5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
molecule keywords Amidase, hydantoinase/carbamoylase family
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
1XJOA 4CPAA 1XFOA 4NGNA 3PB7X 3PB9X 4ZX9A 4O23A 3ISXA 2GREA 4P44A 2GU2A 3CT9A 3FH4A 3WC6A 5LYLA 3MRUA 4OC1A 1VGYA 2J9AA 5JH9A 1Y0YA 1QMUA 5JGFA 2F7VA 2PJ3A 3JRUA 4NJQA 3TC8A 1CPXA 3LWUA 2PJBA 3KHZA 1CP6A 4OC3A 2RB7A 2PCUA 3D66A 2JBKA 3FEDA 1PYTB 4OC0A 3S9LA 4TWEA 4ZX8A 1ZG7A 2V77A 3RZAA 1ZG9A 5HVGA 4F9VA 3KHXA 5K8OA 3B3TA 3RBUA 5I4MA 4MMOA 3FMCA 4EMEA 4JZ0A 3NH8A 2Q43A 4YWYA 2PJ4A 1YW4A 2IMOA 6CPAA 4PXEA 3K2KA 2NSMA 3VARA 4MHZA 4MRIA 4P4BA 3V38A 3IIBA 2QYVA 4P4FA 2PIYA 2ZEEA 5D29A 4NFRA 5F09A 1LFWA 1FT7A 2I3CA 4ZY2A 2XEGA 3B3WA 1XMBA 2EWBA 4A39A 2PJ9A 1M4LA 3SJFA 3B3CA 4NGSA 3H8EA 1KWMA 4OIWA 3N5FA 3KR4A 3V7ZA 3PFOA 4IHMA 3SJGA 2QVPA 4ONWA 2PJ8A 4A37A 2O4HA 2G9DA 3B3VA 5HVFA 1BAVA 3MN8A 3QNVA 2AFSA 5K8MA 2GLFA 3GUXA 1VIXA 2BO9A 3D67A 1TKJA 5LRJA 1ARLA 5J1QA 2XEJA 5JM6A 1ZG8A 2PJ7A 4F8ZA 4GM5A 1DE4C 1YSJA 3FECA 2C1CA 1R43A 1TF8A 1XBUA 2PE3A 4MHYA 3NA6A 2IJZA 4MXUA 2FVGA 2PJ2A 3PB6X 4R76A 3DGVA 3IFEA 3IWWA 3S9NA 3D7FA 4PXDA 4NGRA 3CPXA 2ZEDA 3NFZA 3SJEA 1QQ9A 4IK2A 3D7DA 2RFHA 5THWA 3PRTA 3HUVA 1GYTA 4PPZA 1UWYA 2WYRA 1YMEA 4R7MA 3BHXA 5IB9A 1TKHA 3B2YA 3CPAA 3WT4A 2WZNA 4UIAA 1R3NA 2VL1A 2POKA 3SI0A 3KQXA 4DYOA 3PB8X 4G1PA 3ISZA 3PBBA 1TKFA 3T8WA 5K8NA 3B35A 8CPAA 1AMPA 4PXCA 4LQGA 1Q7LA 2EK8A 4H2KA 1TF9A 3IJ3A 1BPMA 2CTBA 4FWUA 1Z5RA 4A94A 1F2OA 1ELLP 3KR5A 2NYQA 5LRGA 3VATA 5D8NA 5LYDA 2F8HA 4OMEA 2AFXA 4MCQA 4JYWA 5ELYA 4ZI6A 4OKOA 3WABA 2V8GA 5CBMA 2ZEHA 1Y7EA 4UF4A 1RTQA 5DS0A 3NH4A 1PCAA 3SI2A 1LANA 3H8GA 1ZLIA 2ANPA 3B3SA 4P45A 2PVVA 2AFMA 1OBRA 4FBEA 3KI9A 2PJ5A 2HC9A 3D68A 2HB6A 2ZEMA 4NGTA 4F9UA 3D7GA 4OIDA 4TNUA 1FNOA 4X2TA 3TX8A 2Q51A 4P4DA 5LYFA 2OOTA 1EE3P 1NSAA 2AFOA 3VH9A 4MCSA 4K3NA 4P4EA 4NGPA 1CX8A 1CP7A 2ZOFA 2ZENA 2IQ6A 2PJAA 1VHOA 5HXDA 1LAPA 3BI1A 4R8FA 2JBJA 1IY7A 1Y0RA 2Q4ZA 3KL9A 2CTCA 4A38A 3S9MA 4PQAA 3H8FA 4NGQA 3FJUA 2O53A 1LCPA 1ZLHA 4R6TA 4UEFA 1AYEA 2PJ0A 1ELMP 4ZY1A 2XEIA 3KQZA 7CPAA 3FF3A 2C6GA 2AFUA 2PJ6A 4UIBA 3D7HA 2ZOGA 4WWVA 4MHPA 4X3RA 1JQGA 1CG2A 4P4JA 4OP4A 1F2PA 2OR4A 5CPAA 1HEEA 3HLPA 3B7IA 4P6YA 2PIZA 2ZELA 4BD9A 3FX6A 1Z2LA 5K8PA 1XRYA 1YW6A 1Z8LA 3I1UA 3SI1A 4ZYQA 4DJLA 2DEAA 4OC5A 3IC1A 2ZEPA 2V8DA 1DTDA 4MCRA 1VHEA 4P4IA 1HDUA 5LYIA 3PEIA 4FAIA 2V8HA 2CF4A 3PBEA 3GB0A 3PFEA 3BI0A 1LOKA 3CDXA 4MCPA 1LAMA 2QJ8A 4YU9A 4FUUA 4KSIA 4PXBA 4X8IA 3SJXA 2PVWA 1HDQA 2ZEGA 1YLOA 2EK9A 3D4UA 4Z65A 2AFWA 2V8VA 4Q7AA 1CPSA 4P10A 4UEZA 2ZEOA 1TXRA 2PJCA 3BXMA 4OC4A 3IO1A 2PJ1A 3RAMA 1IGBA 2BOAA 3FEEA 4W9YA 4UEEA 3LMSA 3PB4X 2JEWA 3L2NA 4NGMA 2C6CA 4OC2A 3FVLA 2ZEFA 4RUHA 2CIJA 3WC7A 4ZY0A 2GLJA 1BPNA 1CBXA 2C6PA 5HVHA 1F57A 3KZWA 3NH5A 4EWTA 4DUKA 4EFDA 3KGQA 3WC5A 2XEFA 3KASA 3GLJA 4IAVA 5LRKA 2AFZA 1H8LA 4AXVA 2ABZA 2PRQA 3DLJA 2BCOA 3IEHA 4B6ZA 3K9TA 1BLLE 4WJBA 4MHNA 4NJRA 1ARMA
chains in the Genus database with same CATH superfamily
4Q38A 1FI4A 1FFWB 3CO0P 1MLAA 2RUSA 3KLGA 1BE4A 3MOZA 3ZNUA 1WC4A 1XIXA 2CY2A 3ILLA 3Q86A 3B8HA 3KUEA 2JRSA 2IAJB 4ZVQB 1LNQA 1PAUB 1SQGA 2G2YA 3D9BA 2VG5B 3TC8A 4Y2KA 4KPCA 1SBRA 2UU9J 5A8RB 2PCUA 3KLIA 4WFXA 3ZC4A 4OC0A 3KYLA 3R1LA 1YGHA 4LRFA 2XMWA 4C8NA 3BN7A 3QJJA 3D1HA 2OMOA 5DLGA 2GVDB 2HNDA 3BDEA 1A7GE 2X1BA 2HK3A 5A2QY 4F0MA 4C2XA 1FT7A 3JYTA 1UKUA 4WF9Q 1Y9WA 4RKUC 3SXOA 5B0BA 4A8KA 4ID5A 4KR0B 4DV4F 4J9NA 2DHHA 2YBVA 5DWMA 3N5FA 4C8KA 3JQKA 3EICA 3M6XA 2EFNA 4ZP6A 4DSLA 1XEZA 1PKUA 1U2FA 3M32A 3NGRA 2BQ3A 2W4DA 3PW4A 3MF5A 3MD1A 1RISA 2CZ4A 2HFSA 3QAEA 2R2UA 5DQGA 3MEDB 3OJUA 4ID5B 5DG8A 4C6AA 4UCNA 5D78A 1RWMB 1K1SA 3W5ZA 1TF8A 5AXNA 2GJFA 2RIJA 2PE3A 4KUAA 3T1HF 1Q7LB 1VLYA 1U25A 3KKWA 3QNWB 2W9AA 3LANA 3IWWA 1RBAA 3D7FA 4ZJQA 4LR7A 4RPFA 2MSSA 2WK4A 2DHXA 1YMEA 3I32A 3DXBA 1VMBA 2BQUA 1KLNA 5HLFA 3EY5A 4PG6A 2FCKA 2Q04A 1WACA 2KXNB 1Z5RA 3MMJA 2I2YA 2MZJA 3VAHA 1ELLP 1FESA 4X66J 5LRGA 5D4PA 3EZ5A 1QAJA 4JYWA 4YY3J 3OTEA 1WC6A 4RW9A 3H4BA 4XDCA 4C8YA 1D1UA 5LSOA 2E5LJ 3OUYB 3B3SA 1U45A 2VQEF 5J1NA 5HO4A 1VBYA 3PHEA 1R0AA 3FBFA 3A8EA 4UY85 3JQMA 3D68A 4C4WA 4H4OB 1QD1A 4USMA 4EO6A 1RU2A 3IGNA 3QGIA 2ZBPA 2B51A 4RW9B 4PQUA 5CA5A 1MK4A 4RU9A 4IQMA 2ZZTA 1IR2A 1TKXB 2LCWA 4NGPA 2PJAA 2HFVA 4EK2A 2HEKA 2P6SA 4HTIA 4MK8A 4DV7F 1P1TA 2HWTA 1I94F 2CAJA 4DUYJ 2Y8YA 4J9RA 4WFNQ 3GFZA 1A6LA 1WORA 2W2NP 3GFHA 4C0HA 1FD8A 3UD5A 3OR2B 1N5QA 1NDLA 4B10A 1RA6A 4WKRA 1B64A 3FF3A 1AT1B 4DU7A 3PGPA 1JNZB 1X4BA 1XWLA 1UTAA 5F0UA 1NK7A 4DV5F 3LGMA 1S0VA 4CH0S 3PW7A 2HWIA 1CVJA 1WHWA 5D3GB 2HBRB 1FDDA 3G8WA 4LFCF 4P4IA 4NLRA 2ZE2B 4F50A 3PFEA 3IBFB 4ZVRB 4DSJA 5B0EA 4UOHA 2DR9A 2OPPA 2XYHB 3N4WA 2BDPA 4MFBA 2FDNA 1YDLA 4ZJLA 2AFWA 1ZTWA 2K06A 3KNAA 2NMTA 4V1Ak 2DR6A 2ZEOA 4AXIA 3C16A 1SIWB 3RAMA 3JAMU 3CD7A 4U6PA 2XCPA 3V5RA 3QO9B 1RU1A 4NGMA 3MEGB 2OPPB 3A3PB 1JKHA 1FXDA 1X0PA 4IOAQ 2QSWA 3RR7A 1RKJA 3EC4A 2A1BA 1UCNA 3KGQA 1FEEA 4E8UA 3SHPA 2E5LF 3T41A 