5I43A

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate chelator water-soluble inhibitor (dc32).
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
157
structure length
157
Chain Sequence
b'PVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHQIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i43A00
1UMSA 2JT6A 3K7LA 1R54A 1Y0VA 4H49A 4IN9A 5CUHA 2OW0A 3P1VA 3HYGA 1FLSA 5D1UA 1A86A 3EDGA 2OW2A 2Y6DA 4G9LA 1KUGA 3TT4A 4QKZA 1UEAA 4IJOA 1GKDA 1KUIA 3G5CA 4XM8A 1G49A 1JH1A 1B3DA 5JMYA 2OW1A 1YP1A 4GWNA 1JANA 1ZTQA 1OO9A 3ELMA 2O36A 1CGLA 4AUOA 3HBVP 1B8YA 3O2XA 1BZSA 3ZUKA 1CAQA 3KECA 1R1IA 1ZS0A 2W15A 2D1NA 3RTSA 3HY7A 2JT5A 3G42A 1RMZA 5D7WA 3V96B 1EUBA 4FXQA 1AKLA 3KMEA 1HOVA 4G0DA 1HTDA 830CA 2MLSA 4JP4A 1D5JA 4PKWA 1CXVA 1MNCA 5L7FA 4WKIA 1ROSA 1SRPA 3HB2P 4DF9A 3SHIA 2OY2A 1IAAA 3LK8A 1R1HA 1C8TA 1GE6A 4WF6A 4L63A 4A7BA 4ILWD 1UMTA 3L0VA 1D8FA 3DWBA 3F18A 4JA1A 1GE5A 3GBOA 2JIHA 3LQ0A 1GKCA 1QIBA 1YCMA 1XFZA 1JK3A 5D1TA 5B5OA 966CA 1JIWP 5L79A 2SRTA 2OVZA 4CTHA 5I4OA 1OS2A 3B2ZA 3Q2HA 1XFUA 1C3IA 1HV5A 1SLNA 3LJTA 1RM8A 1L6JA 2OXZA 3E8RA 4L19A 1MMPA 1O0QA 1BUDA 1YQYA 3EDIA 1ATLA 1A85A 3KMCA 1HFCA 2KRJA 3Q2GA 1KUKA 3KRYA 2TCLA 4R3VA 2ERPA 1GXDA 4JPAA 2EROA 5CXAA 1BKCA 1KAPP 4PKRA 1XFWA 1AYKA 2OZRA 4GF1A 1I1IP 3I7GA 1PWPA 3LEAA 1XFYA 1PWQA 3USNA 4PKTA 3EDHA 3DPEA 4PKQA 2AYKA 1EB6A 4DV8A 1CIZA 1QUAA 2MLRA 2MZIA 1K7QA 1JIZA 2Z2DA 3LKAA 1R55A 4WKEA 2DW2A 1PWUA 1Y93A 3WV3A 5I43A 1UTTA 1DTHA 4IUWA 3RTTA 2X3BA 2QPJA 1J7NA 3NX7A 1USNA 2OXUA 2WO8A 2POJA 3LUMA 4H3XA 1XFVA 1CGEA 1GE7A 1OMJA 1BKCE 2DW1A 1BQOA 2OXWA 1BUVM 3EHXA 4A3WA 1D8MA 4AIGA 5CZMA 3KWVC 1BKCI 2J0TA 3LJGA 1K7IA 3EDZA 4JIJA 2XS3A 3OHOA 5I2ZA 1G05A 2OY4A 3DPFA 1JAQA 1I73A 3AIGA 1ZVXA 4I03A 1IADA 1C7KA 2N8RA 4L6TA 3LUNA 5D1SA 2X7MA 4HMAA 4GR8A 2O3EA 1QICA 3LJZA 1H71P 2WOAA 1I76A 2FV5A 2RJQA 4H1QA 3HDAP 3ZVSA 5D2BA 4H30A 1ZXCA 3VI1A 2OI0A 2JSDA 3CKIA 5B5PA 2I47A 5D3CA 4DPEA 3LE9A 4AXQA 2OW9A 1IAEA 4H84A 4Q1LA 1SLMA 1R1JA 3KHIA 4H2EA 1BQQM 4I35A 1SATA 1G9KA 1MMBA 4XCTA 2E2DA 1CGFA 1OS9A 2Y6CA 3K7NA 4DD8A 2DDYA 3TVCA 2RJPA 1QJJA 2E3XA 5I3MA 2OVXA 3B92A 2W12A 4GR3A 3F1AA 1Q3AA 3KEKA 3O64A 2HU6A 3F15A 3I7IA 3AYUA 1JJ9A 1KUFA 5LABA 1JAPA 1HFSA 2FV9A 1FM1A 2D1OA 2L0RA 3HBUP 3LGPA 1CK7A 2WO9A 2MZHA 4HX3A 1GO7P 1S4BP 1PWVA 2DDFA 1K7GA 3TS4A 2X3AA 2PJTA 1CQRA 4FVLA 2CLTA 1EAKA 1BSWA 2V4BA 5I12A 2AIGP 3HY9A 4ZR5A 1ND1A 4H82A 3B8ZA 3LQBA 3MA2A 1MMQA 4FXYP 1XUDA 3WV2A 2DW0A 3AYKA 3OHLA 1QJIA 1FBLA 5I0LA 1GO8P 1KBCA 3DL1A 1DMTA 3LMCA 5BOYA 4PKUA 3DSLA 1OM7A 4XM6A 5BOTA 3F16A 2K9CA 3BA0A 2W13A 1JKYA 3TSKA 2MZEA 3LILA 2JNPA 1BIWA 2J83A 5H8XA 3ZXHA 3DNGA 3N2UA 3U1RA 2W14A 1IACA 2A8HA 3F17A 3N2VA 4AYKA 4JQGA 3EWJA 1XURA 1IAGA 1MMRA 4PKSA 1JAOA 3HDBA 4FU4A 4GWMA 3L0TA 1ASTA 1SU3A 1Z3JA 2USNA 2YIGA 3LIRA 1KUHA 3F19A 2K2GA 1OM6A 5BPAA 1ZXVA 1O0TA 2ERQA 1HY7A 1XFXA 1G12A 1BM6A 2XS4A 4GQLA 3VTGA 2YB9A 1ZP5A 1XUCA 4WZVA 1Y8JA 2CKIA 4XM7A 2X3CA 4EFSA 1SMPA 1UTZA 1WNIA 3KEJA 4ON1A 2W0DA 1IABA 1D7XA 3EHYA 1QIAA 4H76A 4GUYA 456CA 3P24A 1AF0A 3LIKA 4WK7A 4J4MA 1G4KA 4PKVA 4GR0A 3UVCA 1PWWA 1OM8A 3WV1A 1YOUA 4XBHA
