5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amidase, hydantoinase/carbamoylase family
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
4EFDA 3VARA 1NSAA 2ZEHA 3HUVA 1YW6A 1TKJA 4R8FA 3GLJA 4NGMA 4ZYQA 4UIBA 3H8GA 4OMEA 4NJQA 4A39A 3CT9A 1KWMA 3D4UA 3IJ3A 2EWBA 3B3SA 1VHEA 3CPXA 2ZEMA 4P10A 1VIXA 3WC5A 4YWYA 1DTDA 2NYQA 2PRQA 4JYWA 3VATA 5K8MA 1LANA 2POKA 4P4FA 1LFWA 3KR4A 4KSIA 1F2PA 4GM5A 1Q7LA 2AFMA 3KQXA 3KQZA 4OKOA 4FWUA 2Q51A 3H8EA 1TF8A 2RB7A 2J9AA 2O4HA 2AFXA 4R7MA 3B3VA 4A38A 4EMEA 2XEGA 1CPXA 5LRGA 1JQGA 3IC1A 2ZEPA 5THWA 3JRUA 2CIJA 3BI0A 2JBJA 2BOAA 3V7ZA 3NA6A 4R6TA 4P6YA 1TKFA 4DJLA 2PJ1A 5HXDA 1TF9A 2PJ6A 3D7HA 4OC3A 2PJ4A 2ZEOA 5F09A 4G1PA 5CBMA 1LAPA 3NH8A 1AYEA 2AFWA 3K2KA 3FMCA 4FUUA 1GYTA 3BHXA 1Y7EA 4MCRA 1HEEA 3KGQA 2ZEGA 4YU9A 3RAMA 4MRIA 3FEEA 2QVPA 3PEIA 4RUHA 1TXRA 4ZY0A 4Q7AA 4FBEA 2PJCA 4P4IA 4X8IA 3CDXA 1ARLA 4P4DA 3V38A 5HVGA 1FT7A 4P4EA 3B3CA 4DUKA 3PB4X 5D29A 2GREA 1M4LA 1Z5RA 3WC6A 2RFHA 3KASA 1XFOA 1Z2LA 4PXDA 4F9VA 5K8NA 2OR4A 2EK8A 3PFOA 3GB0A 4NFRA 3IIBA 6CPAA 4F9UA 2C6GA 3PB7X 3RBUA 3PBEA 2PE3A 1LCPA 2C1CA 2CTCA 4H2KA 4PXEA 1ZG9A 4MCQA 4WWVA 1BPNA 3WC7A 3FEDA 4IHMA 1VGYA 3H8FA 1OBRA 2CF4A 2JEWA 2OOTA 2ZOFA 4P4BA 2PJ2A 3TC8A 1QMUA 1TKHA 2O53A 4MHNA 4UEEA 4PQAA 3PB9X 3S9MA 2PJ9A 2BO9A 3LMSA 2QYVA 2IMOA 1ZLIA 1AMPA 3QNVA 2PJ8A 1CG2A 5I4MA 3CPAA 4F8ZA 1VHOA 2PIYA 2ZEDA 4MCSA 3VH9A 1ZG7A 4WJBA 3PRTA 2PJBA 3B3WA 4K3NA 2XEJA 4O23A 2AFOA 4ZX8A 2GLFA 1R43A 2Q4ZA 3FECA 4NGSA 4P4JA 4NGPA 4NGNA 5HVHA 4IAVA 1IY7A 3GUXA 5J1QA 2AFUA 2GLJA 5K8OA 2ZEEA 1PYTB 1CPSA 4UIAA 1YSJA 2PVVA 3ISXA 5CPAA 2F8HA 1BPMA 2PJ3A 1RTQA 3D66A 2ZOGA 4CPAA 1XBUA 4Z65A 3IO1A 5LYLA 1CX8A 3SJFA 5HVFA 3MRUA 2PCUA 3SI2A 2FVGA 3KZWA 3IEHA 5ELYA 4NJRA 1HDQA 2PJ0A 4PPZA 4OC0A 1QQ9A 2PJ5A 4X2TA 3KHZA 2PJAA 1IGBA 4MHYA 4UEZA 2AFSA 2ZENA 7CPAA 4R76A 1ZG8A 3FVLA 3IFEA 1BAVA 2V8GA 5LYDA 2BCOA 2ANPA 2ZEFA 4NGRA 4A37A 3MN8A 3PBBA 4MMOA 4P45A 1ELLP 3D7DA 5K8PA 5LRJA 1LAMA 2ZELA 1XRYA 4OC5A 2VL1A 1Z8LA 1HDUA 1DE4C 2QJ8A 4A94A 2F7VA 3D7GA 3DGVA 4MXUA 4W9YA 3TX8A 1ARMA 1CBXA 3T8WA 3K9TA 4AXVA 2XEFA 3B35A 1Y0RA 3IWWA 4ZY2A 3KI9A 1YMEA 3PB6X 1FNOA 2JBKA 3D7FA 3FH4A 3PB8X 2V77A 3RZAA 4TNUA 1Y0YA 5LYIA 3DLJA 3HLPA 3B7IA 4JZ0A 4ONWA 1LOKA 1F2OA 3SJGA 3FJUA 4LQGA 5LYFA 3I1UA 5LRKA 3FF3A 4X3RA 4DYOA 2V8HA 2EK9A 2Q43A 1XMBA 2NSMA 5JGFA 3SJEA 4P44A 1ELMP 1EE3P 2WYRA 2XEIA 4NGQA 4ZY1A 2WZNA 4OC1A 1YW4A 3PFEA 3SI0A 2I3CA 1ZLHA 2V8VA 4MHPA 3WABA 2DEAA 3D68A 4OC4A 2C6PA 2PIZA 4UF4A 2C6CA 4PXCA 2CTBA 8CPAA 1UWYA 3NFZA 1BLLE 4MCPA 3S9LA 3ISZA 4B6ZA 2V8DA 1CP6A 3WT4A 1F57A 1PCAA 1R3NA 4OP4A 4OIDA 2PJ7A 3S9NA 3NH4A 4EWTA 3BXMA 2AFZA 2G9DA 4OIWA 5DS0A 4ZI6A 1XJOA 3B3TA 3KHXA 3SI1A 3SJXA 2IJZA 4MHZA 5JH9A 5JM6A 4ZX9A 2GU2A 3LWUA 4NGTA 1H8LA 3D67A 3N5FA 3L2NA 3BI1A 3KR5A 2IQ6A 3NH5A 1YLOA 4IK2A 2HC9A 3B2YA 4OC2A 4BD9A 2ABZA 2HB6A 4UEFA 5D8NA 1CP7A 4FAIA 2PVWA 3FX6A 5IB9A 4TWEA 3KL9A 4PXBA
chains in the Genus database with same CATH superfamily
2IM1A 3VARA 4B12A 4NMXA 4O3NA 2KDOA 3OW2R 1S0VA 3FJ2A 4ZPDA 5GAEI 1KWMA 4DX6A 2C2KB 1HBMA 4B9MA 3B3SA 1VHEA 3CPXA 3VAMA 1S76D 4OLPA 2LXIA 2GMJA 2C3YA 4OJ1A 3PO4A 2R8KA 4HKQA 1HMVA 4LREA 4WXOA 2B5JB 4C8LA 1AA1B 1FDBA 2GVZB 1UFKA 1M5OC 2RKIB 3CVKA 4XO0A 1Z8XA 4FKYA 1IKVB 5BR8J 1HKAA 1WHYA 3DLEA 2FY8A 3A8JA 4M5HA 3W64A 3DOKA 1Y10A 2LEBA 1ZPWX 3KK2A 3EM1A 4GC6A 2PO4A 1GFWB 3MEDA 2C3UA 2HEKA 5LJ5Y 2F8EX 2IJFA 2LQ8A 1AROP 3ETMA 3MAHA 3Q8YA 2RRNA 5J1NA 1Q8LA 2MTLA 2ROEA 4QOTA 4ZGYB 2XQCA 3O3LA 2HZVA 3POTA 3C26A 1KRPA 2DNOA 4EVYA 4JP8A 3DRYA 4DL5A 1SH0A 1MJ9A 2HYIB 2V9KA 3H4QA 4P7VA 2XNQA 1FT7A 2PQ8A 1RHMB 1HWLA 2XG8A 1B4SA 3GJSB 1SUQA 3HJVA 1Z2LA 1N56A 1RT5A 2CQCA 1SV5B 4DX8H 3ZZTA 1RGVA 