4EGLA 3W6SA 1UA0A 3M30A 3QIPB 2BCOA 1FE4A 3FMBA 3MR7A 2YNHA 1IOFA 3W8PA 1UFHA 1HD0A 1WJ9A 4ZLLA 4ES1A 2W4PA 2Z56B 3DGPB 1C1CB 2WPWA 1OS5A 2QX0A 4ZPDA 2BE2B 4B9MA 2MXYA 4ECQA 4J9SA 2OFHX 2XMJA 3RW7A 4CO0A 4B3RJ 4KYZA 2KT5A 4J9UE 1VRTA 2JEVA 2GU2A 3CT9A 4BBYA 3A3NB 1YTYA 2KFNA 4FPIA 1HYSA 4LF9J 1QSOA 4OC1A 2GX8A 1WKLA 4U9ZA 3FRZA 5HMXA 1CJVA 1KUYA 5J2QA 3NMAA 3NBPB 2F7VA 2R7SA 5E33A 2J7WA 3GIIA 2DNHA 3QGGA 2F5IA 3CJ5A 2IY5B 3PYGA 3RB0A 4KE5A 3LP2A 4N5SA 4DV0F 1YX0A 3PIPQ 1QTMA 3RBUA 2YH0A 4USTA 2Q43A 1KEKA 4X64J 3TAQA 1X4EA 2G0IA 3UDVA 2R9LA 5M2RA 2E5JA 2G2OA 4II9A 3GILA 3LOUA 1VQ7S 3TNVA 3DU6A 1ROFA 2X7BA 1IM6A 4WBFA 3N5BA 4NF1A 2QECA 3S6FA 3T1HJ 1VBZA 4ER8A 2VOOA 3R5BA 2WTFA 5G1ZA 4ZPAA 5KFTA 2NXEA 3SJGA 1Z4EA 2G9DA 3T1AA 3PDNA 1WG4A 2VH7A 2ATCB 5D0HA 5KFUA 1S6UA 2EFPA 3T3FA 4O3QA 2BR0A 2V4JB 3Q8SB 1Y9OA 2RKIA 2CA9A 4EBDA 3ILIA 4F8ZA 3IWLA 1OJ4A 1V6HA 4L73A 4RU2A 2P9GA 4LQ9A 2FJXA 4QWDA 5E3RA 3DDDA 5D0EA 4MIBA 4MHYA 5I3UA 1HWUA 2LA6A 1RK8A 3TA0A 2UUCF 5D4NA 2G2ZA 2CPZA 2PA3A 4NGRA 4B3OB 5DZ7A 4F4XA 1FWKA 1U1LA 3GIUA 2MGZA 3PRTA 4GKJF 2DCUB 5C24A 4PPZA 1VRUA 3BGRA 4TYAA 2E5IA 5LJ5Y 2WZNA 4ED4A 2VL1A 4DYOA 2XY6A 3KJQB 2ROEA 4PSWA 1Y3JA 2LVWA 1WHVA 1NK6A 4H2KA 5CXTA 3PTWA 4FWUA 1KQSR 4FVMA 2VG6A 4E2FB 2R7QA 4KV8B 3W2VA 4HPSA 2H4WB 2F8HA 2AFXA 3HVRA 5LJ3Y 4IFVB 2DNQA 1IXKA 1B0VA 5CBMA 2C3OA 3OWCA 3N7ZA 3IAM9 4QBJA 4C7QA 1AXQA 2V6AA 4C68A 4L6V3 3J81j 2ADBA 1JLAA 4IOBA 3S6HA 4P45A 1HHSA 2V4QA 5C2GA 1H72C 2ZNZA 3RGIA 1E6YB 4FD4A 3BR9A 2BEFA 4J9MA 4LBPA 3BPSP 4X2TA 3M2UB 1UAWA 3MDFA 2FHOB 4PWUA 2ROPA 1M5SA 3VAKA 1FKPA 5KTDA 1ICEB 4B3RF 1N34F 1S57A 4MCSA 3R7BB 5G0RB 1U47A 3CDBA 5B7WA 1C0TB 1CPZA 1LAPA 4LF5F 3MEKA 3K7RA 1RT6A 5EDWA 2IJNA 3FZ2A 2QL7B 4EU0A 2IVYA 2PT0A 1K1QA 3KK1A 4J9VA 2DITA 4MKBA 4LQ6A 4ECVA 2Z3OA 2ZVSA 2YNIB 4OX7A 4CRJA 1U02A 2RRAA 1LCPA 3P45B 5DDPC 1NDCA 2BEIA 1AYEA 4LRDA 5A6WA 5FDLB 1J5EJ 3EYZA 1JQGA 5A0YA 1FERA 4DR3F 1NJXA 2JZ5A 1ON0A 3B7IA 1H73A 1LK5A 2PIZA 3PRBA 3EGZA 4DL0C 2WRMA 1L3UA 3PX4A 1Z4UA 3MPWA 1EAYC 2W7AA 2PN6A 3E2EA 2QLFB 4KOWA 2FS5A 3M8SA 2J8RA 3A8JA 4ZGYB 1DTDA 3U27A 3DRXA 4LSNA 4DG1A 5L1KA 2HIYA 4B13A 2MHEA 5EWFA 2DH7A 2H5JB 1PBUA 4ZCLA 5M2UA 1LWFA 4A95A 1UFLA 2KHCA 3DOLB 5IB0A 4Y65A 3ZZPA 1SJRA 4A8OA 1TV6A 1GNKA 1JXVA 3K5LA 5DGAA 2FQQB 1HWKA 2P9EA 2KL8A 2V69A 3QIDA 4QU7A 3CJQA 4B3TF 4AXJA 3UVJB 1FA0A 4CNYA 4NYPA 3FVLA 3P2HA 3C8YA 4JV1A 2QMXA 5EHHA 5C25B 1FWLA 5IQ6A 2QC3A 6FD1A 1NJIT 5DRKA 4EFDA 2GO8A 4IYQA 5JQ4A 1LKZA 3VAJA 2GAHC 2AFZA 2HPUA 2PQ8A 4LF7J 1CS4A 3IRWP 5KFMA 2HKEA 5E3CA 2AGOA 1S1VB 1AUDA 4R0JA 5H9EK 3CDUA 5LYLA 3NWRA 4FXDA 4J9QA 4F8RA 2CQGA 4KUBA 2EG2A 4P74A 3HPOA 3TANA 3QMQA 3MURP 1JLFB 3LWMA 1YJTA 2YVSA 3T1YJ 1L3SA 4ZVEA 1U6BA 2J9EA 2DH8A 3R9LA 4ONUA 3DLKA 2FVQA 3W9HA 5F8NA 4OC3A 3CB4A 3D66A 4RJVA 1PYTB 1XMOF 4XNHC 4DUZF 2NPIA 3AY0A 2XBPA 4YEAA 2YKMB 5J2PA 1VQKS 4DR1J 4CYUA 2F40A 4A8WA 4WFYA 1KLMB 1FK9B 2PJ4A 3HF5A 5I0CA 2W9BA 1NKBA 4PXEA 4DQSA 2VG6B 2RT3A 1YLXA 4FD6A 2EBJA 3MM6A 1BC6A 4KHPF 4DPYA 2RF2A 4AD6A 2DPTA 4EVYA 3HT0A 3TVZA 4CYPA 3M9NB 4Y0FA 4N77A 1L5UA 3DHXA 1UL3A 2EWBA 4A39A 1P4NA 2CZVC 3DRPA 2YKMA 2GANA 4F6AA 1XQIA 5C7PA 1WHYA 3D6HB 2Z3MA 1U6ZA 4I2PB 3B3VA 2VZYA 5CZXA 3NOCA 2JJ4D 1Q79A 2DXQA 1T0TV 3UCZP 2IAJA 3GV8B 3MI7X 4ELUA 4OMFG 1RHRB 3G6XA 4A31A 3R6GB 4WPAA 1A0OB 1WSRA 2GFFA 4B3MJ 3CCZA 2XC9A 2O01C 4O3NA 5HATA 1RABB 1XJWB 2FIUA 1JLCA 3MR2A 3QJLA 3BO4A 2JNJA 2PJ2A 4JI8F 1GMUA 4YQWA 1OY9A 1PJ7A 2J0XA 3DOMB 2PMWA 1BGXT 4YDDB 2BQRA 5D0GA 3T90A 3KTQA 2YH1A 1RT2B 2MZTA 1I12A 3GZ7A 3TOBA 1TAUA 1RAAB 2OP5A 3MM7A 2W9CA 3M6VA 3O1LA 3BJYA 1FKAF 4QC6A 5J8FA 4D3GA 4F0HA 3IJ3A 4ZBGA 2UXDJ 3AH6A 3EMTA 2B3TB 3SSRA 4DWIA 4MCQA 4LUBA 2ZH4A 2DHGA 4JV5F 3M2VA 2FJVA 4I56A 2Z3KA 4HKQA 3WDOA 5B0FA 2UP1A 5IWAJ 2AYMA 4W4MA 3SI2A 1VISA 4DXLA 2G13A 4ZP8A 1UVMA 3OTOF 2GJ2A 4ED2A 1SUQB 5H9FK 4ILLA 4Z7CA 3I55S 1C4AA 5EX0A 1XNQJ 4OYXA 3QIPA 4XPLA 3HXMA 1U1KA 1EE3P 2KT2A 4YUDA 3CIZA 3AOCA 1Q5YA 5ADZA 5A28A 2KT3A 2QMLA 3KFWX 2KB2A 4MTPA 2B9YA 3W63A 4FVCA 3V8IA 4O3OA 1B0PA 4C3KA 4JOUA 4E0AA 2HNYB 4J90A 5JVGQ 1S60A 5LMUF 2VPXB 1CJVB 2IYIA 2O67A 2C3UA 2O53A 3VAIA 2P6EA 4ZK7M 2QL9B 2PJ0A 1JLBB 5HANA 2AX0A 4KVME 3ZTQA 2Q4VA 1B87A 4OP4A 2OR4A 2DRDA 2XZTB 2B4UA 1F9FA 4X4UA 2FHJD 2HRUA 4M5HA 1KC8T 1YW6A 1VHFA 2FLOA 3R2CJ 3RYLA 3PYDA 2JC1A 2JLFA 5G21A 2XMVA 4FAIA 1SV5B 5LYIA 2GQQA 4R8UB 2MTLA 1PC4A 3PVXA 5KFKA 1UJ4A 2VG7A 4HYKA 2VKRA 4F25A 4K4UA 5H1SV 2DNOA 4FUUA 2B6AA 2Z2ZA 1LWCA 4QYRA 2LKZA 2JSXA 3ZZ0A 4AFFA 5AG4A 3ENAA 4P10A 1BY9A 2Q79A 4UEZA 2WSAA 2CQIA 4CI0B 2YX7A 2J8NA 4LRBA 2MKKA 4NZ6A 1TL7B 1O0PA 2FJAB 3EFAA 4GO7X 5C2CA 2F8EX 1C1BA 1NJYA 2CIJA 4DV6J 2DY9A 4J9LA 3GYAA 4EWTA 2VICA 3G86A 1YI2S 4UW2A 1WG1A 1VQ6S 2RAQA 3THTA 4DPOA 4V19J 2ABZA 3TUIC 5EGYA 2HGLA 3UD4P 1K0VA 1VRUB 1LFPA 1MNEA 4USIA 2YKNA 2X1GA 4CH7A 4KHRA 1JNRB 5HN0A 2HHQA 2OPSB 4PRFA 2GREA 4ZOSA 2EXUA 3FEXB 4CYQA 5KG6A 3NGKA 3KLGB 1LWXA 3PZPA 3ENVA 3QRRA 1U2RA 5LMNJ 5B0DA 4OFZA 1XNRJ 5GMEA 