chains in the Genus database with same CATH superfamily
1UMSA 2JT6A 3K7LA 1R54A 1Y0VA 4H49A 4IN9A 5CUHA 2OW0A 3P1VA 3HYGA 1FLSA 1OZ9A 5D1UA 1A86A 3EDGA 2OW2A 2Y6DA 4G9LA 1KUGA 3TT4A 4QKZA 1UEAA 4IJOA 1GKDA 1KUIA 3G5CA 4XM8A 1G49A 1JH1A 1B3DA 5JMYA 2OW1A 1YP1A 4GWNA 1JANA 1ZTQA 1OO9A 3ELMA 2O36A 1CGLA 4AUOA 3HBVP 1B8YA 3O2XA 1BZSA 3ZUKA 1CAQA 3KECA 1R1IA 1ZS0A 2W15A 1XM5A 2D1NA 3RTSA 3HY7A 2JT5A 3G42A 1RMZA 5D7WA 3V96B 1EUBA 4FXQA 1AKLA 3KMEA 1HOVA 4G0DA 1HTDA 830CA 2MLSA 2YUFA 4JP4A 1D5JA 4PKWA 1CXVA 1MNCA 5L7FA 4WKIA 1ROSA 1SRPA 3HB2P 3DTIA 4DF9A 1TVIA 3SHIA 2OY2A 1IAAA 3LK8A 1R1HA 1C8TA 1GE6A 4WF6A 4L63A 4A7BA 4ILWD 1UMTA 3L0VA 1D8FA 3DWBA 3F18A 4JA1A 1GE5A 3GBOA 2JIHA 3LQ0A 1GKCA 1QIBA 1YCMA 1XFZA 1JK3A 5D1TA 5B5OA 966CA 1JIWP 5L79A 2SRTA 2OVZA 4CTHA 5I4OA 1OS2A 3B2ZA 3Q2HA 1XFUA 1C3IA 1HV5A 1SLNA 3LJTA 1RM8A 1L6JA 2OXZA 3E8RA 4L7AA 4L19A 1MMPA 1O0QA 1BUDA 1YQYA 3EDIA 1ATLA 1A85A 3KMCA 1HFCA 2KRJA 3Q2GA 1KUKA 3KRYA 2TCLA 4R3VA 2ERPA 1GXDA 4JPAA 2EROA 5CXAA 1BKCA 1KAPP 4PKRA 1XFWA 1AYKA 2OZRA 4GF1A 1I1IP 3I7GA 1PWPA 3LEAA 1XFYA 1PWQA 3USNA 4PKTA 3EDHA 3DPEA 4PKQA 2AYKA 1EB6A 4DV8A 1CIZA 1QUAA 2MLRA 2MZIA 1K7QA 1JIZA 2Z2DA 3LKAA 1R55A 4WKEA 2DW2A 1PWUA 1Y93A 3WV3A 5I43A 1UTTA 1DTHA 4IUWA 3RTTA 2X3BA 2QPJA 1J7NA 3NX7A 1USNA 2OXUA 2WO8A 2POJA 3LUMA 3DTKA 4H3XA 1XFVA 1CGEA 1GE7A 1OMJA 1BKCE 2DW1A 1BQOA 2OXWA 1BUVM 3EHXA 4A3WA 1D8MA 4AIGA 5CZMA 3KWVC 1BKCI 2J0TA 3LJGA 1K7IA 3EDZA 4JIJA 2XS3A 3OHOA 5I2ZA 1G05A 2OY4A 3DPFA 1JAQA 1I73A 3AIGA 1ZVXA 4I03A 1IADA 1C7KA 2N8RA 4L6TA 3LUNA 5D1SA 2X7MA 4HMAA 4GR8A 2O3EA 1QICA 3LJZA 1H71P 2WOAA 1I76A 2FV5A 2RJQA 4H1QA 3HDAP 3ZVSA 5D2BA 4H30A 1ZXCA 3VI1A 2OI0A 2JSDA 3CKIA 5B5PA 2I47A 5D3CA 4DPEA 3LE9A 4AXQA 2OW9A 1IAEA 4H84A 4Q1LA 1SLMA 1R1JA 3KHIA 4H2EA 1BQQM 4I35A 1SATA 1G9KA 1MMBA 4XCTA 2E2DA 1CGFA 1OS9A 2Y6CA 3K7NA 4DD8A 2DDYA 3TVCA 2RJPA 1QJJA 2E3XA 5I3MA 2OVXA 3B92A 2W12A 4GR3A 3F1AA 1Q3AA 3KEKA 3O64A 2HU6A 3F15A 3I7IA 3AYUA 1JJ9A 1KUFA 5LABA 1JAPA 1HFSA 2FV9A 1FM1A 2D1OA 2L0RA 3HBUP 3LGPA 1CK7A 2WO9A 2MZHA 4HX3A 1GO7P 1S4BP 1PWVA 2DDFA 1K7GA 3TS4A 2X3AA 2PJTA 1CQRA 4FVLA 2CLTA 1EAKA 1BSWA 2V4BA 5I12A 2AIGP 3HY9A 4ZR5A 1ND1A 4H82A 3B8ZA 3LQBA 3MA2A 1MMQA 4FXYP 1XUDA 3WV2A 2DW0A 3AYKA 3OHLA 1QJIA 1FBLA 5I0LA 1GO8P 1KBCA 3DL1A 1DMTA 3LMCA 1XAXA 5BOYA 3DTEA 4PKUA 3DSLA 1OM7A 