3HHEA 3QJPA 4M94A 1UP1A 4LVOP 4CGLA 1QE1A 2QE5A 3PR4A 1JLFA 1ZYQA 3UDEA 4QBUA 3X1LB 1XMOF 2MHEA 1I12A 3QZ7A 4B3SF 2KJVA 2JEWA 1TL1B 2HVDA 4WTOB 1HNVB 4JI2F 5L1KA 1S9EB 3HT0A 1DQ8A 5KFLA 5M2UA 4RW8B 1GTHA 1N34F 5EDWA 5DM7Q 4G6VB 3DRXA 4HI1A 2QYVA 1U2FA 4LSNA 2DVIA 2WCXA 1Q82T 1RABB 3ZTSA 1FXRA 3QFWA 1YX0A 1ZH5A 2VF3A 2BVZA 3TA2A 4ZX8A 1LK7A 5E3PA 4ENOA 4ILMA 2F40A 4DUZF 4NGPA 4RW6B 4L89A 3RR7A 3AJ2A 2JX2A 3H5ZA 2V94A 2XSJB 1UEVA 5D15A 2E1PA 3GU0A 1T9UA 2YKMA 4OYWA 4TYAA 5KFFA 1EETB 3SI2A 2FVGA 3KZWA 2OHDA 1J5OB 3DR6A 4F04B 4OJGA 3GYGA 3RYLA 3W8GA 4UEZA 2PR1A 3S8SA 2HFZA 2IRYA 5HQMA 2V8GA 1B0VA 3BH7B 4LRCA 2ZEFA 1AUGA 2E1CA 4H6UA 2ZEJA 1CQNA 2FS5A 1X5TA 3OL8A 1S1VA 3C14B 2M88A 3MR7A 1LV5A 1S7FA 1HBNB 3ILLA 3L7PA 2GIFA 3WC0A 1FE4A 5D3GB 2G1HA 4B9NA 2UU9F 2A3JA 2EG2A 4IO9Q 2ZBIA 3I5BA 1YMEA 3NGRA 1FNOA 2FB0A 1U8SA 4KR0B 1GXUA 1RWVB 5DJBA 3FUYA 5KFPA 2BJEA 3N28A 4DV4J 1UPPA 2HNDB 2WVBA 3J7Z5 3Q0AA 1IBKF 3LGHA 2Q43A 1MWYA 2HNYB 4O4RA 2HZCA 1RTHB 2E1RA 2XEIA 3VAGA 1BLUA 4ZPBA 3KK1B 5LMUF 3DI6B 3CCZA 3WABA 2MKYA 3LD2A 3EYZA 1HBOB 1E6VA 4K59A 2RSQA 4QPTA 1UWYA 2UUCF 2H48B 4KOSA 4IH7A 1OPZA 1KN6A 3CJTA 4M95A 1CQMA 1RACB 2RQKA 1WC6A 4OX8A 4ZVRB 4J3GA 5I3PA 5HJYA 3NEKA 2CQGA 4NRUA 4RJVA 4DWIA 2Q66A 1KFSA 1VQ4S 3SJXA 3MMBA 4V19J 1WD6A 3CJ2A 1I94F 3OVBA 4MIBA 1KQGB 4NGTA 2RT3A 2GE3A 2DTJA 3LQVA 3BI1A 1X4HA 3OSPA 4KE5A 4NOHA 1IXKA 3VWEA 1MK4A 1S1UB 3ADAC 4K4TA 3J7YI 5EX3A 5I3UA 1QAXA 3NWGA 3DRRA 1ON0A 4X62F 1VC5A 4R0JA 4XDDA 2MHNA 3IA0A 2GVDA 2L9NA 2MZ1A 3QSIA 2QMLA 4OMEA 3GP9A 3CCWA 3HMJG 2MZRA 2Y1RI 4B3MJ 4U9ZA 5F8GA 2EWBA 2VOOA 2WUUA 4DBQA 4F4XA 1IR1A 2WOMB 2NYQA 5IXUA 2RJZA 3KLHA 1UA1A 4YGOA 2YNIA 1YRTA 5A8RB 3PX4A 1X8DA 3ULHA 3D3SA 2YWFA 4WE1A 3SDEB 1TVRA 3TO7A 3OXGA 1RUSA 4DV0F 2F9JA 3IN5A 1CJTA 1X31C 2Z2YB 2C27A 1YVFA 5LXRA 3CJRA 3SV4A 3MPWA 5I42B 2OZHA 1CJUB 2R7QA 5KG1A 4ZA1A 3W91A 1CS4B 1HNXF 1XWLA 5KG6A 3CULA 3V7ZA 3W8PA 2W9CA 1MMDA 3D2MA 4DJLA 4WF9Q 1NSQA 4J9SA 3TJ8A 3OR1B 4G1PA 2LXFA 1Q7LB 2YX7A 5IWAJ 2PN6A 4KV8B 1VISA 5A6PA 4ALZA 4U7CA 3DOMB 2JOQA 5KT3A 1ITPA 2VEZA 2VG5B 3S6HA 3FQKA 1J2VA 2DGQA 4O44B 2QIRA 2Y9HA 5MLCV 2EFOA 4RW9B 2RE1A 3QIPA 4DQPA 4OIXA 1MJBA 5HI7A 2CJXB 3IRXA 5D29A 1F9EB 2IMWP 2GREA 3BO3A 1M4LA 1HHTP 1E6YA 1PUAA 4JXQA 1N48A 4WFYA 1YK9A 3R9EA 2RQMA 3CEDA 3EE3A 6CPAA 1RAAB 2WPXA 1TELA 2L9DA 3ZZIA 4Z37A 4Q0BB 1M1GA 2AT1B 2G3TA 1RT3A 1Z2ZA 2W8LA 2BW2A 3MGDA 3PZPA 3CD0A 3HO1A 4U9YA 4XPDB 3QRPA 1OBRA 4YY3J 3PZJA 4X4OA 3KUGA 1TKXA 3AXMA 3I3GA 5KT2A 4NXYA 2XBPA 4P6QA 3IR6B 2IMOA 4X4QA 2PJ8A 3FFIA 1Y9KA 2PIYA 4F8ZA 1V0CA 4R87A 1BQNA 3U02A 4MAKA 5B0FA 2C3OA 4WYLA 4K3NA 3NGTA 1GQEA 3G6VA 2CJ9A 1HW9A 2WRMA 2VUGA 1RTZA 5KAKA 1K44A 1N33J 4ZCKA 1RTDA 2HLUA 2MJUA 1U02A 4ZLLA 1U1NA 3P5BP 2C3PA 4PEOA 3NKYA 5RUBA 3IU2A 4ZDNA 1ZM3A 2IYIA 3RBDA 4WFAQ 3G9CA 2DBBA 3RB4A 1UETA 1HDQA 4C0HA 1VDHA 2XYHB 1JLCA 1HQEB 2KHCA 4KGZB 1C1BA 3A8IA 4OX6A 2HK3A 2FVCA 2OH1A 5IB0A 2VG6A 5ETLA 2QIFA 5KFYA 1FY7A 5A2QY 1R0AA 4I67A 3MN8A 2B3UA 4MMOA 1M5HA 3NAHA 1YQEA 3JSRA 3T1AA 4J91A 1T3OA 2XZTB 1CVJA 2CG4A 2J0SD 3PVXA 2VFRA 2JVOA 4JOUA 3R8YA 4M85A 4DR7F 2XO6A 5KFCA 1FK9B 2OKQA 4HACA 5HMXA 2RDIA 5C7PA 3NCQA 3BKFA 3UN2A 4QIGA 4RU2A 3H5UA 5EMIA 1JLQA 3NNHA 3P45B 2IRXA 3DLGB 1ZA2B 2UUTA 3TA1A 3FJUA 2DXEA 2MQ8A 3I9ZA 1FJCA 2R2SA 3IR7B 3J80Y 1QTNB 4R5PB 3MPUB 4QIFA 1Q86T 2FJXA 4QR0A 3CJ5A 1WF1A 4DPOA 2ZH1A 2I3CA 3CPWR 1T9XA 2V8VA 4AL7A 4KZTA 4F8RA 4DSIA 2ZNZA 3GFXA 1RT6B 1H72C 1LK5A 2B3VA 3L7UA 2RHSB 4L73A 2R7UA 1F57A 1VHIA 4KC5A 4P2XA 3GPAA 1FEHA 2FUG9 4K0KF 2FE7A 4WFBQ 2R8VA 4U7UD 3SCLE 3HHLB 3PM9A 4JBCA 4USVA 2H5IB 3D6TB 2KRRA 4LIWA 2QECA 3SI1A 1YWXA 1RU2A 4YR2A 1O51A 1YJTA 2HURA 4B02A 4A8QA 1S97A 2KB2A 2R2TA 4DQRA 4JI2J 5EWEA 