5I4DA

1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
192
structure length
192
Chain Sequence
TPKYEDLRAYYTKPSFEFEKQFGFMLKPWTTVRFMNVIPNRFIYKIALVGKDEKKYKDGPYDNIDVFIVLEDNKYQLKKYSVGGITKTNSKKVNHKVELSITKKDNQGMISRDVSEYMITKEEISLKELDFKLRKQLIEKHNLYGNMGSGTIVIKMKNGGKYTFELHKKLQEHRMADVIDGTNIDNIEVNIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein
publication title 1.75 Angstrom Crystal Structure of Superantigen-like Protein, Exotoxin from Staphylococcus aureus, in Complex with Sialyl-LewisX.
rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 52
structure length 192
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i4dA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5i4dA01
1SJED 1YN4A 1AW7A 3DWPA 3BYTB 2WV6D 2RDGA 1EEFD 3DWQA 1BCPC 1I4XA 2O2LD 1SBBB 1JWUD 4OHJA 3MFGA 5ELBA 5ELCA 1LT4D 4RGTA 1I4GA 1LTRD 3EA6A 1SJHD 1PTOF 1TS2A 1TS4A 1LTTD 3BVZA 1KLGD 1LTSD 1B1ZA 1XXGA 1LLRD 2TSSA 1CK1A 1ET9A 1RCVD 4RGMA 3V05A 2IJ0A 1TS3A 5D3DA 1LTBD 1ET6A 1FNWA 1M4VA 2XNAC 1RD9D 1LT6D 4K6LA 1S5FD 1ENFA 1PYWD 1QILA 1LTAD 4UDUC 1CQVA 1EFID 4L6TB 1TS5A 1UUPA 1PTOB 1PTOH 1V1PB 3CHBD 2XN9C 1SE4A 1EEID 1CHQD 1JQYD 1LT3D 2NTTA 4RFBA 4RGOS 5TSSA 2AQ3B 1SE3A 1DJRD 1HQRD 1HTLD 2CHBD 1I4HA 1JWSD 1G8ZD 1BCPD 1RDPD 1S5BD 1FNVA 1TY2A 1HXYD 1I4QA 4DXGA 2XRSD 5ELEA 1S5CD 3DWAA 1T5XD 2IPKD 5ELFA 1PRTC 1SE2A 1FD7D 1S5DD 1D5XC 3URYA 1YN3A 3R8BA 1V1OA 3SEBA 3EFXD 4RCOA 1F77A 1ESFA 5ELDA 2QEJC 3BVGA 1CHPD 1I4PA 1EWCA 1BCPF 1MD2D 3BVMA 1YN5A 1D5MC 1B44D 1PRTD 4L63B 4C56C 3TSSA 4NZLB 1GOZA 1PZJD 5FKAC 1RF2D 3OWEB 1EU4A 1LO5D 4ZYSA 2ICIA 4Z9CB 4RHSA 1D5ZC 1PZID 2NTSA 4RHRA 1HA5A 1LTID 1STEA 1LTGD 2Z8LA 3R2TA 4DXFA 1AN8A 1EU3A 4O1NA 1SXTA 1UNSA 1BCPB 1CT1D 2AQ1B 1FGBD 5I4DA 1JCKB 1PRTF 1V1PA 2XRQD 1XTCD 3KLSX 5D3IB 1I4RA 1L0XB 2G9HD 2J4XA 5FK9C 1KTKA 2R61A 1PTOC 1BXTA 1S5ED 1L0YB 1LT5D 3O13A 1KLUD 3R2IA 1FNUA 1PZKD 2QILA 4BWGB 1JR0D 1SEBD 3BYYB 3MC0B 1DYQA 4RH6A 2RDHA 2SEBD 3W2DA 3GP7A 1JWMD 1PRTB 2AQ2B 1PTOD 4TSSA 3BZDB 4RGNA 1TY0A 1D6EC
chains in the Genus database with same CATH superfamily
1GVPA 2DNCA 3F8TA 3CU7A 2F4VQ 4CDFC 3BK2A 4KKSA 3FHWA 1HUNA 2G5DA 2DYOA 2JU6X 2KAJA 1Z7TA 1JC7A 3ERQA 4DV0Q 2D5GA 5DM63 2N9XA 5IO9A 3NSWA 3VA5A 3DBHB 1WMHA 3EA6A 1B3AA 1WZ3A 1Q90A 1PYSB 2PQAB 5A2QE 1SB3C 3TMPB 1QG7A 1ET9A 5T1GA 2BKRB 3HOZB 3AE2B 4O2DA 4ZRPA 4OX9L 2DN8A 1IYUA 5IYCG 1B7YB 3TDQA 1RD9D 1LT6D 4PZ6A 2LGSA 2M0XA 4HJ8A 2ZPNA 3KWLA 4HCPB 2ASQA 3VH4B 2KCMA 3MVVA 5CHWA 1N60A 1TS5A 1UUPA 1RHPA 1Q86C 2VZAA 2HHHQ 1UH6A 1R4NI 4GN4B 2C7HA 4DK0A 2F03A 1TKGA 5BYRA 1E22A 2DZMA 3H7PA 2NYZD 4HSVA 1OTRB 1EOTA 4J3OD 2L52A 4JL9A 4DK5A 3M4OH 3Q24A 2LRUA 3K0XA 4RFBA 2UUAQ 3MFYA 4XE0A 4ME5A 4N59A 3J7ZC 2B39A 1RWSA 4GNXB 4YTMB 4HTHA 5J2RA 5E6JA 3L54A 3HUIA 1NAPA 5M5YH 1K3RA 1PVOA 2EJMA 4IC7B 3RNFC 1E2WA 2IGHA 5ELEA 2BB6A 1P0RA 4JI8Q 2CKHB 3AQQA 4R4OA 4HJAA 2AL3A 2ZT9C 4C3HH 3OIQA 1S5DD 2OQ0A 1X54A 3J80L 1II3A 1C3TA 3AMZA 1QUQB 1TTNA 3EFXD 2QEJC 3I90A 3HOUG 2WS3B 3K7AB 2MFIA 2WYQA 4I6LB 5L83A 4W9KA 2PQAA 4BA1I 3CCMA 4GKKQ 3S2AA 4S17A 2HCIA 1K28A 3ULJA 2V4LA 4W9FA 1PUTA 1EY0A 4LFAL 2JE6I 4IJHA 1PH7A 4F8MA 3AN1A 4EZJA 4FJVB 2K5DA 2CHXA 1C48A 3M3YH 2INPE 3QOJA 5C4JB 2RSUA 1WYWB 2ZW1A 2BE5C 2NUCA 3J7YW 4BY7G 1PHJA 3KH0A 1I94L 2N4FA 5M3MB 4CHTB 3J80c 3PLUA 3T13A 4C3JB 5IYDG 4B3SL 2LXAA 4P72A 3NS1A 2RVLA 1H9MA 3V3XA 1L0XB 3I63C 3CC7A 5A2QL 2LVPA 1PLFA 5DPTA 3NHHA 2R7ZH 3N30A 1DD2A 4XQJA 5LXIB 2VQFQ 3H0GB 1BXTA 1S5ED 1X9NA 2AEHA 1WGYA 2KMCA 4YXDB 4BXXG 4NXMQ 4GNXA 3BK1A 3K5OA 4X66L 5JVH3 2CCZA 4N8X1 1VR9A 2D5DA 4NQKE 4OONA 4KMUC 3NXWA 1F9RA 4K5WA 4QY7A 4GOPC 2MBQA 1C78A 5H8YE 3T1HQ 2JVCA 1WR6E 4FHKA 2JP1A 4IPDA 1HTOA 3GTKH 2KNBA 4JWUC 1QUQA 3SD5A 1FFVA 1YJWA 1EEFD 1I4XA 1XWEA 4AUQC 3ONAB 3MC9A 1HFGA 5BN4A 3BZKA 4QMGA 2ZVNA 1SROA 2Q8RE 1JB3A 3IBEA 2H5XA 1HZ6A 1H9SB 2A4ZA 3U52E 5HURA 4P74A 4IURA 2RPVA 1G51A 5JEAH 1PTOF 2K14A 3A4SC 3EFCA 3ETRA 3EIVA 3AU7A 4LJZC 2C5LC 5AZFA 2Y3AA 2VUMH 1TQOA 1O7IA 2KX3A 2G3QB 3BDCA 2E3TA 4DUZQ 1S3OA 2IY5B 3OLMD 3Q22A 2JRIB 2R2QA 3VRBB 4B6WA 2FINB 4ZDVA 2ZXOA 1YQ4B 3KUDB 1NCVA 1J7CA 4ARCA 2L83A 1V5TA 2IYDB 1Z47A 2RR9A 1QNUA 2K04A 3A4RA 1B70B 1NI2A 4DKAC 4IUUA 3SDZA 1IKMA 2V3PA 2XN9C 1IUEA 1F0ZA 1A8VA 4QJFA 1KAAA 1PGXA 2B63H 3AYHB 5G3LD 1FVIA 3K81C 1HTLD 3J7A5 3TEYA 1C7YA 4M8AA 5JPNC 3ZVVA 1SYDA 2M0AA 4KY5A 5KHQA 2PVGC 1EYCA 1HNXQ 4NXNQ 2D3CA 1KABA 3SFEB 2KCTA 4IFDG 4HEDA 2J0JA 4C3IH 2KFJA 1WCMH 1XO3A 4DV3L 1WD1A 2EMTA 2KA7A 2XRSD 3ND9A 3AEEB 2JSOA 3CPFA 2KWUB 2C9OA 2K6AA 4LF9Q 2KLCA 1EQVA 1PFDA 4N9PA 2ZTCA 2I46A 3RMHA 2PO4A 3DXJC 3URYA 5DM73 3DVGX 1RFAA 3NG0A 1D7QA 4HROA 5AFWA 4RM9A 1IXRA 2ZCCA 1WTHA 4JI4L 1CHPD 3E0JA 3OG5A 4JBJA 1NNXA 5E4XA 5C5LA 5DPSA 1GB1A 1OXVA 3OWFA 1K51A 2KMMA 3VDZA 1EY9A 1VQ4A 4IPGA 1FD6A 1E6EB 2X8XX 3VTVA 3PV1A 5EE0A 5AJ3L 2K5NA 4ZCKA 1TKWB 4BY1H 5KGUA 1WGDA 2ZCBA 3B08A 3FILB 3P1MA 3P4QB 4PS3A 3U30A 4DK6C 4MGKE 3L13A 1STGA 1ZDXA 3P4RB 1P7FA 4HAEA 3QAQA 2FE8A 4CO7A 3QCAA 4DAYA 4ANXA 2XTIA 1CFMA 4IWPA 2KOXA 5C4HA 3HOYG 2HE7A 2SAKA 2BS4B 4L2YA 4LF4L 2MNAA 