4XM6A 5BOTA 3F16A 2K9CA 3BA0A 2W13A 1JKYA 3TSKA 2MZEA 3LILA 2JNPA 1BIWA 2J83A 5H8XA 3ZXHA 3DNGA 3N2UA 3U1RA 2W14A 1IACA 2A8HA 3F17A 3N2VA 4AYKA 4JQGA 3EWJA 1XURA 1IAGA 1MMRA 4PKSA 1JAOA 3HDBA 4FU4A 4GWMA 3L0TA 1ASTA 1SU3A 1Z3JA 2USNA 2YIGA 3LIRA 1KUHA 3F19A 2K2GA 1OM6A 5BPAA 1ZXVA 1O0TA 2ERQA 1HY7A 1XFXA 1G12A 1BM6A 2XS4A 4GQLA 3VTGA 2YB9A 1ZP5A 1XUCA 4WZVA 1Y8JA 2CKIA 4XM7A 2X3CA 4EFSA 1SMPA 1UTZA 1WNIA 3KEJA 4ON1A 2W0DA 1IABA 1D7XA 3EHYA 1QIAA 4H76A 4GUYA 456CA 3P24A 1AF0A 3LIKA 4WK7A 4J4MA 1G4KA 4PKVA 4GR0A 3UVCA 1PWWA 1OM8A 3WV1A 1YOUA 4XBHA
chains in the Genus database with same CATH topology
1UMSA 2JT6A 3K7LA 1R54A 1Y0VA 4H49A 4IN9A 5CUHA 2OW0A 3P1VA 3HYGA 1FLSA 5D1UA 1A86A 3EDGA 2OW2A 2Y6DA 4G9LA 1KUGA 3TT4A 4QKZA 1UEAA 4IJOA 1GKDA 1KUIA 3G5CA 4XM8A 1G49A 1JH1A 1B3DA 5JMYA 2OW1A 1YP1A 4GWNA 1JANA 1ZTQA 1OO9A 3ELMA 2O36A 1CGLA 4AUOA 3HBVP 1B8YA 3O2XA 1BZSA 3ZUKA 1CAQA 3KECA 1R1IA 1ZS0A 2W15A 2D1NA 3RTSA 3HY7A 2JT5A 3G42A 1RMZA 5D7WA 3V96B 1EUBA 4FXQA 1AKLA 3KMEA 1HOVA 4G0DA 1HTDA 830CA 2MLSA 2YUFA 4JP4A 1D5JA 4PKWA 1CXVA 1MNCA 5L7FA 4WKIA 1ROSA 1SRPA 3HB2P 3DTIA 4DF9A 3SHIA 2OY2A 1IAAA 3LK8A 1R1HA 1C8TA 1GE6A 4WF6A 4L63A 4A7BA 4ILWD 1UMTA 3L0VA 1D8FA 3DWBA 3F18A 4JA1A 1GE5A 3GBOA 2JIHA 3LQ0A 1GKCA 1QIBA 1YCMA 1XFZA 1JK3A 5D1TA 5B5OA 966CA 1JIWP 5L79A 2SRTA 2OVZA 4CTHA 5I4OA 1OS2A 3B2ZA 3Q2HA 1XFUA 1C3IA 1HV5A 1SLNA 3LJTA 1RM8A 1L6JA 2OXZA 3E8RA 4L7AA 4L19A 1MMPA 1O0QA 1BUDA 1YQYA 3EDIA 1ATLA 1A85A 3KMCA 1HFCA 2KRJA 3Q2GA 1KUKA 3KRYA 2TCLA 4R3VA 2ERPA 1GXDA 4JPAA 2EROA 5CXAA 1BKCA 1KAPP 4PKRA 1XFWA 1AYKA 2OZRA 4GF1A 1I1IP 3I7GA 1PWPA 3LEAA 1XFYA 1PWQA 3USNA 4PKTA 3EDHA 3DPEA 4PKQA 2AYKA 1EB6A 4DV8A 1CIZA 1QUAA 2MLRA 2MZIA 1K7QA 1JIZA 2Z2DA 3LKAA 1R55A 4WKEA 2DW2A 1PWUA 1Y93A 3WV3A 5I43A 1UTTA 1DTHA 4IUWA 3RTTA 2X3BA 2QPJA 1J7NA 3NX7A 1USNA 2OXUA 2WO8A 2POJA 3LUMA 3DTKA 4H3XA 1XFVA 1CGEA 1GE7A 1OMJA 1BKCE 2DW1A 1BQOA 2OXWA 1BUVM 3EHXA 4A3WA 1D8MA 4AIGA 5CZMA 3KWVC 1BKCI 2J0TA 3LJGA 1K7IA 3EDZA 4JIJA 2XS3A 3OHOA 5I2ZA 1G05A 2OY4A 3DPFA 1JAQA 1I73A 3AIGA 1ZVXA 4I03A 1IADA 1C7KA 2N8RA 4L6TA 3LUNA 5D1SA 2X7MA 4HMAA 4GR8A 2O3EA 1QICA 3LJZA 1H71P 2WOAA 1I76A 2FV5A 2RJQA 4H1QA 3HDAP 3ZVSA 5D2BA 4H30A 1ZXCA 3VI1A 2OI0A 2JSDA 3CKIA 5B5PA 2I47A 5D3CA 4DPEA 3LE9A 4AXQA 2OW9A 1IAEA 4H84A 4Q1LA 1SLMA 1R1JA 3KHIA 4H2EA 1BQQM 4I35A 1SATA 1G9KA 1MMBA 4XCTA 2E2DA 1CGFA 1OS9A 2Y6CA 3K7NA 4DD8A 2DDYA 3TVCA 2RJPA 1QJJA 2E3XA 5I3MA 2OVXA 3B92A 2W12A 4GR3A 3F1AA 1Q3AA 3KEKA 3O64A 2HU6A 3F15A 3I7IA 3AYUA 1JJ9A 1KUFA 5LABA 1JAPA 1HFSA 2FV9A 1FM1A 2D1OA 2L0RA 3HBUP 3LGPA 1CK7A 2WO9A 2MZHA 4HX3A 1GO7P 1S4BP 1PWVA 2DDFA 1K7GA 3TS4A 2X3AA 2PJTA 1CQRA 4FVLA 2CLTA 1EAKA 1BSWA 2V4BA 5I12A 2AIGP 3HY9A 4ZR5A 