3BGFA 2HFNA 3K8VA 1S9GA 2C28A 4UEFA 2FD2A 1MN9A 2DCUB 3OQ2A 1U6FA 1JNZB 4EYHB 1VBXA 4KOUA 1FNXH 1YW6A 3OTDA 3O44A 4BINA 1R8CA 2MPUA 2CXEA 4ZS6A 3TYTA 1FRJA 4P9SA 3IS9A 4A39A 2A18A 4ECZA 3U27A 1S6UA 5KFSA 1SJ3P 3BDPA 4LFCF 3Q8UA 1TL7A 1S49A 3VATA 2ZJRQ 2CJBA 3E3XA 2CQBA 1YHQS 3F8KA 1PBUA 3LO3A 3MMAB 5F48A 1A6LA 3RUBL 4UY8T 2F3JA 3ILIA 4PWUA 4B3RF 3H8EA 2GMHA 4OZ3A 3VZHA 1LFPA 2W01A 5KFKA 2E7WA 4MYTA 3M9NB 2AV5A 4OHZA 1DTTB 1YKWA 1T95A 1JMTA 2FLLA 3M30B 4DOZA 4AVBA 5F8MA 3BI0A 4DCOB 4E2AA 1MJAA 1YR0A 3ITHB 5HXDA 4B3TF 2FZCB 4TYBA 4USHA 3MCMA 5AG4A 5ETPA 4AXJA 1UVKA 1Y7EA 4JYAJ 3FNNA 1S0NA 3RB0A 4F4KA 1W26A 1Q8KA 1TXRA 4ANDA 2UU9J 1RZMA 2YKNB 1H7WA 3LP0B 4MFLA 1KKHA 3EX7B 4RWXA 4UCNA 7FD1A 4P4DA 1Y7RA 3NGUA 2UUAF 1SIWB 3NGKA 1ZAXA 3PW2A 5JPHA 2XMMA 3A13A 1FRLA 2GQ2A 4WXWA 3QT7A 2DK2A 1RISA 3PFOA 3VTIA 2EVZA 2REEA 3MZIA 2R8HA 1S3ZA 2EG1A 4B3OA 5A27A 4RBVA 3VV2B 1HA1A 2DH8A 1EJ7L 5I3QA 1WC5A 4F2RA 5HN0A 4DI6A 3PP9A 4RNOA 2KXNB 2E5GA 1P1TA 2PT0A 1HNWF 1U1PA 2GGPB 1FDDA 4QBJA 2B9XA 2H4YB 1Y11A 5LL6d 4JI0F 2UV8G 2HS3A 3VCDA 4L6V3 1NMEB 4X4PA 1ZLIA 1SH2A 5DETA 5HLFB 2FTRA 3MMCB 5DLFA 4JWPA 4UOFA 4JI6F 4CGMA 3NMRA 3GFYA 3C3LA 4ECXA 4KOWA 2XGQA 3JQMA 1IY7A 1RLDA 2ZEEA 1CPSA 1ZETA 4BC7A 2V0NA 2OGUA 3DRSA 4X5KA 1EZZB 1VFJA 2EFNA 1N5YA 3SJFA 5HVFA 5G4DA 1AZSB 3HDSA 4FS2A 4W4MA 2X7BA 1Y3KA 3MURP 4FXVA 1QQ9A 3KLVA 4A95A 4X62J 2ZH5A 2OZGA 2XLKA 3QWPA 4KPYA 4JV5F 4ZPVR 4DUYJ 2L9WA 1J5EF 3HULA 2MLYA 1M4IA 1KUXA 3AD8C 1LAMA 3EVMA 4DU8A 2AZ1A 3RRGA 1N32F 2IPOB 4KTQA 4AXIA 2QA1A 3DYAA 4WIQA 4USUA 4MXUA 4G65A 3TX8A 4PG6A 1NMTA 1XBWA 4AXVA 4B5PA 4CTAB 1XIXA 1R27B 2HBQB 2GNKA 4F6AA 4K7QA 4FYWB 2V67A 3Q83A 1N6QA 3FNCA 5HANA 3RZAA 4KB7A 1YRUA 2Z56B 1MN7A 2KRBA 3HF5A 4AVCA 3R6GB 1X4DA 3C46A 5AG6A 2ZITA 1UVNA 2PE8A 3KJNB 4KS9A 1EHWA 3U1NA 1EE3P 4KSFA 1R31A 3LP2B 4J37A 4TU8A 4F67A 2J0WA 1VQPS 4OHWA 5E2QA 4I6AA 4LFBF 1KOOA 2PMHA 1PJ6A 3MEEB 4J90A 3P3DA 4YMEA 3CCQS 2HQ3A 3NFZA 2JEGA 1BLLE 2IVYA 3FIXA 5CYMB 4I6WA 5K14B 3WT4A 1R3NA 4PAAA 2B5GA 1FFWB 1HQUA 3I96A 3GYNA 2HK2A 1HARA 1G4CA 1L3VA 5D8HB 1X5SA 2U2FA 4GKKF 1FRKA 4UQTA 4WCEQ 2YKPA 1UVLA 2C1EB 2K06A 1I3OB 3RW6A 1WNEA 2GX8A 3M8RA 1T9WA 3AQPA 3LPEA 1FRXA 2DKOB 3TO9A 5HH1A 5C88A 2BV3A 2FVRA 3JTPA 5FLXU 3NG8A 2FL4A 4JXRA 2B5JA 1LW2B 3D2WA 2JFKA 3N6LA 2GVZA 2RKIA 1Y9WA 2PR8A 3KL9A 3THVA 2XEXA 4AB7A 4LF7F 3CO9A 1H2UX 2W7OA 4U8YA 3HUVA 1X4AA 2CQPA 1QSOA 3DHXA 3D28A 1MG7A 2C2MB 4HDGA 2DNGA 5CZXA 4M6IA 1FDAA 3K59A 4P10A 1VIXA 2J9DA 3G6YA 5HAOA 3HKZD 4KVXA 3JVNA 1F60B 2FY1A 1YGHA 4CLZA 3HVTB 1WOOA 2WSEC 4OYIA 2ZW7A 1SJ1A 5AE3A 4MYUA 1TL5A 5MAOA 4IG3B 3VQTA 3FBUA 1B0PA 1YI2S 3BBCA 1WC3A 3WIUA 1SJQA 3ENWA 2JLFA 1UCNA 1YIJS 2VB6A 4E8UA 3OTBA 4AUKA 1JQGA 3TA0A 6FD1A 1P6TA 2QLBB 5KFMA 1TR0A 2CPJA 2HNZB 4IKAA 1RHJB 3QT5A 2OEKA 3VR1A 3Q24A 1L3UA 2GJIA 1K0VA 1WOPA 3EDRB 1N5SA 2O67A 4F0KA 1NK8A 4MIWA 1IOIA 3OLBA 1UWBB 3AB2B 4DR4F 3KDOA 1TAUA 2FHJD 1SV5A 2F63A 3DSBA 2W1BA 5AXLA 3K89A 1QSSA 3VAIA 4DR7J 2VBWA 2BQRA 4FBEA 1GXLA 3E01A 1HI0P 3IU1A 2QTWA 1TL1A 1S9EA 2E29A 1SXLA 3TOQA 1XNRJ 4RW8A 3TUJC 1TMMA 2W9AA 3BN4A 2REFA 3DCAA 3EGWB 3IMQJ 4DG1B 3D8PA 4DF4A 1FVSA 2HRYA 2OR4A 4OYXA 2QA4G 2O66A 3BJYA 3FRMA 3K9UA 4A8OA 4MFJA 1NSPA 1Q8IA 3MPVA 1ZG9A 1JLBB 1X9SA 3C6UB 1LWEB 4NLRA 2DNMA 4R57A 2CWXA 4IHMA 2B56A 5F49A 4ZVOB 2Q0YA 4I68A 4BBHA 2CYYA 2KL8A 4RW6A 2XMWA 2DGOA 4LF2A 1P27B 3KMQA 4GVLA 4Q2LA 1GMWD 2B43A 3QAEA 3BQ0A 1CC7A 1TTHB 2FIUA 2AKWB 3CJSA 3VVTA 1R0CB 2AJFE 1CG2A 2E5LF 2XCPA 4YB1P 2GO8A 1U1KA 2HS4A 4NXMJ 2XY6A 4KIAA 1EETA 2JHEA 4KYZA 5DRKA 1J5OA 2X51A 1AUDA 2Y0SD 4FF2A 1WKJA 1HPZB 3RW7A 2JRSA 4A4JA 1G1XA 1RYRA 2G13A 3QGHA 4QR1A 3G8WA 1M4GA 1EARA 3G8SA 4OAEA 3D66A 3PIOQ 4KRWA 4L75A 3IWEA 