2WZ1A 5CYJA 2HRYA 5RUBA 2ERRA 3VVUA 4A4JA 1HMVA 2UVWA 2DEIA 1BWEA 4LFAJ 3GMGA 2GV1A 3SQGB 2GA7A 3F73A 1RA7A 4KSAA 4HT7A 1N6QA 1KQFB 5L1LA 3DHWC 2D41A 2X3GA 4O3PA 4PG5A 5ETSA 4X2BA 2ATRA 1TKTB 1SKWA 2QLXA 5KFOA 2WONA 1IN0A 4QYZK 4DL3A 3VARA 3M2RA 2VASA 1VK3A 4DHVA 1S59A 2QYVA 4LVNP 4NFRA 3OVBA 4U67Q 2N3OA 1S1WA 4TU7A 3PHTA 1KVIA 3L4BC 4FXVA 2OTJS 2DPSA 2XGPA 1DHMA 2EG1A 3MPDA 3ADAC 2XS5A 3MN8A 2DISA 5KTAA 2HZVA 2IRYA 1VIXA 4LRAA 3T5JA 1SC4B 4JUZA 2D1CA 1S1WB 3WC0A 2VPZB 2YY3A 2OSQA 3S1TA 4X66F 4W98A 4WZMA 5A8WA 1I3OB 3H4DA 5EWGA 2V63A 1DTQB 5KT4A 3B4MA 5T7LB 5F9NA 3VGUA 3OXFA 3KLHA 5KFRA 2DYAA 4KHMA 2CQ3A 3V4IA 1YVKA 4KH0B 4R57A 4N47A 1QQ9A 3DU5A 2YNEA 4DR5F 1YJUA 1FFSB 3U1LA 4R7MA 5ETQA 1S7KA 3CVKA 3RRHA 4NCAA 1G7CB 3DOKA 4RN7A 2V67A 2A2CA 4IDKA 3MM5A 2EFOA 2NSBA 1IU8A 4A8YA 2IM3A 1S72S 5KFVA 1NK0A 2Q1LA 3KR5A 4AUKA 4LF4F 5CQGA 1PJ6A 1XMOJ 4F02A 1TR0A 1HPZB 5AXLA 4CH1A 4NLYA 1MWYA 1S76D 4AT1B 3TO8A 4N8OA 2Y0SD 2B7BB 3NH4A 5J1EB 4P2XA 2XYPB 1RTZA 2AJ6A 4ZHRB 2F9JA 5KFNA 4DR1F 2V2VA 3W66A 1AUGA 4C9DA 4Y49C 4F9UA 1OY8A 2AZ1A 1W25A 1SC3B 2M70A 2DNKA 2AE6A 4RBUA 4LMZA 1XE4A 1RAEB 1VQPS 1HNVB 1CP7A 2PO4A 2IDLA 2XSJB 1E6VB 2ZBQA 2D3OR 2DGUA 2M7SA 4PWWA 4X62J 3BSOA 1OSDA 5GCNA 3H20A 2QRRA 3SDEB 2FLPA 2M4MA 1ZM2A 1ELOA 3CCMS 3B54A 4JWPA 4ZITA 4LBHA 2DGXA 5KOWA 2AFUA 4UIBA 1FVSA 2ZDOA 1UW9A 4MHPA 3IR5B 4X3RA 4UUWA 3HHLD 3RBXA 2RHQB 3HHLB 1CG2A 4P4JA 1F2PA 1PSDA 2HBZB 2J6TA 1FK9A 1ZAWA 1C0UA 3FBCA 4OZ1A 3JSBA 4LFBJ 2GFQA 1IBLJ 2ZBRA 4B9LA 3K89A 1HL6A 2FHJA 4NI2A 4DJLA 3BBCA 4UT4A 3MEEA 5GAHU 2V8PA 4CGOA 3MM8A 3M8PA 1U0HA 3HSDA 1X4CA 3SCIE 3QLHA 3CUNA 5HMNA 2OH1A 1CJUB 4QWCA 1SL1A 4MCPA 2ZC3A 3UQSA 4EYHB 2KFZA 2DNYA 3MD3A 1TVRA 3RBDA 1LEOA 2EK9A 4H6ZA 2HV2A 4FN5A 2GGPA 2WOMB 2REFA 4IG0B 3KJFB 4DV2F 2PJ1A 1S7FA 2DGVA 1JLQB 3BS9A 3H2UB 1R89A 2MB0B 1F9HA 2Z0GA 2FPHX 4A8XA 2DNPA 1VC6A 4LT6A 4HT5A 4YB5A 4DL5A 3PCOB 1Q82T 1H2TZ 2XEFA 4TY8A 2P6FA 2WOMA 2N82B 4IR9A 3KG0A 1S6QA 3UDEA 3UDLA 2VBXA 4I4BA 4UBRA 2IVMA 1SH0A 1FWPA 5CD4H 4MFJA 1GT8A 1OO0B 2DNLA 1RGVA 3KMSA 2AJ1A 3MTJA 2E7XA 5GADI 3PB7X 3IS9B 4WFAQ 2KZZA 5DQHA 1VC0A 2ZW4A 2RHSB 3A12A 1S6OA 2Y9HA 2ARHA 1IB1E 2ILZA 4DL6A 4ZLNA 3ZNJ1 2BJ7A 1RT7B 4JD6A 2GMJA 2OEKA 2MYFA 2PJ3A 3VGVA 3LH2S 2IBKA 4F67A 1IUJA 2BM0A 2K8GA 3AJDA 2DXEA 2HUZA 5I42A 2G0JA 1BXNA 3HFKA 2QYGA 3I9ZA 4WCEQ 4F9VA 3KHXA 1NHVA 1F5BA 4JI7J 6CPAA 1IM4A 4QIVA 1HBMB 4CM0A 3BM7A 1YK3A 3O8WA 5L9XA 4P4BA 2PIYA 3R9FA 3ZZZA 2M3DA 1UVJA 2BE7D 1KTVA 1S1VA 1T95A 5I42B 1RJJA 3KUGA 1MU2B 1QTNB 1WI6A 4PUOB 2GMLA 1KWMA 4XPEA 5K14A 3I96A 5E0OA 3CCES 1X5SA 3K5NA 4L74A 4NXNJ 3OLBA 2R1IA 4A37A 2ILYA 1O6XA 4NLVA 3W2WB 3M8QB 2KVQE 3V6DB 2ZZNA 2BO9A 1YRUA 2NYHA 2JL9A 1VQ4S 1ZM9A 2CVIA 2JLEA 4O44A 3DDKA 2IJFA 1DE4C 4CQ1A 4DL4A 4NCGB 3OFFA 4UY8T 3QQCD 3GQCA 4ZCKA 1EKRA 4KBIA 8ATCB 4CGMA 5J2MB 2AD9A 4NASA 4ORFA 3HVWA 1RT1A 3W6XA 2ZEDA 2CXEA 4B17A 3GTYX 1T9XA 2M5YA 1HBUA 5KT2A 1IJFB 3BHXA 1YWXA 4LFCJ 4AL7A 2CQ1A 3DYAA 4DPXA 4HH0A 4IG3A 8CPAA 3ETMA 4CT9A 2KO1A 1R0AB 2Z0ZA 1G1XA 4A94A 4RW4A 2B0GA 3VATA 3R1HA 2BZ2A 4YRHA 2YWKA 2Z2MA 1RKIA 4TU9A 1FJEB 1HD1A 1REVA 4RZRA 2X1FA 4B9UA 3UFCX 4KS9A 4PR6A 3D3CJ 2QG9B 4DV3J 3BKFA 2ZDPA 2EFQA 2PDAA 2FC8A 5EWEA 4ZIVA 2IFXA 2ZWOA 4CGNA 3QGPA 3RAXA 2QO3A 4P4DA 4EBCA 1XTZA 4WE1A 4N41A 2FHKA 2GZOA 1HLWA 2JFDA 1WK4A 1T9TA 3HO1A 2D9PA 1TKZA 3BKTA 2DO0A 2FVRA 2IQ6A 4ZP9A 2DRAA 2GCFA 3MMBA 4YR3A 4CRYB 4R8FA 4AQYJ 2OHDA 5CHCB 3NGSA 5KFJA 3KG4A 1Q16B 5K20B 3QWUA 1Q2YA 2GIFA 2XS7A 1ZLHA 3KQZA 2MZSA 2WBRA 2L41A 3AJ1A 2WAQD 4FYDA 3QAHA 2ZKUA 1KOOA 5ETOA 1IKXB 3H90A 3ISNC 2CJXB 1K9MT 4B02A 1VIOA 3I82A 3P8BB 5HQMA 4X5KA 1ZAXA 2IJRA 4OI2A 3CF5Q 3KXDA 5KFHA 1Q4RA 3ZO7A 5HJXA 3TWZA 2DNRA 3QT8A 3SJXA 3SCJE 2MY8A 2OJ3A 3KKFA 2V8VA 2AJFE 3M8RA 2NYIA 5HQ8A 1QSLA 4NZ0A 4G1QA 1TV6B 1HBMA 5BYQA 3UNYA 2C22A 2FJBB 1WC1A 3TVYA 2XNRA 1YQHA 4NPOA 8AT1B 1HNWF 4JI3J 4M5GA 5F46A 4A46A 5JPHA 4QVTA 1HQUB 5K14B 4DUKA 4GC6A 1ZETA 3CEDA 1HBOA 2ASJA 5F8HA 3T19A 3IR7B 1FJGJ 3D2WA 1VHIA 1KP6A 1QLNA 1RT5B 4WJBA 2XI3A 3NBPA 2OPQB 5A27A 2A18A 4ZCMA 2L08A 1BO4A 3FIXA 2LP4A 4NGNA 4KORA 3PB9X 3EX7B 2SXLA 3MCNA 4KGVB 4ZLPA 2ZUAA 4JI6F 1VBXA 4DR4J 2UV8A 4OIXA 2CNOB 3MRUA 3ZTPA 1Q8LA 2H48B 5JH9A 3NAIA 1RWKB 3SMZA 2H65B 1GMWD 1RLCL 3D0HE 3PW5A 1LWEB 4B9NA 3AD7C 2I79A 1CP6A 2QIRA 3NY0A 3WX8A 2VFVA 1AA1B 4L76A 4JI0J 3H2VE 1HNWJ 2BJ1A 3B3TA 2AP6A 2JLMA 2MSTA 1TL4A 5ISVA 2AKWB 1UPPA 1YW4A 4DN0A 4KGMA 3T5HA 2IMOA 4KLVA 3IRXA 3JTOA 4NOHA 3M1VB 3TP2A 2EO8A 2FJWA 4W90B 1NSLA 4OJ1A 4LR8A 5H86A 3JVNA 4JV0A 2FUG9 6FDRA 3HFVA 4C2ZA 2FHMA 1HI1A 3L09A 4XDDA 1SJ4P 3VZIA 1UA1A 2FLNA 3OVSA 1VS3A 3EXNA 2B3UA 2PJ8A 1RWNB 1ZH5A 3HVTA 4L75A 1KTQA 4CYNA 3QJPA 3GUXA 2J9CA 2FLLA 1FRHA 2FC9A 2CRLA 1DTTA 4E2AA 5LXRA 4DL2A 4E0DA 4WU3A 4NA3A 2Y0MA 5JM6A 2M0GB 2E9RX 5F41A 4P7TA 2OLWA 4PK3A 2Z8QA 2P0WA 5HP1A 2KU7A 4C11A 2LXIA 1L3TA 2C1EB 1NZ8A 2HBYB 4I64A 5KG3A 4MH8A 1RCXB 2DO4A 2Q0YA 4GVBA 1J27A 1NEEA 2KM8B 2LU1A 4QWBA 2XGQA 5IB9A 2CPHA 1Y7PA 3TT2A 