5I4DA

1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
b'TPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title 1.75 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 52
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i4dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5i4dA01
5ELFA 5I4DA 3BYTB 1JQYD 3GP7A 1XXGA 1RCVD 4RCOA 1S5ED 3EFXD 4RH6A 1GOZA 2TSSA 1F77A 4NZLB 2XNAC 1L0XB 2NTTA 4DXGA 1ENFA 1I4XA 1TY2A 4BWGB 1PTOB 2G9HD 1LT3D 2Z8LA 1TS5A 4C56C 1KLUD 1PTOH 2XRQD 1YN4A 1YN5A 1XTCD 1CHPD 1LTAD 3O13A 4DXFA 2J4XA 1JWMD 1FD7D 2QEJC 1ET9A 1KTKA 1DJRD 2R61A 4RFBA 2AQ3B 1I4RA 2ICIA 1SEBD 1PTOD 1SJED 2IPKD 1B44D 1S5FD 4RGOS 4Z9CB 3URYA 3R2IA 1S5BD 2AQ1B 1SE2A 1CT1D 1KLGD 1T5XD 4UDUC 1FNUA 1HQRD 1PRTC 3BVZA 1ESFA 5D3DA 2QILA 1ET6A 1LTSD 2SEBD 1LT4D 5FKAC 1JWUD 1D5XC 1LT5D 1PRTF 1B1ZA 3TSSA 3W2DA 1JR0D 1I4GA 1V1PA 1BXTA 1CHQD 1D5MC 2NTSA 4RHRA 3SEBA 1S5DD 1SXTA 3MC0B 1RF2D 1BCPF 3BVMA 1I4HA 4OHJA 1LLRD 4RGNA 1HTLD 1V1PB 3EA6A 4L63B 1PYWD 1AW7A 1JCKB 1CK1A 1DYQA 4RGTA 1FGBD 3CHBD 1STEA 4K6LA 2AQ2B 2CHBD 1D6EC 1LTGD 1PZKD 1LO5D 1LTID 1PRTB 4RGMA 1EFID 1I4QA 5FK9C 3KLSX 1LTTD 4L6TB 4O1NA 3BVGA 5ELEA 1BCPB 1EEFD 1LTRD 1CQVA 5TSSA 1BCPC 1HXYD 5D3IB 1V1OA 1L0YB 1RD9D 5ELBA 2WV6D 2XN9C 1PZID 1G8ZD 2O2LD 4ZYSA 1EU4A 1PRTD 1SJHD 1M4VA 1I4PA 3BZDB 1EEID 4TSSA 1EU3A 1FNVA 1JWSD 1MD2D 1SE4A 1BCPD 2IJ0A 5ELCA 1QILA 3OWEB 1RDPD 1EWCA 2RDGA 1TY0A 3MFGA 1FNWA 1D5ZC 3R2TA 1PZJD 3BYYB 3V05A 2RDHA 1PTOC 1TS2A 1LT6D 3R8BA 5ELDA 1YN3A 3DWQA 1TS4A 1HA5A 1SE3A 3DWAA 1LTBD 1UUPA 3DWPA 1AN8A 1PTOF 4RHSA 2XRSD 1SBBB 1TS3A 1S5CD 1UNSA
chains in the Genus database with same CATH superfamily
4A3IB 2D2CC 1HNXQ 4A3EG 2MJDA 4JI6Q 4A3KG 2UUCQ 4RCOA 2UWQA 2M56B 2HT1A 2TSSA 2LVQA 4TV3A 3I90A 5IKCM 4IUVA 4DHZE 4OELB 2K8HA 4DXAB 4QIWB 2NTTA 4GKKL 3AN1A 2FMCA 3RFZB 2KA7A 3CSTA 4EZLA 4W9DA 2G9HD 2JA6H 1SRUA 1PTOH 4A3CH 3PZ7A 3BDLA 1GB4A 4DN4M 4PV1C 3M7NA 1GHKA 2K9XA 4S17A 3S1MH 2G45B 1WZ3A 2QEJC 4Y7NH 1DOIA 3KDFA 3EFCA 4A3DG 3TS0A 3ZIMA 4DV7Q 1AE3A 4JI4Q 1I94L 1YNND 3L0OA 1ZPSA 4LF5Q 4BXXH 4H13C 3MA2B 5M5YB 5EQ0A 2N9EB 2M8SA 2Y3AA 2EYPA 1IL8A 2PQAA 1GB1A 2RCNA 3MWYW 2N88A 1CM9A 1Y8OB 1QF6A 2JA8B 3JSVB 4BKSD 3VH4B 2JK8A 1PFDA 1WH3A 2B2YA 3E3XA 3CCEA 3RN5A 1K3RA 4EZJA 5GAGC 3UI2A 4JWUC 4REZA 4N8FA 1PLFA 4EVOA 2OCEA 5K5PA 2AX5A 1C0AA 2K1FA 3RZDB 3ULJA 3UF8A 2O6VB 2A6EC 2PEAA 5COYA 1I4GA 1NNXA 1MI0A 2D2QA 1QUQB 2IZVB 3JVZX 3EROA 2HHHL 1FXAA 4DAYA 4NMZA 4LJOB 3I73A 2BBCA 4FYDA 1J7AA 3PVLA 5D7GA 1HZBA 1UE5A 1TWFB 2A6HC 2R93G 1L4DB 1P1AA 2WHIA 2VW9A 3KVFB 5IOIA 2D07B 4ICUA 3RNFC 1STEA 2DJFC 5J2RA 4KY6A 5D94A 2IT1A 1N6ZA 1YOVB 2HJ1A 1H9RA 1PZKD 2GBMA 1WI5A 1HFGA 4GN4B 5FK9C 3UE0A 3SFDB 2ZT9C 3K9PB 4DV3L 2A8VA 1WGDA 5J22A 4IOCA 4OZAA 2H5XA 3SK4A 4MM3B 2FUG1 3FVQA 1GUGA 4DR1L 3QK0A 3H6MA 2KDEB 3DVNU 2A73B 5E4XA 1G8ZD 2RCFA 1K73C 4DQOC 2JYTA 3L9AX 1K53A 4GDLA 1J5EQ 2F4VQ 3QJZA 1JWAD 3TL5A 3UINB 1XLPA 1JROA 3HP3A 1BO0A 1HTPA 1FL0A 4P75A 3AULA 2PZTA 1ZYRC 3PIP3 2LZ6A 1QQRA 2B39A 2LS01 2PMZE 1WJ6A 2L05A 2G3QB 2LD9A 2KJRA 1EUVB 3ML8A 2VUMB 1IYUA 3WWVA 3RI7C 1N32L 2KD0A 2M17A 1HRJA 3AEEB 3OMCA 3CCMA 1Q46A 1TS4A 1EQTA 5CV9A 3I4MB 2KC2A 1QG7A 5DEHA 1Z9FA 3UDXA 1VQNA 2ZPNA 3BYTB 2B8GA 5FO8B 2DWQA 3FILB 3SFEB 4AJYB 4C2MH 3P4PB 2KTFA 1V43A 3PV0A 2DLBA 2B2TC 2RKSA 4RH6A 3WIMA 1VS0A 2M4NA 1L1OB 1NUCA 5GROA 1QOGA 2WXRA 3DOWA 4XYQA 4MGYE 4JK1C 1V9JA 2GVAA 4GMVA 2MP2B 1W3SA 1T9HA 1ENCA 4DV1L 3R3OA 4LJPB 1VQ7A 1WCMB 1EWIA 2GBNA 4H0LC 4P74A 1ML0D 1ZYRD 4HJ5A 3MXGA 4UPAA 4YTMB 3S24A 4P71A 5IYDG 2KCCA 1TT2A 3EIVA 4P1CC 1RTNA 1FRDA 2W54A 4BOSC 1ZGUB 2KX3A 1KM7A 4JI2L 2M00A 1F2ZA 2EOTA 2OF1A 2PI2A 3GD7A 5KGUA 2KWCA 2Q5WD 2VH1A 2XBBC 3DBRI 4A3GG 2M19A 3URYA 2CJNA 3VQIA 1DGSA 1E22A 2NVYB 3S17B 4JL9A 2PJHA 4YXDB 3VYTA 2YTXA 1NI3A 3TP8A 3CQZB 1ESFA 3PCOB 2WP9B 2KWDA 4C3JG 3JYUA 1GO3E 1LTSD 2OJRA 3ZUNA 5IA7A 2F3WA 3RLOA 1CKNB 2WXLA 2NN6G 5BR8Q 2RGFA 3OOCA 2DZKA 3TEXA 5H8YE 1A70A 4CO7A 1D5MC 3SEBA 4GLVB 4A3FH 1QT9A 4ZUJA 1U0LA 2NBWB 4M8NA 3VUXA 3L7ZC 4OL7A 4RG1A 3ZLZA 4R4IA 1NE3A 4UP9A 3KUZA 1O80A 3CC7A 3FRPB 4OIJA 1UWXA 3BINA 4CJ2C 1XEEA 1DCZA 3N1ZC 2EELA 2WU5B 3ML9A 2PQEA 4BOZB 3GZNI 2O6VD 2L15A 3EHVA 2FIFA 4PS7A 5E6NA 3NTKA 5E6PA 4C4VB 1R4NI 5AZGA 1V6EA 2K75A 4DUZQ 2K05A 2LVPA 3HOYB 2J0KA 1WXSA 3MEHA 2Z1CA 2PO4A 1M1KC 3AEVA 4CBVA 3ZXVA 3AU5A 2PKOA 4CJ0B 3RULA 2PZWA 2I5HA 4O2DA 5IODA 4YWKA 2B2VA 1UEBA 3NELA 2PPHA 2LSSA 2EYLA 1H9SB 2ONQA 2ALYB 2FUHB 1FCCC 2RSOA 1FNVA 1DGJA 2JZPA 4XQNA 2MCNB 1CFMA 1Y8PB 3NBHB 4HIDA 2GA4B 2GBKA 4QB4A 1SYCA 2RDGA 5FLXc 4JG2A 1KRSA 5CBEE 3T1YQ 4A3KB 4P16A 2WDQB 2HIXA 4OWTB 4FF2A 1LT6D 4GXBA 5M3MG 4M8AA 1DOYA 1GUNA 1KDBA 3HKZG 2J0MA 1EY7A 3HOVG 1Z2MA 2KTRA 1NCVA 1SE3A 1VQGA 2F0KA 1Q0WB 5J3BA 5IOCA 3DWPA 3HOXH 3CRKC 4FHJA 3U52E 2F4IA 2UUAL 3RZOH 1KD1C 1TS3A 4AP4C 4HCPB 1WGYA 2HQEA 2AUJD 4IPGA 2GMIC 2QSDA 3APDA 5IWAL 3ZRFA 4A3MG 2KX0A 4HRSA 2XTIA 4A3DB 2WXGA 3ZDMC 3TP5A 1Q1EA 2IX1A 2QGQA 3OW7A 4KVGB 5DCNA 4NZLB 1VLBA 2NVXH 2D11A 