2Y0SE 1GUNA 4OWXB 2BCOA 1FR3A 3S1NH 3RLFA 1XPUA 4K14A 3HRDD 1DXMA 2GVAA 1JR0D 1E7PB 2K39A 1GHKA 4NMZA 3SGIA 2SEBD 2V3NA 4IUPA 3HOZH 2A68C 4IN3A 2D3AA 5IE8A 1FJGL 2QCZA 2AQ2B 3NWSA 2C9WB 1S72A 2ONQA 2EKIA 3NE5B 3STBD 1RIPA 3LYYA 2CFMA 1GJZA 2KN5A 3D0FA 3DWPA 1N8RC 5LMNL 4CBVA 4LF8L 4GXBA 3X23A 3KOJA 4DV4Q 3VR3A 3A74A 4BS9A 4KD4A 4FN2A 2DLBA 1E8XA 1SYBA 3RLNA 2MJ8A 2O2VB 1W6KA 5CHFA 1CZWA 2JXXA 4GIVA 4Q5VA 4A3GB 4GZYC 3DLLA 4QB4A 4G4KA 2WXMA 3U50C 5KNBA 4BBRG 4A3EG 2O5JC 1ZGUB 1ILPA 1VRAB 4DAMA 4XYOA 2VRRB 1SN8A 3PSIA 2KQSA 1F52A 1YJNA 2F0GA 3MTNB 2BGFA 4K6LA 2JQRB 1EY8A 2EZVA 4A55A 4AYBG 2I0QA 4HMJA 4M00A 4BKSA 2FJ2A 1PV4A 5AZHA 4UDUC 4YHHL 2R7FA 2VW9A 4DUYL 1K53A 2PTLA 2KVMA 3V96A 1PTOH 2PNRC 5E1FA 3CW2C 1VZ7A 4FHJA 1T6BX 1WJ6A 1IW7D 4KZCA 3K7AH 5M3FG 2WAQG 1LT3D 4FDBA 4XTCS 1U4PA 2QW7A 2RGFA 1YQBA 1C9FA 2D62A 3CCUA 2L05A 2JX5A 2PE6B 1JWBD 2JA6H 1JJ2A 4APVA 4DHJB 4XXEA 2L7RA 2NVYB 4JI2L 2N8NA 5C4JH 4IFDJ 5C44B 3R3MA 4DV2Q 4HCEA 1BOSA 5BR8Q 4UY8C 5JJKA 1SF0A 5M3MH 5A35A 1XMQQ 2C35B 2KDBA 3HVDA 2L0TA 1U4AA 3RYTA 2W3RA 2K5VA 5EAYA 4DNRB 1YIJA 3BDLA 4LW1A 1N33L 2JY6A 5G5HA 3U58A 4HLEA 4DGZA 2B76B 1Y1WG 2O2VA 3CAMA 2RPQA 4HWIB 1V9JA 2J7ZA 3PO3H 1B53A 1KJTA 2A1AA 3BVGA 2OWOA 3I91A 3HOVH 3H0GH 2LXKA 1D5MC 1B44D 2L12A 3V2TA 3JVZX 1MKHA 3MHZA 1GOZA 3K57A 1V8QA 3PIP3 2EXDA 2J52A 2O6VB 4YSZB 3NUCA 1LO5D 2YTXA 4H13C 4IG7B 2Q8TA 1H8CA 3TS0A 3KLSA 1T0YA 1LFDA 1D8LA 2JYOA 2XIWA 1FM0D 3R2TA 1N62A 3VQIA 3H3VC 4HPMB 1N32Q 2E5LQ 2MX2A 3UIOB 4FLHA 3WALA 5EPKA 5ISRA 4YT0B 5L95C 1IBKL 1I50H 1PFSA 3HP3A 1IPGA 3AEBB 4DDGD 2WAQE 2XGTA 1JOQA 1B8AA 1LM8B 1TJEA 2FNJB 3NTKA 3VH3B 1GKHA 3WIMA 4J8QA 1E7ZA 4L5SA 1WFYA 1I5FA 5C3EH 2Q5WD 3IVFA 4HCNB 2ZW0A 4KHPQ 4ZUJA 1KDAA 4K3CA 4RH6A 2KFKB 3JW0X 3NP8A 1Q1BA 2VB2X 4GN3B 3W2DA 2JSVX 3KYCD 5KNDA 3ZO5B 2I5LX 3FRPB 1TKYA 5IYBH 2PE9A 1PTOD 1PGBA 2G1EA 5EBCA 4GNXC 1TZOA 1OXUA 3PF5A 4C7YA 5KEEA 1XT9B 5CORA 3S1QB 2NVQH 4IOCA 2DYMA 3T9LA 2N7JA 3GTPB 1GUWA 2BYEA 2CU1A 5IP9G 4IOIE 4FJYA 4OHJA 4WJ4A 2ZVOA 3KLWA 1STNA 2F0VA 2GA4B 4ZLTF 4C2MH 4X65Q 2KMAA 3KBXA 3UDFA 3GZNI 5C3JB 1SJHD 4UP8A 2G4SA 2O6VA 1TS4A 1GG3A 1O78A 1B1ZA 1XXGA 5BO4B 3HKZB 2AUJD 4HKQA 2QA4A 4POGA 1HR0W 4G7HC 4RAUC 3T16A 2L15A 3PQIA 3OIPA 1M4VA 3I4NG 2F4IA 2L1BA 3I4MB 1Q8IA 4JX1C 3NVZA 3ZW3A 1QOFA 1V5OA 2VB3X 2IL8A 1Q8KA 1J9OA 2M1MA 2NN6H 4HEA1 5LMUL 3F2BA 2C7NB 2YTVA 4OL7A 4B0MA 2FMMA 2WB1G 3OW2A 1V1QA 1KDCA 4ZYNA 3QO2A 2NB0A 4DV5L 4EUTA 1NMFA 2R93H 3SU8X 1ZXIA 2ZM6Q 4OZAA 1F2MA 3T3NA 3ONSA 2ZNVB 1EM7A 4PNYA 5CGKA 1BUVT 2R92B 4ID6A 2KFKA 2KBNA 3QX1A 4MTNA 2JA8B 3VHTC 2CHBD 3X3MA 4DK3C 1Z9FA 3C1FA 4FVMA 1PH9A 4A93G 1GUGA 2LWPA 2FFKB 2KDMA 1UEBA 4YY3L 2JT4B 4PK1A 3CXCA 1PFNA 2UU7A 3IG3A 5LLIA 1B9MA 2LGDA 3H3VI 4MEMA 1V81A 1XX8A 3S24A 2KWCA 1VLBA 4RKBA 4BA2I 1JWAD 2P5ZX 1C4PA 2GLSA 2DAJA 2KTFA 3AE7B 3M63B 1C8CA 4PYZA 1Q81C 4DR1L 2KHIA 5E7NA 1I4PA 2HTME 3PHWB 3ZDMC 4IO9A 3AB9A 2KVRA 1XNRL 2EKEC 3RN5A 2N9KA 3AEDB 2PKOA 2D0OA 5FKAC 1VQBA 3OWEB 1T9HA 1TGZB 4LCDE 1Q1OA 4CHKA 1KF6B 1T0QC 2ICIA 4GSWA 2KZRA 1VZ6A 3UF8A 2ICEC 1DM0B 1SDFA 1E0ZA 1HA5A 1HRJA 3PUWA 2FXQA 1PA6A 2L76A 3MC8A 2KANA 4IW0A 2INCC 5EE3A 4LUOA 3Q3FA 3I8ZA 5HG2A 1W2BA 4XT3B 3GTLB 4O42A 3NTHA 4A3KB 1IBML 3TJPA 3MXNA 3E0EA 2K5WA 2N9EB 3EQLC 2N49A 1I6HB 1HJPA 4A3GH 4LTUA 2Z4HA 1X3EA 1JOOA 3D8GA 4WJOA 3CF5A 2YEPF 4CDEC 4K81A 3I5JC 1UBIA 2X38A 2QILA 3VAWA 1R4PB 1UAPA 2UUBQ 2N1WA 1CQFA 5IGEA 1UE6A 2NZ1D 1DOXA 3QIJA 2F0LA 2JF5A 3SK8A 3CCEA 2IW3A 5CMDA 2WIIB 2IX3A 2HT1A 4OO1G 4TSSA 1TVXA 2DENB 4HVBA 4F1SA 1ZYRD 2NMQA 1J8CA 2NBWB 1HNZQ 2Z9HA 1NBWA 5C0XG 3BYTB 3IT4B 4GU2A 2MRPA 2UXBQ 4G50A 1BCPC 1MFWA 3HOUB 2G45B 1AZPA 2J42A 3HM3A 3VUYA 2L4NA 1SNPA 1TWHB 1NBFC 1SIJA 3CIRB 1U5KA 4K7UA 4G7ZC 1AP0A 1HZ9A 4JK1C 2K3UA 3SHQA 4W9IA 1IYVA 1FXTB 4PS8A 2LFIA 1TWAB 1SMYD 2KCNA 2F0WA 2VH2A 4JI6L 1ZXTA 1QE6A 2HIVA 2LASA 2NVYH 3CQZB 4R9WA 4CKBA 3GTOB 4V0BA 5C44H 1ET6A 4BY7B 1C4AA 2OJWA 3P4SB 2MHJA 2EYOA 4HXDA 1F2RC 2CU3A 1EF5A 1J19A 1WOCA 2X6LA 1ENFA 1BO0A 1EY6A 1PYWD 2OEDA 4GLAC 5GAEC 1D2BA 2MA9B 1SYFA 1EFID 4MNOA 4XQQA 1G6PA 2IY1B 2BYVE 3BJUA 4OW0A 2V1YA 3OJ4B 3VYSA 1NE3A 4IM0A 5IN7A 3N20C 1KNAA 2ZXRA 4JIOU 4L5RC 4BOSC 3NRZA 1JQYD 2NTTA 2N7DA 5J39A 4WORA 3M95A 5C3WA 3PIOA 4GKKL 2WU2B 3AE1B 2RDFA 3RR5A 3DWMA 3L4PA 2PMZE 2IWHA 3LGJA 3S1MH 3VUWA 3WANA 2UXCL 5BYSA 1E9MA 1PH6A 1RYJA 4DR7L 1G6JA 4JI7Q 3E9SA 1Z2MA 1SAPA 2F0DA 4QIWE 2F0EA 3DOWA 1V1OA 3GTMB 3NZ3A 4KSKC 1JQ4A 4HPLB 3WAPA 3NHEB 4YIJA 3TN2A 4DR2Q 3C3LA 1EWCA 2ZTEA 1MD2D 3P63A 2E8GA 3UINB 4XWWA 3CCSA 4ZRIA 4HPPA 1QZGA 2VY3A 3TP7A 1PZJD 4NZLB 4LF7Q 3V62A 2RKSA 2W55A 4DR4L 3NVWA 4NXML 5E4WC 1PH3A 1EY5A 3KDFA 2KTRA 2DWQA 3H94A 2F0MA 3J81i 1YHBA 3AXCA 4HDQA 4D2KA 4R4QA 2DYBA 3HHMA 4JI3L 5BYQA 3I2ZA 2WNMA 5IKCM 3Q8DA 5EJWA 1E0BA 3T1HL 3CF6E 3GTPH 1AFPA 4J6IA 4R4CA 3PRZA 2PEAA 2I1KA 1W3SA 3ZLZA 5KHOA 4LWCA 5CV5A 1VQNA 4ARIA 2N3SA 1R4MI 1YNND 4ME3A 3DWGC 3CSTA 3HEJA 4A3CG 3C46A 3R2IA 1F1HA 2BKFA 4A75A 4LK0M 4MSMB 1WMHB 2LRWA 1RFKA 4LFBQ 1WY8A 4P2CB 4KDIC 3B2GA 2V0GA 1FCCC 3D3RA 5EGTA 4GS3A 1F2RI 