4GF1A 1JH1A 1DTHA 5JMYA 1XAXA 3TT4A 4H84A 1BQOA 5CUHA 1ZVXA 3DTKA 4FXYP 5H8XA 4FVLA 3KEKA 3ELMA 2W15A 1G49A 1OM7A 1UTTA 4GUYA 5D1SA 2XS3A 2OW1A 3UVCA 4H76A 4H2EA 3WV3A 5I2ZA 1B8YA 2OI0A 3G42A 3KMEA 4IUWA 1A85A 4I35A 4IJOA 3USNA 1BQQM 3LE9A 1PWVA 2WO8A 3EHYA 1G9KA 4GR0A 4JP4A 4DD8A 1TVIA 1JJ9A 4H82A 1ZP5A 1JAQA 5BOTA 1D8MA 4H49A 4PKWA 4WKIA 3SHIA 3DPFA 1KUHA 4J4MA 3HDAP 1GE7A 2X3CA 1CK7A 4FU4A 3DSLA 1BM6A 2I47A 2EROA 1KUGA 2DW2A 4GWMA 1WNIA 2Z2DA 1R55A 2W12A 3V96B 1AYKA 3B92A 2ERQA 1IACA 3KHIA 4ON1A 2MZIA 1R54A 3LJTA 2YUFA 3HB2P 3AYUA 3DL1A 3KECA 1HV5A 1JKYA 3F1AA 1O0TA 5D2BA 1UMSA 1MMPA 3P1VA 1OM6A 4PKVA 1S4BP 1XUCA 1HFCA 1USNA 1H71P 2JSDA 1OS2A 4AXQA 1I73A 5B5OA 1ND1A 2SRTA 2DW1A 1R1JA 4PKRA 4ILWD 1QIAA 1ZXCA 1JAOA 2N8RA 3KRYA 1I76A 1BSWA 3DTIA 3KWVC 1GE6A 4IN9A 5D7WA 1CQRA 1BKCE 1Z3JA 3CKIA 1GKDA 1SU3A 3DPEA 4QKZA 1XFWA 2DDYA 5CZMA 3B2ZA 4PKSA 4XCTA 1UMTA 4I03A 1XFUA 1MNCA 1GO8P 1ROSA 4L6TA 5D1TA 3TS4A 4H3XA 1QJIA 2O3EA 3K7LA 3EDZA 3RTTA 1YQYA 1PWWA 1YCMA 2POJA 1AF0A 1K7QA 4WZVA 1OZ9A 2RJQA 5B5PA 1GE5A 1HY7A 4PKQA 2Y6CA 3LKAA 3I7GA 4AYKA 3DTEA 1HTDA 1CGEA 2JT5A 3O2XA 3F15A 2OZRA 1Q3AA 1XFXA 3LQBA 1JIWP 4L63A 3RTSA 1OM8A 1XFVA 2MZHA 3K7NA 1G4KA 3LK8A 4XM6A 4HX3A 1ZTQA 2OXZA 1QUAA 3ZVSA 3TSKA 2OY4A 1ZXVA 2AIGP 1YP1A 1QJJA 1CAQA 1IABA 5I3MA 1BZSA 1JK3A 3VTGA 2OXUA 4DF9A 1BUDA 2JIHA 2J0TA 1XFZA 3N2UA 3LILA 2DDFA 4XM7A 4AUOA 3WV1A 1OS9A 1GKCA 1XFYA 3EDHA 4WF6A 3EDGA 3TVCA 1HFSA 1PWPA 2X3AA 1CGLA 1BIWA 4FXQA 2O36A 1C7KA 3F17A 1MMRA 1SLMA 4XBHA 1G05A 3Q2HA 1YOUA 5I43A 2CKIA 4GQLA 2HU6A 4JQGA 1K7GA 2MLRA 1KUIA 1L6JA 4EFSA 3LUNA 1RMZA 4WKEA 3G5CA 1R1HA 2OW2A 2JNPA 1PWQA 3LJZA 1IADA 2W13A 4G9LA 1BKCI 5CXAA 5L7FA 1C3IA 2OY2A 4JIJA 1Y8JA 3WV2A 4DPEA 1SLNA 4GWNA 4PKTA 1SMPA 5I12A 3DNGA 1QIBA 1Y93A 2RJPA 3LQ0A 4PKUA 1O0QA 830CA 4H30A 2D1NA 1UTZA 2OVZA 5BOYA 456CA 3MA2A 1SRPA 4Q1LA 3E8RA 4XM8A 2W14A 1FM1A 1ATLA 3HY7A 3OHOA 1D5JA 3LIRA 1CGFA 3U1RA 1JANA 1DMTA 4A7BA 5I4OA 3LEAA 3F19A
chains in the Genus database with same CATH topology