2Q3PA 3MMCA 3NNCA 2F5GA 1IBKF 1R8BA 3PB8X 4B3MF 2C42A 4YMEA 1FE0A 3WIVA 3EGNA 5KT7A 2YNDA 1I1DA 3NEKA 3QGHA 2MJUA 3A9LA 4ECZA 4PEOA 1G3OA 1KDNA 1N71A 1EJ7L 3CCRS 2VJVA 2UXBJ 2ZE2A 1OQ6A 3MFHA 4V19X 1W2IA 3DI6A 2C2OB 1FDAA 1FX4A 2AV5A 1X60A 5JUMA 4NEXA 2DRBA 3KI9A 3OXLA 4ICLB 4DZ6A 1VC5A 4KC5A 1SKSA 3JSMA 2H1YA 2FE7A 1UVLA 2R3VA 2NXUA 4O4GB 1KS2A 2IL4A 1R31A 2C2EA 1F60B 2OPRA 2HWHA 1FTCA 4R5PB 5KT6A 2G1HA 2AFOA 3VH9A 3Q8YA 3R5JB 5IT4A 1FJCA 4DF4A 3VAMA 1U1NA 5L9NA 3SZ2A 4IDKB 4NLUA 2HMIA 4RW7A 2WSCC 4MY0A 1FKOA 1FRKA 1MN7A 4I7FB 1NBEB 3KG1A 2DR7A 3BEGB 2J7KA 4F04B 4PQAA 1MG7A 2J8AA 5G4DA 4ZVFA 3P5TL 5CYMB 2C6GA 2KXFA 1MMDA 2PJ6A 4ED1A 1VQYA 7FD1A 2ZH8A 2E1RA 3Q83A 3QSIA 1AZSA 1Q0NA 3ET6A 4DR2F 1F2GA 4ZPVR 1NKEA 4ES3A 5F49A 1R27B 2P6GA 2VD3A 3MUTP 2CPEA 2F9DA 3MPUB 3UCGA 2KRRA 4DR7F 3GP9A 1CJTB 2XO6A 5DLFA 2KRBA 2GVZA 1U0SA 1HI8A 2IVFB 3ZZRA 5KOXA 1H6KX 1HNXF 4PXBA 2HVIA 2HW3A 3OL9A 1HDQA 2DT9A 1UWAA 1TUVA 2VQYA 2NZCA 4CAFA 1R57A 4TLQA 4Q7AA 4UFXA 5KFZA 5BR8F 3FRYA 4WYLA 3W9JA 4DJBA 2XM3A 1UFWA 2P6TA 4OHYA 4F0KA 1MJ9A 4B3OA 1ZA2B 1IICA 3QZ8A 1NRKA 4FP9A 3UI3A 3P5BP 2ZM6J 3G82B 3P4UB 5MLCV 4J37A 3T5LA 2IDEA 4ZCIA 4PQUB 2H4YB 4RUHA 4NLDA 1TKXA 2CQ2A 4JI2J 1N4LA 4ZY0A 2H54B 2IHR1 4WKYA 1OPZA 3VWEA 2IYGA 1NDKA 3IR6B 4HNXB 3K5MA 3B82A 2DEJA 2FGCA 4Z37A 3PX0A 1URRA 5HMZA 1RTHB 1D3WA 3IEHA 1WWHA 3HSGA 1R0CB 2HGNA 3AD9C 3KK2A 3F0NA 4ZJOA 5KG5A 3CSKA 4WU2A 2AT1B 3KHHA 1QSMA 3QLHB 2ZPAA 3D6MB 1ZBTA 5AJ3F 4CIOA 5E5NA 4IG3B 1LQ9A 4ETXA 4DSIA 4P44A 4F4ZA 2PD1A 1NMTA 1X9WA 2BRKA 3LP0A 1FHTA 3CJ4A 2CVEA 4BDPA 2E7WA 3AT1B 2FY1A 3DLLQ 3GG1A 4DPUA 4WK3A 2MPUA 4CYOA 3DRSA 1UMJA 2HHVA 1CPXA 3KHZA 2RB7A 4DQQA 3MMCB 1X10A 3WIUA 3IGRA 1RTJB 2MY7A 5HVGA 2WPXA 2HVZA 3MCMA 4XIUA 1FXRA 4Q5VA 3KLFB 2QA4S 4QIWD 3IA0A 1U26A 1GHEA 3IIBA 4X4QA 4I68A 1LFWA 2ZJRQ 2CQ0A 4PZVA 1HW8A 5KFYA 1VRTB 4B14A 1NPKA 2VKZG 3H8EA 4QW8A 3PW0A 3IS9A 1RWOB 2Q44A 3DC2A 1AW0A 5KFAA 1TK0A 3DOMA 1NJWA 3DSBA 4IG0A 4HLBA 2LLZA 3UPFA 2KKHA 4OX9J 3I0RB 1FKPB 1ARLA 2UUCJ 3EE3A 2XEJA 1AFJA 4LSNB 1YREA 2KZMA 1LXNA 4YB6A 3TI0A 2W1BA 5CNPA 2RQKA 1Z2ZA 2N3LA 3ZTOA 2FZCB 3FKBA 3E01A 3EUNA 4C2YA 1KFDA 2B4PA 4X4SA 1WOPA 4ZPCA 2FVGA 4ED7A 1LOUA 2CNTA 3H98A 4C97A 3ENWA 3OTOJ 5THWA 2NCKL 1UEKA 4I6WA 5L8RC 2CQCA 1PGZA 4LQ3A 1JWWA 2QA4G 3KQXA 2K1RA 4TLRA 3EO4A 3ISZA 3O3LA 2YNFB 2HNZA 1KOHA 1NLKL 2B4DA 3LF0A 2WB4A 3PYEA 1U1QA 2UXDF 3DR8A 1NK4A 3D3SA 1DQAA 4LFBF 4MIAA 4OJHA 3OV7A 2JX2A 3ELHA 4OKOA 2GIRA 3HZGA 2DIVA 1HKAA 2HHSA 3MZIA 4J9PA 2ASLA 2MQPA 2DHSA 2R8JA 1RXOB 3Q22A 2EFVA 2IC3A 4KAIA 1Q8KA 2HYIB 4K0KJ 1X4GA 4R25A 5EX3A 1LANA 3SQOP 1U49A 2M9KA 4BWMA 1WEYA 2QLBB 1RO5A 5GAHI 1TL5A 4ECWA 2CG4A 5KFPA 3NLCA 2R8HA 2OKQA 1R8AA 2B58A 3EGWB 2DR8A 2GW8A 1RB0A 1M5VC 3TR5A 2LEAA 3D7GA 4OIDA 1N56A 4JYAJ 1RT5A 1XMQF 4DDFA 3KLEA 3DFEA 2BOPA 1J4JA 1SH3A 1S97A 4J9KA 2CADA 3BYPA 3LQVA 2CPDA 1VHSA 2R42A 3EPGA 4MFKA 4IR1A 3POTA 3VAGA 4PYDA 4FS1A 3IBCB 3P2FA 3R6LB 1E6VA 4C7HA 1QUVA 3D0IE 5ETVA 4U96A 3V81B 1WKJA 1UP1A 2DHAA 2BXJA 1W26A 2AEJA 1L3VA 3ZJ0A 1MJBA 4MIWA 4DOZA 2HURA 2NREA 1I6JA 1HBNA 3SDEA 4N76A 5IT0A 3F44A 3KK2B 3POTB 3HULA 3R95A 3MGDA 4NLTA 4YHHF 1KKHA 2KTQA 3S8SA 2RU3A 3HHLA 4YN3B 2BVZA 2J5AA 2VBQA 4QOTA 3V6KA 1HHTP 1BHNA 2MZ1A 3H7HB 1SQFA 5IT9Y 1FEHA 1M1GA 5KTCA 5LSRA 3TRGA 3C6UB 2DNMA 5KG4A 2PI5A 2XWXA 2PE8A 3GB0A 1GTHA 5KFWA 1X5OA 3S6KA 3BR8A 1KNZA 4JBCA 2W8LA 3P49B 2Q6CA 1C1BB 4X8IA 2CNMA 1TAQA 1C4CA 3KJNB 3PM9A 4DS5A 3MFIA 2R8VA 4Z65A 2N7YA 5LT5A 1Q8IA 1PYOB 2MMYA 1P9QC 1Q86T 3CC2S 3QAUA 1WNEA 1KD1T 3S01A 1RHMB 5LOQA 4Y34A 2E1AA 2I8EA 2LXUA 1CJKA 3FEEA 4M5MA 3CNQP 5DZ6A 3MM6B 4IO9Q 4WIIA 3ZZYA 3EVMA 3D28A 1S1XA 3FNNA 1MROB 3PKYA 2Z3NA 3FEYB 1IKXA 4OI4A 2RQ4A 1QAYA 4NLOA 3JS9A 2OZHA 4EBEA 4F2SA 1N5VA 2PEBA 1Z1ZA 2C3YA 1FXLA 1FJ7A 2LYVA 4AG7A 2KXHA 1CEZA 1DURA 3CJ0A 3KK1B 1BD6A 3N28A 3J81U 2HQDA 4KVXA 4JI6J 4OYOA 3U7JA 4CTAA 4UQTA 2BBEA 4CPAA 2KJWA 3DLEA 5F48A 2REEA 3GU0A 1S5KA 4ZVGA 5IQQA 4JV2A 3LGHA 4O0IA 4O23A 3R5DA 2YQ3A 3TAMB 2B4OA 1H74A 2UUBJ 3HHEA 4MFBB 2DGOA 3BGUA 4C3MA 5HK4A 2I9SA 5IFMA 1IJEB 4K4TA 2VDIA 2CPIA 1ZTTA 1D9DA 1R6YA 3UVJA 1JLGB 4HEA9 3M32B 2ZW7A 3I87A 2HFOA 3LWUA 4QQBA 3FEDA 1Y4ZB 3QO9A 4XPCA 3B8GA 2C2MB 3CJRA 3LD2A 4TWEA 4Y49B 3CJ3A 4LF1A 3CDAA 2J0QD 3C26A 2KHDA 3RU0A 4YR2A 3AXMA 1RHKB 4KFBA 1IBMF 1SQEA 5IC4B 3LTOA 3K2KA 4KVOE 4JI4J 4MHZA 1JLEB 1UZHA 3H5YA 3Q8RB 3V38A 4P4FA 1TL1A 2ZEEA 5D29A 5F09A 4LSLB 2I3CA 2CQDA 3I0SA 3FRMA 3S7RA 5SUHA 4ALZA 2EBGA 3D3BJ 3RTVA 2FVSA 3PR4A 4DR5J 1FKOB 1GAOA 2QT7A 5ETTA 1EP4B 5G22A 3BBBA 3DRYA 3ILOA 5T41A 3F5BA 4ZMMA 2VODA 3W64A 2A6MA 2ZD1A 4CO5A 2DKOB 1U1PA 1N34J 1GXUA 3HI9A 1WF0A 3PJXA 2EWHA 1SH2A 4U7UD 2PA8D 2HHXA 3I5CA 4BBHA 4MXUA 1U4BA 1HQUA 3D4JA 2COLA 3NRBA 2GNKA 5A6PA 1UW4A 4EI2A 2CWXA 3NFZA 5KFIA 3TO6A 1V0CA 3DM2A 2C2RA 3HCXA 2HVDA 3HUVA 3M6WA 4PAAA 1HBNB 4E98A 3J81Y 3B2YA 1NE9A 2VFSA 1Z8TA 3H4QA 4OZ0A 2POKA 3C19A 4H6UA 4K5RA 4OYZA 3W61A 5HBMB 1RZMA 4JI1F 3JQJA 3PBBA 1RT3A 5B09A 2EK8A 