4KHZA 3RD2A 1VF5C 1G2TA 4XDCA 4RGNA 2KQ4X 4E6IA 1WFQA 4DU9A 2Q2IA 1WXQA 3WCQA 4C80A 2N9PC 4A3JG 1LTLA 3RZOB 4JYAQ 2OOBB 2X6GA 3RI7C 4IWQA 1UE7A 4E71A 4DR6L 4MTKA 3N52A 4ANWA 5CV8A 3QARA 2M17A 3Q3JA 3CKIB 2QC8A 3RCZA 2R92H 3PUZA 2IO3B 2JA8H 1KIXA 4US8A 5FR3A 4UP7A 4DFAA 3CCJA 2L11A 1U9RA 1WIAA 3V6EB 5K36G 4US9A 5FJ8G 2IBIB 4XX5A 1YX6B 4RKLA 1TS3A 4A3DG 1PGAA 3AU4A 1WRIA 3M7NA 2K8CA 3WOFA 1WM3A 1TIFA 3D4DA 1VS0A 1KQSA 4B3TQ 3H1UA 3PVLA 3G7LA 4XT1B 3HOYB 3ULLA 4IWOA 5FR6A 4XIGS 1LUZA 1IBLL 1KH0A 1A5RA 1A70A 4FULA 4E3CA 1D4BA 1L6VA 3T1YQ 4JLCA 5CHVC 2BVCA 3X0WA 4A3PA 1L7YA 5M9OA 4A3MG 4JQWC 4LF5Q 1RL2A 1CHQD 1E90A 1LM0A 2MPMA 2YLMA 4PMCA 3UDXA 2DY8A 1AYFA 3A1QB 2KHJA 2WX1A 1YD8U 4ITKA 2NVUI 4NKLA 1R9TB 2KKCA 4OO1I 1CM9A 1O7LA 4ZKCB 1TZ1A 4Q2JA 2LY7A 4MELA 4MH0E 4PZ7A 5JVG3 1YNJC 4Q0FA 2LUEA 1KC8C 4KZ0A 1S4ZA 1HNWQ 2RSOA 2F0NA 1RTNA 5HY6A 3GTLH 2GI9A 2W54A 3LJ3A 5CBEE 4GB9A 1L4DB 1BR9A 2FCMA 1XCTL 2FBWB 4YSYB 4EKUA 4HJ7A 3UQBA 5JPMC 4RCOA 3CCQA 4A3KH 3GTGB 3P2BA 3PO0A 2MGSA 1QZEA 3Q6SA 1XLQA 3A8JE 4JPBW 1FRDA 3ENEA 3W3AA 4DR5L 2RA4A 1YHAA 2HQLA 2WINB 1J8IA 3HG9A 4A3EB 3Q8CA 1I3QB 4KY7A 3DBRI 2BYTA 3HOWH 2F0JA 2NR2A 2EYMA 1B3QA 1EUJA 3TMEA 4LF6L 4MIUA 1WX7A 4MGZE 3TUOA 2D2QA 2NBUA 3VVWB 2Y5CA 1HCZA 2KJRA 3DHGC 1QOHA 4AYBB 3FVQA 3I3TB 2DUDA 4JV5Q 4C4VA 3ZIMA 3GTJB 1V8CA 3H8HA 2DJGC 3PPAA 1BBUA 3KYHC 4YWMA 4A90A 3KLSX 3HOUH 4X3UA 5LHY1 5M3FB 3PS6A 5C23A 2BE5D 2WAQB 1WM2A 2K1FA 3UDIA 1V49A 2MBHA 3HOXB 4B3RQ 1UWMA 2FCSA 1X3GA 4GN1A 4BWGB 3A1QA 1SEBD 4KGSA 5HI1A 3A54A 1TWAH 2WXJA 3A5ZB 3GV3A 1P16A 1ENCA 2ZNVC 4IDIA 2E2IB 1IHZA 3FPPA 3CQZH 3GTOH 4OVUA 4AOFA 4BY7H 2A6HC 3TEHB 3PZ7A 1L2FA 3PO2B 2PMVA 2OEOA 3TP5A 5J3BA 1ZW7A 1E8ZA 3QA8A 2V4DA 5DAUA 5IYDH 2JZ3B 2WP8J 3R66C 3APFA 1Y1WB 4KGRA 1CSPA 4C3HG 5IP4D 1BF4A 5JHAA 2H89B 1BKBA 1OXTA 5C2TB 1GUSA 2CJNA 3QJZA 4A3FG 1YHQA 4IUMB 4OWWB 2KDIA 4A3IG 4XWTA 4JBKA 2NBVB 1DGSA 1X65A 1ICFB 4DHZE 2RHSB 4DA2A 2DNEA 1EZ6A 1VDVA 3RULA 1QNKA 3QWNA 3N9YC 1L1OA 4L5TA 1EO6A 4L8JA 3OTOL 3HM6X 4ULLA 1CKNB 3TQYA 3DBSA 3ZUNA 3QJYA 2INDC 3RLOA 1XMOQ 1I7HA 1STAA 1GD7A 4JE3B 4EOYA 3PUVA 2VZKD 3J81j 3GS2A 3GOEA 2A6EC 2W3SA 1G2SA 2MO1A 2LVQA 2UXDL 4DV2L 1N61A 3GTMH 1O80A 1U4LA 1EL0A 2PQEA 2IHEA 2FCNA 2AWTA 1EFWA 1BNZA 4H0LC 4KY6A 1SE4A 3QR8A 1VQ6A 1RLFA 2M19A 5IY0A 1UWVA 1WRDB 2MW5A 3Q8AA 2JZZA 3ZNHB 1VQPA 3ICEA 4JI1Q 2I5MX 1A2UA 2UU9L 1DJRD 1V9PA 4DV6Q 1QB5D 1NUCA 1E24A 1I4HA 4MDKE 4KN7C 2PVOD 3Q8BA 1HTQA 1YNTE 3PCOB 2D9UA 1Y14B 2KECA 2SDFA 1XNQL 4DQOC 1B2TA 3TS2A 2Z6KA 1Z6HA 2KEDA 2XWJB 5CV7A 1WI0A 1Z5SB 4DAYB 3PTFC 1D3ZA 1D5XC 2JK8A 1OTCA 2CW0C 3TIXA 4MM3B 2BDNA 1UEAB 2E74C 3BY4B 4QAYA 1AEXA 3PSEB 4X64L 4JBWA 1BT0A 3VR2A 1TWFB 3BVMA 2ENBA 2Y0SG 2L3ZA 4HSPA 1M90C 1HEZE 2LXJA 4KJNA 3ULPA 3GDEA 1CKNA 3PGZA 2VQEL 4IFDH 3H7SA 4ZRZA 1L6UA 2HDMA 3HVZA 1VQJA 2PIAA 4WH4A 5IWAL 4CDDC 2NWGA 4K0KL 3I4NB 4I7ZC 3TREA 2B2TA 1KFYB 3I55A 3L16A 5LXHA 2JWUA 2KJHB 2A19A 3AECB 4LDTB 3FMCA 3NBIA 1VQIA 3AV8A 4TQ1A 5JOBA 4HMIA 1BCPB 5IGGA 3RZOH 3NUHB 3PRPB 3LWUA 3VA7A 4JGHB 2WB1B 3S14B 1JCKB 1WWTA 3LB8C 1WTVA 2QDLA 2M4NA 1R4MB 2BW2A 1CZPA 3C8YA 3GTQB 5I9PA 2R61A 1WXVA 2WDQB 4WQMA 1CI3M 1XTDA 2ZXPA 1L0YB 3O13A 4II3B 5I9OA 1CKOA 1MPEA 4GN5A 4RM8A 4DNTB 4KHVA 3RNEC 2F0FA 3AH7A 3TEWA 4ANUA 2OJRA 1MJCA 2RDHA 4A93B 3Q3OC 3VYRA 2LS01 2K0PA 1OQYA 2WLBA 1HR0Q 5C6AA 1KRHA 1X3QA 1JWMD 4OWTB 1SYEA 2KC2A 1H9RA 5E6PA 1Y1VG 2OCEA 1UWXA 1SE9A 1EYGA 1F9JA 4NAMA 3VFKA 4CYEA 3AULA 3HOYH 1WSPA 1YN4A 1RODA 1E5WA 4X6AH 4DV1L 4MM3A 3L0OA 4ASWC 4ZQ3A 1C4QA 2A68D 5JJIA 2DGYA 2KEEA 2KJXA 4KX6B 4X62L 1MJDA 4TMAB 4PYUA 5MPOA 1VQHA 4Y52H 2OHFA 2I5HA 4X3KA 1N36L 2INNE 1ZPSA 1AH9A 4W9EA 1I6VC 2CR5A 1WD0A 1GUOA 4F7ZA 1P7EA 4ZHOA 4AS1A 1LLRD 1JORA 2RCFA 1C77A 1FPYA 3ALBA 1CK1A 3Q8EA 4NJ6A 3J80i 1OGWA 1QOBA 4REZA 3ML9A 3H3VH 3S17B 2K4KA 3EHVA 3N6RA 1R4QB 3M7GA 4IKGA 1TYGB 2MJDA 2ZJDA 4FA6A 2BWES 3B9JA 2GBKA 1VCIA 2YV5A 4KTAA 5FOBB 2FIFA 3RUZA 3QK0A 4LMQD 4L6TB 2N55A 4HDOA 3U7DA 2K7VA 5D94A 4JI0Q 3GTGH 3GQBA 4G0NB 1FRRA 1K0RA 3CHBD 4FP5D 4K2KA 2YYZA 2YU9B 1PH4A 1EEID 2LEKA 2WXPA 1F2ZA 4L23A 5D14A 1HQRD 2N1VA 3L9AX 3D31A 4A3EH 3K5NA 2NVXB 1I3QH 1SNMA 1NI3A 2CVRA 3ABVB 3BWUD 1NYQA 1RDPD 4PG3A 1N5XA 4KD3A 4K7WA 2PMZB 3HOZG 2AKWB 2EELA 1QJOA 4M01A 3FC4A 5IOIA 2K8HA 2KWDA 4EZKA 2GN5A 4G3XB 3GTJH 2F0IA 3CCLA 3VR5A 3D32A 1UD7A 2WU5B 4RMFA 4QIWB 5FLMH 1SSOA 3GE3C 4HJ5A 3PZ8A 2YVCA 2K52A 1F77A 5M3FH 3AE5B 3SFDB 4DV7L 3HOXH 4LFAQ 4FXCA 1QCBD 1LQBA 3KUPA 2LHDA 4BBNC 3OOCA 2HIXA 3AB5A 2OF1A 1AZQA 3DBRB 1STHA 2OXPA 5CR3A 4NNJB 2KXJA 3RZDB 3WAOA 2E2IH 1D5ZC 2UUBL 2NTSA 4YSXB 3PO2H 3R3OA 4RHRA 4B3SQ 1STEA 1LTGD 3F2UA 3JYUA 4HCSA 2JYEA 3RPFC 1JROA 5ELOA 2BS2B 3S9WA 2VNUD 2XRQD 4C3JH 1E8WA 2KK8A 1PQSA 2KC1A 1WX9A 2B2UA 2PLPA 1KNEA 3KUCB 4LNOA 3U9SA 1RAXA 3NTIA 3E6ZX 4X66Q 2UXBL 3I73A 4R4IA 3S1RB 4JI5Q 3CCVA 5K5PA 1EYDA 1K8OA 2H1EA 2LGYA 2L55A 3A8KE 2KD0A 4KLKA 4HIMA 3AU5A 3GV6A 4USAA 2F3WA 4EX5A 4QF4A 1DOKA 2JA6G 1A0IA 3M4QA 2G4DB 1PRTB 4N58A 3S2HB 2HD5B 2ZJRA 5HKHA 2RSNA 2NCNA 4PQXA 4HIKA 1X56A 3DVNU 5IOCA 4B9WA 