3KMCA 2XS4A 3HBUP 5BPAA 3NX7A 2A8HA 5I0LA 1CIZA 2FV5A 2J83A 4G0DA 2WOAA 1FBLA 3ZXHA 4WK7A 4HMAA 1QICA 5D3CA 2CLTA 2AYKA 1RM8A 2E3XA 2MLSA 3OHLA 4DV8A 4GR3A 1HOVA 2WO9A 2X3BA 1G12A 2K9CA 3HDBA 2E2DA 1D8FA 2QPJA 966CA 1KUFA 3HYGA 1Y0VA 1C8TA 1IAAA 1GXDA 3N2VA 4JPAA 3L0TA 1K7IA 3AIGA 2USNA 3DWBA 3I7IA 2DW0A 2K2GA 1KAPP 3Q2GA 4L7AA 4L19A 1I1IP 3F18A 1GO7P 1XURA 2OVXA 4H1QA 1B3DA 2OW9A 2V4BA 4ZR5A 1EAKA 1FLSA 1SATA 3EHXA 3EWJA 2KRJA 1KUKA 1CXVA 1EB6A 2FV9A 3LMCA 2OXWA 5L79A 1XUDA 3VI1A 1J7NA 2MZEA 3GBOA 3HBVP 3LGPA 1OO9A 4A3WA 2YIGA 1R1IA 1EUBA 3LIKA 4GR8A 1JAPA 1A86A 2OW0A 3KEJA 1IAEA 2TCLA 2Y6DA 1D7XA 1PWUA 2W0DA 1UEAA 1MMQA 5LABA 1AKLA 2PJTA 1OMJA 2X7MA 1KBCA 3EDIA 4JA1A 4R3VA 1BKCA 3LUMA 3B8ZA 3F16A 3P24A 4CTHA 1ASTA 3AYKA 3BA0A 2D1OA 1BUVM 2L0RA 1ZS0A 2JT6A 2YB9A 2ERPA 1MMBA 5D1UA 1JIZA 3HY9A 3ZUKA 3O64A 3LJGA 4AIGA 1IAGA 3L0VA 4GF1A 1JH1A 1DTHA 5JMYA 3TT4A 4H84A 1BQOA 5CUHA 1ZVXA 3DTKA 4FXYP 5H8XA 4FVLA 3KEKA 3ELMA 2W15A 1G49A 1OM7A 1UTTA 4GUYA 5D1SA 2XS3A 2OW1A 3UVCA 4H76A 4H2EA 3WV3A 5I2ZA 1B8YA 2OI0A 3G42A 3KMEA 4IUWA 1A85A 4I35A 4IJOA 3USNA 1BQQM 3LE9A 1PWVA 2WO8A 3EHYA 1G9KA 4GR0A 4JP4A 4DD8A 1JJ9A 4H82A 1ZP5A 1JAQA 5BOTA 1D8MA 4H49A 4PKWA 4WKIA 3SHIA 3DPFA 1KUHA 4J4MA 3HDAP 1GE7A 2X3CA 1CK7A 4FU4A 3DSLA 1BM6A 2I47A 2EROA 1KUGA 2DW2A 4GWMA 1WNIA 2Z2DA 1R55A 2W12A 3V96B 1AYKA 3B92A 2ERQA 1IACA 3KHIA 4ON1A 2MZIA 1R54A 3LJTA 2YUFA 3HB2P 3AYUA 3DL1A 3KECA 1HV5A 1JKYA 3F1AA 1O0TA 5D2BA 1UMSA 1MMPA 3P1VA 1OM6A 4PKVA 1S4BP 1XUCA 1HFCA 1USNA 1H71P 2JSDA 1OS2A 4AXQA 1I73A 5B5OA 1ND1A 2SRTA 2DW1A 1R1JA 4PKRA 4ILWD 1QIAA 1ZXCA 1JAOA 2N8RA 3KRYA 1I76A 1BSWA 3DTIA 3KWVC 1GE6A 4IN9A 5D7WA 1CQRA 1BKCE 1Z3JA 3CKIA 1GKDA 1SU3A 3DPEA 4QKZA 1XFWA 2DDYA 5CZMA 3B2ZA 4PKSA 4XCTA 1UMTA 4I03A 1XFUA 1MNCA 1GO8P 1ROSA 4L6TA 5D1TA 3TS4A 4H3XA 1QJIA 2O3EA 3K7LA 3EDZA 3RTTA 1YQYA 1PWWA 1YCMA 2POJA 1AF0A 1K7QA 4WZVA 2RJQA 5B5PA 1GE5A 1HY7A 4PKQA 2Y6CA 3LKAA 3I7GA 4AYKA 3DTEA 1HTDA 1CGEA 2JT5A 3O2XA 3F15A 2OZRA 1Q3AA 1XFXA 3LQBA 1JIWP 4L63A 3RTSA 1OM8A 1XFVA 2MZHA 3K7NA 1G4KA 3LK8A 4XM6A 4HX3A 1ZTQA 2OXZA 1QUAA 3ZVSA 3TSKA 2OY4A 1ZXVA 2AIGP 1YP1A 1QJJA 1CAQA 1IABA 5I3MA 1BZSA 1JK3A 3VTGA 2OXUA 4DF9A 1BUDA 2JIHA 2J0TA 1XFZA 3N2UA 3LILA 2DDFA 4XM7A 4AUOA 3WV1A 1OS9A 1GKCA 1XFYA 3EDHA 4WF6A 3EDGA 3TVCA 1HFSA 1PWPA 2X3AA 1CGLA 1BIWA 4FXQA 2O36A 1C7KA 3F17A 1MMRA 1SLMA 4XBHA 1G05A 3Q2HA 1YOUA 5I43A 2CKIA 4GQLA 2HU6A 