2DF5A 3DNSA 2EW9A 1YJWS 2ODFA 5IV4A 7AT1B 1X4HA 1QAXA 2MQLA 4DNCA 2WVDA 4M6GA 3WABA 3OSNA 2PMHA 2ZEHA 3IGVA 4N7TA 3JUWA 4TY9A 2J9DE 2LDYA 1AUSL 5DS0A 4KKOB 4RWWA 1YBUA 1SL2A 1VQMS 4ZVTB 4NLPA 4FF2A 2ANPA 2B5GB 2PVVA 1K47A 2ASYA 5EBVA 2E1PA 3DRPB 4K5SA 3VR1A 2Q4YA 3MUVP 3BN4A 2LEPA 2UUTA 1Y0HA 3TUZC 4KRWA 3QATA 4IUSA 1WOSA 1Z4RA 1MMNA 2G9OA 2W8KA 5K9FA 5ETPA 4K2JA 3D5MA 2V50A 5IT9U 5AE1A 2AU0A 4UUXA 3CC7S 4BLGA 2V9KA 3NS6A 3R7SB 2JBJA 2Z2YB 3HJVA 2Q4ZA 4FS2A 3NP5A 4OZ5A 5IX3A 1FRMA 1WTBA 5KFBA 1X9MA 1I1GA 5KTQA 4UEFA 3THVA 3FSXA 2Q6BA 2XQCA 2F4FA 3BSNA 1KONA 1VJWA 4KTQA 3CD0A 1N54B 2B43A 1EQMA 2R7XA 3BZQA 3GYXB 1LXJA 2ZH5A 5AE2A 4LF6J 3FX6A 1JXLA 3PYFA 4CGPA 3CIMA 4X4NA 3JSMB 4F0YA 1SQHA 1YIJS 3FXTA 4LF2A 4O4GA 2V8DA 2W25A 3PEIA 4IFYA 2VBZA 3R27A 2JDCA 1NSPA 1ZZFA 3DLGB 1YJ9S 1H38A 2HFNA 3O2IA 3AFGA 1RAJA 4LF4J 3B6BA 1DRZA 2PVWA 5D4OA 4DR3J 3U1MA 2RDIA 3Q8VA 2AYBA 2YWFA 3JSYA 2OSRA 1UPMB 4M5NA 1J5EF 3BBFA 2IBOA 3FCWA 2FTRA 4OYMA 3IO1A 2V0NA 1IWAA 2BOAA 2MKYA 3G4SS 2BV3A 1D0EA 3T1YF 1N5YB 4A47A 5EUHA 3SIPB 4OC2A 1G4CA 3SYZA 2I5JA 4QIEA 3KZWA 3W65A 4K8RA 2CWKA 2K2PA 4QIGA 3QT7A 4IAVA 1NNDA 3OW2R 1MWZA 2V4JA 2X51A 3GIJA 5F3TA 4U7UK 5CD4A 4OYPA 2VG7B 2NSCA 4NLWA 4JLYA 4DEZA 4O3RA 5CCMA 2OB0A 3I5BA 3ULHA 3FBEA 4CO4A 2E1CA 1LW2A 4Q0BA 3CXSA 1QY7A 1S49A 1YJRA 4ILMA 1VGYA 2RH3A 4OYIA 1B6BA 2BW2A 2Z2LA 3ZFVA 4M3SA 3C2PA 3MAAB 4MJ8A 1TL7A 1IKYA 2MQ8A 3BKUA 4NJQA 4DSEA 4RUAA 4KOUA 1SV5A 1HI0P 1VQ8S 4ECSA 5J8CA 4F26A 3S6GA 2B3VA 5T14A 3ISND 2IM1A 4BCAA 2F8MA 2K3KA 3N6LA 3IU2A 4HACB 1X5TA 5DO2A 1LWCB 2QJ3A 4CCHA 3OR1A 1Q1KA 2GHPA 3TZZA 5JMNA 5U47A 1NXIA 4TN2A 4QIFA 3IRXB 3AODA 1IYLA 3OXGA 2RQMA 4I1TA 1HWIA 2RRNA 2VF3A 4URSA 1YJVA 5LSLA 3HD2A 4URGA 2QFJA 2OMLA 4OJ3A 5AXKA 2AF6A 3MPYA 3O5TB 3FSIA 1YRXA 3G87A 2DJWA 3M2UA 2I0XA 5HJYA 5HVFA 3NG8A 5HI7A 1S1UA 2GLFA 2HHPA 1SKRA 3OL7A 4QCLA 3L9ZA 4TU8A 4IFVA 3G9CA 4QPXA 1LW0A 4OI1A 1Q2CA 2PJ7A 2RKIB 3UO0A 1NSKL 2X7IA 1PYTA 3EGVA 2R7TA 4R87A 1B4SA 2IJZA 2OELA 3DMJA 5J1PA 3N0VA 4HHJA 5I3UB 2MEWA 1E6YA 2XNQA 3SJEA 2J6SA 1U6MA 2NXJA 2H5MA 2WVBA 2EC0A 4NCZA 4QW9A 2LMIA 1R3NA 4L3KA 2KFYA 1S9FA 2HHHJ 4BINA 4RUBA 1PU9A 3QT5A 2BJ9A 3AXKA 1QM9A 4Y2MA 3SQGA 4NRUA 2VU5A 4IH5A 2DBBA 2NUUG 1UVIA 5LMUJ 1GTEA 2LEBA 2R2SA 2OZUA 3CMQA 3RO0A 5G20A 5B0GA 2VA2A 2HBQB 4URQU 2YNIA 1S9GB 1U0HB 1QE1A 4YS2A 2VBWA 2FZKB 1ZLIA 4R3LA 5EN1A 4N56A 3VWSA 2CYYA 1RE1B 2ZJQQ 4CRZB 5A0YB 2BANA 1BUXA 2M2BA 2H3EB 2HC9A 1X0FA 2V2ZA 4J91A 2NS1B 4CAWA 2HFZA 2J8SA 3CCJS 1RAGB 3LWLA 3NE8A 1QSSA 3LP2B 1M1HA 1JX4A 2KCWA 5L46A 2ZENA 4ZN1A 4A8MP 3MM7B 4C3LA 4HI2A 3SSQA 5A8RA 4DCJB 5HSPA 1S7NA 2D74B 5A8WB 3BJ8A 1ZM3A 3BQ0A 1XN9A 3CDEA 1Y0RA 4ITSA 2ZXVA 1PAEX 2UV8G 3S9MA 1CM0A 2BSWA 1DAXA 3TVKA 3FK4A 3M7VA 1S6PB 4RBTA 3I3GA 2NXCA 3W5XA 3FYNA 1N0VC 2UVRA 1ELMP 1TKDA 1NK5A 3M2VB 2AX1A 2X3DA 1X5PA 4HVZA 1RT4A 4DV1J 3MR6A 4MFZA 2DNNA 3M4XA 1A9NB 4CLYA 3CD6S 5CYQB 3FQLA 4LF8J 2JOQA 2XS2A 3IG1A 3WZ0A 1XF8A 4DSFA 2J0SD 2LQ9A 3MUMP 2EBEA 3KWMA 3MM5B 3PRDA 5K8PA 5ETLA 4FD5A 2WVEA 3GJSB 1GXLA 2ZH7A 1RXTA 2JEIA 4HKFA 5D15A 4LSLA 1P8GA 4X62F 2YGWA 3F8KA 3GR1A 2UXCJ 1WF1A 2VV5A 1UETA 2Y0BB 3TQ1A 2FYXA 1YLOA 2RUGA 2BKPA 4DZDA 2RU9A 3BF4A 2KN4A 1NHUA 2RS2A 1RAHB 5C24B 2FZGB 1WEXA 3BGRB 3RBEA 1U6FA 3EVOA 2OPQA 4P71A 2HFUA 3LMSA 4ERDA 4MKAA 3NL0A 1YGYA 3LALA 4WXOA 2AJQA 2GIQA 5KG1A 1VBKA 5HVHA 1UVKA 5C25A 4AYBD 5F8MA 3G6ES 3WC5A 2CNKB 1FNXH 3MEEB 3GLJA 2ZH9A 2NZ4A 1HQEB 4Q2LA 4KO0B 3BH6B 3HMJG 4UZBA 4NLXA 4RW6B 5F3ZA 5E96A 3DM2B 3TARA 1QDUB 1HWLA 4RW4B 4KGKA 2HQ3A 1GXTA 4IRDA 4DI6A 4NE9C 1H98A 1WKKA 1LWEA 1CS4B 3MOJB 3I31A 3NS5A 2FJDB 4USVA 2AYEA 5L1IA 2PEHA 1OY6A 4NWBA 4H54A 4O44B 3VV2B 3N9UC 3KUHA 2M52A 2QL5B 1V5VA 3CXPA 5AXMA 2OAUA 5C42A 1F5AA 3JTPA 3GPAA 1JJ4A 2R98A 4C7IA 1EKSA 1BMQB 2ZFHA 3TO9A 1IKWB 1M5PC 1JLFA 4RW6A 1S0NA 2I1RA 1C0UB 1RACB 5JGFA 1X12A 2XMKA 2O3DA 3CD5A 1Q78A 2MLZA 4F3QA 1SVDA 1R6VA 3CCWA 3MM8B 2R7WA 2YQ0A 4TQRA 3L3CA 1M1KT 1ZG7A 2QV6A 3M05A 5K8OA 1OPIA 5I4MA 2ASDA 3MECB 1I51B 3TJ9A 2GIVA 4Y6IA 3EZOA 3SXNA 2VONA 4MK9A 3TYTA 4BC9A 2NSMA 3ICLA 2EKNA 4ENOA 1SL0A 3KLFA 3JYTB 3C15A 5EC4A 4GKKJ 2KYXA 4WP9A 1CC7A 4OYBA 3GYNA 2BACA 4U8VA 1YBTA 2XEGA 1H7WA 4USKA 3B3WA 1FVQA 3CJSA 1NCLA 2IRUA 3GV7B 4GS4A 4OZ2A 1FRLA 2VQFF 4OIWA 1ZPWX 4AG9A 5IXUA 1UEUA 2APOA 1M4IA 2HQCA 2FGOA 3CDWA 5C82A 2BANB 1DY3A 1RLDA 2Q7BA 4RW8A 3GIRA 2FVPA 3CXCR 4F4YA 5IZHA 4DLEA 1UEVA 3G8QA 2ZH3A 2MQMA 3ETOA 5J2NA 2XULA 4OX6A 4XNHB 2QA2A 3VQTA 4CNZA 1JJ2R 4GM5A 1WDDA 3HHDA 2F4VF 2XY7A 2C1CA 3DOLA 1HHQA 2OEJA 3GYGA 4USWA 2DPIA 3MMBB 2C2DA 5KFFA 2DVIA 3AHPA 2LQBA 1VR6A 3GJRB 3FBUA 1N5SA 3BLNA 2VEZA 1PIEA 3DCAA 3K57A 4RNOA 4CAVA 1JLEA 2J7UA 3MM9A 2IA6A 4OZLA 4Y28C 2WYRA 4FZVA 2HQGA 3TUPA 5K5MA 3TAPA 3GG0A 4X4TA 1LV5A 3T8WA 1YBAA 3MEGA 2Y1LB 4J3GA 3HHNB 2XZWA 1TF9A 4DFMA 5LMNF 2CPYA 3A8KA 5KFEA 3IM9A 3IBWA 1UJ6A 1KHVA 1EP4A 4ZI6A 2V8GA 2E5HA 3NMRA 1URNA 1Y7EA 1WC3A 3T9ZA 3UDCA 5DG7A 2FT0A 4P9SA 2OIHA 2NUHA 2UZAA 1TZ0A 3CJKA 4ANEA 