1FXAA 2K5HA 2N0SB 2B8GA 1J6QA 2WDRB 3F2DA 3PO3G 4WJPA 5ELBA 5EBDA 4LUVA 3EGRA 4GDKB 1UELA 1MSHA 4B3ML 2J0TD 3HOVG 1MI2A 1VQ7A 4KKIA 3W5OA 1Q82C 1KLGD 1LTSD 4Y7NB 1V86A 1MSGA 2K5QA 4P73A 2LXCA 3ML8A 2BOSA 4IFDI 3NBHB 4IM3A 5EPJA 4M1UB 2KQ3A 4OZCA 1S5FD 4LFCQ 1L1OC 5EE1A 4I7AA 3B0AA 4IPHA 1QILA 2ID0A 2DX5B 1PH2A 1IP9A 2PZTA 4FADA 1VQ8A 3A33B 1C79A 3N32A 2O4XA 1U0LA 4C1NI 3A55A 4IZ8A 3G6EA 1CA5A 2W82A 4I6PA 2K1BA 4TKNA 1TWFH 3HK0A 2GBRA 5TSSA 1MG4A 4G11A 3MHSD 5C3EG 2WDVB 3FP9A 4P1CC 4DV3Q 2WXIA 4ZKBB 3IAM1 1JWSD 2JZPA 3RUIB 2WHIA 3W1GA 4JC0A 1XLPA 3W9CB 3CPWA 5AZGA 5CBAE 1NJIC 3I4NH 3SR6A 5IYBG 3HIZA 4PMBA 2PPHA 3OSOA 3I57A 2QIEB 4DK1A 3JAME 1S5CD 4ALPA 3DWAA 1FL0A 4A76A 4A3JB 1LYLA 4HIDA 3I70A 5D7GA 4ANVA 4URKA 3APDA 3S14H 3ZNID 2HQEA 5ELNA 2E2HB 3DBLI 2AHOB 3SEBA 2OQKA 5NUCA 4GDKA 2IO1B 4M8NA 1BBXC 3S2DB 1OO9B 1V43A 1X3FA 2Z6KC 5AJ3Q 4LNQA 4A3BG 3S15B 1S3SG 2MJ3A 1PXUA 4IM2A 4WWPA 3MXNB 3GB1A 3AEAB 3AMUA 1E3PA 2JWZA 5IIFA 1M8AA 4FO2A 5H1SE 4A93H 3TZDA 3IAS1 4XC2A 4ZYSA 1EWIA 4A3DB 3H91A 5C4XG 3NBHA 1A6XA 4W9GA 4RHSA 2PJHA 3PGEA 1O7YA 2F0TA 2E2JB 4S3SA 4LFBL 2BB5A 2DNFA 2UUCL 1HHVA 4OEMB 1GNUA 4LF4Q 3W1YA 2BH8A 3C2PA 3R7QA 5D6JB 2NN6G 3H6NA 5G2NA 4KV6A 1XTCD 2J0KA 2B2TC 3FDTA 1EIYB 1XLNA 4WIPA 3QWZB 3J81L 4TUUA 4JYAL 4A3MB 4FBJB 3VR4A 2GBMA 3DQVA 2OTJA 1WX8A 1NSNS 1TU2B 3RZWC 2JA7G 2L5TA 1K8MA 3M4YA 2R93G 1SNCA 2RBMA 3T8MA 1PZKD 5KYLA 3PRMB 2MQHA 5BMGA 4TQ0A 4BOZB 2CKZB 4JBMA 3DEPA 2I07B 5D2MB 1M94A 1MHWC 3GP7A 4X3SA 1XD3B 4RNAA 3AEGB 1EY7A 4XQNA 4RA8A 3EVQA 3H15A 2RDBC 4DXAB 4AQ7A 4LF8Q 4ABNA 2MH7A 2TMPA 4K6DA 1TT5B 3SK4A 3KF6B 1OFFA 4P16A 3J81c 2EY1A 1SBBB 1UE1A 2F4VL 1AWDA 2YU9H 2HCCA 1RRBA 1SNOA 1T3QA 2FHTA 5M5WB 1LT4D 4CJ2C 1GUAB 3W5UB 1LTRD 4KJOA 4LAAA 2GBJA 4DHZB 4DV0L 3SVMA 4NY0A 3UQAA 2DAFA 2CWPA 3BZCA 2TSSA 3JAML 2PNHA 1JT8A 4NAWA 2L0CA 2MJEA 4YTNB 4CQNA 3OAWA 5COYA 4OO1H 4RGMA 5T1IA 1ZXHA 1IGCA 3NEMA 4R1JA 3MJ5A 2QF7A 4ILWA 4FF2A 1FNWA 4YHHQ 4RMAA 4DUYQ 1I35A 1GHJA 4OGQC 4HJ9A 3U4EG 4N6EB 2K03A 1CQVA 4LJPB 5DLQE 2KVZA 2HDLA 3L7ZC 3AE6B 3L17A 4IQZA 1MBYA 2LGIA 3T3OA 1EWHA 5KIXA 5IT9L 1L0WA 2A74C 5HGTA 5IGFA 2HHHL 2WP9B 2AQ3B 2XWBB 5C1ZA 4MZ9A 1QLBB 1EIFA 3JAMc 3CRLC 4WWNA 4JI2Q 1FYCA 3KJPA 2JPHA 3VTUA 4EVOA 4KV2A 3NVYA 1G8ZD 1S5BD 4IPCA 3RZDH 2UUAL 1CUKA 4DBGA 3Q0AA 1K9MC 1L2NA 1JJCB 1HXYD 4YCWA 1WE7A 4BKSD 4ZUIA 3I4OA 1G291 4X57B 1C9OA 1N33Q 1HA6A 1PDQA 3RD4A 2N7EA 3KDFB 2KTRB 2A5UA 4XGAB 3KF6A 2WXHA 4C3HB 1RJTA 4LUZA 4C00A 1YN3A 5EPLA 1KRTA 1DOIA 1CKMA 1NY4A 1VQKA 3S16B 5CV4A 4JI8L 4JV5L 3VTWA 4A3FB 1OQRA 5BMHA 2LSSA 1C4CA 5JJLA 4A3IB 3MA2B 2XSCA 5IT9c 4BKGA 4FXGC 3D4RA 4ZHPA 2QHOA 4XDXA 4R4TA 3S1RH 4WAAA 3BINA 2LJIA 3CRKC 3U7ZA 3QB3A 5E6NA 3ITPA 2Q2UA 4AJWA 3DUZA 4N8FA 2EJGC 1ASYA 4B3RL 3FAHA 3SK6A 3NOBA 4M0WB 2K75A 3GO5A 4IUQA 4ODGA 2QSDA 3J9CA 1RTOA 1U4MA 4GKJQ 1PFBA 4K5XA 1OEYA 3KF8A 4CKEA 5J22A 4WJNA 4FYDA 1UNSA 2RMMA 2WXFA 3DHIC 1GC7A 3AFPA 4BVUC 2K05A 5AUKA 5D3IB 1P98A 2DZKA 4EZLA 4OVVA 1OXSC 3F1ZA 5CYUA 4GMVA 2K25A 5CC4A 3NZSA 4A3LG 5EKIA 3PZDA 2B2UC 4HKZE 4XYCA 2VQFL 4RF1A 1QZHA 1STBA 2M9VA 4AH6A 4ICUA 4OXPA 1FO4A 3MXPA 4MH8A 5L37A 1WTRA 4W9HA 1B9NA 3L08A 1N6ZA 2MBOA 2BH2A 5EKKA 2QJLA 1NR4A 3RMKC 1T5EA 4FF1A 5TR5A 3S1QH 3LXFA 3RZFA 2O2LD 1XYIA 3ZNGC 1HH2P 2AWNA 3WOEA 2Y0SB 2MP2A 5ELCA 4DHJD 4B0EA 2Z6BA 2KCCA 1EZ8A 3MAQA 1WTWA 1YJ1A 3P20A 3MJWA 4EQOA 5JHBA 3U9OA 3NENA 3DHQA 1MIUA 1X3PA 3SK5A 4M0WA 5BMIA 1LACA 4I65A 3V05A 4UAIA 2NVTB 1ICWA 2K9XA 5H92C 4A3JH 3I4MH 2XK5B 4C1NK 1WJNA 2EMSA 1KD1C 1HE8A 5IP7G 2QGQA 1ML0D 1MI0A 2IGDA 5JZEB 3PUYA 4DUZL 1YITA 4HJGE 3TRZA 3HRZC 1V1PB 3MTSA 5C0XJ 1CJEA 1RKNA 2O6VD 1X55A 3S2DH 1GB4A 1J7AA 3PHXB 4DAVA 3IAYA 3EC8A 1J7BA 4RGOS 5LL6S 2XBBC 3BG3A 2PCFB 2FUG1 5K36H 5FJ8H 1WTQA 4AWJA 1DOLA 1FEHA 4GDLB 3CWIA 4A3DH 1EQRA 2EXZA 4DR3Q 3P75A 4DN4M 2KHSA 4TRDA 3BS1A 2WXNA 2J53A 1X32A 1Y1VB 5DCNA 2K5PA 3V6CB 2K33A 3HZXA 3AE3B 2E2JH 4JWSC 2WXRA 2IZVB 4LLGM 1QKZA 2RF4A 1HNXL 4KKUA 4NXNL 5LMNW 2G9DA 2KWVB 3DBLB 1ILQA 2M2LA 1PRTC 1H4RA 3UGBB 3A56A 1WI5A 4WJQA 3K5LA 3R93A 3R8BA 1BMLC 3L0WB 3TEXA 4C4VB 3AFQA 3PREA 4DF7A 4A3MH 4LF9L 5ELDA 1ESFA 3FKIG 2IT1A 2JA5G 1A3UA 3L3OC 2FCQA 2HUGA 2QMTA 1YNJD 4A9AA 4AIMA 1A15A 3M62B 3W1SA 4C56C 3WAMA 3VR9B 4WAFA 2GMIC 4K7SA 3CP0A 2EVBA 1WTXA 1J5EQ 2A69C 1EYAA 3ZJUA 1DOMA 3E3XA 4LNIA 3VR6A 4W9LA 3EJIA 5IYCH 4AQYQ 1Q10A 4BBSG 2BPSA 2XK5A 5AEKB 4C7ZA 2J7QB 1LTID 1HR0L 2EE1A 1VQEA 4HJKA 4FJZA 4O1NA 4LNKA 2X69A 2BDOA 1OXXK 1IBMQ 4KIKB 3R7RA 1CT1D 3U4ZA 2DHZA 1V1PA 3ZTDA 1U4RA 4NB3A 5C0XI 1ZUD2 3TBLD 1N34Q 3WA0A 2B2WA 2Z0EB 3S1NB 2K6DB 2PI2E 3O65B 5M5WH 1I6HH 2ZZPB 1WE6A 2AWOA 4BBNF 1KDBA 2ATWA 3HKZE 2BWFA 4GDLA 2JEAI 2BBCA 2CS4A 2J0MA 1DYQA 4BBRB 1E7VA 1SLJA 4EGVA 2WX0A 3IFWB 4WJWA 3LDZE 1L1OB 1P9DU 3RT3B 2KUMA 1JOKA 3ZGZA 1JJGA 2EYFA 1KXLA 3AEVA 4ICVA 1D6EC 1CTMA 3J7AV 2RQXA 4FNFA 4QUFA 2B2YA 2IY0B 1QVFA 3L2PA 3DDCB 4W9DA 4TVAB 4YTPB 2NZHA 1UBQA 1HUMA 2A6HD 2Z4IA 4A3KG 2D07B 1TWHH 4JI0L 3OMGA 2M8SA 2EIFA 1GJXA 2WDTB 4DV4L 4WWMA 3DM1A 2JN4A 1MHXA 2PYKA 3K7UC 3W1BA 2Q2HA 4JI6Q 