1ND1A 4H82A 3B8ZA 3LQBA 3MA2A 1MMQA 4FXYP 1XUDA 3WV2A 2DW0A 3AYKA 3OHLA 1QJIA 1FBLA 5I0LA 1GO8P 1KBCA 3DL1A 1DMTA 3LMCA 5BOYA 3DTEA 4PKUA 3DSLA 1OM7A 4XM6A 5BOTA 3F16A 2K9CA 3BA0A 2W13A 1JKYA 3TSKA 2MZEA 3LILA 2JNPA 1BIWA 2J83A 5H8XA 3ZXHA 3DNGA 3N2UA 3U1RA 2W14A 1IACA 2A8HA 3F17A 3N2VA 4AYKA 4JQGA 3EWJA 1XURA 1IAGA 1MMRA 4PKSA 1JAOA 3HDBA 4FU4A 4GWMA 3L0TA 1ASTA 1SU3A 1Z3JA 2USNA 2YIGA 3LIRA 1KUHA 3F19A 2K2GA 1OM6A 5BPAA 1ZXVA 1O0TA 2ERQA 1HY7A 1XFXA 1G12A 1BM6A 2XS4A 4GQLA 3VTGA 2YB9A 1ZP5A 1XUCA 4WZVA 1Y8JA 2CKIA 4XM7A 2X3CA 4EFSA 1SMPA 1UTZA 1WNIA 3KEJA 4ON1A 2W0DA 1IABA 1D7XA 3EHYA 1QIAA 4H76A 4GUYA 456CA 3P24A 1AF0A 3LIKA 4WK7A 4J4MA 1G4KA 4PKVA 4GR0A 3UVCA 1PWWA 1OM8A 3WV1A 1YOUA 4XBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMS A;  2JT6 A;  3K7L A;  1R54 A;  1Y0V A;  4H49 A;  4IN9 A;  5CUH A;  2OW0 A;  3P1V A;  3HYG A;  1FLS A;  5D1U A;  1A86 A;  3EDG A;  2OW2 A;  2Y6D A;  4G9L A;  1KUG A;  3TT4 A;  4QKZ A;  1UEA A;  4IJO A;  1GKD A;  1KUI A;  3G5C A;  4XM8 A;  1G49 A;  1JH1 A;  1B3D A;  5JMY A;  2OW1 A;  1YP1 A;  4GWN A;  1JAN A;  1ZTQ A;  1OO9 A;  3ELM A;  2O36 A;  1CGL A;  4AUO A;  3HBV P;  1B8Y A;  3O2X A;  1BZS A;  3ZUK A;  1CAQ A;  3KEC A;  1R1I A;  1ZS0 A;  2W15 A;  2D1N A;  3RTS A;  3HY7 A;  2JT5 A;  3G42 A;  1RMZ A;  5D7W A;  3V96 B;  1EUB A;  4FXQ A;  1AKL A;  3KME A;  1HOV A;  4G0D A;  1HTD A;  830C A;  2MLS A;  4JP4 A;  1D5J A;  4PKW A;  1CXV A;  1MNC A;  5L7F A;  4WKI A;  1ROS A;  1SRP A;  3HB2 P;  4DF9 A;  3SHI A;  2OY2 A;  1IAA A;  3LK8 A;  1R1H A;  1C8T A;  1GE6 A;  4WF6 A;  4L63 A;  4A7B A;  4ILW D;  1UMT A;  3L0V A;  1D8F A;  3DWB A;  3F18 A;  4JA1 A;  1GE5 A;  3GBO A;  2JIH A;  3LQ0 A;  1GKC A;  1QIB A;  1YCM A;  1XFZ A;  1JK3 A;  5D1T A;  5B5O A;  966C A;  1JIW P;  5L79 A;  2SRT A;  2OVZ A;  4CTH A;  5I4O A;  1OS2 A;  3B2Z A;  3Q2H A;  1XFU A;  1C3I A;  1HV5 A;  1SLN A;  3LJT A;  1RM8 A;  1L6J A;  2OXZ A;  3E8R A;  4L19 A;  1MMP A;  1O0Q A;  1BUD A;  1YQY A;  3EDI A;  1ATL A;  1A85 A;  3KMC A;  1HFC A;  2KRJ A;  3Q2G A;  1KUK A;  3KRY A;  2TCL A;  4R3V A;  2ERP A;  1GXD A;  4JPA A;  2ERO A;  5CXA A;  1BKC A;  1KAP P;  4PKR A;  1XFW A;  1AYK A;  2OZR A;  4GF1 A;  1I1I P;  3I7G A;  1PWP A;  3LEA A;  1XFY A;  1PWQ A;  3USN A;  4PKT A;  3EDH A;  3DPE A;  4PKQ A;  2AYK A;  1EB6 A;  4DV8 A;  1CIZ A;  1QUA A;  2MLR A;  2MZI A;  1K7Q A;  1JIZ A;  2Z2D A;  3LKA A;  1R55 A;  4WKE A;  2DW2 A;  1PWU A;  1Y93 A;  3WV3 A;  5I43 A;  1UTT A;  1DTH A;  4IUW A;  3RTT A;  2X3B A;  2QPJ A;  1J7N A;  3NX7 A;  1USN A;  2OXU A;  2WO8 A;  2POJ A;  3LUM A;  4H3X A;  1XFV A;  1CGE A;  1GE7 A;  1OMJ A;  1BKC E;  2DW1 A;  1BQO A;  2OXW A;  1BUV M;  3EHX A;  4A3W A;  1D8M A;  