4GN1A 4DXGA 3P20A 3CCJA 1D7QA 1SNMA 4BBRH 1K0RA 3OJ4B 1E2WA 3DLLA 2KCMA 4E74A 1SYDA 1VQOA 3CIRB 4J1MA 2N9KA 2DZMA 4X64L 3JAMi 1XTCD 2Z4HA 3CF5A 3CU7A 1R4QB 3H7SA 2EJFC 2CKZB 4DAPA 1DXMA 2N9LA 3SK5A 3DBSA 4DBGA 1PH2A 2FFKB 4ZLTF 4HJGE 4L2YA 4FVMA 2ICIA 2E2IH 1UGJA 4U673 3J80E 3ITPA 2K5WA 5TR5A 1IUEA 4IG7B 3A56A 4EQOA 3R2IA 4IUTA 1T0YA 5LXHA 1PFSA 3EBEA 4I6PA 4TUUA 2QW7A 4KDIC 1ROEA 3I3CA 4MHEA 4JGHB 1SAPA 1Z7TA 2AWTA 4RF0A 3WANA 4DV0Q 3S9WA 1UAPA 4DR7Q 2KANA 1Y1VG 2HTME 3X0WA 3LDZE 4II3B 2K5VA 2L1BA 5M5WH 5FJ8H 1OXUA 5IO9A 4L5TA 5KNBA 5HURA 5AJ3L 2ZCBA 3M95A 1D8LA 3NS8A 1ZXHA 4GLSC 1SYFA 3W2DA 2I2YA 2JXMB 2RHQB 1F1HA 3EFUA 1S40A 2B2WA 4HN7A 2GVBA 4QF4A 1WE7A 4TKNA 5E6JA 1BCPF 2BQQA 5NUCA 2OT2A 1XNQQ 3OW2A 4KHVA 1V1PB 2FINB 2M0AA 3VRBB 4DR3L 1BUIC 2EYJA 2RQXA 1AW7A 1X3PA 4E6IA 4YY3L 1WTPA 2V3PA 3CMMB 3I5JC 1DYQA 5C0XH 4LNKA 3Q23A 2CHBD 2KQ4X 2L00B 3FHWA 1B9MA 3FMCA 4CJ1B 1PRTB 3A54A 3W1BA 3CCSA 1R9TB 1V49A 3X23A 4IFDG 1EM7A 5ELEA 1J19A 4OONA 1CQVA 1UWVA 3H91A 2Q2IA 4DR5Q 3J7AV 2R93H 5I6YA 2LHEA 3F1ZA 2B76B 2DNEA 3VA5A 1XMOL 1RAXA 3DM1A 2JA5H 3DBLB 2HIVA 4B3ML 4LFBQ 4POGA 2WV6D 4KIKB 3P4SB 2ZXRA 1K8OA 2IY0B 2V9HA 4ICVA 2BYEA 4JPSA 2WACA 2CU1A 5KNCA 1GUSA 3DXJC 3OIQA 3BIID 3L10B 3BK2A 1SNQA 4E71A 5JPNC 2N3SA 4MTNA 4AH6A 2D5GA 1ESRA 4MM3A 2MWSB 4OVZA 5FR3A 1E3PA 5M5XB 2RDHA 4MGIE 2DUDA 2C35B 2K33A 3HOWG 2RR9A 1CKOA 2OEOA 4ULLA 1EF1A 3E0JA 2NVTB 3VFKA 3ZRCA 4PQXA 3VR3A 1I50B 2XWJB 3MXNB 1L4ZB 1MFWA 1UUPA 3G7LA 1C4QA 1TWCB 4RHSA 2FMMA 2BB6A 2EZVA 1OTCA 4US8A 2HCIA 1C8CA 4KX6B 3GTKB 1LUZA 1WI0A 2Q8IB 1J8CA 5GMVA 4X66L 4EE2A 3GTMB 4LF7L 5C4ZA 3A74A 1UE6A 4L5QA 4CQNA 3IFTA 4C3IG 2BWFA 1G91A 4UP8A 5LHY1 2I5MX 4A3GB 1FO4A 5FO7B 4IM3A 3U8ZA 3R66C 3CC4A 4B9KA 5FO9B 1TS5A 1Q5WB 3L13A 2IW3A 1STYA 3TS2A 1STBA 2MSED 3RYTA 5T1IA 1HR0Q 2EPBA 2JZ3B 3CSFA 2ICEC 1LTAD 4C3JB 3O13A 4OZBA 3TMPB 4DAMA 1TQOA 1ET9A 2E5LQ 4KHPL 1F2RC 1HTOA 5CV5A 4KI0A 2VH2A 4RFBA 4RKBA 1HNWQ 2AL3A 1ZEQX 1B9NA 4RF1A 4LF9Q 1L1OA 2L11A 1E9MA 3KDFB 4B95A 3VYRA 3J81i 2JA6G 2NVQH 3ZTCA 2WXNA 1HH2P 2ZM6Q 1FFUA 4GSWA 1JB3A 1GXDC 1IBML 1HTQA 4O42A 1MHXA 1SE2A 1WR6E 1GUAB 2ES2A 2NZOA 1PRTC 2PQAB 3ER0A 1CA5A 2UXDQ 1LABA 4B3TL 4IN3A 3R93A 2KJHB 3OHXC 1YQ4B 3K7AB 1K3BC 4B3RQ 2UXBL 5G5GA 1IBLQ 2UUBL 4DK0A 4LFAL 1OGWA 2PW9A 2ZTEA 4A20A 3F8TA 4BXXG 4GZYC 1PQSA 3PO3H 3PHXB 2R6GA 4DDID 1B1ZA 3DBLI 2C9OA 1XT9B 4HDOA 5EKKA 2QC8A 3IXSA 3KFUA 3HOZB 2BF8B 1VQ6A 1SXTA 1J8IA 1QCBD 3PF4A 1PYSB 1NR4A 1TWAH 4ME5A 3TP7A 1PYWD 2NN6H 1G51A 4CDEC 3H3VH 2A5HA 4JYAQ 4RGTA 4DAYB 2WXPA 3KLRA 1OEYA 1KNAA 3Q22A 1PDXA 1CKNA 5AUKA 2O4XA 3S2HH 2F3VA 3CCVA 2JEBI 3V62A 4K0KL 1LTRD 5CMDA 5DLQE 4L23A 2MJ8A 5ELBA 1IGCA 5M3MB 2Z6KA 1N33Q 1EO6A 2HDEA 3N9YC 4BZAA 1PH8A 3LB8C 4TKOB 3KWLA 4XDCA 1PRTD 1UZXB 2BKRB 3OSOA 2HQLA 1QVFA 3HOVB 4FP5D 2B8FA 2HDLA 4NPNA 1JWSD 1WTWA 3I9V1 4GDLB 1EYCA 2E74C 1FXIA 2W3RA 4C4VA 3S16H 3QIJA 1VQBA 3PIOA 1P98A 4PZ8A 1STNA 4R9WA 3R2TA 3V05A 2ON8A 2MA9B 2ZJDA 3M3JA 1LM8B 4B6WA 4GIVA 4XC2A 1E7VA 5C1ZA 1ILPA 4M01A 4PS8A 4RMAA 3I3TB 4PZ7A 2KDMA 3DWQA 4RWSC 1HA5A 3EN2A 1Q1BA 3NZUA 4DV4Q 1AN8A 4QL5A 3TZUA 2D10A 1SBBB 1CTMA 1PH7A 2Y5PA 1I3QH 1PHJA 2V1CC 2XIWA 2KUMA 3M62B 2VQEQ 2MBBB 5E6OA 1EWHA 4S3SA 4JI7L 1A6XA 3SDLC 4FO2A 1XO3A 3UIPB 2BB5A 3SHQA 4HIOA 4G57A 2HD3A 2K8BA 1WD0A 4HEDA 1OXVA 3NP8A 2CCZA 2MHJA 1E7ZA 4JOIA 5CBAE 4YHHQ 1VRAB 4A9AA 4LF8L 3U50C 4A3MH 2B2YC 2XRQD 3DDCB 1B8AA 4DWFA 4Y52H 4JI5Q 1WJJA 1Y1VB 4JCVE 4OX9Q 1JWMD 2LKVA 3CD6A 2K04A 3HUIA 4B3SL 4OVUA 1KTKA 3U4EG 1O7ZA 4R8NA 1MSHA 3S14H 1EQVA 1TKEA 1WX7A 2BGFA 2VZAA 1SJED 5KEEA 3ZNGC 1S5FD 3T9LA 1MBYA 5A35A 1W6JA 1QVGA 2E2JB 3FDTA 2EMTA 4R4QA 4FA6A 5FOBB 1IBXA 3J9CA 1STHA 2F0QA 4GN3B 1GC6A 2ASQA 3NZSA 4G11A 1NTGA 1PYBA 3OMGA 2WB1B 1K83B 2QCPX 3GTPB 4J15A 2CQOA 3NOBA 2B63B 5KHQA 1KQSA 1P8LA 1TKYA 4RM8A 3KUPA 5JVH3 1WYWB 1A62A 2EYFA 3CPFA 1AARA 3WAMA 1WJUA 3RUIB 1VMCA 1ZUD2 2I07B 1KOTA 4RHRA 1N8RC 2G5DA 2F3IA 5GAEC 3AU4A 4CDCC 3NENA 4YWMA 3H09A 5M3FH 3GE3C 2L9HA 2LGSA 5T8IA 4BA1I 1WGRA 1N36L 3SD5A 3AEGB 5C3EB 3UDFA 1L6VA 3A8KE 3DEOA 3E0EA 1WTXA 1P7FA 4K6LA 3M3YB 4RAUC 3TIXA 2NUCA 3MC8A 4BY1G 2KVZA 2R7ZB 1YJWA 3S2DH 2KT7A 2W82A 3WAOA 2KWUB 2KFJA 2KOLA 2KECA 3ONAB 5C4XH 1VQEA 3C3LA 4HPLB 4KZCA 4MH8A 5DPRA 3MEFA 2JYEA 5E3FA 1HXYD 5EPJA 4F1SA 4A55A 1TT5B 1IW7D 2DY8A 2IWHA 3K5MA 1B53A 5EKLA 1WD1A 1EU4A 1M94A 1M4VA 5I9OA 4TMAB 4YL8A 1SNOA 1EEID 4IO9A 3C19A 2WKCA 5I2XA 5JJIA 3S2AA 3KBXA 3GTLH 4P73A 1LGRA 5GAHC 3I4NB 2MW5A 2LVOA 3HFZB 4G7ZC 2D0OA 5D14A 3TQYA 3JAME 1FNWA 2O5JC 4ZRKA 5EKIA 1ZKHA 4ZKCB 3IAS1 4JLCA 1VF5C 2JA7H 3DMUA 1F9QA 2EY1A 2J7ZA 5C4JH 3KF6A 5IGEA 2WXHA 3R8BA 4GGQA 2LI5A 3PZ8A 2AMCB 1L0VB 4XXEA 4N9PA 1VQDA 1KXLA 3J7A5 2Z4IA 4XTCS 2KWVB 3DPDA 4LNIA 1TWHH 2RSNA 3GV3A 3NBIA 1LM0A 3ULLA 2D3CA 4DHZB 5H92C 2QDLA 2KTRB 3HOWH 2L32A 3GP7A 4GKKQ 5AEKB 3VR6A 2IO1B 3HZXA 1C1YB 4DAVA 4IQZA 3M4YA 2C60A 3A1QA 1UGMA 3H7PA 1EYGA 1EZ8A 1EIYB 3TRZA 1GUOA 1AP0A 1PTOB 2LRWA 2K25A 1JJCB 3T4AC 3Q6SA 4JI8L 1ISNA 3AE7B 4Y7NB 1ASZA 