1FX2A 1O51A 2FJEB 1RI7A 3F56A 4MBUA 1RT1B 3SV3A 1IQZA 4PUOA 1RTIB 4KOSA 3H42A 4Y2AA 2ZEMA 4KSFA 4OV1A 3CCQS 5I3PA 4UOFA 4UFVA 1BLUA 3GSDA 5B0AA 3TCVA 4LUAA 1PC5A 1GFWB 4AL6A 3KDNA 4GC7A 2W2OP 4K30A 3PRVA 4MKVA 3MEDA 2VC0A 2VZ9A 4C8LA 3OT9A 3BQ2A 1F6TA 5HBMA 3PP9A 5D8HB 2U1AA 2A6OA 4I6AA 4DR6F 5IM0A 1EQ0A 4QR1A 1HNXJ 1SJ3P 5SZTA 4JI8J 2BRLA 4O0NA 5F8IA 2JDJA 4ZY1A 1U8WA 1Z8XA 3UR3C 1TFYA 3QPIA 1KVJA 5CPAA 4E8OA 1SB6A 3TA2A 2YNGA 3DYAB 1UWBA 5KG7A 1NJZA 2R7HA 4X65J 1OSCA 2D4OA 3FSYA 1REGX 1GMVA 2RILA 1X7VA 3HVTB 5FLXU 3JTNA 2V8HA 3KMQA 1L0CA 1R8HA 4DPWA 1SKUB 3G82A 1HNVA 2AIRB 1YRTA 1J5OA 1JLCB 3A8IA 4MYTA 1TKTA 3EXCX 4RNFA 3VALA 3PXGa 3W60A 2IMWP 3H5UA 5F8GA 4DL7A 1DLOA 4AL5A 4QWAA 1CPSA 2E5GA 2PJCA 4OC4A 1IGBA 4K4SA 1XNQF 4DQRA 3E3XA 4DV5J 4DCPB 4UEEA 4LF8F 1U24A 2OEMA 4PSXA 3D6FB 1J5OB 1CBXA 3H2LA 4LVOP 5ETMA 5FIIA 1S99A 3UNGC 2DTJA 3HFZB 1VDHA 4QYZJ 4B3TJ 1FO1A 1H8LA 2PC1A 3R9EA 4ECRA 4DSKA 2ALYB 2B4BA 2U2FA 3CWJA 3HDSA 2EKYA 1HIYA 1WDTA 3DGPA 3RNZA 2P5VA 4MHNA 1S7LA 4HTJA 1XJOA 4ETZA 1DTQA 3UW1A 2AEMA 4KIAA 5IWAF 4F3OA 2MKJA 4I2QA 1ITPA 3H8YA 5FVJA 5HP1B 4RO0A 2BKOA 2KI2A 3GONA 4G1QB 2KDOA 1NPPA 3MMAA 5JVHQ 4EZ6A 5KFLA 2CUYA 4UOGA 2G3AA 1NZAA 4ANCA 2XLIA 5L38A 3PEHA 2JLGA 2C2KB 2OPRB 1NKCA 3OSPA 4A8FA 3WBZA 4DPTA 1SJ1A 2ZVIA 3S9LA 2EI5A 4CO1A 3D2MA 3IAS9 1Z9UA 3RZAA 2HNYA 1ULRA 4MMOA 4LX9A 5BJRA 4JZ0A 2CQPA 1TELA 2YQ1A 2HMIB 5IV0A 3NNHA 1VQ5S 4A32A 3UY5A 2EVNA 2QYCA 3RW6A 4K4VA 4K59A 4G1IA 5DETA 2WONB 2QIFA 3B78A 4R3KA 3TOQA 4XAKA 2PI4A 2YKQA 1ZAVA 4YFJA 5HL7Q 4RR5A 1EX8A 2B5JB 4A48A 1JXEA 4DN9A 9RUBA 3CJKB 5GMKa 5KT5A 1S7IA 1LW2B 3OTBA 2OGUA 2GC8A 1T11A 4IHMA 5L1JA 4ONWA 4ICLA 2PR8A 1P9YA 4CLFA 2EC2A 3JTKA 1FDNA 4K7QA 1NSQA 2JHEA 1HARA 4IOCQ 3Q0AA 1IKYB 3ZZUA 3CZXA 3OTCA 2DNGA 4LF9F 3FECA 3D7SB 4IH6A 3I9SA 2Z57B 2Z11A 2CJBA 2E7VA 2CJAA 1GH8A 3ITHA 5ETRA 4R76A 2L9DA 3PG9A 2L9NA 1HQ2A 3WHIA 5DG9A 3LACA 1GK8A 3LUYA 2EK1A 1RTDB 2WW4A 2HZCA 4K0KF 2G0CA 2FIAA 4Y3CA 1Q2DA 4FD7A 2HS4A 5KAKA 1N33J 1VI7A 2C2NA 2PSWA 2VC1A 2MLYA 2ATLA 1VK8A 4QUSA 4G1PA 4YGOA 3O6QA 4X4RA 1TKFA 4LIRA 2VFUA 2D7SA 3T6BA 3ITHB 4C2MA 2YNGB 4L8AA 1RYRA 1UWBB 4ZLJA 4KQZA 3H5SA 2NYQA 3OJSA 2XB2D 2HGMA 5D8NA 2PSZA 1YHQS 3LO3A 5AG7A 2HLUA 3CMES 4ED6A 1VQOS 4OI3A 1T03A 2OPSA 1PCAA 1ZYQA 3CC4S 1QSTA 3R1KA 2GVZB 3VF0B 3ZZOA 5BWAB 4K2XA 4CLLA 1Y11A 3PY8A 4FBEA 2F4VJ 1Y5IB 2PFFB 1XR5A 3NGDA 1D8YA 2B7CB 2CNNB 2G4BA 3R7NB 2BUNA 4KSEB 2Z58B 1P27B 3I5AA 1Q8BA 1ZA1B 4CZCA 3CJTA 2JDDA 1XNRF 1YG0A 3RYOA 4RBVA 1Q81T 2UU9F 3TEGA 3M8WA 2QN6B 4DF8A 3CXQA 3DN9A 2HS0A 3TX0A 3BI1A 3R3TA 2CDQA 5KFQA 3SV4A 5IV3A 3OLAA 1K0TA 4C11B 4LJMA 3R8YA 4DR2J 1NUEA 4B08A 2MQQA 2IPOB 2W2MP 3FJUA 3T6JA 1PILA 1M90T 4R6TA 4M1KA 2CIMA 5B08A 1BQNB 2CQ4A 1ZS6A 2RF2B 5GMDA 4NA1A 1HNZF 3D54A 1OYDA 3OBIA 4DV2J 4ZVPB 1HEEA 1H3DA 4JYAF 4EFAC 4OLPA 1X4FA 3W9IA 2WVCA 2MKSA 4YB7A 3KHLA 4OLOA 3M30B 1GEHA 1Z8LA 2GS8A 1NM2A 2YNHB 1W7WA 1DFDA 1B7FA 2WW8A 4OC5A 4B5OA 4F4WA 3Q24A 3KLIB 1HDUA 1N52B 3I0RA 2K7KA 4OADA 4DBQA 3CGIA 1PBAA 1S1XB 4Q44A 5T7LA 1CJUA 4MFPA 5CAAA 5AG5A 3X1LB 4K4ZA 4DX6A 4DFPA 3W91A 2V4RA 1VKCA 2AW0A 3E01B 2EK6A 2P9CA 1BWVA 2V2KA 1TXRA 4P73A 1X4DA 2GMHA 3P96A 4FNIA 1N5TA 4YY3F 5A76A 4HDGA 3OD2A 1IBMJ 3OL6A 2GQCA 1NB2A 4QZVB 2GQ2A 1WI8A 4R5PA 2VG5A 2D9OA 4Q36A 1RT4B 5GAEI 1GQEA 4M94A 4ZP7A 2W9CB 1F57A 2CZ9A 1FF2A 4NLSA 3NNAA 3K8VA 4YB1P 4G65A 4UA3A 3ZZTA 3NCPA 2W7OA 1RT6B 1IBCB 4CO2A 1YKWA 1J2VA 2JFKA 1WF2A 4I7FA 1DBDA 2DXFA 2R7UA 3BO2A 3VWDA 2EFGA 2M88A 4ZVHA 4NJRA 4NX9A 1NO8A 4TKTA 1FTRA 1KQGB 3X3UA 2MKIA 5J2MA 1G2EA 4QBUA 4Y2CA 1X4AA 3G8TA 2B56A 2E66A 3IWNC 4UQGA 2EUIA 4C8ZA 3J7YI 4UOCA 2V68A 4X4PA 4ZS6A 4PWDA 2G1DA 2DPJA 3W2WA 2V2QA 5HMYA 3IWXA 4H4KC 3PKMA 3M8QA 3EM1A 2MZRA 1WTFA 2G0BA 2PJBA 5CH7B 1CULA 3DNCA 3FMWA 5J2PB 3D1QA 3P6YC 2OO4A 1SI9A 4HR2A 1RTIA 4EMEA 3NH8A 4FDFA 3H40A 4YWYA 4EUVA 1L3KA 2GHVC 2ACMA 4HACA 2ZBIA 2UVVA 2J9DA 4JI5F 3B4DA 3QRQA 4AB7A 3NS7B 2LFVA 3EXYA 3DXSX 2QEXS 2XYGB 3OUYA 2K5TA 2ZW5A 4ZY2A 2CJKA 2B9EA 3OHAA 1WC5A 4M8LA 1XMBA 4CLZA 1WOOA 2MKCA 1IYKA 4CM2A 1XERA 2AWZA 2ABYA 4F4KA 1FRJA 2DCLA 1MW7A 2HQIA 2KJVA 1FRXA 3Q8QB 1Y10A 3Q2SC 4C0BA 4I49A 2WSEC 4CLPA 3K58A 1XK8A 1BQXA 3R2DJ 1NHKL 4FF3A 3GFYA 4LF5J 2Z10A 4P72A 1X31C 5E3AA 1JLAB 1TVRB 4PG7A 3EPIA 1TL3A 5H9FJ 1DQ8A 1XBUA 4RLEA 4DQIA 1DARA 2LXFA 1T3NA 3J7ZT 3PB6X 1NU4A 2RS8A 3CCTA 5H9EJ 3AA8A 3CCSS 3MTKA 4ECYA 5FLXY 2DNZA 2XMTA 2DH9A 4A8SA 4DUYF 2GAGC 1D9AA 3CPWR 5LL6d 1UWYA 2AJ4A 1TKHA 2NPFA 2HLTA 4WYWA 2ALZA 3CPAA 1C0TA 2P2CB 2VXKA 1HBUB 1Q53A 4DV6F 3HM9A 1CC8A 2B9XA 2XY5A 3W1YC 1SXLA 3QWPA 2FY8A 1F0XA 2MJNA 3QRPA 2HNDB 4NMLA 1F2OA 4U8YA 1SCJB 2CJQA 1NH7A 1FY7A 1B3TA 3NGTA 3PIOQ 2W9BB 4FF4A 1MWQA 1GMWA 1OQ3A 1T9UA 3Q8PB 4AQYF 4KGXB 1YVOA 5J2NB 3GV5B 1REVB 3UR0A 4F3MA 4WXWA 2AFMA 4P75A 3DLEB 2CFXA 1S1TA 2HZAA 4DCOB 2HAIA 3FCHA 4CLKA 2E9TA 2IRXA 4TNUA 2ZM6F 4FXWA 1RHUB 3BJ7A 4C0OC 1VYAA 3C15B 2R7OA 4ELTA 4LR9A 1CJKB 5D3GA 4K3NA 5LXYA 4P4EA 2ZOFA 4XK8C 4IQXA 1T05A 4C8OA 