1HBNA 1N54B 5HMYA 3IEHA 4ED3A 3M2RA 1VRQC 5D3GA 3SQGB 2LQ5A 5B0CA 2R2RA 2VJUA 1GH8A 1LXJA 2WAQD 2BYCA 2NYIA 2MEWA 2V6AA 1BAVA 3UVJB 5LYDA 5KOWA 3HI9A 3VGUA 3GV8B 5T14A 3PBBA 1PGZA 2W9BA 4DL2A 4JV0A 4XNHB 3QFHA 3R7SB 4PYAA 1FRHA 2B7BB 3K8WA 2GV1A 2HNDA 4MT1A 3T5KA 3C16B 2Q7SA 2ROPA 5IT4A 1EKRA 3T6BA 3OBIA 2HNYA 5AJ3J 2Y8WA 5D0HA 4B14A 4YFJA 1RTHA 2B4UA 4B3RJ 3OL6A 2PC6A 2W24A 2UXCF 1KR4A 3GTYX 4ZMMA 4RBTA 3TZZA 3KK1A 3OTEA 1R57A 4USWA 3PB6X 1S72S 3DI6A 2OD6A 2JBKA 3PDNA 3KG4A 4M6GA 1B99A 1X9WA 2NZCA 4MK9A 3US5A 2J9DE 1AB8A 3HVAA 2P6GA 2OFGX 4O3PA 2K7JA 5LRKA 1O8BA 1CJKB 4CT8A 1F9FA 3VWSA 4LQ6A 1M5VC 4PABA 4OX9F 4OL8A 4RS2A 2WZNA 4XTTA 2LXUA 4MHPA 2MY7A 2K3KA 4P2FA 3ZO7A 3FBBA 2C6CA 3BJ8A 1HBMB 2PEHA 4KHRA 3SBMA 3KTQA 4B6ZA 1TKZB 1T9YA 2UUAJ 1HMVB 1S1UA 4I2QB 3GYAA 3D2PA 2X3DA 2I5JB 1BWEA 2XS2A 4IYQA 1NK4A 3S01A 2HPUA 2ATLA 4DR6J 2PMWA 4LFAJ 1QSMA 3KK2B 1BY9A 3RRHA 2EC0A 1BXNA 1F5BA 4OC2A 2BKOA 2YNGB 4NCAA 2WOMA 1C0UB 4ZJLA 5FVJA 3NXZA 3VAJA 2MQQA 4JI0J 1X10A 1MWZA 4DQQA 2B4DB 2BQUA 2H65B 3MM9B 4Y6IA 2BE9B 3SDEA 1NM2A 2OMOA 2VPYB 5L9NA 3MM6A 3UNYA 2ZZTA 4FYVB 3H8GA 2FJAB 1UMJA 2D3OR 1D9FA 3CT9A 3IJ3A 5D78A 4JI6J 5I42A 4PRFA 1CJUA 4MJKA 4FF3A 1CS4A 1R6VA 3CC4S 1LANA 2M3DA 3EVWA 2P9GA 3R7BB 4BCAA 1S79A 1QVGR 1S5KA 1NSLA 3OR1A 2M9KA 5HROB 4Y3CA 1Q7LA 2H3EB 4KV8A 2JC1A 3DU6A 1U45A 3I87A 4DHVA 3DOMA 3UE2A 1K1SA 2VG5A 5IC6B 5DDOC 3QGPA 3P2FA 3T9YA 1DAXA 4TU7A 4AL6A 4EMEA 5LRGA 3BGLA 5THWA 2HW3A 3T5HA 3M9MB 2E7VA 4O44A 2PSWA 3F41A 4NYPA 4QIVA 2XMTA 1UA0A 2JBJA 1D1UA 3CXSA 3PY8A 4RW9A 4GS4A 4JV5J 2ZEOA 3MTJA 1Q2DA 1J5EJ 1RDRA 1AYEA 1RU1A 3MR2A 4OZJA 4QB9A 1KQKA 1QAIA 2YWGA 4LRDA 4DCJB 1VJWA 5DDQC 2ZDPA 5IFMA 5CA5A 4E0DA 1BQMB 4Q0BA 1Y5LB 3A8EA 1RLCL 4PK2A 5LSRA 3Q8RB 4G1QB 2CQ3A 3GSIA 2ZWOA 3LH2S 2IM2A 5HVGA 1SKWA 3V38A 4CP5A 3D1HA 1F6TA 2EBJA 1TK0A 1NU4A 1NDLA 2O28A 2ZW5A 3L3CA 2P5VA 4ZCMA 2BANB 3CB4A 1Q0NA 2YKMB 4HL9A 4A2ZA 3I9SA 4F9UA 2C6GA 1SCJB 1LCPA 2B58A 3FRYA 1LXNA 2EWHA 4MCQA 3T1YF 4N8OA 3WC7A 1CEZA 3I32A 4I4BA 2DNPA 3H8FA 2BMBA 3TE4A 2BABA 4ZLJA 4LFBJ 4CLTA 1QMUA 1FKOA 3FXTA 1B87A 2VI7A 4ID8A 4UEEA 3OVAA 2ZHBA 5EC4A 4ZCLA 5G22A 4Q8EA 1RP5A 4YR0A 2CNOB 1U0SA 4FVCA 2RHQB 2BL1A 4P7TA 5F8HA 2ZW6A 4ITSA 3KHHA 3V8IA 4BBYA 2OJ3A 1HQEA 4IUSA 2VFVA 3MUTP 4IH6A 2N82B 4P72A 4K4VA 4U8VA 5J1QA 1IU8A 4UIAA 1O6XA 3NNAA 1I5OB 4N7TA 2BBEA 1JWWA 2QZ8A 1FJ7A 3S6EA 4ED2A 2UVVA 2KZZA 3CUNA 3EXNA 3D54A 2AU0A 1EB0A 4ES3A 1X0FA 3Q86A 5L39A 4WFXA 2FSRA 4DV5F 2CA9A 1SQEA 2FJEB 1TUWA 4HPSA 3ZZYA 1KDNA 1FK9A 2DH9A 4R76A 2CNMA 5A0YB 2BM1A 2I0XA 2IM0A 1WORA 4ES2A 1ZA1B 3LP1B 3D7DA 1MROB 3JYTA 1U0HB 1VQSA 2HVEA 3DLGA 1OY6A 2VQFF 2UXDF 2FLNA 4P73A 4DCPB 3C2PA 3W5XA 4R5PA 3D0GE 3J81U 4TKTA 1TKTB 2WSCC 3TO6A 2O5DA 1S6QB 4IFVB 4Q36A 4Y2AA 1KQSR 1T03B 2V69A 3FBCA 1RT6A 3B78A 2VBYA 3MAQA 4FYDA 3F5BA 3FZBA 1F5CA 4X65F 4YDDB 2VDIA 1PJ7A 3H0PA 3M32B 3HHLA 4DR4J 2AYBA 1OSDA 4N76A 2MQPA 2YQ0A 4KGKA 4P74A 3TO8A 5KT5A 3ZNJ1 1YDLA 1C1CB 2JEIA 1UFLA 4OQJA 3OL7A 4MCPA 2QLJB 1B70B 3PKMA 3ENVA 1WDTA 4NEXA 4Y2MA 4EZ6A 1S7LA 3HVWA 2CQ0A 4NLVA 5SUHA 2KVIA 5KG7A 3PYFA 3LACA 1APSA 5T7LB 3HXMA 3B3TA 1DY3A 3BGOP 2QL9B 5KTDA 4HI2A 2GU2A 1FVQA 4U96A 2IC3B 1KHWA 3LWUA 5DQIA 1S1XB 2EO8A 1FTCA 2QMWA 3VGSA 4JI1F 3PO5A 2ZBCA 3OXFA 2PVWA 3QO9B 1NJYA 3FX6A 4NL5A 1W7WA 4EFDA 3MMAA 4DXLA 3HCXA 1NKEA 1KONA 4TQSA 4FN5A 5G0RB 4PSXA 2NS1B 2E5LJ 1NJZA 1HW8A 5F8LA 3Q23A 4CT9A 2KYXA 2O3DA 3RB6A 5C82A 3K2YA 1WI6A 4TY9A 4DV2F 5FD1A 5AT1B 2WB1D 1R8AA 3D4UA 3H25A 1DTTA 3W60A 3TR5A 1RHUB 3M30A 5B08A 1A0OB 4KUAA 4I0WA 4WTYA 1Z8TA 4DL0C 1PSDA 4C48A 3NS6A 3ITHA 3S6FA 2PEBA 1F2PA 4JD6A 1E6YB 4OYAA 2QL5B 5KG2A 2RD5C 3KQXA 4HKFA 3BR9A 2MKKA 2DRDA 2J5AA 4OKOA 3CMES 2AJ4A 4LMZA 1YZ6A 