4AIG A;  5CZM A;  3KWV C;  1BKC I;  2J0T A;  3LJG A;  1K7I A;  3EDZ A;  4JIJ A;  2XS3 A;  3OHO A;  5I2Z A;  1G05 A;  2OY4 A;  3DPF A;  1JAQ A;  1I73 A;  3AIG A;  1ZVX A;  4I03 A;  1IAD A;  1C7K A;  2N8R A;  4L6T A;  3LUN A;  5D1S A;  2X7M A;  4HMA A;  4GR8 A;  2O3E A;  1QIC A;  3LJZ A;  1H71 P;  2WOA A;  1I76 A;  2FV5 A;  2RJQ A;  4H1Q A;  3HDA P;  3ZVS A;  5D2B A;  4H30 A;  1ZXC A;  3VI1 A;  2OI0 A;  2JSD A;  3CKI A;  5B5P A;  2I47 A;  5D3C A;  4DPE A;  3LE9 A;  4AXQ A;  2OW9 A;  1IAE A;  4H84 A;  4Q1L A;  1SLM A;  1R1J A;  3KHI A;  4H2E A;  1BQQ M;  4I35 A;  1SAT A;  1G9K A;  1MMB A;  4XCT A;  2E2D A;  1CGF A;  1OS9 A;  2Y6C A;  3K7N A;  4DD8 A;  2DDY A;  3TVC A;  2RJP A;  1QJJ A;  2E3X A;  5I3M A;  2OVX A;  3B92 A;  2W12 A;  4GR3 A;  3F1A A;  1Q3A A;  3KEK A;  3O64 A;  2HU6 A;  3F15 A;  3I7I A;  3AYU A;  1JJ9 A;  1KUF A;  5LAB A;  1JAP A;  1HFS A;  2FV9 A;  1FM1 A;  2D1O A;  2L0R A;  3HBU P;  3LGP A;  1CK7 A;  2WO9 A;  2MZH A;  4HX3 A;  1GO7 P;  1S4B P;  1PWV A;  2DDF A;  1K7G A;  3TS4 A;  2X3A A;  2PJT A;  1CQR A;  4FVL A;  2CLT A;  1EAK A;  1BSW A;  2V4B A;  5I12 A;  2AIG P;  3HY9 A;  4ZR5 A;  1ND1 A;  4H82 A;  3B8Z A;  3LQB A;  3MA2 A;  1MMQ A;  4FXY P;  1XUD A;  3WV2 A;  2DW0 A;  3AYK A;  3OHL A;  1QJI A;  1FBL A;  5I0L A;  1GO8 P;  1KBC A;  3DL1 A;  1DMT A;  3LMC A;  5BOY A;  4PKU A;  3DSL A;  1OM7 A;  4XM6 A;  5BOT A;  3F16 A;  2K9C A;  3BA0 A;  2W13 A;  1JKY A;  3TSK A;  2MZE A;  3LIL A;  2JNP A;  1BIW A;  2J83 A;  5H8X A;  3ZXH A;  3DNG A;  3N2U A;  3U1R A;  2W14 A;  1IAC A;  2A8H A;  3F17 A;  3N2V A;  4AYK A;  4JQG A;  3EWJ A;  1XUR A;  1IAG A;  1MMR A;  4PKS A;  1JAO A;  3HDB A;  4FU4 A;  4GWM A;  3L0T A;  1AST A;  1SU3 A;  1Z3J A;  2USN A;  2YIG A;  3LIR A;  1KUH A;  3F19 A;  2K2G A;  1OM6 A;  5BPA A;  1ZXV A;  1O0T A;  2ERQ A;  1HY7 A;  1XFX A;  1G12 A;  1BM6 A;  2XS4 A;  4GQL A;  3VTG A;  2YB9 A;  1ZP5 A;  1XUC A;  4WZV A;  1Y8J A;  2CKI A;  4XM7 A;  2X3C A;  4EFS A;  1SMP A;  1UTZ A;  1WNI A;  3KEJ A;  4ON1 A;  2W0D A;  1IAB A;  1D7X A;  3EHY A;  1QIA A;  4H76 A;  4GUY A;  456C A;  3P24 A;  1AF0 A;  3LIK A;  4WK7 A;  4J4M A;  1G4K A;  4PKV A;  4GR0 A;  3UVC A;  1PWW A;  1OM8 A;  3WV1 A;  1YOU A;  4XBH A; 
#chains in the Genus database with same CATH topology
 1UMS A;  2JT6 A;  3K7L A;  1R54 A;  1Y0V A;  4H49 A;  4IN9 A;  5CUH A;  2OW0 A;  3P1V A;  3HYG A;  1FLS A;  1OZ9 A;  5D1U A;  1A86 A;  3EDG A;  2OW2 A;  2Y6D A;  4G9L A;  1KUG A;  3TT4 A;  4QKZ A;  1UEA A;  4IJO A;  1GKD A;  1KUI A;  3G5C A;  4XM8 A;  1G49 A;  1JH1 A;  1B3D A;  5JMY A;  2OW1 A;  1YP1 A;  4GWN A;  1JAN A;  1ZTQ A;  1OO9 A;  3ELM A;  2O36 A;  1CGL A;  4AUO A;  3HBV P;  1B8Y A;  3O2X A;  1BZS A;  3ZUK