1R7SA 4PS7A 2FAZA 3WWVA 1Q46A 1DZ1A 3P42A 2HD3A 1UE5A 5E3FA 1I42A 3CMAA 3NQIA 4ACFA 1RCVD 2R6GA 5IGCA 3HOWG 1WGHA 3UE1A 5HHDG 5EDSA 1E10A 5D3DA 5AUIA 3Q6BA 4L5QA 3D4WA 3PV0A 3DPDA 4KIKA 5I6WA 3QQ8B 3NJTA 1MG8A 4KN4C 1F2LA 3VR8B 1SFOB 3S16H 3DM3A 1PTOB 1K50A 1Q12A 4A3FH 3A8IE 1WGGA 2IO2B 4M02A 1NTGA 4A3IH 1PH8A 3X3NA 1YX5B 2CWAA 2RD0A 5GAHC 4FXKC 1VDZA 1GAQB 3PMFA 1A63A 3CC4A 4KSLC 2A6ED 5G5GA 4BXXH 4ZRKA 3OJ3A 1GXDC 3JSVB 2GB1A 4RCNA 2JA6B 2UXCQ 1JW9D 2WXLA 2WXKA 4I6NB 3U8ZA 3ZXVA 2KHWB 3QOLA 1H9KA 4DR7Q 4GGQA 3QHTA 1LABA 4B95A 2C5CA 1KAWA 3IRBA 3U4VA 2JA9A 4HN7A 1QQRA 2F0SA 2PZWA 2D3BA 2MLBA 2L0FA 3PUXA 4WRDA 1BDOA 3N1YC 2K22A 1XJVA 4MJSB 3RNCC 1VF7A 1B50A 1BQQT 1HZCA 5BR8L 2BQQA 2V9HA 3MWYW 3PO3B 1WF9A 1XMQL 5FO9B 1IBXB 2SOBA 2B2VA 2JXMB 3HOVB 4O0AA 2BT6A 4GLSC 2R7ZG 4DR4Q 3APCA 4NJ7A 1XPOA 3RN2A 2EY6A 2L00B 3VRAB 4EFOA 2QEXA 3HFZB 2CW0D 1SNQA 3IL8A 2K8BA 4JI5L 1VQOA 4J1MA 4RG1A 2K6QA 1XCQL 4JI3Q 3DCGA 4GLVB 1PZID 1HZBA 1VMCA 2K28A 4ZRQA 1IYFA 2F3VA 3G4SA 4KVGB 2C60A 2Z8LA 1EU3A 2PZUA 4EQ5A 3BU2A 3AE8B 4M8MA 1SYCA 3IFTA 3V60A 4AJYB 2MWSB 5I4DA 1I50B 1FMAD 3EECA 4OELB 1N32L 2E5LL 3I72A 2D3GA 1P3QU 2DY7A 3NVVA 3JSVA 3VYTA 2QDFA 4LJOB 3HGBA 5C3EB 3L10B 1KLUD 1FIQA 2N88A 4K8JA 1ISNA 4FXDA 1SE8A 2HJ1A 2WWZA 4NPNA 5JEAG 1YQ3B 2EJFC 3K5MA 2EYHA 2KT7A 2Y5PA 4A4IA 3CC2A 2VUMG 2NVTH 4KHPL 3A9KB 3BZDB 2R3ZA 5IA7A 1YJJA 3DVGY 4OVZA 1IL2A 2KACA 4MJSA 4MN3A 3N1ZC 2Y5BB 5KRUA 4DR6Q 2WACA 3KWVA 2NVQB 1IGDA 3EN2A 1IBXA 3G48A 2QCPX 4LFCL 2MHVA 3F2CA 3EBEA 4GLXA 2F3IA 2MUYA 3DMUA 1JWUD 4A3BB 3NK9A 1OEYJ 4OIJA 2KO3A 1A62A 1WYDA 3ER0A 4G57A 3NELA 1YZ6A 1CZGA 4C2MB 2LD9A 1ZDVA 3MEHA 3KBGA 5LNK1 3MZ5A 3UI2A 4U673 3VDYA 4POFA 2ES2A 2D11A 2B63G 5C4XB 4U68A 2KX0A 4X65L 3IKJA 1YEZA 2XEWA 3UE0A 5I2XA 2N9LA 4EE2A 1Y1VH 2IJ0A 1IBLQ 2OTLA 2MO0A 4C3IG 4FF4A 3B2FA 3IT6B 1WCMG 4IUTA 3U2SC 2Q8IB 4A20A 2H88B 2LHEA 1LTAD 2C7MB 3RNGC 3I56A 1STYA 4B9XA 3LWEA 1Y8RC 3NZUA 5CTRC 1H9SA 3Q2AC 5HGQA 2JA7B 2CJOA 2RHQB 2R93B 1WGKA 3Q3NC 4F8CB 5IODA 2BYFA 1GUTA 1V97A 3SHLA 1DOYA 1SE3A 1A3TA 1XEEA 1TWCB 4OX9Q 4L1BA 1K8GA 1CSQA 1VJKA 3C0RB 2ZM6L 3PF4A 2EYJA 1C76A 4XZ4A 4BY1G 3A9KA 2B3AA 1R9TH 1K8RB 2EYPA 2UWQA 1I4QA 1H95A 3A0JA 4LNNA 2IDYA 1N63A 2I1JA 4N9F4 4K3BA 4XYQA 3RN9C 3VUXA 4NW2A 1JRUA 3AEFB 5CV9A 4DR5Q 1NDDA 2CH4A 2CHWA 3EUB2 2WGSA 3VXWA 3ND8A 1ZOYB 3LX0A 3RNUA 3K9OB 3TL5A 1BCPF 2LGXA 1XLOA 4WURA 4WFN3 1YN5A 4LF6Q 4KKJA 1SR3A 4AP4C 1VCBA 4BBRH 2E6XA 5GXGB 4DAPA 1PYBA 4YWLA 1YBYA 1EIHA 1OQQA 2Z0SA 2D10A 3W1SC 1EIGA 2EDGA 1N5WA 1AN8A 4P6VF 1YOVB 1SXTA 1ESRA 5J17A 1GC6A 4JVZA 4JW0A 2KDFB 5JXVA 3B6YA 4W9JA 2J4XA 2NS5A 2FUHB 1SYGA 3ZJYC 4F88A 3BDOA 2HDEA 1ASZA 3P4PB 1F9SA 1PMRA 3ZKJC 3FILA 1LT5D 3IXSA 1JB7A 2KYWA 2LKVA 3I3CA 4OIKA 3STBC 5T8IA 2JYTA 2B2WC 3CCRA 2D2CC 1TBEA 4YL8A 2CH4W 5JEAJ 3BIID 2K01A 1TR5A 1K0SA 1AE3A 2EQSA 1KHIA 1I94Q 2ZEQA 2BS3B 4K5VA 1GPXA 2VS1A 1Y69U 1ROEA 4OZBA 1K83B 4JOIA 5JJZA 3QIAA 5IGBA 2ZJQA 2AL6A 2NBFA 1R4NB 1Y1WH 3E5SA 1SFOH 3V61A 2A73B 5FLMG 3DWQA 1WGRA 2KQ7A 1SSNA 1L0VB 2LUMA 4TV3A 4W9CA 5HFYA 2F0PA 4ZAIA 2LJ5A 5DEHA 1HNZL 2JRHA 3Q14C 2B2YC 2WKDA 5E6OA 3KUZA 4RGTA 3HOXG 3OTOQ 1TS2A 4MSQB 1LTTD 1Y8PB 3BVZA 4NP5A 2W9NA 3Q23A 3D6CA 3AE4B 5C3XA 1WH3A 3T56B 5KYIA 2LMCB 3CMEA 4QUCA 3A5UA 1CA6A 1V6EA 2UXDQ 3ZJTA 2JUOA 3PO2G 4KDLB 1IW7C 1PFMA 4QCLA 1EOVA 1DGJA 4PV1C 5M5XB 5M3MG 1YI2A 2IHFA 4YCUA 2F0KA 4C3JG 5BN3A 4XDDA 2E76C 2GRIA 2MQJA 3KW5B 2UU9Q 4WJ3M 3N3KB 1TIID 1GO3E 2JEBI 3UI3A 1ZP0B 3AM9A 1EQQA 1VQ5A 1XQQA 3W5VB 3PIO3 1C1YB 3H0GG 5FO7B 4J6HA 1NVID 1EWYC 2Z1CA 1NMGA 2FMCA 3J81E 2D0PA 3T51B 1XNQQ 4PZ8A 2F0HA 3OHXC 3OPOA 3TP6A 1FNVA 3S1MB 2L1AA 1JE4A 2V3SA 4HRSA 5EQ0A 2DBYA 2ACZB 4AYBE 5GQOA 1EF1A 3CSFA 4GOCA 3KQ4A 1QOAA 5F2DA 1FGUA 2Q2TA 1VQCA 1PH5A 2F0QA 3C19A 4GKJL 1SE2A 4JPSA 1SGHA 4X64Q 1SMXA 1TT2A 4K2LA 4PMWA 4B9KA 2MCNB 1E7UA 3E56A 4DWFA 5IP9H 4JI7L 1L5PA 2IO0B 2VQEQ 5C5MA 3AI5A 3DVNV 1F9PA 3GD7A 4L63B 2VH1A 4EEWA 5IWAQ 1AE2A 1UGMA 2NZOA 4DR2L 2O5IC 4JG2A 4K0KQ 1HZAA 3MP9A 3ZDTA 3ZTCA 2LMCA 2B2VC 2NPTB 1WZ0A 1KOTA 1MVKA 4EQPA 3DEOA 4ZRJA 1SIFA 2QKIC 5EE9A 4R3DA 4LF7L 1BUIC 2VL6A 1JE5A 4IUNA 2V1CC 4DXFA 3IFDA 3QG1A 1WTPA 2BA0A 1T0SC 4MGYE 1HTPA 2H4OA 1IZ6A 2AQ1B 1NR2A 1FGBD 2AMCB 1VQDA 1VQMA 1VQFA 4JI4Q 1F2YA 1PRTF 1S40A 3M85A 2G9HD 3GE8C 4A3BH 3N1XC 3H9DA 4ZOHC 4B08A 3M4PA 3ZJVA 5FK9C 2R2OA 3ZYYX 1WTOA 3GTQH 1MJEA 2OT2A 1PTOC 1TKEA 1MHHE 1HPCA 1FNUA 1G6ZA 5BN5A 5C4XH 3M9BA 3MHBA 2MBEA 2LFNA 3K0YA 4PT5A 4KK7A 1JALA 5IGDA 4NAWB 5IT9E 1A2TA 2VXWA 3EROA 3ZXRA 4DV1Q 4K8IA 4QQBX 1KL9A 1DCZA 2E2DC 3NPPA 1V2YA 1E2VA 4MT5A 1YVCA 1LV9A 5J1ZA 1JRPA 1AW7A 3TEZA 4X62Q 2DZIA 2L9HA 4DDID 4WWOA 2ZPYA 2RDGA 1N36Q 2LZ6A 3MXGA 1AARA 2M56B 3FKIB 2YEPB 3B1LX 3K58A 3FEWX 2PW7A 2JA7H 2JA5B 1FFUA 3MFGA 1UZXB 4WQOB 1V80A 1QT9A 4NQLB 4LNFA 3NS8A 3RFZB 2LI5A 4UHVA 1N9WA 1FCLA 4HR7B 2MEKA 2NPTA 5FLXE 3HS0C 1TWCH 3DBHI 4BZAA 2EYLA 3D6WA 5IAAC 1FJGQ 5GADC 1Y8NB 3T53B 3UDGA 2BA1A 1TXYA 3I4LA 1WXMA 4BBSB 3NY5A 3S17H 2ZTDA 5FO8B 4DR3L 3M3JA 3UIPB 1TWGB 3E9HA 1ZE3D 5LMNQ 4MACA 1EQTA 3P7JA 1LXDA 