4JQGA 1K7GA 2MLRA 1KUIA 1L6JA 4EFSA 3LUNA 1RMZA 4WKEA 3G5CA 1R1HA 2OW2A 2JNPA 1PWQA 3LJZA 1IADA 2W13A 4G9LA 1BKCI 5CXAA 5L7FA 1C3IA 2OY2A 4JIJA 1Y8JA 3WV2A 4DPEA 1SLNA 4GWNA 4PKTA 1SMPA 5I12A 3DNGA 1QIBA 1Y93A 2RJPA 3LQ0A 4PKUA 1O0QA 830CA 4H30A 2D1NA 1UTZA 2OVZA 5BOYA 456CA 3MA2A 1SRPA 4Q1LA 3E8RA 4XM8A 2W14A 1FM1A 1ATLA 3HY7A 3OHOA 1D5JA 3LIRA 1CGFA 3U1RA 1JANA 1DMTA 4A7BA 5I4OA 3LEAA 3F19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KMC A;  2XS4 A;  3HBU P;  5BPA A;  3NX7 A;  2A8H A;  5I0L A;  1CIZ A;  2FV5 A;  2J83 A;  4G0D A;  2WOA A;  1FBL A;  3ZXH A;  4WK7 A;  4HMA A;  1QIC A;  5D3C A;  2CLT A;  2AYK A;  1RM8 A;  2E3X A;  2MLS A;  3OHL A;  4DV8 A;  4GR3 A;  1HOV A;  2WO9 A;  2X3B A;  1G12 A;  2K9C A;  3HDB A;  2E2D A;  1D8F A;  2QPJ A;  966C A;  1KUF A;  3HYG A;  1Y0V A;  1C8T A;  1IAA A;  1GXD A;  3N2V A;  4JPA A;  3L0T A;  1K7I A;  3AIG A;  2USN A;  3DWB A;  3I7I A;  2DW0 A;  2K2G A;  1KAP P;  3Q2G A;  4L19 A;  1I1I P;  3F18 A;  1GO7 P;  1XUR A;  2OVX A;  4H1Q A;  1B3D A;  2OW9 A;  2V4B A;  4ZR5 A;  1EAK A;  1FLS A;  1SAT A;  3EHX A;  3EWJ A;  2KRJ A;  1KUK A;  1CXV A;  1EB6 A;  2FV9 A;  3LMC A;  2OXW A;  5L79 A;  1XUD A;  3VI1 A;  1J7N A;  2MZE A;  3GBO A;  3HBV P;  3LGP A;  1OO9 A;  4A3W A;  2YIG A;  1R1I A;  1EUB A;  3LIK A;  4GR8 A;  1JAP A;  1A86 A;  2OW0 A;  3KEJ A;  1IAE A;  2TCL A;  2Y6D A;  1D7X A;  1PWU A;  2W0D A;  1UEA A;  1MMQ A;  5LAB A;  1AKL A;  2PJT A;  1OMJ A;  2X7M A;  1KBC A;  3EDI A;  4JA1 A;  4R3V A;  1BKC A;  3LUM A;  3B8Z A;  3F16 A;  3P24 A;  4CTH A;  1AST A;  3AYK A;  3BA0 A;  2D1O A;  1BUV M;  2L0R A;  1ZS0 A;  2JT6 A;  2YB9 A;  2ERP A;  1MMB A;  5D1U A;  1JIZ A;  3HY9 A;  3ZUK A;  3O64 A;  3LJG A;  4AIG A;  1IAG A;  3L0V A;  4GF1 A;  1JH1 A;  1DTH A;  5JMY A;  3TT4 A;  4H84 A;  1BQO A;  5CUH A;  1ZVX A;  4FXY P;  5H8X A;  4FVL A;  3KEK A;  3ELM A;  2W15 A;  1G49 A;  1OM7 A;  1UTT A;  4GUY A;  5D1S A;  2XS3 A;  2OW1 A;  3UVC A;  4H76 A;  4H2E A;  3WV3 A;  5I2Z A;  1B8Y A;  2OI0 A;  3G42 A;  3KME A;  4IUW A;  1A85 A;  4I35 A;  4IJO A;  3USN A;  1BQQ M;  3LE9 A;  1PWV A;  2WO8 A;  3EHY A;  1G9K A;  4GR0 A;  4JP4 A;  4DD8 A;  1JJ9 A;  4H82 A;  1ZP5 A;  1JAQ A;  5BOT