2K6QA 2OJWA 1I94Q 4W9LA 3RNUA 2KYWA 1OXTA 1XWEA 5FR6A 2FXQA 4C3IH 1DONA 1XF5L 2K7VA 1HE8A 2NBVB 1WTOA 3Q2AC 4XE0A 1XCQL 1C76A 3I4LA 2QF7A 4IPDA 2GLSA 2J7QB 4RGOS 4BBRG 3T1HL 4M02A 3AFPA 1SF0A 3RNCC 2BH2A 2KDIA 3Q0AA 2EXZA 1J6QA 1YX6B 2UU9L 5T1GA 3RT3B 1XNRL 4NXML 2EY6A 4K1RB 4S0RA 2I1JA 1MJCA 1IYJB 1EY8A 1F9PA 1C79A 2DZIA 1FD6A 2WAQE 4HLEA 2F0FA 3FKIB 2HHHQ 2LXCA 2L55A 5CV7A 3PPAA 4LK1C 3EC8A 2SNMA 2QEXA 3CF6E 4R1JA 3EQLC 1NR2A 4FF4A 4DUYL 4L5SA 3I56A 1I4HA 1VQKA 3QWNA 4N59A 3QCAA 2FCQA 1KC8C 3VXWA 4J6HA 2K4KA 4O0AA 2EY5A 2B2VC 5FJ8G 1XPOA 3K5OA 2AUKA 4DV3Q 2BW2A 3PUWA 3X3MA 5C3WA 1JQ4A 4RM9A 2CWAA 4YWGG 4K3CA 4DR1Q 1AYFA 2FNJB 2K3UA 1EFID 1ZXIA 3PSEB 1WXVA 2KHWB 5KYIA 3K5LA 3PTFC 2JN4A 4QMGA 1NJIC 1E6EB 1VQ5A 2YTVA 5CV4A 3I4OA 3W5VB 4J8QA 1WIAA 5C0XG 2PMZB 3GTQH 3GOEA 1FIQA 1GHJA 1JRUA 1A5RA 1EIHA 4TSSA 4K3BA 1U4MA 1EY5A 3T8MA 3K57A 3LNNA 1VF7A 1SE4A 3SE0A 4LK0M 2F0DA 3OIPA 4R4CA 1N32Q 1RDPD 1EOTA 4HJ7A 2JUOA 4MGZE 4FXKC 4WFN3 4FF3A 1FXTB 2JA5G 1PMRA 1RJTA 4P7IA 3Q8DA 1PTOC 4G7OC 4HSVA 4HIMA 3MJWA 3J7ZC 2OTJA 2D3AA 5KIXA 1EYAA 4JI0L 1X55A 1Y69U 3A5ZB 4RKLA 1RFAA 1A3VA 5C5LA 4QIWE 1V8CA 3B2FA 4IDIA 1NBWA 2N9XA 1MG4A 4USAA 3J81E 4XWTA 4IPHA 5FLMH 1I6HB 2NPTA 5JJLA 1S5CD 4QY7A 5IE8A 3VA7A 4JV5L 4A8XC 2PE9A 1C9FA 5IT9L 4F7XA 5L37A 3IKJA 3AEBB 1C4AA 2DY7A 1WY8A 3MXUA 4DV1Q 1RCVD 3TUOA 1L5PA 2KCNA 2LGYA 2ZW1A 4K14A 4JI4L 4DPGA 3VDYA 2B3GA 1YITA 3OAWA 3RNAC 3N6RA 4MNOA 3CMAA 4BWGB 4DR2L 4OW0A 1G6ZA 4BY7H 1GJXA 3ZNHB 2ATWA 2ASBA 3ND8A 3EECA 4HMIA 4JI2Q 1OQYA 2OOBB 4EQNA 1GNUA 3DVNV 1UE1A 1D3ZA 2FCSA 1YHBA 2RPQA 3BS1A 1JICA 4OO1I 5HKHA 1Y14B 1T0RC 1TGZB 2HTHA 2I38A 4EEWA 4I6LB 1Y1WB 4I65A 5A2QL 3PO2H 2K5PA 1NY4A 3HRDD 3NRZA 2C7NB 1PTOD 1LV9A 1QE6A 1G6PA 3I2ZA 3ZGZA 5E1FA 3RN2A 2WLBA 2B2WC 2D9UA 3Q8CA 3AE2B 2F0PA 5LMNL 2CW0C 2OQKA 1X3FA 2ENBA 4MIUA 5C6AA 2KFKA 4AYBB 2HE7A 3SXHA 3CWIA 3CAMA 4NDXA 2KK8A 1WM3A 2CHXA 3CCQA 1SE8A 2E8GA 2QILA 3OYYA 4JW0A 1OTRB 2L8JA 2DNCA 1STAA 2F0SA 2JA9A 5EJWA 4EQPA 2JQOA 2K28A 2VB2X 4A3FB 5IGDA 4YTNB 3HEJA 4APVA 4RA8A 1XTDA 2ACZB 3BY4B 3W1SA 5CGKA 4ILWA 1LLRD 5CC4A 2AEHA 1DOMA 1O7LA 3MJ5A 1WFQA 4QAYA 3HS0C 1FR3A 2EQSA 4W9FA 2PZUA 3PO3G 3F2CA 2BCOA 4XIGS 5L95C 1VCBA 2WXJA 1LO5D 2NS5A 3UE1A 4NPSA 3WDNA 1KNEA 3KH0A 4HCNB 3BDOA 1NENB 4L6TB 4LFCL 3VR4A 3Q3FA 2D3GA 4DKAC 1LACA 4K2LA 4IKGA 4B0MA 4DFAA 2JRIB 2LEKA 2CW0D 2J0TD 2KHJA 1Q10A 2K5QA 2MGSA 4BY1H 1CZPA 2C7HA 1WYGA 4YCWA 2D0PA 3OWFA 1N63A 3W1GA 4XQJA 2IDYA 3E9SA 4NB3A 4X65L 1VJKA 3LWEA 2A4ZA 1S3SG 4WWMA 3L2PA 3B1LX 5ELCA 1QILA 4X62L 5C44H 2I1KA 4JBWA 1K8RB 2LXKA 4NW2A 3T53B 3MHZA 4NJ6A 3VR9B 1PZJD 2F0NA 5IP9G 1VQ4A 4WURA 2UUAQ 5I2YA 2IYDB 3LX0A 4K5WA 3HOXB 5ELDA 3H8HA 3RZOB 2WQYB 5EPKA 5IWAQ 3ND9A 4L5RC 2N49A 3JAMc 5GADC 2AYOB 3OTOL 4P72A 3BVGA 3KOJA 1YN4A 3GTGH 2FE8A 4DK3C 2JP1A 4WRDA 1S72A 4NY0A 1IYFA 5G2NA 1CZWA 1QZHA 3VH3B 5LNK1 4N8X1 3Q14C 4NJ7A 2IL8A 3QB3A 4IFDJ 2KACA 2F0HA 3ZJUA 2MP1A 2XWBB 3PLUA 2DENB 2N4FA 2NVXB 4KSLC 4ME3A 3P7JA 4F88A 2EXDA 1L1OC 3DHIC 4A3BH 4FADA 2NVYH 4X64Q 3WA0A 4C80A 4A3EB 4ZRQA 2QCZA 1L0WA 4LUOA 4YIJA 1Q3LA 1ENFA 4WQOB 1TR5A 2F0JA 1PH5A 4BBNF 1O7IA 5IT9E 3RNBC 4WH4A 2YEPF 4PMBA 4OWWB 4NKLA 2OXPA 2G1EA 4K81A 4KD4A 2E2IB 3BK1A 1VQLA 3DWGC 4LNNA 4M0WA 2EYHA 4H7BA 4ZKBB 1WZ0A 1RM6C 2MBQA 1M8AA 3NJTA 4WWOA 2LGXA 2JEAI 4LF4L 1J9OA 4ZCKA 4ANVA 3TDQA 2DGYA 1CSQA 3U9SA 2N55A 3W5OA 3KJPA 3RNEC 1KDCA 1X56A 2DJGC 4HMJA 4HEA1 1DOKA 1T5XD 2FHTA 3FP9A 1HUMA 2WX0A 5DPWA 5AJ3Q 1IBXB 3GTJH 5M5WB 4JBJA 5C4HA 1XLQA 1R4PB 1JJGA 4KY7A 5A2QE 2L1AA 1AE2A 1KJTA 2ZVNA 3HOYH 1ZP0B 1SIFA 4K8JA 2N9PC 4PNYA 5GQOA 1ZOYB 3C1FA 4DR3Q 1V86A 3S1NB 1Q7YC 1VD2A 2NTSA 4YY3Q 3A33B 4AOFA 4JPBW 1KAWA 1NYQA 3AECB 3PREA 5IY0A 4XWWA 2KQ3A 2LJIA 4YCVA 3GV6A 4IJLA 1YQ3B 3NQTA 2Z6KC 1F9JA 1UELA 1ICFB 2Q2HA 1XJVA 3V2TA 1CK1A 3NG0A 1AZQA 1SYEA 2NZHA 3C2PA 1NSNS 2HUGA 1SROA 3ERSX 4DF7A 4LCDE 1X3GA 2WNMA 3DUZA 2TMPA 1E1OA 3B6YA 2P5ZX 1OXXK 1SNDA 3C1EA 3D6CA 4JC0A 3AQQA 4ZQ3A 1SFOB 4FXGC 1XMOQ 3SR6A 4A90A 3KLSX 4B3MQ 1F9RA 2R93B 5M3FG 4POFA 3NY5A 4X3KA 2Q8RE 3T13A 1SB3C 2E2HH 5CV8A 2JA5B 5IP7G 4DR4L 4Q0FA 4F8MA 1EL0A 4XQQA 3HOUG 2F0OA 2OHFA 1HZ9A 4H44C 1VQ8A 1E1TA 3J81j 4IM0A 4AJWA 1SLJA 3TZDA 4FJVB 2L4NA 1BKBA 2YTYA 2VQFL 5C4XG 2BS3B 3K5NA 3Q8AA 1RL2A 3VR2A 3AE4B 5BMGA 3ZJVA 5LXIB 4JE3B 1EWCA 2NWGA 3WCQA 1MPEA 1HNZL 3RPFC 4K6DA 3AE3B 1ASYA 2YU9B 3M4QA 4GN5A 2Y5CA 1SMXA 2PVOD 4DR6L 3DCGA 4IZ8A 1SNCA 4JOIC 2K6DB 3DWAA 3MAQA 1KHIA 4X66Q 1TJEA 3EUB2 3A7LA 2BOSA 3KF6B 4LF7Q 1B2TA 4X57B 2R92G 1E8XA 4L1BA 2F0TA 2F0GA 3AE9B 3W9CB 1JOOA 3APCA 1V8QA 2H4OA 2VY3A 3IRBA 2JA7G 1Q81C 3ZW3A 2WKDA 3J81c 4L8JA 1B70B 2F03A 2VZKB 4C3HG 3DHQA 4KGRA 5M9OA 4BBSG 4KN7C 3A9KA 4II2B 4LUZA 4KHPQ 3DVGX 4FLHA 3A1QB 3Q8EA 2PLPA 2AWNA 3H7PB 3V60A 1PFMA 2BDOA 4JVZA 1ZDVA 4HCSA 1CHPD 3BU2A 3ZKJC 2J4XA 2Z6BA 5IIFA 5IGFA 2PW5A 1P0RA 3D32A 1IBMQ 1BBWA 1RODA 1FYCA 2KBNA 2ZJRA 2EYMA 3IBEA 3PT2B 2NVQB 1BVSA 3A9JA 1SEBD 4HSPA 1E10A 1VQPA 2LXJA 2KAJA 3IFWB 3W1YA 2BTEA 3QQ8B 4B3TQ 3TN2A 