1UF0A 4B3TL 2JJQA 5I6YA 1ZKHA 5J18A 2B29A 4P71A 5GMVA 5C4ZA 4YCVA 3SXHA 1O7ZA 2PI2A 2R7DA 5DPWA 3T1YL 4KI0A 4TQUS 1C0AA 1HFNA 3RNBC 4LDTD 2NVXH 4LF5L 4GOPB 5I2YA 2E75C 1MGSA 1BCPD 3G71A 3MEFA 4KGTA 4QGUA 4RF0A 1J5EL 3P1HA 4DXGA 2GOWA 2MBBB 1SNDA 1K3BC 1D1KA 3TP8A 4AQYL 5CX3A 3TCAA 1XF5L 2WB1E 1PH1A 2EY5A 2FIDA 5C0XH 3TZUA 4R8IA 1FD7D 5GROA 3K6OA 3KF8B 4DV7Q 1G91A 3SR1A 1WJUA 4ZK9B 1ZEQX 3K8AA 4P1BC 5JAVA 1ZKOA 1ENAA 2F0OA 1HNWL 2B3GA 3Q69A 2VZKB 4IJLA 1WYGA 1N34L 3C1EA 1ONLA 3M4OB 4BAXA 1HZ5A 4A3GG 3KFUA 4TKOB 4G7OC 3A7AB 2UYZB 3FPUB 3NWTA 1YMHE 2BTEA 1RF2D 4MGIE 3K80C 3HOWB 1EU4A 4LK1C 3I9V1 1T0RC 2KJ6A 1NYRA 4IUVA 2L8JA 3FKYA 1JICA 1VQGA 3CD6A 5M5YB 4HK2A 1QVGA 4K1RB 1L4ZB 1Q0WB 2F1MA 1JMCA 2CQOA 3T4AC 5CV6A 2WQYB 3I7FA 1K83H 2N78A 2Z0DB 4IALA 2A8VA 5LL6X 4J15A 1VZ8A 5FLXL 3J7AF 2CQAA 3OYYA 2IX1A 3ZNZB 1QF6A 2KOLA 4R8NA 4F7XA 1KTKA 2ON8A 3PT2B 4A6QA 2ALYB 1WJJA 2K50A 2I38A 3CMMB 4GOPA 4V190 1ZYRC 1Q1EA 2MP2B 1W6JA 3BYYB 2PW5A 4NPSA 2WXGA 4CKCA 1DONA 1Q3LA 3TBIB 2YTYA 3PIPA 2REXA 3M3YB 4A3OA 2PW9A 4BFRA 3S2HH 4II2B 5C44G 1YJIA 1SJED 1IBKQ 4E74A 3G6JB 2EPBA 3KK7A 5M5XH 3ZRFA 2EY2A 3LNNA 2KENA 1LGRA 2HTHA 2WV6D 4KKTA 1UGJA 5FLXc 4B3MQ 1XPRA 4QL5A 1KRSA 1SMYC 4NDXA 1VMPA 3DHHC 2R7ZB 4JOIC 3A7LA 1WVLA 3WDNA 1P8LA 1RM6C 2MP1A 1I4GA 4A3LH 5DPRA 2IX0A 1VD2A 4A8XC 1E2ZA 4H44C 5KNCA 5EKLA 2KN4A 2MSED 1X6OA 1X1MA 1IL8A 4Y7NH 1IKLA 1A3VA 1VQAA 1NEKB 1WR1A 2AYOB 2A5HA 4N9TA 2JQOA 1LTBD 1K73C 1YNXA 3A9JB 2WXOA 4UPAA 2XNAC 2RCNA 2DJFC 1PDXA 1K8AC 3K9PB 4UP9A 1KM7A 3GTKB 1XMOL 3RNAC 3ZRCA 2F52A 1Q5WB 3IHPC 4MHEA 4S0RA 4DPGA 1QWYA 5D65A 1FXIA 2ZJPA 4F87A 4A3CH 3H6MA 3QC8B 2ASBA 3SDLC 3MXUA 4CJ1B 4YWGG 3ERSX 3OMCA 1QOGA 1SRUA 5GAGC 2KLGA 4H7BA 4JI1L 1E1OA 1TY2A 2PPBC 2VUMB 4DV6L 2LVOA 3VYUA 3K59A 2BF8B 5JH5C 2HJ8A 5LMUQ 1KLVA 5IP7H 4H2AA 1T5XD 5DNFA 1ACCA 2IPKD 3ECIA 2EOTA 3JC66 4H02A 3KJOA 4IOAA 2IGGA 5ELFA 3HKSA 1YIWA 2GBNA 3KVFB 3Q3MC 2I2YA 1VQLA 1E1TA 2GVBA 5G3LF 4DV5Q 1BVSA 2E2HH 2NN6I 3NQTA 2WFWA 4YWKA 1Q7YC 2CHZA 1H9JA 4P7IA 2B8FA 4P75A 4DNIA 3S15H 2DZJA 1PRTD 1D1IA 1Y8OB 4X3TA 3TSSA 1M1KC 4FF3A 4HIOA 2B63B 3KYDD 1QVCA 3AE9B 2SNSA 4CDCC 4YY3Q 1WXSA 2Z59B 4EQNA 3HKZG 4Z9CB 2F0UA 2UUCQ 4NJCA 3A9JA 4C3IB 1WXAA 1WCMB 1IYJB 1GM5A 3H09A 4RWSC 2V4IB 1YNNC 3I4MG 4JCVE 3EFUA 5G55A 4CJ0B 2A69D 3PLVA 4DR1Q 3JAMi 3FKIH 3SE0A 1I4RA 4BKTA 1EY4A 4CGYB 1XNRQ 2JA5H 2L32A 1P1AA 3ZQ4A 1E8YA 3GZNB 1S1QB 1J0GA 3Q8FA 1F9QA 1VQ9A 2SNMA 1YJ9A 3J80E 3H7PB 2AX5A 2JXTA 1HQMC 2QDBA 3KLRA 3MC0B 1B4OA 1JMLA 1B9RA 2R92G 1WJ4A 4BY1B 2M00A 2JA8G 3E9IA 2AUKA 1CMXB 2WKCA 1NENB 1EUVB 1Y56A 4BBSH 2K32A 2XVSA 2KDEB 1K52A 1BBWA 2WXQA 1TWGH 1TY0A 3OW7A
chains in the Genus database with same CATH topology
2DNCA 3CU7A 3BK2A 4KKSA 1HUNA 2DYOA 2JU6X 2KAJA 1Z7TA 1JC7A 3ERQA 2D5GA 5DM63 3NSWA 3VA5A 3EA6A 1B3AA 1Q90A 5A2QE 1SB3C 1QG7A 1ET9A 5T1GA 3HOZB 3AE2B 4ZRPA 2DN8A 1IYUA 3TDQA 1RD9D 1LT6D 3KWLA 3MVVA 1N60A 1TS5A 1UUPA 1RHPA 4DK0A 2F03A 1TKGA 5BYRA 2NYZD 4HSVA 1EOTA 2L52A 3Q24A 4RFBA 3MFYA 4XE0A 4ME5A 4N59A 2B39A 1RWSA 4YTMB 4HTHA 5E6JA 3HUIA 1NAPA 2EJMA 1E2WA 2IGHA 5ELEA 2BB6A 2ZT9C 3OIQA 1S5DD 3J80L 1II3A 3AMZA 3EFXD 2QEJC 3I90A 2WS3B 3K7AB 4BA1I 2HCIA 1PUTA 1EY0A 2JE6I 4F8MA 3AN1A 2K5DA 1C48A 2INPE 3QOJA 5C4JB 2ZW1A 2BE5C 2NUCA 3J7YW 5M3MB 4CHTB 3T13A 4C3JB 3NS1A 2RVLA 1H9MA 3V3XA 1L0XB 5A2QL 1PLFA 3NHHA 1DD2A 4XQJA 3H0GB 1BXTA 1S5ED 4YXDB 3BK1A 3K5OA 5JVH3 1VR9A 2D5DA 4KMUC 3NXWA 1F9RA 4K5WA 1C78A 5H8YE 2JP1A 4JWUC 1FFVA 1EEFD 1I4XA 1XWEA 3ONAB 1HFGA 5BN4A 4QMGA 2Q8RE 1JB3A 1HZ6A 1H9SB 3U52E 5HURA 4IURA 2RPVA 5JEAH 1PTOF 3ETRA 4LJZC 3AU7A 2Y3AA 1TQOA 3BDCA 2E3TA 3VRBB 3Q22A 2FINB 2ZXOA 1YQ4B 1NCVA 1J7CA 4ARCA 2L83A 1Z47A 1QNUA 2K04A 4IUUA 3SDZA 1IKMA 2V3PA 2XN9C 1IUEA 1F0ZA 1KAAA 1PGXA 5G3LD 1HTLD 3TEYA 4M8AA 5JPNC 1SYDA 2M0AA 4KY5A 2PVGC 1EYCA 3SFEB 1KABA 4IFDG 4HEDA 1XO3A 1WD1A 2KA7A 2XRSD 3ND9A 3AEEB 2JSOA 2C9OA 2K6AA 1EQVA 1PFDA 4N9PA 2I46A 3RMHA 2PO4A 3DXJC 3URYA 5DM73 4HROA 5AFWA 1CHPD 3E0JA 5C5LA 5E4XA 1GB1A 1OXVA 3OWFA 1K51A 2KMMA 1EY9A 1FD6A 1E6EB 5EE0A 3FILB 1TKWB 5KGUA 3P4QB 3P1MA 1STGA 1ZDXA 3P4RB 1P7FA 4HAEA 2FE8A 4DAYA 1CFMA 5C4HA 2SAKA 2BS4B 4L2YA 1GUNA 2BCOA 1FR3A 3RLFA 4K14A 3HRDD 1DXMA 1JR0D 1E7PB 1GHKA 4NMZA 2V3NA 2SEBD 4IUPA 2A68C 4IN3A 2AQ2B 3NWSA 2ONQA 2EKIA 3NE5B 3LYYA 3DWPA 4CBVA 3VR3A 4BS9A 4KD4A 2DLBA 1SYBA 2MJ8A 1W6KA 1CZWA 4Q5VA 4A3GB 4GZYC 4QB4A 4G4KA 2WXMA 5KNBA 2O5JC 1ILPA 1VRAB 4XYOA 2F0GA 4K6LA 2JQRB 1EY8A 2EZVA 4A55A 4HMJA 2FJ2A 4UDUC 1K53A 2PTLA 2KVMA 3V96A 1PTOH 2PNRC 5E1FA 1VZ7A 1T6BX 1IW7D 1LT3D 4XTCS 1U4PA 1C9FA 2D62A 2JX5A 1JWBD 4XXEA 2NVYB 4IFDJ 5C44B 4HCEA 1BOSA 1SF0A 3HVDA 5A35A 2W3RA 4DNRB 5G5HA 3BDLA 4DGZA 2B76B 2J7ZA 1B53A 3BVGA 3I91A 1D5MC 1B44D 2L12A 3V2TA 3MHZA 1GOZA 3K57A 1V8QA 3PIP3 2J52A 4YSZB 3NUCA 1LO5D 4H13C 2Q8TA 3KLSA 2JYOA 2XIWA 1FM0D 3R2TA 1N62A 3VQIA 3H3VC 5EPKA 5ISRA 4YT0B 3HP3A 3AEBB 1JOQA 1TJEA 3NTKA 4J8QA 2Q5WD 2ZW0A 4ZUJA 1KDAA 4RH6A 3NP8A 1Q1BA 2VB2X 3W2DA 2JSVX 5KNDA 3FRPB 1TKYA 1PTOD 1PGBA 2G1EA 5EBCA 1TZOA 1OXUA 5KEEA 5CORA 3S1QB 