A;  1CAQ A;  3KEC A;  1R1I A;  1ZS0 A;  2W15 A;  1XM5 A;  2D1N A;  3RTS A;  3HY7 A;  2JT5 A;  3G42 A;  1RMZ A;  5D7W A;  3V96 B;  1EUB A;  4FXQ A;  1AKL A;  3KME A;  1HOV A;  4G0D A;  1HTD A;  830C A;  2MLS A;  2YUF A;  4JP4 A;  1D5J A;  4PKW A;  1CXV A;  1MNC A;  5L7F A;  4WKI A;  1ROS A;  1SRP A;  3HB2 P;  3DTI A;  4DF9 A;  1TVI A;  3SHI A;  2OY2 A;  1IAA A;  3LK8 A;  1R1H A;  1C8T A;  1GE6 A;  4WF6 A;  4L63 A;  4A7B A;  4ILW D;  1UMT A;  3L0V A;  1D8F A;  3DWB A;  3F18 A;  4JA1 A;  1GE5 A;  3GBO A;  2JIH A;  3LQ0 A;  1GKC A;  1QIB A;  1YCM A;  1XFZ A;  1JK3 A;  5D1T A;  5B5O A;  966C A;  1JIW P;  5L79 A;  2SRT A;  2OVZ A;  4CTH A;  5I4O A;  1OS2 A;  3B2Z A;  3Q2H A;  1XFU A;  1C3I A;  1HV5 A;  1SLN A;  3LJT A;  1RM8 A;  1L6J A;  2OXZ A;  3E8R A;  4L7A A;  4L19 A;  1MMP A;  1O0Q A;  1BUD A;  1YQY A;  3EDI A;  1ATL A;  1A85 A;  3KMC A;  1HFC A;  2KRJ A;  3Q2G A;  1KUK A;  3KRY A;  2TCL A;  4R3V A;  2ERP A;  1GXD A;  4JPA A;  2ERO A;  5CXA A;  1BKC A;  1KAP P;  4PKR A;  1XFW A;  1AYK A;  2OZR A;  4GF1 A;  1I1I P;  3I7G A;  1PWP A;  3LEA A;  1XFY A;  1PWQ A;  3USN A;  4PKT A;  3EDH A;  3DPE A;  4PKQ A;  2AYK A;  1EB6 A;  4DV8 A;  1CIZ A;  1QUA A;  2MLR A;  2MZI A;  1K7Q A;  1JIZ A;  2Z2D A;  3LKA A;  1R55 A;  4WKE A;  2DW2 A;  1PWU A;  1Y93 A;  3WV3 A;  5I43 A;  1UTT A;  1DTH A;  4IUW A;  3RTT A;  2X3B A;  2QPJ A;  1J7N A;  3NX7 A;  1USN A;  2OXU A;  2WO8 A;  2POJ A;  3LUM A;  3DTK A;  4H3X A;  1XFV A;  1CGE A;  1GE7 A;  1OMJ A;  1BKC E;  2DW1 A;  1BQO A;  2OXW A;  1BUV M;  3EHX A;  4A3W A;  1D8M A;  4AIG A;  5CZM A;  3KWV C;  1BKC I;  2J0T A;  3LJG A;  1K7I A;  3EDZ A;  4JIJ A;  2XS3 A;  3OHO A;  5I2Z A;  1G05 A;  2OY4 A;  3DPF A;  1JAQ A;  1I73 A;  3AIG A;  1ZVX A;  4I03 A;  1IAD A;  1C7K A;  2N8R A;  4L6T A;  3LUN A;  5D1S A;  2X7M A;  4HMA A;  4GR8 A;  2O3E A;  1QIC A;  3LJZ A;  1H71 P;  2WOA A;  1I76 A;  2FV5 A;  2RJQ A;  4H1Q A;  3HDA P;  3ZVS A;  5D2B A;  4H30 A;  1ZXC A;  3VI1 A;  2OI0 A;  2JSD A;  3CKI A;  5B5P A;  2I47 A;  5D3C A;  4DPE A;  3LE9 A;  4AXQ A;  2OW9 A;  1IAE A;  4H84 A;  4Q1L A;  1SLM A;  1R1J A;  3KHI A;  4H2E A;  1BQQ M;  4I35 A;  1SAT A;  1G9K A;  1MMB A;  4XCT A;  2E2D A;  1CGF A;  1OS9 A;  2Y6C A;  3K7N A;  4DD8 A;  2DDY A;  3TVC A;  2RJP A;  1QJJ A;  2E3X A;  5I3M A;  2OVX A;  3B92 A;  2W12 A;  4GR3 A;  3F1A A;  1Q3A A;  3KEK A;  3O64 A;  2HU6 A;  3F15 A;  3I7I A;  3AYU A;  1JJ9 A;  1KUF A;  5LAB A;  1JAP A;  1HFS A;  2FV9 A;  1FM1 A;  2D1O A;  2L0R A;  3HBU P;  3LGP A;  1CK7 A;  2WO9 A;  2MZH A;  4HX3 A;  1GO7 P;  1S4B P;  1PWV A;  2DDF A;  1K7G A;  3TS4 A;  2X3A A;  2PJT A;  1CQR A;  4FVL A;  2CLT A;  1EAK A;  1BSW A;  2V4B A;  5I12 A;  2AIG P;  3HY9 A;  