A;  1D8M A;  4H49 A;  4PKW A;  4WKI A;  3SHI A;  3DPF A;  1KUH A;  4J4M A;  3HDA P;  1GE7 A;  2X3C A;  1CK7 A;  4FU4 A;  3DSL A;  1BM6 A;  2I47 A;  2ERO A;  1KUG A;  2DW2 A;  4GWM A;  1WNI A;  2Z2D A;  1R55 A;  2W12 A;  3V96 B;  1AYK A;  3B92 A;  2ERQ A;  1IAC A;  3KHI A;  4ON1 A;  2MZI A;  3LJT A;  1R54 A;  3HB2 P;  3AYU A;  3DL1 A;  3KEC A;  1HV5 A;  1JKY A;  3F1A A;  1O0T A;  5D2B A;  1UMS A;  1MMP A;  3P1V A;  1OM6 A;  4PKV A;  1S4B P;  1XUC A;  1HFC A;  1USN A;  1H71 P;  2JSD A;  1OS2 A;  4AXQ A;  1I73 A;  5B5O A;  1ND1 A;  2SRT A;  2DW1 A;  1R1J A;  4PKR A;  4ILW D;  1QIA A;  1ZXC A;  1JAO A;  2N8R A;  3KRY A;  1I76 A;  1BSW A;  3KWV C;  1GE6 A;  4IN9 A;  5D7W A;  1CQR A;  1BKC E;  1Z3J A;  3CKI A;  1GKD A;  1SU3 A;  3DPE A;  4QKZ A;  1XFW A;  2DDY A;  5CZM A;  3B2Z A;  4PKS A;  4XCT A;  1UMT A;  4I03 A;  1XFU A;  1MNC A;  1GO8 P;  1ROS A;  4L6T A;  5D1T A;  3TS4 A;  4H3X A;  1QJI A;  2O3E A;  3K7L A;  3EDZ A;  3RTT A;  1YQY A;  1PWW A;  1YCM A;  2POJ A;  1AF0 A;  1K7Q A;  4WZV A;  2RJQ A;  5B5P A;  1GE5 A;  1HY7 A;  4PKQ A;  2Y6C A;  3LKA A;  3I7G A;  4AYK A;  1HTD A;  1CGE A;  2JT5 A;  3O2X A;  3F15 A;  2OZR A;  1Q3A A;  1XFX A;  3LQB A;  1JIW P;  4L63 A;  3RTS A;  1OM8 A;  1XFV A;  2MZH A;  3K7N A;  1G4K A;  3LK8 A;  4XM6 A;  4HX3 A;  1ZTQ A;  2OXZ A;  1QUA A;  3ZVS A;  3TSK A;  2OY4 A;  1ZXV A;  2AIG P;  1YP1 A;  1QJJ A;  1CAQ A;  1IAB A;  5I3M A;  1BZS A;  1JK3 A;  3VTG A;  2OXU A;  4DF9 A;  1BUD A;  2JIH A;  2J0T A;  1XFZ A;  3N2U A;  3LIL A;  2DDF A;  4XM7 A;  4AUO A;  3WV1 A;  1OS9 A;  1GKC A;  1XFY A;  3EDH A;  4WF6 A;  3EDG A;  3TVC A;  1HFS A;  1PWP A;  2X3A A;  1CGL A;  1BIW A;  4FXQ A;  2O36 A;  1C7K A;  3F17 A;  1MMR A;  1SLM A;  4XBH A;  1G05 A;  3Q2H A;  1YOU A;  5I43 A;  2CKI A;  4GQL A;  2HU6 A;  4JQG A;  1K7G A;  2MLR A;  1KUI A;  1L6J A;  4EFS A;  3LUN A;  1RMZ A;  4WKE A;  3G5C A;  1R1H A;  2OW2 A;  2JNP A;  1PWQ A;  3LJZ A;  1IAD A;  2W13 A;  4G9L A;  1BKC I;  5CXA A;  5L7F A;  1C3I A;  2OY2 A;  4JIJ A;  1Y8J A;  3WV2 A;  4DPE A;  1SLN A;  4GWN A;  4PKT A;  1SMP A;  5I12 A;  3DNG A;  1QIB A;  1Y93 A;  2RJP A;  3LQ0 A;  4PKU A;  1O0Q A;  830C A;  4H30 A;  2D1N A;  1UTZ A;  2OVZ A;  5BOY A;  456C A;  3MA2 A;  1SRP A;  4Q1L A;  3E8R A;  4XM8 A;  2W14 A;  1FM1 A;  1ATL A;  3HY7 A;  3OHO A;  1D5J A;  3LIR A;  1CGF A;  3U1R A;  1JAN A;  1DMT A;  4A7B A;  5I4O A;  3LEA A;  3F19 A; 