2DYMA 2N7JA 3GTPB 1GUWA 4IOIE 4OHJA 1STNA 2F0VA 2GA4B 4ZLTF 5C3JB 3KBXA 1SJHD 1TS4A 1O78A 1B1ZA 1XXGA 3HKZB 2AUJD 4HKQA 4G7HC 4RAUC 3T16A 3OIPA 1M4VA 2F4IA 2L1BA 3I4MB 1Q8IA 4JX1C 3NVZA 1QOFA 2VB3X 2IL8A 1J9OA 2NN6H 4HEA1 4B0MA 4OL7A 2FMMA 1KDCA 3QO2A 2NB0A 1ZXIA 4OZAA 1F2MA 3T3NA 1EM7A 4PNYA 5CGKA 1BUVT 2R92B 4ID6A 5BMHA 2JA8B 2CHBD 3X3MA 3C1FA 4FVMA 1GUGA 2FFKB 2KDMA 1PFNA 1B9MA 1XX8A 1VLBA 4RKBA 4BA2I 1JWAD 1C4PA 3AE7B 1C8CA 1I4PA 2HTME 3AEDB 3AB9A 2N9KA 2PKOA 5FKAC 3OWEB 1KF6B 2ICIA 1VZ6A 2ICEC 1DM0B 1SDFA 1E0ZA 1HA5A 1HRJA 3PUWA 5EE3A 5HG2A 3I8ZA 4XT3B 3GTLB 4O42A 3NTHA 4A3KB 3MXNA 2K5WA 3EQLC 1I6HB 4LTUA 2Z4HA 1JOOA 3D8GA 2YEPF 2X38A 2QILA 1R4PB 1UAPA 1CQFA 5IGEA 1DOXA 2NZ1D 2F0LA 3SK8A 2IW3A 5CMDA 2WIIB 2IX3A 4OO1G 4TSSA 1TVXA 1ZYRD 2NMQA 3IT4B 5C0XG 3BYTB 1BCPC 3HOUB 1AZPA 2J42A 2L4NA 1SNPA 1TWHB 1SIJA 3CIRB 4G7ZC 1AP0A 4JK1C 2K3UA 1IYVA 2LFIA 1TWAB 1SMYD 2KCNA 2F0WA 1ZXTA 1QE6A 3CQZB 4R9WA 4CKBA 3GTOB 1C4AA 4V0BA 4BY7B 1ET6A 3P4SB 2EYOA 1F2RC 2CU3A 2X6LA 1ENFA 1BO0A 1EY6A 1PYWD 2OEDA 1D2BA 1SYFA 1EFID 4XQQA 4OW0A 3VYSA 1KNAA 2ZXRA 3NRZA 1JQYD 2NTTA 5J39A 4WORA 5C3WA 2WU2B 3AE1B 2RDFA 3DWMA 3L4PA 2IWHA 5BYSA 1E9MA 1RYJA 3E9SA 1SAPA 2F0DA 2F0EA 1V1OA 3GTMB 3NZ3A 1JQ4A 4YIJA 3TN2A 3C3LA 1EWCA 3P63A 1MD2D 4XWWA 3TP7A 1PZJD 2RKSA 2W55A 3NVWA 5E4WC 1EY5A 2DWQA 3H94A 2F0MA 4D2KA 5BYQA 2WNMA 5EJWA 1E0BA 1AFPA 5CV5A 4ARIA 1YNND 3DWGC 3HEJA 3C46A 3R2IA 4LK0M 1RFKA 4P2CB 3B2GA 2V0GA 1FCCC 3D3RA 5EGTA 1F2RI 4KHZA 1VF5C 1G2TA 4XDCA 4RGNA 2KQ4X 4E6IA 1WXQA 4DU9A 3WCQA 4C80A 3RZOB 2X6GA 3N52A 5CV8A 3CKIB 3PUZA 4US8A 5FR3A 4DFAA 2L11A 1U9RA 5K36G 4US9A 4RKLA 1TS3A 1PGAA 1WRIA 3M7NA 3WOFA 3D4DA 3G7LA 4XT1B 3HOYB 4XIGS 1KH0A 1A70A 1D4BA 1L6VA 5M9OA 1CHQD 2MPMA 4PMCA 2DY8A 1AYFA 4ITKA 4NKLA 1R9TB 4OO1I 1CM9A 1O7LA 4ZKCB 4Q2JA 2LY7A 5JVG3 1YNJC 4Q0FA 1S4ZA 2RSOA 2F0NA 1RTNA 2W54A 2GI9A 4J3OD 5CBEE 4YSYB 1L4DB 1BR9A 2FBWB 1XCTL 5JPMC 4RCOA 3GTGB 3PO0A 2MGSA 3Q6SA 1XLQA 3A8JE 1FRDA 3W3AA 2RA4A 2WINB 1J8IA 3HG9A 4A3EB 3Q8CA 1I3QB 4KY7A 2BYTA 2F0JA 2EYMA 3TUOA 3TMEA 4MIUA 2Y5CA 1HCZA 1QOHA 4AYBB 3FVQA 3GTJB 1V8CA 3H8HA 4A90A 3KLSX 4X3UA 5LHY1 5M3FB 2BE5D 2WAQB 3HOXB 1UWMA 4BWGB 1SEBD 4KGSA 5HI1A 3A54A 2WXJA 3GV3A 1ENCA 4IDIA 2E2IB 1IHZA 3FPPA 2A6HC 3PZ7A 3PO2B 2PMVA 2OEOA 3TP5A 2V4DA 5DAUA 2WP8J 1Y1WB 4KGRA 4C3HG 1BF4A 2H89B 1OXTA 5C2TB 1GUSA 2CJNA 4XWTA 4DA2A 2DNEA 1EZ6A 1VDVA 1QNKA 3QWNA 3N9YC 4L8JA 4ULLA 3QJYA 1I7HA 1STAA 4JE3B 3PUVA 2VZKD 3GS2A 2A6EC 2W3SA 1G2SA 1N61A 1O80A 1U4LA 1EL0A 2PQEA 1BNZA 4H0LC 4KY6A 1SE4A 2M19A 3Q8AA 1A2UA 1DJRD 1QB5D 1NUCA 1I4HA 4KN7C 2PVOD 3Q8BA 1YNTE 4DQOC 2D9UA 2KECA 2SDFA 1B2TA 5CV7A 1Z6HA 2KEDA 2XWJB 1D5XC 2CW0C 4MM3B 2BDNA 1UEAB 2E74C 1AEXA 4JBWA 3VR2A 1TWFB 3BVMA 2ENBA 4HSPA 1HEZE 4KJNA 4IFDH 4ZRZA 1L6UA 2HDMA 3HVZA 2PIAA 4WH4A 2NWGA 3I4NB 4I7ZC 2B2TA 1KFYB 2JWUA 3AECB 3FMCA 3NBIA 3AV8A 4TQ1A 5JOBA 4HMIA 1BCPB 5IGGA 3NUHB 3LWUA 3VA7A 2WB1B 3S14B 1JCKB 1WWTA 3LB8C 1WTVA 2BW2A 1CZPA 3C8YA 3GTQB 5I9PA 2R61A 2WDQB 4WQMA 1CI3M 2ZXPA 1L0YB 3O13A 5I9OA 1MPEA 4DNTB 4KHVA 2F0FA 3AH7A 3TEWA 2RDHA 4A93B 3VYRA 2LS01 2K0PA 2WLBA 5C6AA 1KRHA 1X3QA 1JWMD 1SYEA 1H9RA 1UWXA 4NAMA 1WSPA 1YN4A 1RODA 4ZQ3A 1C4QA 2A68D 2KEEA 2KJXA 4KX6B 4TMAB 5MPOA 2OHFA 2INNE 4X3KA 1ZPSA 1I6VC 1WD0A 1GUOA 1P7EA 4ZHOA 4AS1A 1LLRD 1JORA 3Q8EA 1C77A 1CK1A 1QOBA 4REZA 3S17B 3N6RA 1R4QB 3M7GA 4IKGA 1TYGB 2MJDA 3B9JA 1VCIA 4KTAA 5FOBB 3RUZA 4LMQD 4L6TB 2N55A 2K7VA 3GQBA 1FRRA 3CHBD 4FP5D 2YU9B 4K2KA 2YYZA 1EEID 2LEKA 2WXPA 1F2ZA 4L23A 5D14A 1HQRD 3L9AX 3D31A 2NVXB 3K5NA 1NI3A 3BWUD 1SNMA 3ABVB 2CVRA 1NYQA 1RDPD 1N5XA 4KD3A 2PMZB 2EELA 1QJOA 3FC4A 2KWDA 2F0IA 3VR5A 2WU5B 4QIWB 1SSOA 3PZ8A 1F77A 3AE5B 3SFDB 4FXCA 1QCBD 3KUPA 2LHDA 3OOCA 3AB5A 2OF1A 1AZQA 1STHA 2OXPA 5CR3A 3RZDB 1D5ZC 2NTSA 4YSXB 3R3OA 4RHRA 1STEA 1LTGD 3F2UA 3RPFC 4HCSA 2JYEA 1JROA 2BS2B 3S9WA 2VNUD 2XRQD 2PLPA 2B2UA 1KNEA 3U9SA 3NTIA 3E6ZX 3I73A 3S1RB 5K5PA 1EYDA 1K8OA 2H1EA 2L55A 3A8KE 3GV6A 4USAA 2F3WA 4QF4A 1DOKA 1PRTB 4N58A 3S2HB 2RSNA 4PQXA 5IOCA 4B9WA 1FXAA 2N0SB 2B8GA 2WDRB 5ELBA 5EBDA 3EGRA 4GDKB 1MSHA 2J0TD 1MI2A 4KKIA 1KLGD 1LTSD 4Y7NB 1MSGA 2K5QA 2BOSA 4IFDI 5EPJA 4M1UB 2KQ3A 4OZCA 1S5FD 5EE1A 1QILA 2ID0A 2PZTA 1C79A 2O4XA 4C1NI 3A55A 4IZ8A 1CA5A 2W82A 2K1BA 5TSSA 2WDVB 2WXIA 4ZKBB 3IAM1 1JWSD 2JZPA 1XLPA 3W9CB 5CBAE 3SR6A 4PMBA 3OSOA 3I57A 2QIEB 4DK1A 3JAME 1S5CD 4A3JB 3DWAA 3I70A 5D7GA 2HQEA 2E2HB 3SEBA 5NUCA 1BBXC 3S2DB 1OO9B 1V43A 2MJ3A 3S15B 1PXUA 3GB1A 3AEAB 3AMUA 5IIFA 1M8AA 4FO2A 3TZDA 3IAS1 4ZYSA 4A3DB 3H91A 1A6XA 3NBHA 4RHSA 1O7YA 2F0TA 2E2JB 4S3SA 2BB5A 1HHVA 3C2PA 2NN6G 4KV6A 1XTCD 2B2TC 3FDTA 1XLNA 4WIPA 3J81L 4A3MB 3VR4A 1NSNS 1TU2B 2L5TA 1K8MA 3M4YA 1SNCA 2RBMA 1PZKD 5KYLA 4TQ0A 5BMGA 3DEPA 2I07B 3GP7A 4X3SA 4RNAA 3AEGB 1EY7A 4XQNA 4RA8A 3EVQA 4AQ7A 4ABNA 2MH7A 2TMPA 4K6DA 3SK4A 1OFFA 4P16A 2EY1A 1SBBB 1AWDA 2HCCA 1SNOA 1T3QA 2FHTA 5M5WB 1LT4D 4CJ2C 3W5UB 1LTRD 4KJOA 4LAAA 3SVMA 3JAML 2TSSA 2L0CA 2MJEA 4YTNB 4CQNA 5COYA 4OO1H 4RGMA 5T1IA 1ZXHA 1IGCA 3MJ5A 2QF7A 4ILWA 4FF2A 