1UEAB 1P3QU 3QARA 5E4WC 2UXBQ 2RSUA 3TCAA 2UUBQ 4A3JH 4LFAQ 4KKUA 3RCZA 4CDDC 3E9HA 4WWNA 3D3RA 2F1MA 5EBDA 3IHPC 4W9JA 2GOWA 3VAWA 2E2DC 1ET6A 3IVFA 1PH9A 3PO3B 1JRPA 1JOQA 1WTQA 1GUWA 4BFRA 5LL6S 3VTVA 4HKQA 2N78A 3NHEB 3VDZA 4KGTA 1X65A 2JY6A 4MTKA 3K58A 1BXTA 1F2RI 1LFDA 2WAQG 5BYSA 4KKIA 1S5DD 3VUYA 1RF2D 3I63C 1IHZA 3BVMA 4IUUA 1JWBD 4IM2A 2KLCA 5D2MB 3AFQA 5DNFA 2KMAA 1HTLD 3FKYA 1GVPA 3EVQA 2XSCA 1WE6A 2JXXA 2PPBC 2QDFA 4KJOA 3EGRA 4K0KQ 2IO3B 3H15A 2BDNA 1N9WA 4V190 4EGVA 2KEEA 1PA6A 2KVMA 3S2HB 1UH6A 1LTID 1MHHE 4WJNA 4PS3A 1S3OA 4LF6L 5C2TB 5TSSA 1XMQL 3FC4A 1X9NA 2KQSA 1STGA 2NMQA 3S15H 4LNFA 2BYTA 1TXYA 2ZJQA 1WJNA 2K52A 2NVUI 4MZ9A 1SJHD 1WTRA 1QJOA 2KLGA 3GTKH 2O2VA 2SAKA 3Q24A 1D1IA 1MJEA 4QCLA 2B29A 3S16B 3RNGC 5JAVA 3A8JE 1VQAA 1DM0B 4HJAA 1B4OA 2M1MA 4KLKA 2WINB 3HG9A 2WXKA 1VMPA 2KXJA 1DOXA 3SHLA 1P16A 3BYYB 2YYZA 1F0ZA 2HJ8A 3KBGA 4LW1A 3UDIA 4GB9A 1EZ6A 3D31A 4A3IG 4PT5A 4J6IA 2CVRA 2IO0B 1ICWA 3FPUB 1XPUA 2PIAA 4YSYB 1VDZA 3K0YA 1VQMA 2CQAA 4GLXA 2W3SA 2KN5A 4LNOA 1I3QB 4DNIA 3P2BA 4FDBA 4JI7Q 5E7NA 1IZ6A 2WDTB 5IP9H 3HKZB 5KYLA 4DNRB 4LTUA 4JI3L 4MDKE 5KNDA 1U9RA 4ZRPA 2F0EA 1VR9A 2NPTB 4AIMA 3A7AB 2L0CA 4HAEA 5J39A 4MSMB 5EBCA 4MJSB 1E24A 1XYIA 2V0GA 3S1RH 3QG1A 3P75A 3STBD 2XNAC 1MIUA 5IGGA 2X38A 5FLMG 2INPE 3DEPA 3NHHA 1J7CA 3G6JB 4A3MB 4OO1G 3VVWB 3VTUA 1RKNA 3VR5A 4B3SQ 3N32A 1B9RA 2R7FA 2Z8LA 2ZXOA 2L7RA 4LLGM 3OJ3A 3BWUD 4W9IA 2WYQA 5G55A 2K03A 1YN5A 4ODGA 2RHSB 3NE5B 3S14B 3PS6A 2KDFB 1FD7D 2KOXA 4R3DA 4PMCA 2K32A 5LLIA 3RZFA 1OEYJ 2IGDA 2N8NA 3KF8A 2VZKD 1I4RA 2JA8G 1JMLA 1T5EA 4OXPA 3S1QH 3H3VC 5AUIA 3NQIA 4BY7G 1V5TA 5IT9c 2Y0SE 1FJGL 2IGHA 1BOSA 2A68C 1CZGA 1U4LA 4HCEA 1IBKQ 1JC7A 1EY6A 4GDKA 4UDUC 2QDBA 4LMQD 2ZJPA 3RD2A 3BVZA 2M9VA 2BE5D 4EKUA 2SEBD 2KFKB 1QWYA 2BYVE 3V61A 3K0XA 3PO2G 3PRMB 4ZDVA 5FKAC 3H94A 4GKJL 4FJZA 2A69C 1RWSA 3OPOA 3F2BA 4F8CB 3PUYA 1N36Q 2NBFA 5LMUL 1JR0D 5M3FB 2KHSA 4NXNL 4ZOHC 2IGGA 3DBHB 4NAMA 1BT0A 3MHSD 3NSWA 1NMFA 4JBMA 1RIPA 1EWYC 2DX5B 2DYBA 4DA2A 1E0BA 1QNUA 1N33L 1WMHA 3WALA 4C1NK 2LFIA 5CHWA 2AKWB 3K7UC 2JF5A 4EUTA 3S2DB 1IW7C 4DV6L 2F0LA 1I7HA 1K51A 4EOYA 1N34L 5C4XB 3B0AA 1K8MA 1WJ4A 2EMSA 2EE1A 2OEDA 1YJ9A 2RDFA 1BCPB 2X8XX 1LYLA 3Q69A 2A68D 3DHHC 3LYYA 3U2SC 1N61A 1G2SA 3MTSA 3E5SA 5JJKA 1NI2A 4LUVA 2RVLA 4G4KA 2JT4B 3GTLB 5EE1A 1IKLA 1AH9A 2KVRA 2VUMG 1EU3A 4FJYA 1K0SA 2MUYA 1QZEA 1YHAA 4M00A 4TVAB 4KV6A 3SGIA 2I0QA 4MELA 5IP7H 2WXIA 2A69D 1A0IA 1W6KA 3PQIA 3KW5B 4IURA 1D1KA 4KKTA 4LNQA 3HOUH 2MJ3A 4A93H 3AE8B 2JA7B 1KL9A 5C4JB 3N1YC 1MKHA 3I4MG 1VQCA 3KLSA 4BKTA 3F2UA 4GS3A 4YT0B 5J18A 3U30A 3ZQ4A 1VZ6A 3MC9A 4ZAIA 1WGGA 1TWHB 2UU7A 3L4PA 4J3OD 4XDXA 1RRBA 5C44G 1RLFA 4CGYB 2XRSD 3HOWB 2K5DA 4JIOU 1R4MB 2CU3A 1JALA 4QGUA 2DN8A 2QKIC 1E8YA 1PH1A 1IP9A 1WCMG 4RNAA 3CKIB 1ZKOA 4LJZC 4FHKA 3H0GH 3GE8C 2HCCA 1K8AC 1XLOA 3I72A 3C0RB 4JI8Q 2AWOA 3V6CB 2AL6A 5C0XJ 2R92H 3GS2A 1WVLA 4XYCA 2B63H 4YSXB 1I6VC 4C56C 2PI2E 5J17A 1A15A 4C3IB 1I5FA 3E9IA 1PH3A 1YNXA 2WB1E 3T1HQ 4R4TA 4CHTB 4FN2A 1EY0A 3WAPA 1F2MA 4A3BG 4V0BA 1DJRD 2R61A 4C3HH 2IX3A 1PH6A 2JJQA 2UU9Q 3Q3NC 1FVIA 1XNRQ 2EYOA 4BBSH 1X1MA 3MP9A 1EUJA 1HZ5A 1WX9A 2M2LA 1T0SC 4M0WB 4EZKA 4IWQA 4HJ9A 1KF6B 2WAQB 2ZNVB 3W1SC 2FIDA 5IYCG 3TBIB 2NYZD 2QIEB 2F52A 2MBEA 3J80i 2XK5A 2A19A 1A3TA 1MGSA 2WX1A 4AQYL 2R7DA 2JA6B 1WTVA 4FF1A 4HPMB 3L0WB 3D4WA 1PFBA 3UIOB 1GAQB 4DUYQ 3T56B 3S1MB 4KZ0A 3QAQA 2R2OA 4HJKA 3V3XA 3HHMA 4DV5L 2KENA 1Q1OA 5JH5C 2Q2UA 2JRHA 4ZUIA 4IFDI 3QOJA 1ZE3D 4X3UA 4IPCA 3RMHA 3AI5A 2UYZB 4BS9A 3KUCB 3GDEA 4M1UB 3PSIA 1NDDA 3J7YW 1A63A 3AEAB 2EDGA 1ENAA 3HOYG 4D2KA 5G5HA 3V96A 4MEMA 1RTOA 4KK7A 1D6EC 4JI1L 4BVUC 1K28A 4KKSA 1YJNA 1B50A 1RHPA 3U4VA 4DV2L 2QMTA 3P63A 1HQMC 4NAWA 4HXDA 3R7QA 3CCUA 2EIFA 4N9TA 3ZTDA 1ZXTA 3M4OH 2B3AA 3NVWA 1FGUA 3MZ5A 2CH4W 1GPXA 5DAUA 3GTQB 4OIKA 1V97A 4IC7B 4ALPA 2PVGC 1YZ6A 1L0YB 1RD9D 3ZJYC 1KH0A 3PO0A 4TRDA 4UHVA 5ISRA 3M63B 3D4RA 1PGBA 3K8AA 1R4MI 3NS1A 5CHFA 4HR7B 3BZDB 2DZJA 2UXCL 1L7YA 3M7GA 1CJEA 1BCPD 2I46A 3R7RA 3SVMA 3T3OA 3D4DA 3OWEB 2SNSA 4ABNA 4JI0Q 1YJ1A 4R8IA 4ZYNA 5KHOA 1WSPA 1TY0A 3NTIA 1IXRA 2OWOA 1BUVT 5JOBA 4WJ4A 5JEAG 1TS2A 3D0FA 2GBJA 5I9PA 1A2TA 3E56A 4JV5Q 2N7EA 4FXCA 4GOPA 1YJIA 1WGKA 2C5LC 2E6XA 3L16A 4W9CA 4XX5A 1LTBD 1BBUA 3GTOH 3HVDA 5ELOA 3O65B 1Y56A 2HD5B 1TWGH 3LXFA 1QB5D 2SOBA 2X6GA 2Z59B 4A3LH 1GC7A 3AE6B 1OO9B 4IUPA 1RFKA 4A3IH 3IAYA 2KN4A 3I57A 4DR2Q 3BDCA 1E90A 2G4DB 2ZNVC 3KYDD 1GOZA 5BMHA 2NBUA 2K6AA 2E3TA 1E7UA 1HNXL 1QZGA 1HA6A 2RF4A 2BYFA 2V1YA 1SMYC 2HDMA 5J1ZA 4BY7B 4JI6L 4OWXB 2UUCL 3AB9A 2RA4A 3NK9A 2MHVA 1E8ZA 1E2VA 3MXPA 1TZOA 2W55A 1F2YA 2MPMA 3U7ZA 3FKIH 3A9KB 2EKIA 2BT6A 5BO4B 4KY5A 3PO2B 4LWCA 1E2ZA 5LMNQ 3AYHB 1F2LA 2F0WA 5BN4A 2DHZA 3ZDTA 4C2MB 4OO1H 3TJPA 3NWTA 4MJSA 2Z0SA 1U4AA 3Q8BA 3B08A 3U7DA 3DBRB 1GD7A 1V2YA 3ZXRA 1TBEA 1YVCA 2L52A 3A9JB 4DV7L 5K36H 1S5BD 2AQ1B 5M5YH 1JORA 1KAAA 4DK6C 1U4RA 1HQRD 1A3UA 1GUTA 1CA6A 4LF5L 3N3KB 2K1BA 2JA8H 1OFFA 5EE3A 2MH7A 4PYZA 1OQQA 1O7YA 