#chains in the Genus database with same CATH topology
 3KMC A;  2XS4 A;  3HBU P;  5BPA A;  3NX7 A;  2A8H A;  5I0L A;  1CIZ A;  2FV5 A;  2J83 A;  4G0D A;  2WOA A;  1FBL A;  3ZXH A;  4WK7 A;  4HMA A;  1QIC A;  5D3C A;  2CLT A;  2AYK A;  1RM8 A;  2E3X A;  2MLS A;  3OHL A;  4DV8 A;  4GR3 A;  1HOV A;  2WO9 A;  2X3B A;  1G12 A;  2K9C A;  3HDB A;  2E2D A;  1XM5 A;  1D8F A;  2QPJ A;  966C A;  1KUF A;  3HYG A;  1Y0V A;  1C8T A;  1IAA A;  1GXD A;  3N2V A;  4JPA A;  3L0T A;  1K7I A;  3AIG A;  2USN A;  3DWB A;  3I7I A;  2DW0 A;  2K2G A;  1KAP P;  3Q2G A;  4L7A A;  4L19 A;  1I1I P;  3F18 A;  1GO7 P;  1XUR A;  2OVX A;  4H1Q A;  1B3D A;  2OW9 A;  2V4B A;  4ZR5 A;  1EAK A;  1FLS A;  1SAT A;  3EHX A;  3EWJ A;  2KRJ A;  1KUK A;  1CXV A;  1EB6 A;  2FV9 A;  3LMC A;  2OXW A;  5L79 A;  1XUD A;  3VI1 A;  1J7N A;  2MZE A;  3GBO A;  3HBV P;  3LGP A;  1OO9 A;  4A3W A;  2YIG A;  1R1I A;  1EUB A;  3LIK A;  4GR8 A;  1JAP A;  1A86 A;  2OW0 A;  3KEJ A;  1IAE A;  2TCL A;  2Y6D A;  1D7X A;  1PWU A;  2W0D A;  1UEA A;  1MMQ A;  5LAB A;  1AKL A;  2PJT A;  1OMJ A;  2X7M A;  1KBC A;  3EDI A;  4JA1 A;  4R3V A;  1BKC A;  3LUM A;  3B8Z A;  3F16 A;  3P24 A;  4CTH A;  1AST A;  3AYK A;  3BA0 A;  2D1O A;  1BUV M;  2L0R A;  1ZS0 A;  2JT6 A;  2YB9 A;  2ERP A;  1MMB A;  5D1U A;  1JIZ A;  3HY9 A;  3ZUK A;  3O64 A;  3LJG A;  4AIG A;  1IAG A;  3L0V A;  4GF1 A;  1JH1 A;  1DTH A;  5JMY A;  1XAX A;  3TT4 A;  4H84 A;  1BQO A;  5CUH A;  1ZVX A;  3DTK A;  4FXY P;  5H8X A;  4FVL A;  3KEK A;  3ELM A;  2W15 A;  1G49 A;  1OM7 A;  1UTT A;  4GUY A;  5D1S A;  2XS3 A;  2OW1 A;  3UVC A;  4H76 A;  4H2E A;  3WV3 A;  5I2Z A;  1B8Y A;  2OI0 A;  3G42 A;  3KME A;  4IUW A;  1A85 A;  4I35 A;  4IJO A;  3USN A;  1BQQ M;  3LE9 A;  1PWV A;  2WO8 A;  3EHY A;  1G9K A;  4GR0 A;  4JP4 A;  4DD8 A;  1TVI A;  1JJ9 A;  4H82 A;  1ZP5 A;  1JAQ A;  5BOT A;  1D8M A;  4H49 A;  4PKW A;  4WKI A;  3SHI A;  3DPF A;  1KUH A;  4J4M A;  3HDA P;  1GE7 A;  2X3C A;  1CK7 A;  4FU4 A;  3DSL A;  1BM6 A;  2I47 