1FNWA 1GHJA 4OGQC 3U4EG 4N6EB 2K03A 1CQVA 2HDLA 3L7ZC 3AE6B 4IQZA 1MBYA 2LGIA 3T3OA 1EWHA 5KIXA 5IT9L 2A74C 5HGTA 5IGFA 2WP9B 2AQ3B 2XWBB 1QLBB 3CRLC 1FYCA 4EVOA 3NVYA 1G8ZD 1S5BD 3Q0AA 1HXYD 4ZUIA 1G291 1HA6A 1PDQA 3RD4A 2WXHA 4C3HB 1RJTA 1YN3A 5EPLA 1DOIA 3S16B 5CV4A 4A3FB 1OQRA 1C4CA 4A3IB 3MA2B 2XSCA 4FXGC 3D4RA 4ZHPA 4XDXA 2LJIA 3CRKC 3U7ZA 3QB3A 3ITPA 3DUZA 2EJGC 3FAHA 3SK6A 3GO5A 4IUQA 4ODGA 2QSDA 3J9CA 1RTOA 1U4MA 1PFBA 4K5XA 3KF8A 4CKEA 5J22A 4FYDA 1UNSA 2RMMA 2WXFA 2K05A 5AUKA 5D3IB 1OXSC 5CYUA 5CC4A 5EKIA 4HKZE 2B2UC 4RF1A 1STBA 2M9VA 1FO4A 3MXPA 4MH8A 1WTRA 1B9NA 5EKKA 2QJLA 1NR4A 1T5EA 4FF1A 3LXFA 2O2LD 1XYIA 2AWNA 3WOEA 2Y0SB 5ELCA 4B0EA 2KCCA 1EZ8A 3MAQA 1WTWA 3P20A 4EQOA 3U9OA 3DHQA 1X3PA 3SK5A 4M0WA 5BMIA 1LACA 4I65A 3V05A 4UAIA 2NVTB 1ICWA 2K9XA 5H92C 4C1NK 1ML0D 1MI0A 2IGDA 3PUYA 4HJGE 3HRZC 1V1PB 3MTSA 5C0XJ 1CJEA 1RKNA 1GB4A 1J7AA 4DAVA 3IAYA 1J7BA 4RGOS 5LL6S 3BG3A 2PCFB 2FUG1 5K36H 1WTQA 1DOLA 1FEHA 4GDLB 3CWIA 2EXZA 3P75A 4DN4M 2KHSA 4TRDA 3BS1A 2WXNA 2J53A 1X32A 1Y1VB 2K5PA 2K33A 3HZXA 3AE3B 4JWSC 4LLGM 2WXRA 1QKZA 4KKUA 2G9DA 1ILQA 2M2LA 1PRTC 3A56A 3TEXA 3K5LA 3R93A 3R8BA 1BMLC 4DF7A 5ELDA 1ESFA 2IT1A 4A9AA 1A3UA 3L3OC 2QMTA 2HUGA 1YNJD 1A15A 3W1SA 4C56C 3VR9B 4WAFA 2EVBA 1WTXA 2A69C 1EYAA 3ZJUA 1DOMA 3VR6A 3EJIA 1Q10A 4C7ZA 1LTID 2EE1A 4O1NA 2X69A 2BDOA 1OXXK 1CT1D 1V1PA 1U4RA 5C0XI 1ZUD2 2B2WA 3S1NB 2AWOA 1KDBA 2JEAI 2BBCA 1DYQA 4BBRB 4EGVA 4WJWA 2KUMA 1JOKA 3ZGZA 2EYFA 1D6EC 1CTMA 3J7AV 2RQXA 4FNFA 4QUFA 2B2YA 4YTPB 1HUMA 2A6HD 2Z4IA 3OMGA 1GJXA 4WWMA 3DM1A 1MHXA 2PYKA 1R7SA 1DZ1A 3P42A 5E3FA 3NQIA 1RCVD 2R6GA 5IGCA 5HHDG 1E10A 5D3DA 5AUIA 3D4WA 3PV0A 5I6WA 4KN4C 1F2LA 3VR8B 1SFOB 1PTOB 1K50A 1Q12A 3A8IE 3X3NA 4FXKC 1VDZA 1GAQB 3PMFA 2A6ED 5G5GA 1GXDC 2GB1A 4RCNA 2JA6B 1JW9D 2WXKA 2WXLA 3QOLA 1H9KA 1LABA 2C5CA 4HN7A 1QQRA 2F0SA 2PZWA 3PUXA 4WRDA 1BDOA 2K22A 1VF7A 1B50A 1BQQT 1IBXB 3MWYW 3PO3B 5FO9B 2SOBA 2B2VA 2JXMB 3HOVB 2BT6A 4GLSC 3VRAB 2EY6A 2CW0D 1SNQA 3IL8A 4J1MA 1XCQL 1PZID 1VMCA 2K28A 4ZRQA 2F3VA 2Z8LA 1EU3A 2PZUA 3AE8B 1SYCA 3IFTA 5I4DA 1I50B 1FMAD 3I72A 2DY7A 3NVVA 3VYTA 3HGBA 5C3EB 1KLUD 1FIQA 2N88A 4K8JA 4FXDA 5JEAG 1YQ3B 2EJFC 3K5MA 2EYHA 2Y5PA 3BZDB 2R3ZA 1YJJA 4OVZA 2KACA 4MN3A 5KRUA 2WACA 3KWVA 2NVQB 1IGDA 1IBXA 2QCPX 2MHVA 2MUYA 3DMUA 1JWUD 4A3BB 3NK9A 4OIJA 4G57A 1CZGA 4C2MB 1ZDVA 3MEHA 3KBGA 5LNK1 3MZ5A 3UI2A 4U673 5C4XB 4U68A 3IKJA 5I2XA 2N9LA 4EE2A 2IJ0A 4C3IG 4FF4A 3B2FA 3IT6B 4IUTA 3U2SC 2Q8IB 2H88B 2LHEA 1LTAD 1STYA 4B9XA 3LWEA 1H9SA 2JA7B 2CJOA 2R93B 1WGKA 5IODA 1GUTA 1V97A 3SHLA 1DOYA 1SE3A 1A3TA 1XEEA 1TWCB 4L1BA 1VJKA 1C76A 2EYJA 2EYPA 1I4QA 2IDYA 1N63A 4XYQA 4NW2A 3AEFB 5CV9A 3EUB2 3ND8A 1ZOYB 3LX0A 1BCPF 1XLOA 4WURA 4WFN3 1YN5A 4KKJA 2E6XA 5GXGB 4DAPA 1EIHA 1OQQA 1EIGA 2EDGA 1N5WA 1AN8A 4P6VF 1SXTA 1ESRA 5JXVA 2J4XA 1SYGA 4F88A 3BDOA 2HDEA 3P4PB 1F9SA 1PMRA 3FILA 1LT5D 3IXSA 2LKVA 3I3CA 4OIKA 5T8IA 2JYTA 2B2WC 2D2CC 5JEAJ 3BIID 2K01A 1TR5A 2BS3B 4K5VA 1GPXA 1Y69U 1ROEA 4OZBA 1K83B 5JJZA 3QIAA 5IGBA 2NBFA 3E5SA 2A73B 3DWQA 1SSNA 1L0VB 2LUMA 5HFYA 2F0PA 4ZAIA 5DEHA 2B2YC 2WKDA 4RGTA 1TS2A 1LTTD 1Y8PB 3BVZA 4NP5A 3Q23A 3D6CA 3AE4B 5C3XA 3T56B 5KYIA 2LMCB 4QUCA 1CA6A 3ZJTA 1IW7C 1PFMA 4QCLA 1DGJA 4PV1C 5M5XB 2F0KA 4C3JG 5BN3A 4XDDA 2E76C 2GRIA 1TIID 2JEBI 3UI3A 1ZP0B 3AM9A 3W5VB 3PIO3 5FO7B 4J6HA 1NVID 1EWYC 2Z1CA 2FMCA 3J81E 4C7YA 3T51B 2F0HA 3OHXC 3OPOA 3TP6A 1FNVA 3S1MB 2L1AA 1JE4A 4HRSA 5EQ0A 2DBYA 2ACZB 3KQ4A 1QOAA 5F2DA 4JPSA 2F0QA 1SE2A 1TT2A 4K2LA 4PMWA 3E56A 1L5PA 5C5MA 1F9PA 3GD7A 4L63B 2O5IC 3MP9A 2LMCA 2B2VC 1MVKA 4EQPA 3DEOA 2QKIC 5EE9A 4R3DA 1BUIC 4DXFA 4IUNA 3IFDA 3QG1A 1WTPA 2BA0A 1HTPA 2H4OA 2AQ1B 1NR2A 1FGBD 1F2YA 1PRTF 3M85A 2G9HD 4ZOHC 4B08A 3ZJVA 5FK9C 3ZYYX 1WTOA 2OT2A 1PTOC 1TKEA 1MHHE 1HPCA 1FNUA 1G6ZA 5BN5A 3MHBA 2LFNA 3K0YA 4PT5A 4KK7A 1JALA 5IGDA 4NAWB 5IT9E 1A2TA 2VXWA 3EROA 4K8IA 1DCZA 2E2DC 3NPPA 1E2VA 4MT5A 1LV9A 5J1ZA 1JRPA 1AW7A 3TEZA 2L9HA 2RDGA 3MXGA 2M56B 2YEPB 3FKIB 3K58A 3FEWX 2PW7A 2JA5B 1FFUA 3MFGA 1QT9A 3RFZB 1FCLA 4HR7B 2MEKA 5FLXE 3HS0C 2EYLA 3D6WA 1Y8NB 3T53B 2BA1A 3I4LA 4BBSB 5FO8B 1TWGB 1ZE3D 4MACA 1EQTA 3P7JA 5I6YA 5C4ZA 3SXHA 1O7ZA 4KI0A 4TQUS 1HFNA 5I2YA 2E75C 1MGSA 1BCPD 4KGTA 4RF0A 3P1HA 4DXGA 1SNDA 1D1KA 3TP8A 1XF5L 2EY5A 5C0XH 3TZUA 4R8IA 1FD7D 3K6OA 1G91A 3SR1A 4ZK9B 1ZEQX 5JAVA 1ZKOA 1ENAA 2F0OA 3Q69A 2VZKB 1WYGA 3C1EA 1ONLA 3M4OB 1HZ5A 4TKOB 4G7OC 3A7AB 3FPUB 3NWTA 1YMHE 2BTEA 1RF2D 3HOWB 1EU4A 4LK1C 3I9V1 1NYRA 4IUVA 1JICA 5M5YB 1L4ZB 2F1MA 3T4AC 5CV6A 2WQYB 4IALA 5LL6X 1VZ8A 5FLXL 3J7AF 2CQAA 2IX1A 1QF6A 2KOLA 4R8NA 4F7XA 1KTKA 2ON8A 4A6QA 2I38A 4V190 1ZYRC 1Q1EA 1W6JA 3BYYB 2PW5A 2WXGA 4CKCA 1DONA 1Q3LA 3TBIB 3M3YB 2PW9A 1YJIA 1SJED 3G6JB 2EPBA 3KK7A 2EY2A 3LNNA 2WV6D 4KKTA 1UGJA 1SMYC 4NDXA 1VMPA 2R7ZB 3A7LA 1WVLA 3WDNA 1RM6C 2MP1A 1I4GA 2IX0A 4A8XC 1E2ZA 4H44C 5KNCA 5EKLA 2KN4A 1IL8A 1IKLA 1A3VA 1NEKB 2A5HA 4N9TA 1LTBD 2WXOA 2XNAC 1PDXA 3GTKB 4MHEA 1QWYA 5D65A 1FXIA 4F87A 3H6MA 4CJ1B 3MXUA 4YWGG 3OMCA 1QOGA 4H7BA 2VUMB 2PPBC 1TY2A 3VYUA