4ZR5 A;  1ND1 A;  4H82 A;  3B8Z A;  3LQB A;  3MA2 A;  1MMQ A;  4FXY P;  1XUD A;  3WV2 A;  2DW0 A;  3AYK A;  3OHL A;  1QJI A;  1FBL A;  5I0L A;  1GO8 P;  1KBC A;  3DL1 A;  1DMT A;  3LMC A;  1XAX A;  5BOY A;  3DTE A;  4PKU A;  3DSL A;  1OM7 A;  4XM6 A;  5BOT A;  3F16 A;  2K9C A;  3BA0 A;  2W13 A;  1JKY A;  3TSK A;  2MZE A;  3LIL A;  2JNP A;  1BIW A;  2J83 A;  5H8X A;  3ZXH A;  3DNG A;  3N2U A;  3U1R A;  2W14 A;  1IAC A;  2A8H A;  3F17 A;  3N2V A;  4AYK A;  4JQG A;  3EWJ A;  1XUR A;  1IAG A;  1MMR A;  4PKS A;  1JAO A;  3HDB A;  4FU4 A;  4GWM A;  3L0T A;  1AST A;  1SU3 A;  1Z3J A;  2USN A;  2YIG A;  3LIR A;  1KUH A;  3F19 A;  2K2G A;  1OM6 A;  5BPA A;  1ZXV A;  1O0T A;  2ERQ A;  1HY7 A;  1XFX A;  1G12 A;  1BM6 A;  2XS4 A;  4GQL A;  3VTG A;  2YB9 A;  1ZP5 A;  1XUC A;  4WZV A;  1Y8J A;  2CKI A;  4XM7 A;  2X3C A;  4EFS A;  1SMP A;  1UTZ A;  1WNI A;  3KEJ A;  4ON1 A;  2W0D A;  1IAB A;  1D7X A;  3EHY A;  1QIA A;  4H76 A;  4GUY A;  456C A;  3P24 A;  1AF0 A;  3LIK A;  4WK7 A;  4J4M A;  1G4K A;  4PKV A;  4GR0 A;  3UVC A;  1PWW A;  1OM8 A;  3WV1 A;  1YOU A;  4XBH A; 
#chains in the Genus database with same CATH homology
 1UMS A;  2JT6 A;  3K7L A;  1R54 A;  1Y0V A;  4H49 A;  4IN9 A;  5CUH A;  2OW0 A;  3P1V A;  3HYG A;  1FLS A;  5D1U A;  1A86 A;  3EDG A;  2OW2 A;  2Y6D A;  4G9L A;  1KUG A;  3TT4 A;  4QKZ A;  1UEA A;  4IJO A;  1GKD A;  1KUI A;  3G5C A;  4XM8 A;  1G49 A;  1JH1 A;  1B3D A;  5JMY A;  2OW1 A;  1YP1 A;  4GWN A;  1JAN A;  1ZTQ A;  1OO9 A;  3ELM A;  2O36 A;  1CGL A;  4AUO A;  3HBV P;  1B8Y A;  3O2X A;  1BZS A;  3ZUK A;  1CAQ A;  3KEC A;  1R1I A;  1ZS0 A;  2W15 A;  2D1N A;  3RTS A;  3HY7 A;  2JT5 A;  3G42 A;  1RMZ A;  5D7W A;  3V96 B;  1EUB A;  4FXQ A;  1AKL A;  3KME A;  1HOV A;  4G0D A;  1HTD A;  830C A;  2MLS A;  2YUF A;  4JP4 A;  1D5J A;  4PKW A;  1CXV A;  1MNC A;  5L7F A;  4WKI A;  1ROS A;  1SRP A;  3HB2 P;  3DTI A;  4DF9 A;  3SHI A;  2OY2 A;  1IAA A;  3LK8 A;  1R1H A;  1C8T A;  1GE6 A;  4WF6 A;  4L63 A;  4A7B A;  4ILW D;  1UMT A;  3L0V A;  1D8F A;  3DWB A;  3F18 A;  4JA1 A;  1GE5 A;  3GBO A;  2JIH A;  3LQ0 A;  1GKC A;  1QIB A;  1YCM A;  1XFZ A;  1JK3 A;  5D1T A;  5B5O A;  966C A;  1JIW P;  5L79 A;  2SRT A;  2OVZ A;  4CTH A;  5I4O A;  1OS2 A;  3B2Z A;  3Q2H A;  1XFU A;  1C3I A;  1HV5 A;  1SLN A;  3LJT A;  1RM8 A;  1L6J A;  2OXZ A;  3E8R A;  4L7A A;  4L19 A;  1MMP A;  1O0Q A;  1BUD A;  1YQY A;  3EDI A;  1ATL A;  1A85 A;  3KMC A;  1HFC A;  2KRJ A;  3Q2G A;  1KUK A;  3KRY A;  2TCL A;  4R3V A;  2ERP A;  1GXD A;  4JPA A;  2ERO A;  5CXA A;  1BKC A;  1KAP P;  4PKR A;  1XFW A;  1AYK A;  2OZR A;  4GF1 A;  1I1I P;  3I7G A;  1PWP A;  3LEA A;  1XFY A;  1PWQ A;  3USN A;  4PKT A;  3EDH A;  3DPE A;  