3MF5A 2R7RA 1RHRB 2CDQA 2M70A 3IBFB 2O4HA 2HVZA 4JUZA 4WYWA 3MPYA 3PYGA 4R0EA 4DR1J 2HBYB 3KLFB 4HH0A 2CADA 3LP0A 1IKYB 3R2CJ 1UEUA 2W25A 3C15B 3VWDA 2W4DA 4P6YA 3K5OA 5E41A 4F0MA 2VBZA 4M8LA 4ZP9A 2PJ6A 3D7HA 4Y2KA 5CYQB 2WBMA 3SMZA 4UWIA 5IM0B 3MD1A 4CLYA 2KFNA 3BGUA 3QJJA 2NSBA 1HEEA 2J9CA 3ZZRA 2NQPA 4DS4A 4UBRA 2BM0A 3L9ZA 3LANA 3GQCA 5JVHQ 5DWMA 1BD6A 2UXCJ 3CDXA 1V5VA 1H73A 3I0SB 3BR8A 4A48A 1JJ2R 4TLRA 4DUKA 2X7IA 2GGPA 3BSOA 3W5YA 2YH0A 3QSYB 1RA6A 2RFHA 3THPA 3RGIA 1AFJA 4F9VA 4OJ3A 3GB0A 4B13A 3PGPA 4C4WA 2J6TA 2BJ8A 3MMCA 4WU2A 2C2ZB 5EGYA 2EBGA 3FK4A 2G0JA 1VS3A 4Y0FA 2VG6B 2LQBA 2YBVA 3OJSA 3W2WB 2N3OA 4JLYA 3RBXA 3MR6A 4IF5A 3A3PB 1TUVA 1V9OA 1VR6A 4K5RA 1S77D 3AD7C 2MMYA 2WPWA 5I4MA 1UJ6A 4JI3F 4MKBA 4ED4A 3W9HA 1AZSA 2KVQE 2ZH8A 3UI3A 1AW0A 4IO1A 2HVHA 1S1WB 4KFBB 1IBLF 1X9MA 4QPXA 3D5MA 3RAQA 4LF4F 2Z2ZA 4DX7A 3Q2SC 1RYSA 4OYMA 3HSJA 1PYTB 4NXNF 3OFEA 2FJWA 4ED7A 2QMXA 4DPYA 2Z8QA 1TU0B 2E1AA 2IFXA 5F8IA 2J6SA 2YGWA 4LRFA 2N4DA 4CRJA 1AXQA 2HAFA 1S6PB 3MCOA 3BB5A 3UPFA 2PCUA 2M8HA 4CNYA 3BYPA 2VA3A 3MMJA 3R6LB 2PJ5A 2EK1A 3QNWB 1IGBA 2AFSA 2YH1A 4CTAA 2FHMA 2CAJA 2E44A 5KFBA 3W2VA 2KHDA 2ANPA 3JQJA 1HIYA 4MFPA 4I6YA 3P2HA 4Z2XA 4A32A 5LRJA 1Z8LA 3ZTRA 1HDUA 1DE4C 2F5GA 2JFDA 2OELA 2N7CA 2LCWA 3FZ2A 3P4UB 3GCXP 5F8NA 5CABA 3TOAA 4RLEA 2R8IA 2PI5A 3IWXA 3D1OA 3EDQB 2RRAA 3LP2A 4H4OB 4DV6F 2UXBF 3JTNA 2BRLA 4NSQA 2ZHOA 4HH1A 3A3NB 3MEEA 3B7IA 4QW9A 1KFDA 3MM8B 3LUYA 4IR1A 4JV1A 5CYMA 3FKBA 5K14A 1ULRA 4FBUA 3FF3A 4CLPA 1K4JA 2ZKTA 5JGFA 1WSRA 2AMCB 1XMTA 3TZWA 1FWKA 2G2ZA 4DN9A 1ICEB 3AJDA 1YVKA 3PFEA 1GXTA 1IICA 3SXOA 2UVWA 2ZUGA 4MY3A 4NLTA 3OHBA 2EKYA 5E3RA 2HRTA 4UUWA 2CPZA 2J0QD 3WX4A 2BW7A 3ZXWA 2JZ5A 1U6BA 5DZ7A 4XPDC 1KBRA 1A7GE 2R2UA 2G0BA 1P1LA 4RNHA 4CLSA 4OIDA 3HHDA 4IFYB 3NH4A 1XMQF 2GIQA 2K2PA 2JDDA 1JWQA 1TP7A 2CWKA 3T1HJ 5ETKA 2EFQA 1ZBTA 4RKUC 2PGCA 2I2YA 3O1LA 3J7ZT 1PJ5A 2Z3NA 5D0RA 2Y0BB 4X64F 3Q8PB 3D6HB 4M5MA 4QU7A 2XMAA 2CQDA 2F5IA 2OUGA 5GADU 2HC9A 2DHAA 1SC6A 1LW0B 2I38A 2P2CB 3B8HA 1Q16B 3HVTA 3GONA 2OIHA 1OSCA 3N0VA 5ETRA 1VQKS 3PEHA 2FJDB 3NCRA 2CNSA 3GMGA 5HJXA 4L76A 4NF1A 5D4LA 5KFAA 4IG3A 4O3RA 2DPTA 1YZ7A 4WP8A 1F2GA 4DR2F 4NJQA 1RWKB 4J7CA 1VHFA 3EXYA 1SVDA 4OV1A 2NCKL 3TW0A 2Q4YA 2DY9A 2ZEMA 1OYEA 2PRQA 1ZAVA 4OLLA 2HNZA 3DDDA 1WI8A 2XM3A 5IZHA 3TQ1A 4H4KA 3DLLQ 2VICA 1TIQA 2FJVA 2DNKA 4FWUA 2EI5A 1HHQA 3G82A 2AF6A 4DSFA 4WP9A 4PG7A 2J9AA 2EFPA 3C6TB 4B3OB 2Z11A 4LF1A 3QZ8A 3IC1A 4C8NA 2VHGA 5E3CA 4WP3A 4NCZA 4WWSA 1NPRA 3E2EA 1BMQB 1VRUB 3TX0A 1IBMJ 2CIMA 2OPRB 4GO5X 2VA2A 3TANA 3W61A 4L3KA 5T41A 4PG8A 4FUUA 1L3KA 2CPHA 2RNEA 4RPFA 3HHNB 2UXDJ 3CCLS 4MRIA 2G3AA 2LU1A 4ZOSA 1RKIA 1GNKA 5JXSA 2FYXA 5LMNJ 1JLBA 2OAUA 3C6UA 1JJHA 1UZDA 4GXHA 2CJAA 4P4IA 1YQHA 5B0GA 1SC4B 2VD3A 3NMAA 3B3CA 3GCWP 4UCPA 2G0IA 1Z9UA 1YK3A 2VFSA 1C0TB 1IR2A 4PXDA 3PRVA 1U4BA 2ZD1B 2OFHX 4CH7A 2AGQA 2GJFA 5ETQA 4D3HA 4PXEA 3HHLC 1DARA 2H5EA 3NGSA 2MSSA 3WZ0A 4WWVA 2YWEA 3F0AA 1VGYA 4QU6A 4C8OA 2MZJA 4G1IA 5J2MB 4EBCA 2KXHA 4CYUB 4Z7YA 1SKSA 2O53A 4CLLA 2CQHA 3PB9X 2RUSA 2PJ9A 2ABYA 1XEZA 1CULB 1WF0A 1V3RA 4QVTA 2XB2D 3CPAA 4LR7A 2ZEDA 2E9TA 1G2EA 1UW9A 2IL4A 2OSQA 4NPOA 2CZVC 4NA3A 4UOGA 3DYAB 3IM8A 2PJBA 2YXLA 5AXKA 4FD6A 2VOPA 3OTOJ 5H9EK 1NZAA 3CJ4A 4LF9J 2GLJA 3R9LA 3VAHA 1FJGJ 4M63A 2J7UA 3UVJA 4JB8B 1KEKA 1XN9A 2DRBA 2HHSA 1HWKA 5BXIA 4JI1J 4EGLA 2QSFA 1QSLA 3BREA 4V1Ak 3C16A 1K47A 3ISNC 4PV6A 1ROFA 2H5MA 2QG9B 5KFZA 2MZSA 2B0GA 2SXLA 3T5JA 3I9V9 3X3UA 3KK3A 1L3TA 2RAQA 7CPAA 4X4RA 1D8ZA 2B6AB 2HFSA 4DV2J 2VODA 4F3MA 3CMAS 1EP4B 2B51A 1QAJA 1ELLP 3KUEA 4EYIB 4KPCA 2F1FA 4H4MB 4DPXA 4GVBB 1Q8BA 1WSVA 2W4CA 3OTCA 3R5AA 1CJKA 3TFYA 3IGRA 1S7KA 3QWUA 2Z57B 3DGVA 4F02A 