4I2QB 4A2ZA 3TJAA 3EWGA 4BS2A 3DDNA 2XMMA 1N48A 1U1OA 2MQNA 4IO1A 1JIHA 4A38A 3LP1B 2LQJA 2H51B 1KUXA 2YPZA 2I38A 2QMWA 2BE2A 1HR0F 3ONQA 4M85A 3N6MA 1TL1B 4QPTA 2ZOGA 2GE3A 4MFQA 1SC1B 3NOGA 4MAKA 7FDRA 4FYYB 2WBMA 2RMLA 3KLEB 4CDIA 4NA2A 1HBOB 2YNCA 3IC1A 2HQFA 2ZEPA 3JSRA 4ZPBA 5GAGU 2H5IB 1VHEA 4UWJA 1SJQA 1S77D 1JLGA 2FIWA 5ITHA 5E3QA 4DV7J 1CJWA 4NXMJ 4F7VA 3TEHB 1N5YA 5FJ4A 3AB2B 2O5DA 4DV1F 3RB3A 1CULB 3V81A 1T7PA 3R5AA 2YKPA 4B11A 4RL1A 2QLJB 5FD1A 3FFIA 1XC9A 2ZITA 1OWXA 3W62A 2H5EA 3A4TA 4KPYA 1HYSB 4ZA1A 4C8MA 4EO8A 4B9VA 4KJIA 1S3ZA 4NXNF 5I3QA 4JXRA 3BGFA 2ZJPQ 5KG2A 2R2TA 1S5ZA 3L2NA 5GAEU 4P52A 2ZEFA 1F5CA 3AQOA 3F41A 4IRCA 4Q0BB 1HW9A 4WZQA 3HKWA 5AE3A 1Y00A 1M1DA 2VQFJ 3N79A 3G96A 1EZZB 1Y7RA 1Y5NB 1RADB 1BQMB 1VQSA 1YX2A 1KZFA 3EVWA 3UN3A 1BOBA 1IBLF 2LA4A 4U9YA 2B6AB 4GVLA 2B8QA 4RWXA 3FB3A 4P2SA 2DGSA 2NQPA 5AG6A 2ZC4A 3TJ8A 3KNGA 5KFGA 2HHWA 1S48A 1TL3B 3WC6A 3NWGA 2I00A 2IA0A 3TE4A 2UUAJ 4L72B 3D6TB 3Q89A 1K4JA 2LU2A 3NCRA 2KG0A 1YJ7A 3LW5C 1B99A 3W7BA 4A30A 3WC2A 1VRQC 4M5IA 2VUGA 4YR0A 1VCTA 1T03B 3J7A1 3G3SA 3F0AA 4GXHA 2R8GA 1V3SA 3O44A 3BYRA 2XSFA 4ZX8A 2V77A 3IXQA 2PC6A 2YWWA 1XMQJ 3KHGA 3ILJA 2YKAA 1T9VA 4B9SA 3MECA 1KVKA 3FNCA 3M8ZA 3DI6B 2ROGA 3QBCA 1IIDA 3K5OA 5BR8J 2XTJP 3GSIA 4U95A 3GCWP 2BMBA 3UN5A 2DB1A 4TYBA 1M44A 2QLWA 3MWBA 1TMJA 4GMKA 4QU6A 3SJFA 1RWVB 4AVBA 3CCUS 1S1TB 1JMTA 2QVPA 2O4HA 2AZ3A 4YOEA 3QNVA 2AGQA 1M5KC 2Z30B 4KGZB 4WIQA 4ID8A 4RW8B 1I94J 4CLWA 3PJWA 4JI2F 4Q8FA 2Z3PA 1DTTB 1N6QB 3LPYA 3VVTA 2KYZA 1YSJA 4RNHA 4JP8A 3V6JA 2YKNB 3T5KA 4KY3A 1N33F 1S9EB 3L7OA 2ACYA 2DD8S 4ZVUB 1RHQB 3DGVA 2ZHOA 3S9NA 5J2QB 1APSA 3GJTB 4IK2A 4OZ3A 4RI1A 4F2RA 5FDLA 3VHQA 4XPDB 3BDPA 1S9GA 3BGLA 3DOKB 3WT4A 1JKHB 1DJ0A 5CZVA 4TXSA 3SI0A 2VB6A 3NE7A 2NLWA 4KLWA 2FSRA 4OX9F 4PXCA 4LQGA 3PR5B 2QSFA 1Q7LA 4EEYA 2JEJA 4OHVA 4ECUA 4KOYA 3JB9k 3SCKE 3J7AN 4MFLA 2ZUGA 2HQYA 5J1EA 2BUEA 4IFYB 2ADCA 3H5XA 2YTCA 2F1FA 4NLGA 1YLEA 3KLHB 2HHTA 1QSNA 3H8GA 1U48A 1S7HA 3CTRA 3VQSA 2OI2A 2AYGA 1RBOB 3DDIA 4M6HA 1SC6A 2R4FA 1S0OA 3G6VA 3MR5A 3FFIB 1RP5A 3FGVA 3H25A 3FBBA 2IM2A 1VFJA 4B3SJ 3IWEA 5LYFA 4Q43A 1RT7A 3AOAA 3E0KA 1NMEB 3UCUP 2Y8WA 4NCBA 2AJ0A 4M6IA 4I67A 2ZW6A 4DG1B 4P2MA 1KHWA 4LF7F 3SCLE 3FCVA 3M9OB 3ZTSA 1PJ5A 2K7JA 5JXSA 2HVEA 3VAFA 4OZJA 2B4DB 5DGBA 1NAQA 1EETB 3TW0A 2E29A 4NZ7A 3THPA 2VQEJ 1UVNA 4JJXA 1VJQA 1OYEA 2VPWB 1JK9B 4J5OA 3Q23A 5BYRA 2RC4A 4NGQA 4J7CA 3LODA 4KKOA 2BM1A 5AJ3J 3GCXP 3HKZD 4B5PA 3ZTRA 3OFEA 3E51A 4B3SF 3QB8A 3HLUA 2C2ZB 4WFZA 4NI2B 5F47A 5L39A 1FNMA 1KUVA 3I1UA 3K2YA 5M2PA 4OI6A 3SI1A 2W01A 1SPBP 3KJVB 4GRSA 3QAYA 1RTDA 1B70B 2B8PA 1GX5A 4MCRA 1NPRA 2EEYA 3PBEA 2JEFA 4R9MA 4UTGA 1TUGB 1TMMA 3CDXA 3PEJA 3V6HA 4YU9A 2VA3A 3V4MA 2ZEGA 2HHUA 5F8JA 2A2DA 5CABA 3R9GA 2E9ZA 4K50A 2B5GA 4ZDNA 3SEOA 3ZXWA 5ETNA 3T9NA 1JWQA 2JH3A 2MDAA 3GIKA 2J8MA 1V3ZA 1DLOB 3C3LA 4KH1B 4PYAA 4H4MA 4W9YA 1HMVB 3PB4X 4FYXB 4U5YA 3LAKA 4BWJA 3EDRB 3E8OA 2B4VA 3DRSB 4NRTA 5DDOC 2PR1A 1R8PA 2A10A 1HNZJ 1RCOB 3RB4A 3IU1A 1N32J 4DV4J 1D8ZA 3LA0A 4B6ZA 5LM7E 2ZNYA 3UD3P 4X65F 1FRIA 1BLLE 1F2HA 4OJGA 4XPKA 1ARMA 2KVIA 2W7PA 2BE9B 3CE8A 2CXAA 3N6NA 1QE1B 1N36F 2BYCA 3SSSA 1XFOA 1U7LA 3TZXA 4DV3F 5F8LA 3ISXA 1F1BB 4OYAA 3FH4A 5IOLA 4UWIA 5D77A 3OVAA 5HQLA 3C66A 1VQ9S 4I6YA 1AFIA 2M8DB 4MHDA 1QMUA 1TK8A 3ZZIA 3JRUA 1FJGF 1ZOTA 5HROB 2OU2A 1BQNA 1F3VA 2ZH6A 1XIQA 2YNFA 1LRZA 5CCLA 3NXZA 2F3JA 3J7Z5 3LGNA 1TKZB 1O5JA 1UJ5A 3DLGA 2VPYB 4TY8B 2A3JA 1H2UX 1WUUA 3KHRA 1IR0A 4ECTA 1WEZA 3V4IB 3C46A 2D69A 4DQPA 4KZTA 3C6TA 1X9SA 3KDOA 4Y2IA 1VQLS 3G2XA 4NLQA 4DR4F 4MRIA 4OYWA 1RWXB 2RVJA 5HH1A 2YPYA 3IM8A 2W2PP 1XBWA 2RD5C 1YZ6A 4RNNA 2AGPA 2PJ9A 1M4LA 4Q45A 4XO0A 3KR4A 3AOBA 3PFOA 2XMUA 3VGSA 4WP8A 2ZEJA 1VQNS 1S4EA 3LPEA 3C6TB 3UE2A 2R8IA 3FDSA 1HPZA 3D2PA 1RYSA 1CJTA 3K17A 5DJBA 2VI7A 1I21A 1S6QB 1IBKJ 2XHCA 3MM9B 5LRJA 3TO7A 3S6EA 1YK9A 1OIAA 4PKDB 1AROP 3AB4B 4NCGA 1X8DA 4LRCA 1LWFB 2XMAA 3NCQA 4TVAB 2RDJA 1JJCB 3NA6A 3L7UA 3QT6A 1YQEA 1IKVA 2GHWA 1UZDA 4ED8A 2DGQA 3H5ZA 3IFEA 4L3NA 1NB7A 1WC0A 4PXDA 4ZIWA 2RFHA 3TOAA 3DLKB 4M95A 4DS4A 4CLUA 4MY3A 2YX1A 3CW2C 3P3DA 3G6YA 2AQ4A 2VFTA 5JJBA 4DMZA 1ZM4A 1RSCA 2XEXA 1K73T 3I0SB 1MSWD 4FYWB 2RDDA 3KK3A 5K8NA 1EIYB 5CYQA 3DLHA 3IG1B 1NK9A 1IQTA 2QA1A 4ED0A 1BPMA 3GJQB 3TA1A 4LREA 1WG5A 3FJ2A 1RBLA 3C6UA 1S12A 4KHPJ 1W2BR 5ELYA 1MN9A 1CSJA 1XR6A 3KJVA 3DRRA 3OR1B 1AB8A 2BKNA 2XCAA 3CJ2A 1ACMB 5GAGI 1NH8A 2JVRA 1YITS 2OD4A 2H9ZA 3BSCA 4FKXA 5GVQA 4KOTA 4RUCA 3KK3B 1T3OA 1N0UA 5KT3A 4PG8A 2OUGA 4HH1A 4I2PA 2XG8A 1FD2A 3TZYA 2PJ5A 2A4NA 3I4PA 2AEFA 2Y1JA 5IM0B 1IKWA 3WQPA 1N8RT 4I69A 4X4OA 2N4DA 3DRRB 4A8QA 3FUYA 2JWNA 2G3TA 4IH7A 4LBIA 2NR0A 5KFCA 4OHWA 4R8UA 4GKJJ 4CYUB 5H84A 5KG0A 4IF5A 2UVUA 4HL9A 2LQ5A 3HHKA 2P8IA 1S10A 3ENQA 4CLTA 2HS3A 4B9TA 1IY7A 4MK7A 5DDQC 1O8BA 4WTOB 2CJ9A 4KO0A 2UUWA 3R97A 4Q8EA 3GR0A 8RUCA 4OLLA 3M1VA 3R96A 3RR8A 1R8CA 2ZOMA 2Z4PA 2IIHA 4OQJA 3BREA 2RNEA 4F36A 4PG4A 1T94A 3HD1A 1NDPA 2EPIA 