A;  2ERO A;  1KUG A;  2DW2 A;  4GWM A;  1WNI A;  2Z2D A;  1R55 A;  2W12 A;  3V96 B;  1AYK A;  3B92 A;  2ERQ A;  1IAC A;  3KHI A;  4ON1 A;  2MZI A;  1R54 A;  3LJT A;  2YUF A;  3HB2 P;  3AYU A;  3DL1 A;  3KEC A;  1HV5 A;  1JKY A;  3F1A A;  1O0T A;  5D2B A;  1UMS A;  1MMP A;  3P1V A;  1OM6 A;  4PKV A;  1S4B P;  1XUC A;  1HFC A;  1USN A;  1H71 P;  2JSD A;  1OS2 A;  4AXQ A;  1I73 A;  5B5O A;  1ND1 A;  2SRT A;  2DW1 A;  1R1J A;  4PKR A;  4ILW D;  1QIA A;  1ZXC A;  1JAO A;  2N8R A;  3KRY A;  1I76 A;  1BSW A;  3DTI A;  3KWV C;  1GE6 A;  4IN9 A;  5D7W A;  1CQR A;  1BKC E;  1Z3J A;  3CKI A;  1GKD A;  1SU3 A;  3DPE A;  4QKZ A;  1XFW A;  2DDY A;  5CZM A;  3B2Z A;  4PKS A;  4XCT A;  1UMT A;  4I03 A;  1XFU A;  1MNC A;  1GO8 P;  1ROS A;  4L6T A;  5D1T A;  3TS4 A;  4H3X A;  1QJI A;  2O3E A;  3K7L A;  3EDZ A;  3RTT A;  1YQY A;  1PWW A;  1YCM A;  2POJ A;  1AF0 A;  1K7Q A;  4WZV A;  1OZ9 A;  2RJQ A;  5B5P A;  1GE5 A;  1HY7 A;  4PKQ A;  2Y6C A;  3LKA A;  3I7G A;  4AYK A;  3DTE A;  1HTD A;  1CGE A;  2JT5 A;  3O2X A;  3F15 A;  2OZR A;  1Q3A A;  1XFX A;  3LQB A;  1JIW P;  4L63 A;  3RTS A;  1OM8 A;  1XFV A;  2MZH A;  3K7N A;  1G4K A;  3LK8 A;  4XM6 A;  4HX3 A;  1ZTQ A;  2OXZ A;  1QUA A;  3ZVS A;  3TSK A;  2OY4 A;  1ZXV A;  2AIG P;  1YP1 A;  1QJJ A;  1CAQ A;  1IAB A;  5I3M A;  1BZS A;  1JK3 A;  3VTG A;  2OXU A;  4DF9 A;  1BUD A;  2JIH A;  2J0T A;  1XFZ A;  3N2U A;  3LIL A;  2DDF A;  4XM7 A;  4AUO A;  3WV1 A;  1OS9 A;  1GKC A;  1XFY A;  3EDH A;  4WF6 A;  3EDG A;  3TVC A;  1HFS A;  1PWP A;  2X3A A;  1CGL A;  1BIW A;  4FXQ A;  2O36 A;  1C7K A;  3F17 A;  1MMR A;  1SLM A;  4XBH A;  1G05 A;  3Q2H A;  1YOU A;  5I43 A;  2CKI A;  4GQL A;  2HU6 A;  4JQG A;  1K7G A;  2MLR A;  1KUI A;  1L6J A;  4EFS A;  3LUN A;  1RMZ A;  4WKE A;  3G5C A;  1R1H A;  2OW2 A;  2JNP A;  1PWQ A;  3LJZ A;  1IAD A;  2W13 A;  4G9L A;  1BKC I;  5CXA A;  5L7F A;  1C3I A;  2OY2 A;  4JIJ A;  1Y8J A;  3WV2 A;  4DPE A;  1SLN A;  4GWN A;  4PKT A;  1SMP A;  5I12 A;  3DNG A;  1QIB A;  1Y93 A;  2RJP A;  3LQ0 A;  4PKU A;  1O0Q A;  830C A;  4H30 A;  2D1N A;  1UTZ A;  2OVZ A;  5BOY A;  456C A;  3MA2 A;  1SRP A;  4Q1L A;  3E8R A;  4XM8 A;  2W14 A;  1FM1 A;  1ATL A;  3HY7 A;  3OHO A;  1D5J A;  3LIR A;  1CGF A;  3U1R A;  1JAN A;  1DMT A;  4A7B A;  5I4O A;  3LEA A;  3F19 A; 