1QSYA 2OZUA 3UWTA 1ARMA 4C0OC 3K9TA 3DRPB 2HHPA 3LAMA 1NUEA 4FF1A 3MR5A 4NLUA 1YJ7A 1VQLS 4TNUA 5GMEA 3QGIA 4ECRA 3RU0A 3NBPB 2XI3A 3NRBA 1RTJB 1TKZA 1NRKA 3DGPB 3M2VB 5LYFA 1DFDA 4I2QA 3C19A 4ZVGA 5KFJA 2I5JA 4USIA 4C0BA 3SJEA 1LWXA 4JI8J 4ZN3A 4YB7A 2J8AA 3QGGA 4HHJA 1HBUB 1RAIB 3ZTOA 5J2PB 3BSNA 1T7PA 1GX5A 4UF4A 2ZBRA 1NE9A 1VLYA 2HGNA 5KFQA 2EEYA 3S9LA 1BGXT 2IY5B 1GTEA 1LWFB 1R89A 2YNGA 1FCAA 4O3OA 4AD6A 4HR2A 1C0UA 3JAMY 4ZPCA 3S9NA 1RE1B 3N01A 2G9DA 4OIWA 2BUNA 1PC4A 1XJOA 2B4DA 1Z8WA 3MM9A 1NNDA 3UD5A 1S6OA 2RILA 2VZ9A 3CXCR 2XO7A 4AVAA 5B0BA 1UVMA 1REVB 2ZNYA 3N5FA 4XPCA 3L2NA 3D3CJ 2DXFA 1JLGB 4A8WA 1HWUA 1KHVA 1N36J 4BD9A 2AHOB 1WG4A 1HLWA 2HBRB 3ZFVA 1T9TA 1CP7A 1U6ZA 4A31A 4A47A 2LU2A 4IRCA 4D3GA 5HROA 4DPWA 2KM8B 2WK4A 3EO4A 2AGOA 3PRBA 2M7SA 1JB0C 3UN5A 3MAAB 5KFWA 2RH3A 3E01B 2YPZA 3DXBA 3CCJS 2VJVA 5H9FK 3DHWC 1CJVB 2P8IA 4BDPA 1RCXB 1OY8A 3DKDA 5J2QB 2DHXA 5KFVA 1NB7A 1FERA 2FXFA 2K1RB 3UW1A 4DR3F 2AJ6A 3M05A 1FFGB 3J81j 3H59A 5KFDA 3CJ3A 1I21A 1NJXA 4AG7A 3HD1A 1SL2A 1IM6A 4PSWA 3IWLA 1Y4ZB 5F3ZA 3C66A 2WSAA 2CXAA 4F36A 2ADCA 1F0XA 1OWXA 4A38A 2W2NP 2FIWA 1BQMA 1CBKA 2IAJA 4EUVA 3MECB 4G1QA 3T19A 1FTRA 1Y3JA 1ZO0A 3OR2B 1RHQB 1BC6A 4Y2CA 1XR6A 2PJ1A 1GHEA 2W2QP 1B7YB 4H54A 5KTAA 4RUAA 2AFWA 1LWCB 2W2PP 4F7VA 2PDOA 3QBCA 3JSBA 1JXVA 2F4FA 2BANA 4YU9A 2UUWA 1PILA 3RO0A 3EY5A 3TNVA 4J9MA 2JEJA 3CGIA 1C2PA 1C4AA 2RQ4A 1PKUA 3PV8A 3E0KA 5IV0A 3E51A 1T02A 3MUVP 2D41A 2J7WA 3QRRA 1FESA 4UTGA 8AT1B 2HHHJ 2GZOA 1YJVA 1VQ9S 2BSWA 1Q7YT 1XFOA 4GMKA 1Z4EA 2X3GA 3M1VB 1X12A 4P52A 2ATRA 4CO3A 1Y5IB 3D6MB 2ALZA 3M2RB 5F0UA 1NK0A 4ONUA 2FVSA 1FXLA 2OP5A 1EIYB 4CWBA 2ZOFA 2OSRA 2W7AA 2H5JB 4QIWD 4I2PB 2PJ2A 1W25A 4NASA 3DLKA 2W9BB 2Q6BA 2R7WA 3BYRA 4ZHRB 4OI6A 4LF5J 2E5IA 3VH9A 3H7HB 1F1BB 5DG7A 2XMVA 2GLFA 3J80U 3FECA 2DHSA 3D3BJ 3TAMB 1M0SA 5A0YA 3GUXA 1WC0A 4X64J 4ECUA 3QJLA 4ED5A 1DJ0A 2B9WA 3LP1A 1MROA 4DN0A 1U0HA 3NS5A 1CLFA 4GC7A 2HIQA 4QYZJ 4NJRA 1URNA 5IS2A 2ZM6J 2U1AA 2DR9A 4PZVA 1TKTA 1MU2B 2ZENA 1SKRA 2CVEA 1KVIA 3BQ2A 4QWCA 1S6QA 4IFVA 3FVLA 4PQUB 4EBEA 1SC3B 3MM7A 3W7BA 4CIOA 4DR2J 2LLZA 2DYAA 3THTA 2IIHA 1T03A 3SQOP 3VAKA 4URSA 3BLNA 3EJMA 1I51B 4N5SA 2BJ1A 3I6PA 4NYOA 3WBZA 2VFUA 3DC2A 2BXJA 2CPDA 2V9WA 2FC9A 2R7XA 4QZVB 5U47A 3M32A 3MHYA 4MIAA 4CO1A 2BEIA 5L38A 1FE0A 3DDNA 3DM2A 3N6NA 4A8MP 2Z2MA 2EFVA 2YNEA 5LM7E 1H7XA 2V77A 1C1CA 2B8QA 2VASA 1N71A 3M8PB 2LDYA 1XR7A 3SSRA 4CYOA 1XMBA 2IDEA 3DLHA 2HLTA 2R7OA 4P44A 4UCMA 2C22A 3HX9A 5T7LA 1IN0A 1S0OA 2WBRA 3QYYA 1HNIB 3MM6B 1EKSA 3AQOA 5CZVA 1FXDA 2IC3A 1MW7A 1S1XA 4LBHA 1OZPA 2J8SA 1N5VA 2V34A 4C8ZA 8CPAA 2FGCA 1UAWA 4CYPA 3W5ZA 5BR8F 3ISZA 5KT7A 1S4EA 5JVGQ 4XK8C 3AD9C 3HSZA 4ATNA 2L3MA 1ZM4A 1B7FA 3QO9A 3UR3C 3MD3A 5L9XA 4ANCA 2L08A 2HV2A 5DS0A 2QMUB 3V4IB 5KFEA 5G0RA 2QX0A 1VHSA 3TQEA 5GCNA 1ZPVA 5SZTA 1JXEA 2KJWA 3H5YA 4OZNA 3FMWA 3CC2S 2F4VJ 3K5MA 2FCKA 5H84A 2VPWB 4X66J 2DNYA 4DSKA 5KFGA 1R7IA 4ZP6A 4TWEA 4K2XA 1RT4B 1KUVA 2R7VA 1RKJA 4Y49B 3BV8A 4ZBGA 2WVFA 4LUBA 3IR5B 3KHLA 2G2YA 4HNXB 3PYEA 4Y34A 5F0WA 1NXIA 2PD1A 1N52B 2Z3OA 4MKVA 3KLFA 3LGNA 3BDEA 3CJKB 1IKYA 2WVDA 2B3TB 3C15A 3WC5A 1Q2CA 2DGVA 4KLWA 4MTPA 1PYSB 3TWZA 5AG7A 3FSYA 3I55S 5CYQA 3CDWA 2J9EA 2ZZMA 4XNHC 5IM0A 2AFMA 3TT2A 3GZ7A 4CH1A 1U7LA 4CLFA 2M52A 4ER8A 1NPKA 3D6FB 4QYZK 2VDHA 2WONB 2AJQA 1JK9B 5KFTA 1UKUA 4KOTA 4UW2A 3M6WA 5LXYA 3G6XA 3BN7A 1X5OA 2B9EA 4P2MA 4ZVQB 2EC2A 2BOAA 4F3QA 3LW5C 5K20B 5KFNA 4WK3A 4HYKA 3I0SA 2D1CA 3GILA 1FKOB 6FDRA 4UOCA 2XHCA 5CBMA 3SCKE 3K2KA 4PKDB 2VPZB 3CO0P 4ETZA 3BHXA 1NAQA 1SJRA 1M44A 5F47A 4Y28C 4LT6A 1G7CB 1TL3A 2GC8A 2ATCB 2CZ9A 2PFDA 1XERA 4ECVA 4ED8A 2AJ1A 5KFUA 5E7OB 4PCQA 2AQ4A 5J1EB 2DXQA 1DTQA 1R8PA 5C25B 2DPJA 