2KO3A 1SN8A 4HROA 1QOHA 2F0MA 1WF9A 4C7YA 3MFYA 1PRTF 1F9SA 2INNE 1SYGA 2LY7A 4HTHA 3TSSA 4A3JG 4WJPA 3RZDH 2FBWB 2JQRB 1SMYD 2B2UA 3MC0B 1WFYA 4ZRZA 1X6OA 4F87A 1NEKB 1WYDA 3A5UA 5JVG3 3QR8A 3GQBA 1K50A 1VCIA 3VTWA 3PUXA 4XT1B 4LFCQ 3SK6A 3A4RA 3GZNB 1L2FA 4CKCA 2A6ED 3FAHA 1TWFH 2L12A 3CC2A 3CCLA 2L5TA 2LHDA 1R4NB 3NXWA 2NR2A 1QVCA 1EY4A 1LTTD 2W9NA 4O1NA 3DHGC 3H9DA 1PGAA 1EEFD 4IOAA 2K5NA 4G50A 1WXAA 3ZVVA 2A6HD 5D3IB 3ZO5B 4EQ5A 4BY1B 1YHQA 4X65Q 1N5WA 2I5LX 3PRPB 1QNKA 3ULPA 1PZID 2O2LD 4X62Q 2BWES 4QJFA 3DM3A 1I6HH 5G3LF 2MX2A 1C78A 5MPOA 2PW7A 1SYBA 1BNZA 3D8GA 5C44B 2MLBA 3RR5A 3H6NA 3RN9C 4YWLA 2R2QA 3DQVA 2XVSA 1J5EL 2F4VL 2O2VB 1WXMA 3J80L 1C7YA 1N62A 1QOAA 1YD8U 1C4PA 1IGDA 1LQBA 3HRZC 3KQ4A 4MGKE 4W9HA 1QKZA 2INCC 4GU2A 2VUMH 5HHDG 3OTOQ 1PXUA 1H4RA 3E6ZX 3TP6A 1V81A 4ARCA 4GNXB 4KTAA 3NVYA 2RMMA 3QIAA 1U4PA 3H1UA 3GTGB 4G0NB 5JZEB 4KMUC 2KQ7A 2ZCCA 4NQKE 4ZRIA 1UNSA 3MHBA 5ELFA 5JJZA 3I4MH 5JXVA 2Q8TA 1XCTL 1Y1WH 1MVKA 2MJEA 2KZRA 4XDDA 4MN3A 4A3BB 2OQ0A 1CUKA 1YJJA 1AWDA 1MSGA 2VB3X 1WX8A 3SR1A 2RDBC 2V4IB 2BS2B 1V5OA 2V4DA 1LT3D 1CMXB 4BKSA 2XEWA 3W5UB 3K6OA 1WCMH 3X3NA 1KLUD 3RLNA 4AYBE 2ZPYA 4I7ZC 3OLMD 1X3QA 3PLVA 2K14A 2KMMA 2E76C 3L3OC 4LF4Q 1HFNA 3A55A 1MI2A 4EX5A 3Q8FA 2CJOA 4HPPA 3CMEA 4FULA 3HK0A 1TIFA 2LUMA 2WGSA 3I70A 2IPKD 3NUHB 1PUTA 2KC1A 1GKHA 3Q6BA 3KF8B 1DD2A 1H9KA 1ZW7A 1CSPA 1Q8IA 2PE6B 3CW2C 3N20C 4WJQA 3GTJB 2IY5B 1CT1D 1KLGD 1MG8A 4CHKA 2ZTCA 4US9A 5D3DA 1C9OA 2Y0SG 4BBRB 4WJ3M 3PF5A 1M90C 3S17H 2A74C 3LJ3A 1H8CA 3G6EA 1XLNA 1I42A 4KKJA 1LT4D 3HOZG 1ACCA 3CQZH 4GDKB 4HIKA 1KFYB 1JWUD 4E3CA 5HGTA 3G71A 1G2TA 3PIPA 2V3SA 4KSKC 4B0EA 3KUDB 2MRPA 5IYCH 2IHFA 4X6AH 1CHQD 2X69A 3EJIA 1YIJA 1VQ9A 1AEXA 5BR8L 1L6UA 2LGIA 1WRDB 2WXMA 2F0UA 2H89B 1C3TA 2RPVA 3HIZA 4LDTB 1JCKB 1EYDA 3HM3A 1HPCA 2AQ2B 2WWZA 1LTGD 4DR4Q 3KYHC 1WMHB 2N1VA 2JX5A 3U4ZA 4C7ZA 2VXWA 3DVGY 4N6EB 2E2HB 2LUEA 2IHEA 4CYEA 3AE1B 1TIID 1TYGB 1X32A 4GNXC 2PNRC 2OTLA 1HZCA 2JXTA 3BJUA 5C3XA 1H9MA 4N9F4 1B7YB 3A0JA 2VQFQ 2L76A 4BAXA 2REXA 2Q2TA 2BKFA 1HUNA 2WXQA 3TEYA 4DUZL 2XN9C 2O5IC 3A4SC 4HWIB 4K2KA 3AEDB 1HNZQ 1WGHA 4ACFA 2LASA 2IY1B 1MD2D 2IJ0A 3ICEA 1YEZA 3N52A 5H1SE 5DPTA 4B9XA 4DR6Q 2VL6A 3P42A 2FCNA 3QJYA 1LXDA 1NYRA 2C7MB 2YV5A 2PYKA 4A3EH 2WXFA 3AMZA 4MH0E 4A3KH 5C5MA 1QOFA 4KGSA 1J0GA 2WP8J 3I7FA 4WIPA 3T1YL 5EPLA 4XGAB 3QX1A 1HEZE 5C23A 1UBQA 1UBIA 5D6JB 3WOEA 3K59A 3NWSA 3AU7A 5IP4D 1Q82C 4BA2I 1NVID 4A93G 4K8IA 3VYUA 1EF5A 3AB5A 1O78A 5JEAH 4DDGD 5F2DA 1JQYD 4JWSC 3J7AF 1XXGA 1HJPA 1VQFA 1BR9A 4YSZB 2KJXA 3I55A 2GRIA 2YVCA 2KCTA 3SU8X 4R4OA 3PGEA 4UY8C 1VQHA 3B9JA 1W2BA 4A3DH 1Y8NB 1E8WA 3LGJA 5BYQA 4ANUA 4DNTB 4AUQC 1KLVA 1CI3M 3C46A 1UF0A 1I4XA 1TY2A 3M9BA 1VZ8A 2KNBA 3I8ZA 1PV4A 3PUZA 3L17A 1YIWA 1T3QA 1PFNA 2GN5A 2QHOA 1BQQT 2F0IA 3IT4B 2KKCA 3HGBA 3G4SA 3PZDA 2SDFA 2DNFA 5HG2A 1HR0W 4HDQA 4TQ1A 3H0GG 1TKGA 2K01A 1TZ1A 4P1BC 4FXDA 2PNHA 2B2TA 2MQJA 3S1NH 1UD7A 2NCNA 4K5XA 3DWMA 2K5HA 2WB1G 1HCZA 4CKEA 4Z9CB 3NPPA 2B63G 3RD4A 3JSVA 4A3JB 3WOFA 4DHJB 3A8IE 1C48A 3NZ3A 1SSNA 1VQJA 4WQMA 4X3TA 1MHWC 1B3QA 5CHVC 4HVBA 3QA8A 5DM63 2D3BA 2DYMA 3ONSA 4Q2JA 1D4BA 3PMFA 1A8VA 2BPSA 2INDC 2X6LA 4WWPA 1SFOH 1RYJA 2O6VA 3ABVB 4EFOA 4TQ0A 3G48A 2J42A 2LRUA 2G4SA 2XK5B 3AMUA 5HI1A 3PUVA 3ZNID 1YX5B 2CKHB 1QUQA 4DV0L 2QA4A 4DR7L 3VUWA 5C3EG 1SIJA 1YNJC 3PIO3 3NEMA 2BA1A 4OHJA 4QUFA 4A3PA 2R7ZG 3EA6A 5C0XI 4ANXA 3AM9A 4LF6Q 1FGBD 1XMQQ 2EJMA 2KHIA 1QOBA 2QJLA 5CV6A 1XNQL 2JZZA 2ZVOA 4CDFC 5HFYA 1KRTA 2Z0DB 4RGMA 4YCUA 1EQRA 1I4QA 1EQQA 1KABA 4H02A 2YU9H 2VNUD 4A6QA 4B08A 1IPGA 1C77A 4QQBX 1KRHA 1R9TH 3IFDA 3CPWA 1YI2A 1BMLC 2V3NA 1CQFA 3S15B 4LDTD 4NAWB 2FCMA 2DBYA 3UGBB 3FPPA 5AZHA 3I4NG 2GB1A 4ANWA 5IYBG 2GBRA 1TU2B 4ZYSA 4XYOA 5I6WA 1TWAB 2LMCB 4DR5L 1I4PA 3QWZB 5HY6A 2WDVB 4JX1C 3ALBA 1K9MC 3TBLD 4GLAC 2G9DA 3AH7A 2EVBA 4LFBL 3TEWA 4AWJA 3QO2A 3IT6B 2JWZA 1Q90A 2DAFA 1WOCA 2XGTA 4FBJB 2JSVX 1E7PB 2N7DA 4UP7A 1JW9D 1YNJD 4MACA 5BYRA 1YBYA 4KV2A 4RMFA 5DPSA 1JE4A 5AFWA 1AFPA 1FRRA 5M5XH 3NVVA 4W9GA 3ZNZB 2KMCA 1IKMA 3KK7A 1MJDA 4JI3Q 1BF4A 2NVTH 2N0SB 1SE9A 3RLFA 3FILA 1DOLA 4NP5A 2EKEC 2D5DA 2CR5A 2LGDA 2WDRB 4WJOA 1I50H 1PTOF 3STBC 1AZPA 1TKWB 4GOPB 3IG3A 1C4CA 4CKBA 1WTHA 1TWCH 5HGQA 2IO2B 3P1MA 1J7BA 2AHOB 3KLWA 1VQIA 2ZTDA 5CYUA 3KJOA 2MP2A 1EY9A 3S1RB 1Z5SB 2DAJA 2ZEQA 4A3CG 3QHTA 1ZDXA 1F77A 2LJ5A 1HHVA 5IYDH 4A76A 1N5XA 1SGHA 3GTMH 1G291 5LL6X 1GJZA 3BZCA 4TQUS 1YNTE 5GXGB 2K50A 2BS4B 4GNXA 4XZ4A 2J53A 1TVXA 4A3GH 4A3LG 1YMHE 3N30A 2NB0A 3BG3A 2Y0SB 3Q3JA 2FAZA 1QLBB 3D6WA 3L08A 4OGQC 2BH8A 4KD3A 1FJGQ 3ZYYX 2L83A 3S1QB 4IW0A 4C3JH 3QOLA 3L54A 2BE5C 4NNJB 1Z6HA 1HR0L 1JOKA 1WRIA 1B44D 2MO1A 2E5LL 4W9KA 1KIXA 1PGXA 5L83A 3K81C 3UDGA 3FKIG 4LF8Q 1HNWL 4GKJQ 5JHAA 4LF9L 1FNUA 4XT3B 2YEPB 4QUCA 3CCRA 3AXCA 1IL2A 2K39A 2BA0A 2ZM6L 5LMUQ 3P4RB 2JPHA 4NXNQ 2K8CA 4ASWC 2EY2A 4JBKA 5BMIA 2R3ZA 4KJNA 1T0QC 4NQLB 4OVVA 1D5XC 1Q12A 3K7AH 3JAML 1LT5D 3MVVA 2MEKA 1V9PA 4HKZE 4C00A 4DHJD 4URKA 5LMNW 2FJ2A 