#chains in the Genus database with same CATH homology
 3KMC A;  2XS4 A;  3HBU P;  5BPA A;  3NX7 A;  2A8H A;  5I0L A;  1CIZ A;  2FV5 A;  2J83 A;  4G0D A;  2WOA A;  1FBL A;  3ZXH A;  4WK7 A;  4HMA A;  1QIC A;  5D3C A;  2CLT A;  2AYK A;  1RM8 A;  2E3X A;  2MLS A;  3OHL A;  4DV8 A;  4GR3 A;  1HOV A;  2WO9 A;  2X3B A;  1G12 A;  2K9C A;  3HDB A;  2E2D A;  1D8F A;  2QPJ A;  966C A;  1KUF A;  3HYG A;  1Y0V A;  1C8T A;  1IAA A;  1GXD A;  3N2V A;  4JPA A;  3L0T A;  1K7I A;  3AIG A;  2USN A;  3DWB A;  3I7I A;  2DW0 A;  2K2G A;  1KAP P;  3Q2G A;  4L7A A;  4L19 A;  1I1I P;  3F18 A;  1GO7 P;  1XUR A;  2OVX A;  4H1Q A;  1B3D A;  2OW9 A;  2V4B A;  4ZR5 A;  1EAK A;  1FLS A;  1SAT A;  3EHX A;  3EWJ A;  2KRJ A;  1KUK A;  1CXV A;  1EB6 A;  2FV9 A;  3LMC A;  2OXW A;  5L79 A;  1XUD A;  3VI1 A;  1J7N A;  2MZE A;  3GBO A;  3HBV P;  3LGP A;  1OO9 A;  4A3W A;  2YIG A;  1R1I A;  1EUB A;  3LIK A;  4GR8 A;  1JAP A;  1A86 A;  2OW0 A;  3KEJ A;  1IAE A;  2TCL A;  2Y6D A;  1D7X A;  1PWU A;  2W0D A;  1UEA A;  1MMQ A;  5LAB A;  1AKL A;  2PJT A;  1OMJ A;  2X7M A;  1KBC A;  3EDI A;  4JA1 A;  4R3V A;  1BKC A;  3LUM A;  3B8Z A;  3F16 A;  3P24 A;  4CTH A;  1AST A;  3AYK A;  3BA0 A;  2D1O A;  1BUV M;  2L0R A;  1ZS0 A;  2JT6 A;  2YB9 A;  2ERP A;  1MMB A;  5D1U A;  1JIZ A;  3HY9 A;  3ZUK A;  3O64 A;  3LJG A;  4AIG A;  1IAG A;  3L0V A;  4GF1 A;  1JH1 A;  1DTH A;  5JMY A;  3TT4 A;  4H84 A;  1BQO A;  5CUH A;  1ZVX A;  3DTK A;  4FXY P;  5H8X A;  4FVL A;  3KEK A;  3ELM A;  2W15 A;  1G49 A;  1OM7 A;  1UTT A;  4GUY A;  5D1S A;  2XS3 A;  2OW1 A;  3UVC A;  4H76 A;  4H2E A;  3WV3 A;  5I2Z A;  1B8Y A;  2OI0 A;  3G42 A;  3KME A;  4IUW A;  1A85 A;  4I35 A;  4IJO A;  3USN A;  1BQQ M;  3LE9 A;  1PWV A;  2WO8 A;  3EHY A;  1G9K A;  4GR0 A;  4JP4 A;  4DD8 A;  1JJ9 A;  4H82 A;  1ZP5 A;  1JAQ A;  5BOT A;  1D8M A;  4H49 A;  4PKW A;  4WKI A;  3SHI A;  3DPF A;  1KUH A;  4J4M A;  3HDA P;  1GE7 A;  2X3C A;  1CK7 A;  4FU4 A;  3DSL A;  1BM6 A;  2I47 A;  2ERO A;  1KUG A;  2DW2 A;  4GWM A;  1WNI A;  2Z2D A;  1R55 A;  2W12 A;  3V96 B;  1AYK A;  3B92 A;  2ERQ A;  1IAC A;  3KHI A;  4ON1 