3CTRA 3W2WA 1UVJA 2FPHX 2C2DA 3G3SA 5A8WB 1F5AA 1N5QA 3PR5B 1H98A 2CQ1A 2GQQA 1D3WA 2D4OA 4TVAB 4NFRA 1X4FA 1U48A 1XR5A 4F4ZA 3RBUA 3PBEA 1NLKL 4Y00A 2QA4S 1S1WA 4C7HA 4KFBA 1VC0A 2V63A 4NLQA 1VRTA 2OOTA 2CPEA 3CW2C 2IYGA 3MDFA 4X4VA 3NS7B 1PYTA 1QUPA 3TRGA 3PXGa 1NBEB 3H8YA 3JYTB 3TAPA 4RR5A 2AYMA 3KHGA 2HBZB 4CYNA 1IUJA 1BWVA 4AT1B 3NP5A 4DJBA 1S6PA 1RBAA 3KJFB 2VV5A 3EC4A 2VH7A 2NXNA 2JLGA 4OX7A 2NXUA 1CSJA 2VPXB 1VQMS 2ZE2B 4IG0B 3AFGA 1RWOB 3KUHA 3EICA 1YSJA 2XY7A 4F4AA 1R8BA 1NHKL 5CPAA 4J9VA 2CJYB 5E3AA 1RTQA 1GX6A 1OS5A 1LEOA 4ECTA 4OADA 3UY5A 3IM9A 2JSXA 4OYZA 1NK9A 5L8RC 4OJHA 2L48A 2UVRA 5KOXA 3MR3A 1WDDA 3IP0A 1ZG8A 4H4OA 2ZFHA 1XMOJ 4NI2B 4J9PA 3B8GA 4OZ5A 3BZQA 4TLQA 4UOHA 1FF2A 1VJQA 4FZVA 3SV3A 4B3SJ 1KLNA 2MGZB 3TEHB 3SXNA 3MM8A 2FHKA 1SQFA 2ZBQA 1VBKA 1N34J 3TJAA 4ZP7A 2F7VA 2JH3A 1VBZA 1HNZF 3K7RA 5D4OA 4DU7A 4W9YA 1CBXA 4RW7B 3AJ1A 3I0RB 4U6PA 2XEFA 1JXLA 2E66A 3O8WA 2ASYA 5D77A 3KI9A 4RNNA 4CO4A 4IOBA 3D7FA 3OFFA 2OLWA 4O0NA 5KFHA 5J8FA 3DLJA 2J8RA 4DUZJ 1XNQF 4LQGA 1H38A 1T9VA 4UZCA 5HATA 1TZ0A 4IFYA 2LA6A 2AIRB 2MLZA 3PKYA 1RK8A 3AA9A 4B3MF 2DF5A 1YW4A 4P71A 1X5PA 2MSTA 5AG5A 1QSTA 1Y9OA 4RZRA 5IQQA 4FNIA 3GIKA 5AE2A 2QL7B 3DDKA 2R3VA 3CF5Q 1KS2A 2HKEA 4OZLA 3A1YG 1LW0A 4OP4A 4CGNA 3FBFA 4A46A 3ETOA 1ZTTA 5F9LA 3BBBA 2FGOA 1I1GA 4PUOA 2DIVA 4FDFA 9RUBA 2HHWA 4MK7A 2A4NA 2MY8A 3QLHB 1JX4A 2IJZA 2LKZA 5KG4A 2GS8A 2HHTA 5HK4A 4ZVUB 2DT9A 2LYVA 1V6HA 4USMA 5IWAF 4IUFA 5DG9A 2C2NA 2QC3A 3J7A1 2CRLA 4MHDA 2X1BA 3EZUA 3DNCA 3UN3A 3KHRA 1WEZA 1NK5A 4C8YA 1K73T 1IBKJ 3HHKA 2AX1A 4OYBA 3C6TA 1HQ2A 4DPTA 2IDLA 2OEMA 5DO2A 4GKJF 3HM9A 1RAFB 2MQLA 5LMUJ 4BS2A 5K8MA 2POKA 3OUYB 1LFWA 4S0MA 2PMZD 3FRZA 1VRUA 2PRBA 2OPRA 4M1KA 3CD5A 4MKAA 4R9MA 1YITS 2UUCJ 3LA0A 3OWCA 2E9ZA 3V6JA 4MH8A 4NRTA 3LF0A 4YY3F 2NYHA 2DR5A 3HFKA 3FCWA 2I00A 1VCTA 1WELA 3B6BA 3KG1A 1MLAA 1RAEB 4OHYA 1I94J 3PJXA 4PYDA 4LF8F 5A8KB 3R1KA 1N88A 3BKUA 4NEZA 4R6TA 1TF9A 2GFFA 3CXQA 2PA8D 2ZH4A 5IT9Y 1C0TA 5KG3A 2DIUA 4ELVA 2ZD1A 2V8PA 2DGXA 3QRQA 8ATCB 1FJEB 3RAMA 4NYZA 1RADB 4K4UA 1EX8A 3PIPQ 5HMZA 3N6MA 4FD7A 3TVYA 2RF2B 3A3OB 2Z30B 4R8UB 3K58A 4C3LA 4IR9A 1ARLA 1D9AA 3V6DB 4P4EA 5J2MA 4CYUA 2P0WA 1SH3A 2ILZA 5F3TA 1CULA 5K8NA 4CGOA 3K57A 2AEMA 1NDKA 2CPYA 2VZZA 2V5HG 2HMIB 3IWGA 1MMLA 4MFQA 2X1AA 1JKHB 4DV0J 2FJBB 1LQ9A 4OI2A 1AFIA 3MM5B 1S7NA 3W2VB 2Q4VA 3CCUS 4QJVA 2JDJA 2WB4A 1HNXJ 3V81B 2OPPB 3L7OA 3QNVA 3KWMA 1YJNS 3KJVB 2Q44A 2OPQB 4FYXB 1VOMA 5J1PA 3W65A 2ZH3A 4MCSA 2XEJA 2CNLB 4X4SA 1MMNA 4YP3A 2R98A 3FB3A 1O0PA 2NLWA 3GKRA 3AODA 2B6AA 2H4WB 3FSIA 3BH6B 4K8RA 2Q7BA 1NJWA 1EP4A 3A4TA 2AZ3A 3ISXA 2EK6A 1BPMA 2P6SA 3N5BA 4HVZA 2ZOGA 1NH7A 3BGRB 5CYJA 5F9NA 5JQ4A 2DHGA 4H4MA 4GVBA 5LYLA 1QVFR 1Z1ZA 2QRRA 3JXOA 1GMUA 1VYAA 2DD8S 4FF4A 3O2IA 3BKTA 1JJ4A 2B4VA 1DLOB 3DRPA 5CD4H 4HEA9 1UW4A 3NGDA 3QMQA 3LODA 2ZH6A 4KVOE 5HP1A 4P45A 4C68A 3AT1B 2V2KA 3CE8A 3NBPA 2CNTA 4B9LA 2RDDA 1RTJA 1WG1A 3KLIB 3DGPA 3M2VA 4KHMA 3JSMB 2QV6A 3L4BC 3KYLA 4NWBA 4KKOB 3R2DJ 3ILOA 1K9MT 2HFOA 5EN1A 1TV6B 3O6QA 1ACMB 4FPRA 1Y0RA 2JEFA 2LQ9A 3GE9A 1HFEL 1HBUA 1NEEA 2QSWA 5J2PA 2RS2A 2I79A 1QDUB 1TL4A 3KOAA 4IDKB 2D69A 3HZGA 3W9IA 3A12A 1LWFA 3CXPA 4X4UA 4K4WA 4X3RA 3E8OA 4CYQA 8RUCA 4F50A 3G96A 2AWZA 3K17A 4NGQA 1VQNS 2NZ4A 4H89A 3D0IE 4LUAA 2NUUG 2UVUA 2LEAA 4WKRA 3JTOA 1IVZA 1OY9A 1REVA 2G0CA 2HHVA 4USKA 3AOAA 4YUDA 1JLGA 2BACA 1KP6A 2QFJA 2VG7B 1GAOA 2RC4A 5CH7B 4EWTA 2AFZA 1F9HA 5LJ3Y 3G82B 2DEJA 3KKFA 3M7VA 4MHZA 4ZX9A 4XDCA 1RAOA 2OI2A 2JL9A 1RBLA 1FWLA 2AJ0A 3MAAA 1YLOA 3KFWX 4WPAA 4C3MA 1OIAA 5C2CA 3L95X 3CZXA 4E98A 1CJVA 4JYAF 3B4MA 5C24B 3KNAA 2XI2A 2DGSA 5J2QA 1GK8A 3M8QB 1S48A 1B3TA 2K1RA 3TZYA 2DNZA 2JLEA 5KG5A 2ZUAA 3LAKA 