2UXDL 1T6BX 5K36G 3FEWX 4A75A 3LWUA 4B3RL 1JT8A 3JW0X 1IBLL 3N1XC 3VR8B 4ID6A 5IGCA 4ZHPA 2CH4A 4PG3A 4RCNA 4UAIA 3RUZA 2NN6I 4DV6Q 3H3VI 3HOZH 4RGNA 1N34Q 4KN4C 5AZFA 2GI9A 1SDFA 2IX0A 1E5WA 1A2UA 2PCFB 1VZ7A 2J52A 3VRAB 3GO5A 5FLXL 4ZRJA 4WAAA 1TTNA 3CHBD 3K80C 2Y5BB 5C3JB 3HKSA 1IYVA 3ECIA 2WIIB 2C5CA 2J0JA 3BZKA 1CKMA 1OQRA 4Q5VA 4K5VA 4JYAL 1WWTA 3GB1A 3P4QB 3APFA 2K22A 1WR1A 4IWPA 1V1OA 1H9SA 2NZ1D 2EJGC 4X3SA 1VDVA 1Q8KA 2WS3B 2YLMA 3ETRA 4JQWC 4AS1A 4GOPC 2CHWA 3SK8A 5DM73 1EIGA 1K52A 4P2CB 1G6JA 3NBHA 5M3MH 3M85A 1SR3A 4FNFA 4HJ8A 2IBIB 3RMKC 2ID0A 3HOUB 3HOVH 1HZ6A 5G3LD 1V1QA 4A93B 3R3MA 4ITKA 3NTHA 2LWPA 2V4LA 2ZZPB 3HKZE 3SDZA 1D5ZC 2F0VA 3HVZA 1FFVA 4DK1A 2A1AA 3UQAA 1GM5A 2Z0EB 1L2NA 1EFWA 3I91A 3TMEA 3U58A 4DU9A 3Q3MC 4HK2A 3AE5B 1U5KA 4A3OA 2L0FA 1K8GA 1NMGA 2WXOA 3VHTC 1BDOA 1Q86C 3UI3A 3PGZA 1WM2A 1YN3A 2CS4A 2CWPA 5JPMC 5I4DA 1XD3B 4ZHOA 1R7SA 2LFNA 3TREA 3QC8B 4PK1A 3U9OA 4IUMB 3H0GB 1EOVA 2DYOA 4DV4L 3MTNB 4PYUA 1S5ED 3EFXD 3ERQA 1PDQA 4YTPB 4BBNC 1S4ZA 2JE6I 2R92B 2JWUA 3VYSA 4K7UA 2CHZA 1I35A 1F52A 1L0XB 2CFMA 5BN5A 4ZK9B 1ILQA 2VQEL 3J80c 1IBKL 4H2AA 1Y1WG 1D2BA 1FMAD 1II3A 3AEFB 3B2GA 3AV8A 4PZ6A 4IUQA 1H95A 1JMCA 3RZWC 4C3HB 4BKGA 2JVCA 4DXFA 3T51B 2JSOA 4WAFA 4YHHL 4BBSB 2M0XA 1KDAA 5EDSA 1Y1VH 4DK5A 2AQ3B 4AYBG 2L0TA 1NBFC 5JEAJ 1UWMA 4PMWA 4JI5L 1PH4A 4OX9L 4AQYQ 2L3ZA 3OG5A 3CP0A 3HM6X 2B2UC 4U68A 2C9WB 1FPYA 2BVCA 4LAAA 2E2JH 2Z9HA 1BBXC 1PVOA 2H88B 3CXCA 1FCLA 4A3FG 4IUNA 5CORA 1P9DU 4DV5Q 1GG3A 1P7EA 3K9OB 1NAPA 1JB7A 2PTLA 4GOCA 1E0ZA 1K83H 3GTPH 5D65A 3ENEA 5JHBA 1XQQA 4M8MA 1B3AA 5EGTA 4K7WA 5EE0A 2WFWA 3UQBA 2MQHA 2A5UA 1V1PA 1XPRA 3DBHI 1SNPA 1JE5A 5BN3A 3P1HA 4IFDH 2KEDA 4G3XB 4OZCA 4JI1Q 3TEZA 1S1QB 2MBHA 4NXMQ 1XX8A 4DV2Q 1Z47A 4C1NI 3IL8A 3J81L 4L63B 3T3NA 5EAYA 4OEMB 1WXQA 5CX3A 1JJ2A 4A4IA 4I6NB 5C3EH 3NUCA 1HZAA 1N60A 5IAAC 3NVZA 3Q3OC 4WJWA 3W3AA 5IN7A 3PV1A 1X54A 3M3YH 3M4OB 1YQBA 2VS1A 4N58A 1ONLA 2R7ZH 2N1WA 3F2DA 1UE7A 4K7SA 4IJHA 4KIKA 1FEHA 3PHWB 1BCPC 2KJ6A 1H9JA 4KHZA 3IAM1 4NJCA 2KDBA 2UXCQ 1EIFA 2WU2B 3CRLC 2K0PA 4IWOA 5ELNA 5FLXE 3TEHB 3KWVA 2RBMA 4G7HC 2JU6X 2N7JA 2JYOA 2MO0A 2H1EA 4IOIE 2ZXPA 1FM0D 4P6VF 4KDLB 1X3EA 2D62A 2MFIA 3JC66 1OXSC 2E75C 4IALA 3HOXG 3I4NH 1Y8RC 3MFGA 4W9EA 3PRZA 5IYBH 3C8YA 4AQ7A 2MNAA 3MXNA 1LTLA 3KYCD 1YNNC 4MT5A 3T16A 2MBOA 4F7ZA 5EE9A 3ZJTA 3V6EB 2RD0A 4WORA 5CR3A 4B9WA 1DZ1A 4DGZA 5CTRC 3GTOB 2PMVA 4ARIA 1SSOA 4I7AA 5IGBA 1V80A 2LXAA 2VRRB 1TWGB 2LMCA 2ZW0A 4MSQB 5KRUA 3M4PA
chains in the Genus database with same CATH topology
4A3IB 2D2CC 2MJDA 4RCOA 2M56B 2TSSA 3I90A 4IUVA 4QIWB 2NTTA 3AN1A 2FMCA 3RFZB 2KA7A 2G9HD 1PTOH 3PZ7A 3BDLA 1GB4A 4DN4M 4PV1C 3M7NA 1GHKA 2K9XA 2QEJC 1DOIA 1YNND 1ZPSA 4H13C 3MA2B 5M5YB 5EQ0A 2Y3AA 2EYPA 1IL8A 1GB1A 3MWYW 2N88A 1CM9A 1Y8OB 1QF6A 2JA8B 1PFDA 2B2YA 3UI2A 4JWUC 4REZA 1PLFA 4EVOA 5K5PA 2AX5A 3RZDB 2A6EC 5COYA 1I4GA 1MI0A 3EROA 1FXAA 4DAYA 4NMZA 3I73A 2BBCA 4FYDA 1J7AA 5D7GA 3VQIA 1TWFB 2A6HC 1L4DB 1STEA 4KY6A 2IT1A 1H9RA 1PZKD 1HFGA 5FK9C 3SFDB 2ZT9C 4OZAA 5J22A 3SK4A 4MM3B 2FUG1 3FVQA 1GUGA 3H6MA 2A73B 5E4XA 1G8ZD 4DQOC 2JYTA 3L9AX 1K53A 1JWAD 1XLPA 1JROA 3HP3A 1BO0A 1HTPA 2PZTA 1ZYRC 3PIP3 1QQRA 2B39A 2LS01 2VUMB 1IYUA 1HRJA 3AEEB 3OMCA 1TS4A 1EQTA 5CV9A 3I4MB 1QG7A 5DEHA 3BYTB 2B8GA 5FO8B 2DWQA 3FILB 3SFEB 3P4PB 1V43A 3PV0A 2DLBA 2B2TC 2RKSA 4RH6A 1NUCA 1QOGA 2WXRA 4XYQA 4JK1C 1ENCA 3R3OA 1WCMB 4H0LC 1ML0D 1ZYRD 3MXGA 4YTMB 2KCCA 1TT2A 1RTNA 1FRDA 2W54A 2M00A 1F2ZA 2EOTA 2OF1A 3GD7A 5KGUA 2Q5WD 2M19A 3URYA 2CJNA 2NVYB 3S17B 4YXDB 3VYTA 1NI3A 3TP8A 3CQZB 1ESFA 2WP9B 2KWDA 4C3JG 1LTSD 2F3WA 2WXLA 2NN6G 3OOCA 3TEXA 5H8YE 1A70A 1D5MC 3SEBA 1QT9A 4ZUJA 3L7ZC 4OL7A 1O80A 3FRPB 4OIJA 1UWXA 4CJ2C 1XEEA 1DCZA 2EELA 2WU5B 2PQEA 3NTKA 2K05A 3HOYB 3MEHA 2Z1CA 2PO4A 4CBVA 2PKOA 4CJ0B 2PZWA 5IODA 2B2VA 2EYLA 1H9SB 2ONQA 1FCCC 2RSOA 1FNVA 1DGJA 2JZPA 4XQNA 1CFMA 1Y8PB 2GA4B 4QB4A 1SYCA 2RDGA 4A3KB 5CBEE 4P16A 2WDQB 4FF2A 1LT6D 4M8AA 1DOYA 1GUNA 1KDBA 1EY7A 1NCVA 1SE3A 2F0KA 5IOCA 3DWPA 3U52E 3CRKC 2F4IA 1TS3A 2HQEA 2AUJD 2QSDA 4HRSA 4A3DB 2WXGA 3TP5A 1Q1EA 2IX1A 3OW7A 4NZLB 1VLBA 4DXGA 3P20A 1SNMA 1E2WA 1SYDA 3CIRB 4J1MA 2N9KA 1XTCD 2Z4HA 3CU7A 1R4QB 2EJFC 4DAPA 1DXMA 2N9LA 3SK5A 2FFKB 4ZLTF 4HJGE 4L2YA 4FVMA 2ICIA 1UGJA 4U673 3J80E 3ITPA 2K5WA 1IUEA 3A56A 4EQOA 3R2IA 4IUTA 1ROEA 3I3CA 4MHEA 1SAPA 1Z7TA 4RF0A 3S9WA 1UAPA 2HTME 2L1BA 1OXUA 5KNBA 5HURA 1ZXHA 4GLSC 1SYFA 3W2DA 2I2YA 2JXMB 2B2WA 4HN7A 4QF4A 5E6JA 1BCPF 5NUCA 2OT2A 4KHVA 1V1PB 2FINB 2M0AA 3VRBB 1BUIC 2EYJA 1AW7A 2RQXA 4E6IA 1X3PA 1WTPA 2V3PA 1DYQA 5C0XH 3Q23A 2CHBD 2KQ4X 1B9MA 3FMCA 4CJ1B 1PRTB 3A54A 1R9TB 4IFDG 1EM7A 5ELEA 1CQVA 3H91A 3J7AV 5I6YA 2LHEA 2B76B 2DNEA 3VA5A 3DM1A 2WV6D 3P4SB 2ZXRA 1K8OA 4JPSA 2WACA 5KNCA 1GUSA 3DXJC 3OIQA 3BIID 3BK2A 1SNQA 5JPNC 2D5GA 1ESRA 5FR3A 4OVZA 5M5XB 2RDHA 2K33A 2OEOA 4ULLA 3E0JA 2NVTB 4PQXA 3VR3A 1I50B 2XWJB 1L4ZB 1UUPA 3G7LA 1C4QA 1TWCB 4RHSA 2FMMA 2BB6A 2EZVA 4US8A 2HCIA 1C8CA 4KX6B 3GTKB 