A;  2MZI A;  1R54 A;  3LJT A;  2YUF A;  3HB2 P;  3AYU A;  3DL1 A;  3KEC A;  1HV5 A;  1JKY A;  3F1A A;  1O0T A;  5D2B A;  1UMS A;  1MMP A;  3P1V A;  1OM6 A;  4PKV A;  1S4B P;  1XUC A;  1HFC A;  1USN A;  1H71 P;  2JSD A;  1OS2 A;  4AXQ A;  1I73 A;  5B5O A;  1ND1 A;  2SRT A;  2DW1 A;  1R1J A;  4PKR A;  4ILW D;  1QIA A;  1ZXC A;  1JAO A;  2N8R A;  3KRY A;  1I76 A;  1BSW A;  3DTI A;  3KWV C;  1GE6 A;  4IN9 A;  5D7W A;  1CQR A;  1BKC E;  1Z3J A;  3CKI A;  1GKD A;  1SU3 A;  3DPE A;  4QKZ A;  1XFW A;  2DDY A;  5CZM A;  3B2Z A;  4PKS A;  4XCT A;  1UMT A;  4I03 A;  1XFU A;  1MNC A;  1GO8 P;  1ROS A;  4L6T A;  5D1T A;  3TS4 A;  4H3X A;  1QJI A;  2O3E A;  3K7L A;  3EDZ A;  3RTT A;  1YQY A;  1PWW A;  1YCM A;  2POJ A;  1AF0 A;  1K7Q A;  4WZV A;  2RJQ A;  5B5P A;  1GE5 A;  1HY7 A;  4PKQ A;  2Y6C A;  3LKA A;  3I7G A;  4AYK A;  3DTE A;  1HTD A;  1CGE A;  2JT5 A;  3O2X A;  3F15 A;  2OZR A;  1Q3A A;  1XFX A;  3LQB A;  1JIW P;  4L63 A;  3RTS A;  1OM8 A;  1XFV A;  2MZH A;  3K7N A;  1G4K A;  3LK8 A;  4XM6 A;  4HX3 A;  1ZTQ A;  2OXZ A;  1QUA A;  3ZVS A;  3TSK A;  2OY4 A;  1ZXV A;  2AIG P;  1YP1 A;  1QJJ A;  1CAQ A;  1IAB A;  5I3M A;  1BZS A;  1JK3 A;  3VTG A;  2OXU A;  4DF9 A;  1BUD A;  2JIH A;  2J0T A;  1XFZ A;  3N2U A;  3LIL A;  2DDF A;  4XM7 A;  4AUO A;  3WV1 A;  1OS9 A;  1GKC A;  1XFY A;  3EDH A;  4WF6 A;  3EDG A;  3TVC A;  1HFS A;  1PWP A;  2X3A A;  1CGL A;  1BIW A;  4FXQ A;  2O36 A;  1C7K A;  3F17 A;  1MMR A;  1SLM A;  4XBH A;  1G05 A;  3Q2H A;  1YOU A;  5I43 A;  2CKI A;  4GQL A;  2HU6 A;  4JQG A;  1K7G A;  2MLR A;  1KUI A;  1L6J A;  4EFS A;  3LUN A;  1RMZ A;  4WKE A;  3G5C A;  1R1H A;  2OW2 A;  2JNP A;  1PWQ A;  3LJZ A;  1IAD A;  2W13 A;  4G9L A;  1BKC I;  5CXA A;  5L7F A;  1C3I A;  2OY2 A;  4JIJ A;  1Y8J A;  3WV2 A;  4DPE A;  1SLN A;  4GWN A;  4PKT A;  1SMP A;  5I12 A;  3DNG A;  1QIB A;  1Y93 A;  2RJP A;  3LQ0 A;  4PKU A;  1O0Q A;  830C A;  4H30 A;  2D1N A;  1UTZ A;  2OVZ A;  5BOY A;  456C A;  3MA2 A;  1SRP A;  4Q1L A;  3E8R A;  4XM8 A;  2W14 A;  1FM1 A;  1ATL A;  3HY7 A;  3OHO A;  1D5J A;  3LIR A;  1CGF A;  3U1R A;  1JAN A;  1DMT A;  4A7B A;  5I4O A;  3LEA A;  3F19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...