2LECA 1PG5B 2WVFA 3GFXA 3VCDA 4NXMF 1XRYA 4NEYA 3CCLS 3K8WA 4WE1B 1I5OB 4G6VB 3OFGA 4FKYA 4ILRA 5DS7A 2CPJA 3PW2A 2R2RA 1RWPB 4GO5X 5HROA 4CS0B 1TP7A 2JC0A 2ZBCA 2KH9A 4WTYA 2C3PA 2FB0A 1PUAA 4P7VA 4DFKA 4G3IA 3RRKA 4ES2A 2R7VA 3TAMA 3PO4A 4FYVB 4JB8B 1B0TA 3I56S 3VTIA 3EJMA 4UCPA 3RBZA 4DFJA 2Z3LA 2D3ZA 4NEZA 1KQKA 3RG6A 1EB0A 2UUBF 2XI2A 3NAHA 1YR0A 2BJ8A 1K8AT 2JEWA 5DWNA 1RAIB 2HNZB 3FC9A 4EZ9A 1MJAA 1UFKA 2GLJA 1OZPA 2BA9A 4TNOA 4U7CA 5LRKA 2XHWA 2XZDB 1NK8A 3UN2A 4AXVA 3HZEA 2ZD1B 4KT0C 2PRQA 1XR7A 4K4WA 3EDQB 2Q7SA 5A8KA 3RAQA 1QSYA 3MGJA 2BABA 2VJUA 2HAFA 2UUAF 3VGTA 1B7YB 3GY9A 2N7CA 1SUQA 1G6BA 4ZX9A 3A13A 2VBYA 3G8SA 1PYSB 2V9WA 4MJKA 1Y0YA 1K44A 2BJEA 3C14B 4HI1A 3JAMY 3HSJA 3CULA 4C98A 2CQHA 4PWDB 2DIUA 3SFUA 1S4FA 4ATNA 2JBKA 3OTDA 4FNHA 1V9OA 4ZKAA 2RJZA 2YKOA 3K5PA 3BGOP 2BJDA 4D3HA 2I5JB 5DM6Q 3FMCA 4CAXA 5AGEA 4ZPTR 4H4OA 1S0MA 3Q2TC 4KFBB 3C14A 1P1LA 1GX6A 2OZGA 2V5HG 3LAMA 3HVAA 4FBUA 4I0WA 2R8KA 2NXNA 5HLFB 4OI0A 5C42B 3CO9A 3SBMA 1V3RA 4K4XA 4L89A 1U2CA 5KFXA 1EETA 4PABA 3K0JA 3W8GA 2YWHA 1BAVA 4CO3A 3OQ2A 2AFSA 4CWBA 5K8MA 4X4VA 5C88A 1HQEA 3D67A 3WR7A 1TIQA 1TKJA 1KSPA 2XSJA 1RWUA 2FD2A 5J1QA 1ZPVA 4NL5A 4GKKF 1ZG8A 2FL4A 4W92B 2VOPA 3PJ9A 1TU0B 2RRBA 2DXDA 1OMSA 9ATCB 2WCXA 4PPDA 2OTLS 2I6WA 2W4CA 1IOIA 4GVBB 4JI3F 4FBTA 5AT1B 3K9UA 3FVYA 3CPXA 2Q66A 3D7DA 2ZWPA 3FQKA 1GYTA 3KOAA 5DQIA 2WB1D 2YX4A 4ZN3A 1H2VZ 4ED5A 4JI1J 4QJVA 3TUJC 3V2UC 1Y9KA 1U8SA 2AJ2A 3IN5A 3B35A 2ZKTA 3I9V9 3HHLC 3U1NA 1RT3B 4HHHA 3AD8C 3M8PB 4LSZB 3RRGA 2PMZD 5LYDA 3C16B 3OR2A 4OV6A 3IWGA 2L9WA 4UCMA 1EARA 4DR6J 2ZZMA 3U02A 4UF4A 2PDOA 1RTQA 4JI4F 5IS2A 1D9FA 1LW0B 4WK1A 1QUPA 2CNSA 1M0SA 1MMLA 4M5DA 3SFGA 1QSRA 4DX5A 4M5KA 1HFEL 1T9WA 4MT1A 2HIQA 1S9EA 3H0PA 3PX6A 2HB6A 4DLGA 4NGTA 2GVDA 4MYUA 4TQSA 1FNOA 3TX8A 1QJHA 1RAFB 2OD6A 2YWEA 4FF1A 1RQ0A 3GKRA 4NSQA 5KFSA 2YXLA 2V34A 3QYYA 4RW7B 1VHOA 5BXIA 4J9OA 5HXDA 4DV0J 1D09B 4EMDA 1T05B 1T9YA 1TTHB 3QZ7A 1FT8A 3R5GA 4QR2A 3M2RB 3KL9A 1XEBA 2CTCA 1WD6A 3FZBA 4USHA 4Z7YA 3SI8A 3DKDA 5CYMA 4DUZJ 1PO6A 3BQ1A 2LDIA 3LP1A 5IC6B 3PZJA 1ZZNA 7CPAA 2KG1A 3PV8A 4F0XA 4F4AA 4IKAA 2MHNA 1P0HA 3D8PA 2CQBA 4RS2A 4OHZA 4FPRA 4CAEA 5E41A 2BX6A 2HK2A 2V94A 3GWCA 2QZ8A 2ZELA 2XLJA 4CGLA 3CCVS 3NGUA 4JI0F 1Z2LA 3AA9A 1CBKA 3MAAA 4OAEA 5D0RA 1CQNA 2OFGX 4M5LA 2CNLB 2DEAA 2ZH2A 3QSYB 3J7YU 5A2QU 1IVZA 1LK7A 3KLVA 1C1CA 1T8EA 4WP3A 2CF4A 3BI0A 3M9MB 5DM7Q 2C28A 3MCSA 4S0MA 4USUA 4ZVSB 1LAMA 2QJ8A 4ZHRA 3GIMA 3G71S 2KM8C 4CT8A 5KFDA 2RE1A 3D4UA 5E7OB 1N36J 1Y3KA 3IMQJ 2RQCA 2BW7A 2OH2A 4AVCA 3MR3A 3BXMA 5F9LA 2F65A 4R0EA 1MU2A 1S6PA 2VFRA 1FFGB 3OHBA 1H7XA 2QMUB 2FVCA 2HG4A 2X1AA 4OX8A 2HVHA 4B5PB 3W3SA 3WC7A 2C6PA 2UXCF 1HNIA 2UXBF 1DZ5A 4X84A 1IKVB 2HRTA 4CLSA 2YNCC 3KASA 3JXOA 3L7PA 1IWGA 3HT3A 2CG8A 4YHHJ 3H59A 2CPXA 4UFWA 2QE5A 4JV5J 2BL1A 1JB0C 3PACA 2D3O1 1BQMA 3BV8A 1CQMA 2A0FB 1V5IB 1SJFA 4P2FA 4HDHA 5GADU 3GE9A 1C2PA 4HNYB 3BO3A 3M8YA 4JXQA 1HNIB 1M5HA 1R0BG 5MAOA 4ELVA 1AZSB 3ET6B 3RJMB 4NYZA 2J9AA 2J0WA 3W2VB 4RNMA 1XMTA 2HHHF 1RAOA 4YFUA 3J80U 1U09A 4P6QA 3BPDA 1S1UB 4Y00A 5HMWA 2WHOA 4OHXA 2B9WA 3OL8A 2ZH1A 2PRBA 4DX8H 1ZG9A 1FCAA 3IP0A 4M63A 2O28A 1Q7YT 2GGPB 4AE5A 2YWGA 2PGCA 3MAQA 1R7IA 4RX6A 3DR6A 1WELA 2L48A 2XO7A 2XWYA 1JLQA 3PO5A 2LQ8A 2EVZA 4WWSA 4M5JA 1U1RA 3DLBA 2F63A 3MPVA 1T02A 1RWWB 2N4CA 4YDXA 2VHGA 3B3CA 4NGSA 2QTWA 3MMAB 4M5DB 1WSVA 4EYIB 1ZO0A 3V7ZA 3D1OA 4NXYA 1RUSA 3W5YA 4X64F 4KV8A 1TQLA 2MZQA 4QB9A 4KOXA 3HX9A 3TTHA 4H4MB 2AHOB 3A3OB 1RTHA 3J80Y 2QFIA 4NYOA 4OL8A 2L3MA 4DX7A 1KN6A 1KFSA 3WX4A 2HSEB 1P6TA 1QVFR 1YZ7A 1R43A 4HHUA 4U9RA 4ED3A 2JEGA 4O4RA 1CLFA 3DMJB 3D0GE 1U1MA 2IM0A 4YP3A 3LP0B 4H89A 2VIHA 2B5JA 2J6UA 5G0RA 2W24A 4QR0A 4PCQA 4A33A 4DUTA 6AT1B 4UIAA 4BHQA 2D3UA 4HNWB 4K4YA 1AMPA 2CKWA 3BB5A 2CTBA 3FEZA 2VZZA 5D4LA 3EZUA 1IR1A 2C3MA 1HWJA 4QWEA 2DK2A 4OMEA 5E3PA 4KOVA 1TK5A 2MLXA 4XTTA 2PIIA 2MKHA 2GO9A 3OFHA 5B0CA 4CTAB 4DU8A 2R7RA 3AJ2A 2O1PA 4IRKA 1DQ9A 3RUBL 4JI5J 2RSQA 1YVFA 1OBRA 1KRPA 3OPKA 1Z8WA 3M6UA 3BSAA 1KBRA 3V6DA 1QAIA 5C5JA 3L95X 2XLKA 2Q51A 5A8KB 1Y5LB 2OOTA 3PNIA 2DGWA 1NSAA 1Q95G 5DDRC 4UZCA 5E2QA 1N88A 4LFAF 1CX8A 2D4PA 2BJ3A 3T9YA 1M4DA 2C27A 3K59A 2M8HA 1WHXA 3CMAS 1VOMA 1Q5VA 4PV6A 1RDRA 3I4HX 1YJNS 1KR4A 4H4KA 5HAOA 2J76E 2CJYB 3AAWB 2Y1IA 2CPFA 3SXLA 4C48A 4B12A 3MAHA 3H8FA 2WUUA 2VDHA 2IC3B 3A1YG 3R5CA 1JLBA 1HR0J 3NKYA 4O3SA 3MXHP 4MI4A 2XEIA 4PK2A 3D7HA 1RHJB 4WWVA 4AVAA 4USJC 4BMHA 3Q8UA 3HLPA 3QFWA 4P6YA 1F9EB 2MQOA 4BD9A 2K1RB 3TFYA 1KLMA 2E1MC 3TQEA 3HK2A 4KB7A 2Y1RI 2CDRB 5D6GA 4WFBQ 2WSFC 4ZYQA 2PFDA 1M4GA 3US5A 4ECXA 2MGZB 3UWTA 1SIZA 2O66A 1H0HB 2ZHBA 4ANDA 3MCOA 2GJIA 1LOKA 2DGTA 1HA1A 4NMXA 5ETKA 1TFWA 5BYSA 3MHYA 4KSIA 4XPDC 2ZHAA 3TZWA 4CP5A 2FXFA 1TUWA 2W2QP 3HJFA 1FDBA 1VLOA 5F0WA 2Y3YA 3BH7B 4JI7F 1F3FA 1S79A 1A2ZA 4DR7J 4Z2XA 1QVGR 3QFHA 1MROA 3HP6A 1M5OC 2C6CA 4LF6F 5EMIA 2DR5A 1WWZA 2E44A 1RTJA 2K3IA 1BPNA 2JVOA 3N01A 4BC7A 3CJ8A 3NH5A 4LIWA 4IUFA 4ZVOB 1XOVA 1JJH