2Q8IB 4EE2A 3GTMB 5C4ZA 4CQNA 3IFTA 4C3IG 1G91A 5LHY1 4A3GB 5FO7B 5FO9B 1TS5A 2IW3A 1STYA 1STBA 5T1IA 2EPBA 2ICEC 1LTAD 4C3JB 3O13A 4OZBA 1TQOA 1ET9A 1F2RC 5CV5A 4KI0A 4RFBA 4RKBA 1ZEQX 1B9NA 4RF1A 2L11A 1E9MA 3VYRA 2WXNA 1FFUA 1JB3A 1GXDC 4O42A 1MHXA 1SE2A 1PRTC 1CA5A 1LABA 4IN3A 3R93A 3OHXC 1YQ4B 3K7AB 5G5GA 4DK0A 2PW9A 4GZYC 2R6GA 1B1ZA 2C9OA 5EKKA 3IXSA 3HOZB 1SXTA 1J8IA 1QCBD 1NR4A 4ME5A 3TP7A 1PYWD 2NN6H 2A5HA 4RGTA 2WXPA 3KLRA 1KNAA 3Q22A 1PDXA 5AUKA 2O4XA 2F3VA 2JEBI 1LTRD 5CMDA 4L23A 2MJ8A 5ELBA 1IGCA 5M3MB 2HDEA 3N9YC 3LB8C 4TKOB 3KWLA 4XDCA 1PRTD 3OSOA 3HOVB 4FP5D 2B8FA 2HDLA 1JWSD 1WTWA 3I9V1 4GDLB 1EYCA 2E74C 1FXIA 2W3RA 4R9WA 1STNA 3R2TA 3V05A 2ON8A 1ILPA 2KDMA 3DWQA 4RWSC 1HA5A 1Q1BA 1AN8A 3TZUA 1SBBB 1CTMA 2Y5PA 2XIWA 2KUMA 1EWHA 4S3SA 1A6XA 4FO2A 1XO3A 2BB5A 4G57A 1WD0A 4HEDA 1OXVA 3NP8A 5CBAE 1VRAB 4A9AA 2B2YC 2XRQD 1Y1VB 1JWMD 2LKVA 3HUIA 2K04A 1KTKA 3U4EG 1O7ZA 4R8NA 1MSHA 1EQVA 1TKEA 1SJED 5KEEA 1S5FD 1MBYA 5A35A 1W6JA 2E2JB 3FDTA 1IBXA 5FOBB 3J9CA 1STHA 2F0QA 3OMGA 2WB1B 1K83B 2QCPX 3GTPB 2B63B 1TKYA 3KUPA 5JVH3 2EYFA 1VMCA 1ZUD2 2I07B 4RHRA 3H09A 2L9HA 5T8IA 4BA1I 3AEGB 5C3EB 1L6VA 3A8KE 3DEOA 1WTXA 1P7FA 4K6LA 3M3YB 4RAUC 2NUCA 2R7ZB 2W82A 2KOLA 2KECA 3ONAB 3C3LA 4MH8A 2JYEA 5E3FA 1HXYD 5EPJA 4A55A 1IW7D 2DY8A 2IWHA 3K5MA 1B53A 5EKLA 1WD1A 1EU4A 1M4VA 5I9OA 4TMAB 1SNOA 1EEID 2WKCA 5I2XA 3KBXA 3I4NB 4G7ZC 5D14A 3JAME 1FNWA 2O5JC 5EKIA 3IAS1 4ZKCB 1VF5C 3DMUA 1F9QA 2EY1A 2J7ZA 5IGEA 2WXHA 3R8BA 3PZ8A 1L0VB 4XXEA 4N9PA 2Z4IA 4XTCS 2RSNA 3GV3A 3NBIA 5H92C 2L32A 3GP7A 3VR6A 3HZXA 4DAVA 4IQZA 3M4YA 1EZ8A 1GUOA 1AP0A 1PTOB 3T4AC 3Q6SA 3AE7B 4Y7NB 1OXTA 1XWEA 1DONA 1XF5L 2K7VA 4XE0A 1WTOA 1XCQL 1C76A 3I4LA 2QF7A 4RGOS 1SF0A 3Q0AA 2EXZA 5T1GA 2EY6A 1C79A 1EY8A 1F9PA 1FD6A 2F0FA 3FKIB 2L55A 5CV7A 4LK1C 2SNMA 3EQLC 1NR2A 4FF4A 1I4HA 4N59A 3QWNA 4J6HA 2EY5A 2B2VC 3K5OA 2AUKA 2BW2A 3PUWA 3X3MA 5C3WA 1JQ4A 4YWGG 1AYFA 2K3UA 1EFID 1ZXIA 5KYIA 3K5LA 1E6EB 4QMGA 5CV4A 3W5VB 4J8QA 5C0XG 2PMZB 1FIQA 1GHJA 1EIHA 4TSSA 1U4MA 1EY5A 3K57A 3LNNA 1VF7A 1SE4A 3SE0A 4LK0M 2F0DA 3OIPA 1RDPD 1EOTA 4FXKC 4WFN3 4FF3A 1PMRA 1RJTA 1PTOC 4G7OC 4HSVA 5KIXA 1EYAA 1Y69U 4RKLA 1A3VA 5C5LA 1V8CA 3B2FA 4USAA 4IDIA 4XWTA 3J81E 1I6HB 1S5CD 4A8XC 1C9FA 3VA7A 5IT9L 4F7XA 3IKJA 3AEBB 1C4AA 2DY7A 3MXUA 1RCVD 3TUOA 1L5PA 2KCNA 2ZW1A 4K14A 3N6RA 4BWGB 4OW0A 1G6ZA 1GJXA 3ND8A 4HMIA 4EQNA 3BS1A 1JICA 4OO1I 2I38A 1Y1WB 4I65A 5A2QL 3HRDD 2K5PA 3NRZA 1PTOD 1LV9A 1QE6A 3ZGZA 5E1FA 2WLBA 2B2WC 2D9UA 3Q8CA 3AE2B 2F0PA 2CW0C 2ENBA 4MIUA 5C6AA 4AYBB 3SXHA 3CWIA 4NDXA 2QILA 2DNCA 1STAA 2F0SA 5EJWA 4EQPA 2K28A 2VB2X 4A3FB 5IGDA 4YTNB 3HEJA 4RA8A 2ACZB 3W1SA 5CGKA 4ILWA 1LLRD 5CC4A 1DOMA 1O7LA 3MJ5A 3HS0C 1FR3A 2PZUA 2BCOA 4XIGS 2WXJA 1LO5D 3WDNA 1KNEA 3BDOA 1NENB 4L6TB 3VR4A 1LACA 4K2LA 4IKGA 4B0MA 4DFAA 2LEKA 2CW0D 2J0TD 1Q10A 2K5QA 2MGSA 1CZPA 1WYGA 3OWFA 1N63A 4XQJA 2IDYA 3E9SA 1VJKA 3LWEA 4WWMA 5ELCA 1QILA 4JBWA 4NW2A 3T53B 3MHZA 3VR9B 1PZJD 2F0NA 4WURA 5I2YA 3LX0A 4K5WA 3HOXB 5ELDA 3H8HA 3RZOB 2WQYB 5EPKA 3ND9A 3BVGA 1YN4A 2FE8A 2JP1A 4WRDA 1CZWA 5LNK1 3ZJUA 2IL8A 3QB3A 4IFDJ 2KACA 2F0HA 2MP1A 2XWBB 2NVXB 3P7JA 4F88A 4C80A 4A3EB 4ZRQA 4YIJA 1Q3LA 1ENFA 1TR5A 2F0JA 5IT9E 4WH4A 2YEPF 4PMBA 4NKLA 2OXPA 2G1EA 4KD4A 2E2IB 3BK1A 3DWGC 4M0WA 2EYHA 4H7BA 4ZKBB 1RM6C 1M8AA 2JEAI 1J9OA 3TDQA 3U9SA 2N55A 1KDCA 4HEA1 4HMJA 1DOKA 1T5XD 2FHTA 1HUMA 1IBXB 5M5WB 1XLQA 5C4HA 1R4PB 4KY7A 5A2QE 2L1AA 1ZP0B 4K8JA 4PNYA 1ZOYB 3C1FA 3S1NB 2NTSA 1NYQA 3AECB 4XWWA 2KQ3A 2LJIA 3GV6A 1YQ3B 3NQTA 3V2TA 1CK1A 1AZQA 1SYEA 3C2PA 1NSNS 2HUGA 4DF7A 2WNMA 2TMPA 3DUZA 4OGQC 3C1EA 1OXXK 1SNDA 3D6CA 4ZQ3A 1SFOB 4FXGC 3SR6A 4A90A 3KLSX 1F9RA 2R93B 4X3KA 2Q8RE 3T13A 1SB3C 5CV8A 2JA5B 4Q0FA 4F8MA 1EL0A 4XQQA 2OHFA 2F0OA 4H44C 3TZDA 2L4NA 2BS3B 3K5NA 3Q8AA 3VR2A 5BMGA 3AE4B 3ZJVA 4JE3B 1EWCA 2NWGA 3WCQA 1MPEA 3RPFC 4K6DA 3AE3B 2YU9B 2Y5CA 2PVOD 4IZ8A 1SNCA 3DWAA 3MAQA 1TJEA 3EUB2 3A7LA 2BOSA 1B2TA 4L1BA 2F0TA 2F0GA 3AE9B 3W9CB 1JOOA 1V8QA 2H4OA 2WKDA 4L8JA 2F03A 2VZKB 4C3HG 3DHQA 4KGRA 5M9OA 4KN7C 3Q8EA 2PLPA 2AWNA 1PFMA 2BDOA 1ZDVA 4HCSA 1CHPD 2J4XA 5IIFA 5IGFA 2PW5A 1RODA 1FYCA 2EYMA 2NVQB 1SEBD 4HSPA 1E10A 2KAJA 2BTEA 3TN2A 1UEAB 5E4WC 4KKUA 3D3RA 2F1MA 5EBDA 2E2DC 1ET6A 3PO3B 1JRPA 1JOQA 1WTQA 1GUWA 5LL6S 4HKQA 4KGTA 1FO4A 5BYSA 3K58A 1BXTA 1F2RI 4KKIA 1S5DD 1RF2D 1IHZA 3BVMA 4IUUA 1JWBD 5DNFA 1HTLD 3EVQA 2XSCA 2PPBC 4KJOA 3EGRA 2BDNA 4V190 4EGVA 2KEEA 2KVMA 3S2HB 1LTID 1MHHE 5C2TB 5TSSA 3FC4A 1STGA 2NMQA 2BYTA 1SJHD 1WTRA 1QJOA 2SAKA 3Q24A 1D1IA 4QCLA 3S16B 5JAVA 3A8JE 1DM0B 1B4OA 2WINB 3HG9A 2WXKA 1VMPA 1DOXA 3SHLA 3BYYB 2YYZA 1F0ZA 3KBGA 1EZ6A 3D31A 4PT5A 2CVRA 1ICWA 3FPUB 2PIAA 4YSYB 1VDZA 3K0YA 2W3SA 2CQAA 1I3QB 3HKZB 5KYLA 4DNRB 4LTUA 5KNDA 1U9RA 4ZRPA 2F0EA 1VR9A 3A7AB 2L0CA 4HAEA 5J39A 5EBCA 1XYIA 2V0GA 3QG1A 3P75A 2X38A 2XNAC 5IGGA 2INPE 3DEPA 3NHHA 1J7CA 3G6JB 4A3MB 4OO1G 1RKNA 3VR5A 1B9RA 2ZXOA 2Z8LA 4LLGM 3BWUD 2K03A 1YN5A 4ODGA 3NE5B 3S14B 1FD7D 4R3DA 