4PKQ A;  2AYK A;  1EB6 A;  4DV8 A;  1CIZ A;  1QUA A;  2MLR A;  2MZI A;  1K7Q A;  1JIZ A;  2Z2D A;  3LKA A;  1R55 A;  4WKE A;  2DW2 A;  1PWU A;  1Y93 A;  3WV3 A;  5I43 A;  1UTT A;  1DTH A;  4IUW A;  3RTT A;  2X3B A;  2QPJ A;  1J7N A;  3NX7 A;  1USN A;  2OXU A;  2WO8 A;  2POJ A;  3LUM A;  3DTK A;  4H3X A;  1XFV A;  1CGE A;  1GE7 A;  1OMJ A;  1BKC E;  2DW1 A;  1BQO A;  2OXW A;  1BUV M;  3EHX A;  4A3W A;  1D8M A;  4AIG A;  5CZM A;  3KWV C;  1BKC I;  2J0T A;  3LJG A;  1K7I A;  3EDZ A;  4JIJ A;  2XS3 A;  3OHO A;  5I2Z A;  1G05 A;  2OY4 A;  3DPF A;  1JAQ A;  1I73 A;  3AIG A;  1ZVX A;  4I03 A;  1IAD A;  1C7K A;  2N8R A;  4L6T A;  3LUN A;  5D1S A;  2X7M A;  4HMA A;  4GR8 A;  2O3E A;  1QIC A;  3LJZ A;  1H71 P;  2WOA A;  1I76 A;  2FV5 A;  2RJQ A;  4H1Q A;  3HDA P;  3ZVS A;  5D2B A;  4H30 A;  1ZXC A;  3VI1 A;  2OI0 A;  2JSD A;  3CKI A;  5B5P A;  2I47 A;  5D3C A;  4DPE A;  3LE9 A;  4AXQ A;  2OW9 A;  1IAE A;  4H84 A;  4Q1L A;  1SLM A;  1R1J A;  3KHI A;  4H2E A;  1BQQ M;  4I35 A;  1SAT A;  1G9K A;  1MMB A;  4XCT A;  2E2D A;  1CGF A;  1OS9 A;  2Y6C A;  3K7N A;  4DD8 A;  2DDY A;  3TVC A;  2RJP A;  1QJJ A;  2E3X A;  5I3M A;  2OVX A;  3B92 A;  2W12 A;  4GR3 A;  3F1A A;  1Q3A A;  3KEK A;  3O64 A;  2HU6 A;  3F15 A;  3I7I A;  3AYU A;  1JJ9 A;  1KUF A;  5LAB A;  1JAP A;  1HFS A;  2FV9 A;  1FM1 A;  2D1O A;  2L0R A;  3HBU P;  3LGP A;  1CK7 A;  2WO9 A;  2MZH A;  4HX3 A;  1GO7 P;  1S4B P;  1PWV A;  2DDF A;  1K7G A;  3TS4 A;  2X3A A;  2PJT A;  1CQR A;  4FVL A;  2CLT A;  1EAK A;  1BSW A;  2V4B A;  5I12 A;  2AIG P;  3HY9 A;  4ZR5 A;  1ND1 A;  4H82 A;  3B8Z A;  3LQB A;  3MA2 A;  1MMQ A;  4FXY P;  1XUD A;  3WV2 A;  2DW0 A;  3AYK A;  3OHL A;  1QJI A;  1FBL A;  5I0L A;  1GO8 P;  1KBC A;  3DL1 A;  1DMT A;  3LMC A;  5BOY A;  3DTE A;  4PKU A;  3DSL A;  1OM7 A;  4XM6 A;  5BOT A;  3F16 A;  2K9C A;  3BA0 A;  2W13 A;  1JKY A;  3TSK A;  2MZE A;  3LIL A;  2JNP A;  1BIW A;  2J83 A;  5H8X A;  3ZXH A;  3DNG A;  3N2U A;  3U1R A;  2W14 A;  1IAC A;  2A8H A;  3F17 A;  3N2V A;  4AYK A;  4JQG A;  3EWJ A;  1XUR A;  1IAG A;  1MMR A;  4PKS A;  1JAO A;  3HDB A;  4FU4 A;  4GWM A;  3L0T A;  1AST A;  1SU3 A;  1Z3J A;  2USN A;  2YIG A;  3LIR A;  1KUH A;  3F19 A;  2K2G A;  1OM6 A;  5BPA A;  1ZXV A;  1O0T A;  2ERQ A;  1HY7 A;  1XFX A;  1G12 A;  1BM6 A;  2XS4 A;  4GQL A;  3VTG A;  2YB9 A;  1ZP5 A;  1XUC A;  4WZV A;  1Y8J A;  2CKI A;  4XM7 A;  2X3C A;  4EFS A;  1SMP A;  1UTZ A;  1WNI A;  3KEJ A;  4ON1 A;  2W0D A;  1IAB A;  1D7X A;  3EHY A;  1QIA A;  4H76 A;  4GUY A;  456C A;  3P24 A;  1AF0 A;  3LIK A;  4WK7 A;  4J4M A;  1G4K A;  4PKV A;  4GR0 A;  3UVC A;  1PWW A;  1OM8 A;  3WV1 A;  1YOU A;  4XBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...