4PMCA 2K32A 2IGDA 2VZKD 3KF8A 1I4RA 1JMLA 1T5EA 5AUIA 3H3VC 3NQIA 2IGHA 1BOSA 2A68C 1CZGA 1U4LA 4HCEA 1JC7A 1EY6A 4UDUC 2QDBA 4LMQD 3BVZA 2M9VA 2BE5D 2SEBD 1QWYA 5FKAC 3H94A 2A69C 1RWSA 3OPOA 3PUYA 2NBFA 1JR0D 5M3FB 2KHSA 4ZOHC 2IGGA 4NAMA 3NSWA 1EWYC 4DA2A 1E0BA 1QNUA 4C1NK 2LFIA 3S2DB 1IW7C 2F0LA 1I7HA 1K51A 5C4XB 1K8MA 2EE1A 2OEDA 2RDFA 1BCPB 3Q69A 2A68D 3LYYA 3U2SC 1N61A 1G2SA 3MTSA 3E5SA 2RVLA 4G4KA 3GTLB 5EE1A 1IKLA 1EU3A 2MUYA 4KV6A 2WXIA 2A69D 1W6KA 4IURA 1D1KA 4KKTA 2MJ3A 3AE8B 2JA7B 5C4JB 3KLSA 3F2UA 4YT0B 3ZQ4A 1VZ6A 4ZAIA 1TWHB 3L4PA 4J3OD 4XDXA 4CGYB 2XRSD 3HOWB 2K5DA 2CU3A 1JALA 2DN8A 2QKIC 4RNAA 3CKIB 1ZKOA 4LJZC 2HCCA 1XLOA 3I72A 2AWOA 5C0XJ 3GS2A 1WVLA 4YSXB 1I6VC 4C56C 1A15A 4C3IB 4CHTB 1EY0A 1F2MA 4V0BA 1DJRD 2R61A 2IX3A 2EYOA 3MP9A 1HZ5A 2M2LA 1KF6B 2WAQB 3TBIB 2NYZD 2QIEB 1A3TA 1MGSA 2JA6B 1WTVA 4FF1A 3D4WA 1PFBA 1GAQB 3T56B 3S1MB 3V3XA 4ZUIA 4IFDI 3QOJA 1ZE3D 4X3UA 3RMHA 4BS9A 4M1UB 3J7YW 3AEAB 2EDGA 1ENAA 4D2KA 5G5HA 3V96A 1RTOA 4KK7A 1D6EC 4KKSA 1B50A 1RHPA 3P63A 2QMTA 1HQMC 4N9TA 1ZXTA 3NVWA 3MZ5A 1GPXA 5DAUA 3GTQB 4OIKA 1V97A 2PVGC 1L0YB 1RD9D 1KH0A 3PO0A 4TRDA 5ISRA 3D4RA 1PGBA 3NS1A 4HR7B 3BZDB 3M7GA 1CJEA 1BCPD 2I46A 3SVMA 3T3OA 3D4DA 3OWEB 2SNSA 4ABNA 4R8IA 1WSPA 1TY0A 3NTIA 1BUVT 5JOBA 5JEAG 1TS2A 5I9PA 1A2TA 3E56A 4FXCA 1YJIA 1WGKA 2E6XA 1LTBD 3HVDA 1Y56A 3LXFA 1QB5D 2SOBA 2X6GA 3AE6B 1OO9B 4IUPA 1RFKA 3IAYA 3I57A 2KN4A 3BDCA 1GOZA 5BMHA 2K6AA 2E3TA 1HA6A 1SMYC 2HDMA 5J1ZA 4BY7B 3AB9A 2RA4A 3NK9A 2MHVA 1E2VA 3MXPA 1TZOA 2W55A 1F2YA 2MPMA 3U7ZA 2EKIA 2BT6A 4KY5A 3PO2B 1E2ZA 1F2LA 2F0WA 5BN4A 4C2MB 4OO1H 3NWTA 3Q8BA 2L52A 5K36H 1S5BD 2AQ1B 1JORA 1KAAA 1U4RA 1HQRD 1A3UA 1GUTA 1CA6A 2K1BA 1OFFA 5EE3A 2MH7A 1OQQA 1O7YA 4HROA 1QOHA 2F0MA 4C7YA 3MFYA 1PRTF 1F9SA 2INNE 1SYGA 2LY7A 4HTHA 3TSSA 2FBWB 2JQRB 1SMYD 2B2UA 3MC0B 4ZRZA 4F87A 1NEKB 5JVG3 3GQBA 1K50A 1VCIA 3PUXA 4XT1B 3SK6A 4CKCA 2A6ED 3FAHA 2L12A 2L5TA 2LHDA 3NXWA 1EY4A 1LTTD 4O1NA 1PGAA 1EEFD 2A6HD 5D3IB 4BY1B 1N5WA 1QNKA 1PZID 2O2LD 5G3LF 1C78A 5MPOA 2PW7A 1SYBA 1BNZA 3D8GA 5C44B 2XVSA 3J80L 1N62A 1QOAA 3KQ4A 1C4PA 1IGDA 3HRZC 1QKZA 4ARCA 5HHDG 1PXUA 3E6ZX 3TP6A 4KTAA 3NVYA 2RMMA 3QIAA 1U4PA 3GTGB 4KMUC 1UNSA 3MHBA 5ELFA 5JJZA 5JXVA 2Q8TA 1XCTL 1MVKA 2MJEA 4XDDA 4MN3A 4A3BB 1YJJA 1AWDA 1MSGA 2VB3X 3SR1A 2V4IB 2BS2B 2V4DA 1LT3D 3W5UB 3K6OA 3X3NA 1KLUD 4I7ZC 1X3QA 2KMMA 2E76C 3L3OC 1HFNA 3A55A 1MI2A 3Q8FA 2CJOA 2LUMA 3I70A 2IPKD 3NUHB 1PUTA 1DD2A 1H9KA 1Q8IA 3GTJB 1CT1D 1KLGD 4US9A 5D3DA 4BBRB 2A74C 1XLNA 4KKJA 1LT4D 1ACCA 4GDKB 1KFYB 1JWUD 5HGTA 1G2TA 4B0EA 1CHQD 2X69A 3EJIA 1AEXA 2LGIA 1L6UA 2WXMA 2F0UA 2H89B 2RPVA 1JCKB 1EYDA 1HPCA 2AQ2B 1LTGD 4C7ZA 2JX5A 2VXWA 4N6EB 2E2HB 3AE1B 1TIID 1TYGB 1X32A 2PNRC 2JXTA 5C3XA 1H9MA 1HUNA 2WXQA 2XN9C 2O5IC 4K2KA 3AEDB 1MD2D 2IJ0A 3N52A 4B9XA 3P42A 3QJYA 1NYRA 3AMZA 2PYKA 2WXFA 5C5MA 1QOFA 4KGSA 2WP8J 4WIPA 5EPLA 1HEZE 3WOEA 3K59A 3NWSA 3AU7A 4BA2I 1NVID 4K8IA 3VYUA 3AB5A 1O78A 5JEAH 5F2DA 1JQYD 4JWSC 3J7AF 1XXGA 1BR9A 4YSZB 2KJXA 2GRIA 5BYQA 3B9JA 1Y8NB 4DNTB 1CI3M 3C46A 1VZ8A 1I4XA 1TY2A 3I8ZA 3PUZA 1T3QA 1PFNA 1BQQT 2F0IA 3IT4B 3HGBA 2SDFA 5HG2A 4TQ1A 1TKGA 2K01A 4FXDA 2B2TA 4K5XA 3DWMA 1HCZA 4CKEA 4Z9CB 3NPPA 3RD4A 4A3JB 3WOFA 3A8IE 1C48A 3NZ3A 1SSNA 4WQMA 4X3TA 5DM63 2DYMA 4Q2JA 1D4BA 3PMFA 2X6LA 1RYJA 3ABVB 4TQ0A 2J42A 5HI1A 3AMUA 3PUVA 1SIJA 1YNJC 3PIO3 2BA1A 4OHJA 4QUFA 3EA6A 5C0XI 3AM9A 1FGBD 2QJLA 2EJMA 1QOBA 5CV6A 5HFYA 4RGMA 1I4QA 4A6QA 1KABA 2VNUD 4B08A 1C77A 1KRHA 3IFDA 1BMLC 2V3NA 1CQFA 3S15B 4NAWB 2DBYA 3FPPA 2GB1A 1TU2B 4ZYSA 4XYOA 5I6WA 1TWAB 2LMCB 3TEYA 1I4PA 2WDVB 4JX1C 2G9DA 3AH7A 2EVBA 3TEWA 3QO2A 3IT6B 1Q90A 2JSVX 1E7PB 1JW9D 1YNJD 4MACA 5BYRA 1JE4A 5AFWA 1AFPA 1FRRA 3NVVA 1IKMA 3KK7A 1BF4A 2N0SB 3RLFA 3FILA 1DOLA 4NP5A 2D5DA 2WDRB 1PTOF 1AZPA 1TKWB 1C4CA 4CKBA 3P1MA 1J7BA 5CYUA 1EY9A 3S1RB 1ZDXA 1F77A 1HHVA 1N5XA 1G291 5LL6X 4TQUS 1YNTE 5GXGB 2BS4B 2J53A 1TVXA 1YMHE 2NB0A 3BG3A 2Y0SB 1QLBB 3D6WA 2L83A 4KD3A 3ZYYX 3S1QB 3QOLA 2BE5C 1Z6HA 1JOKA 1WRIA 1B44D 1PGXA 1FNUA 4XT3B 2YEPB 4QUCA 2BA0A 3P4RB 2EY2A 5BMIA 2R3ZA 4KJNA 1D5XC 1Q12A 3JAML 2MEKA 1LT5D 3MVVA 4HKZE 2FJ2A 1T6BX 5K36G 3FEWX 3LWUA 3VR8B 4ID6A 5IGCA 4ZHPA 4RCNA 4UAIA 3RUZA 2NN6I 4RGNA 4KN4C 2GI9A 1SDFA 2IX0A 2J52A 1A2UA 2PCFB 1VZ7A 3VRAB 3GO5A 5FLXL 5C3JB 3CHBD 1IYVA 2WIIB 2C5CA 1OQRA 4Q5VA 4K5VA 1WWTA 3GB1A 3P4QB 2K22A 1V1OA 1H9SA 2NZ1D 2EJGC 4X3SA 1VDVA 2WS3B 3ETRA 4AS1A 3SK8A 5DM73 1EIGA 1K52A 4P2CB 3NBHA 3M85A 4FNFA 2ID0A 3HOUB 1HZ6A 5G3LD 4A93B 4ITKA 3NTHA 3SDZA 1D5ZC 2F0VA 3HVZA 1FFVA 4DK1A 3I91A 3TMEA 4DU9A 3AE5B 2WXOA 1BDOA 3UI3A 1YN3A 5JPMC 5I4DA 4ZHOA 1R7SA 2LFNA 3U9OA 3H0GB 2DYOA 1S5ED 3EFXD 3ERQA 1PDQA 4YTPB 1S4ZA 2JE6I 2R92B 2JWUA 3VYSA 1L0XB 5BN5A 4ZK9B 1ILQA 4H2AA 1D2BA 1FMAD 1II3A 3AEFB 3B2GA 3AV8A 4IUQA 4C3HB 4DXFA 3T51B 2JSOA 4WAFA 4BBSB 1KDAA 2AQ3B 5JEAJ 1UWMA 4PMWA 2B2UC 4U68A 4LAAA 1BBXC 2H88B 1FCLA 4IUNA 5CORA 1E0ZA 1P7EA 1NAPA 2PTLA 5D65A 1B3AA 5EGTA 5EE0A 1V1PA 1SNPA 5BN3A 3P1HA