3SEOA 2AYEA 3QQCD 4ZITA 4IRDA 3SFGA 4NA2A 1RI7A 3MECA 2DNQA 3A8KA 1DTDA 2QYGA 4JYWA 1SQGA 3OR2A 1S59A 4FD5A 4URGA 1D8YA 3KR4A 3QAHA 4PG4A 2QLFB 3MPDA 3ZZUA 3LWMA 3PW5A 1S7HA 3F44A 1LWCA 3W63A 1IM4A 2HIYA 2XS5A 3J7YU 3MFIA 1V3SA 2YKAA 4K0KJ 4MY0A 1OQ6A 2AFXA 1XC9A 2ZHAA 4KAIA 3DLBA 2A2DA 3OFGA 3OPKA 3NAIA 4NCGB 3JRUA 2IA6A 3CDAA 5BJRA 2D74B 1HD0A 4J5OA 1RT1B 1SI9A 4C8KA 4UT4A 4M5KA 3CD7A 2FVPA 3CIMA 1A2ZA 4RUBA 2NPIA 3OT9A 2W2MP 5ITHA 5L1LA 2Y1IA 4B9VA 4KORA 5BWAB 1XF8A 3M1VA 2FHOB 1NSKL 4M5DB 3OXLA 1QSNA 4V19X 3FEEA 3WC2A 2RRBA 2QFIA 4DMZA 4K4SA 1HNZJ 3M8ZA 3G8QA 3PACA 4LR8A 4LRBA 2VKZG 2VONA 2DNHA 1U1OA 4LRAA 4M5IA 4WZMA 2XWYA 1XOVA 4NLDA 4K5SA 2RDJA 4EU0A 4I2PA 1YJUA 3IWNC 3WC6A 2QO3A 4LFCJ 1XNQJ 2ASLA 5FDLB 1MNEA 2PC1A 2NXCA 3S6GA 2EPIA 4NMLA 4ZHRA 3IIBA 3K5PA 2EXUA 4ZPAA 4DUYF 3EPGA 5AGEA 1YX2A 3KK3B 1RWPB 2QGFB 3FEDA 2BEFA 4P2SA 3UNGC 2CF4A 3R5CA 2BOPA 3TAMA 4P4BA 2MKHA 1RAHB 3MXHP 2XYPB 3GIIA 1RA7A 1X4EA 3MOZA 3P96A 4FVMA 4F4YA 2VBXA 5IOLA 1DRZA 1P9QC 4B3TJ 2QLXA 2H1YA 2JVRA 1F3FA 1GT8A 4O0IA 2X1GA 1YJRA 1FX4A 5D0EA 2MZQA 3H2VE 4O23A 3D1QA 3FMBA 3ICLA 4X4TA 4OMFG 5B7WA 1IQZA 3OLAA 1MU2A 2DCLA 3BO4A 2KT5A 1Q5YA 5K8OA 4PQUA 1YJ9S 2FC8A 2GA7A 3VGTA 1ZZFA 4CLKA 2COLA 5D4NA 3BO2A 1VC6A 1WOSA 4YEAA 1L3SA 5C5JA 4II9A 2GJ2A 5HBMB 4Z65A 1DQAA 3IO1A 4DL7A 2D7SA 5IV4A 5D4PA 1N5TA 1U25A 3GJQB 3EGZA 1S7IA 1VQYA 5DLGA 4X2TA 4MFBB 3SI8A 1UPMB 2LVWA 1XIQA 4NA1A 5AE1A 5E96A 4GKJJ 1WTFA 5ETMA 1Q1KA 4U67Q 2WW4A 3M8PA 1HNWJ 2IHR1 2ZELA 2FZKB 2ZDOA 4PPDA 4Z7CA 4U5YA 3RBZA 2QJ8A 4R25A 2XC9A 4A94A 3I82A 3D7GA 1NKCA 3H40A 2HSEB 2WW8A 3R9FA 4K4YA 2ADBA 5J8CA 3CCTA 4C7IA 1HNIA 3AXKA 1U26A 3RJMB 1U49A 3N9UC 1IWGA 4EO8A 2ZBPA 1U6MA 1UFHA 3FH4A 2AJ2A 1KTVA 4I7FB 3KKWA 4TU9A 1C4CA 4PWWA 2DNRA 5FJ4A 2YWKA 2OU2A 1SIZA 4LF8J 3HLPA 4M5JA 2QJ3A 6AT1B 4K50A 3GY9A 1WTBA 3SJGA 4A30A 5BYRA 1D0EA 4RU9A 1S10A 4DUTA 1M1KT 4PWDB 1WEYA 3R5DA 4L72B 3NOCA 2CJKA 1U1LA 1ZTWA 1T0TV 1UFWA 1ELMP 3UO0A 2WYRA 3V4IA 2Z10A 2HFUA 3UCGA 3FEXB 3NL0A 4CRZB 3PHTA 1ZLHA 2HAIA 1YBAA 1TQLA 4FS1A 2HQIA 2W8KA 2ILYA 3ET6B 2NXEA 1KLMB 3VHQA 1N8RT 3MI7X 5GAGU 1UWAA 3B4DA 5LSOA 5DZ6A 2M2BA 4ZJQA 4M3SA 1U1RA 4RUCA 2PJ7A 1RTIA 3EVOA 1DQ9A 2R8GA 3NY0A 2R7TA 4A8SA 2VBQA 4Q5VA 1RT4A 4YR3A 4TN2A 1U09A 1L0CA 4QR2A 5J2NB 4LIRA 2XULA 1XQIA 1IBCB 1N32J 2HZAA 4F26A 2MQNA 2XLIA 4Q43A 2YKOA 2KTQA 2YNFB 3AOBA 1TFYA 2IAJB 5CAAA 3NH5A 4UFVA 1HI1A 4IK2A 1B64A 3CJKA 2BE7D 5F8JA 3GFHA 1ZM2A 4KOVA 4L3NA 3I56S 2ZH2A 1O5JA 5DQHA 5IB9A 4CGPA 2K7KA 4PXBA 2JDCA 5FIIA 2CQ2A 3F0NA 2ZEHA 4Y65A 1HI8A 5GAGI 4R8FA 4I1TA 1FRIA 3PEJA 3GLJA 2EW9A 5KTCA 4ZYQA 2WONA 4ECQA 5M2RA 3HFZB 1ELOA 1XNRF 3U7JA 4M5GA 2DGUA 3PTWA 4USTA 5LT5A 3MUMP 3HPOA 2EUIA 4LQ3A 4P4FA 3CC7S 4GO7X 1P0HA 1RT2A 1KTQA 1WUUA 2N4CA 1I1DA 4OYPA 3T41A 1FDNA 3HKWA 2J76E 1Q95G 3Q89A 5KFRA 1TF8A 2IJRA 3HVRA 3AAWB 3Q8QB 4R7MA 3B3VA 2O01C 3ZZPA 1U2RA 2YTCA 2ZZNA 2D3ZA 5J1EA 4GKKJ 4ED0A 1HWJA 4HHUA 5C25A 4FXWA 1KSPA 4L74A 2HQCA 2A0FB 2R42A 1T3NA 3DLKB 4NXMF 5A8WA 4XPEA 4QIEA 4NZ0A 2BX6A 3FMCA 4DL4A 1XTZA 4ZN1A 4DV7F 2YVSA 4BWJA 3TAQA 3HHLD 2ZEGA 1S57A 4RWWA 4EI2A 5EHHA 4N47A 4EK2A 4LF7J 3G6ES 4MKYA 3V6HA 3R97A 1TMJA 4JI7F 2JNJA 4TQRA 4HHHA 1VQ5S 2HHQA 2ZJQQ 3SSSA 3KLGB 4ZLPA 1QTMA 5E3QA 4C2ZA 4Y2IA 3T6JA 2EK8A 3SSQA 2J7KA 2CZ4A 3PB7X 2XNRA 1Q78A 1T05B 3GSDA 4YB5A 4H2KA 1RQ0A 4CI0B 1U1QA 3Q8VA 1QJHA 4CDIA 2XCAA 4KO0B 4X84A 3M6VA 4J9OA 4JJXA 2ZE2A 4IG0A 3MM7B 4OYOA 4FBTA 4ZVHA 4HT5A 2BDPA 2HWIA 4USJC 5B0AA 3HSGA 4QWEA 3S9MA 2DXDA 3QAUA 3C8YA 3ISND 5DGBA 5AJ3F 1AT1B 3OHAA 2KFYA 1KOHA 2ALYB 3G86A 3LWLA 4CH0S 3DXSX 2EBEA 5B09A 3M6XA 4UWJA 1Q53A 2QA2A 4O4GA 2KM8C 4A8KA 5DDRC 2V4QA 1R0BG 1KQFB 4NGSA 4JV2A 2V2ZA 1SB6A 3DM2B 5HVHA 1PIEA 1CC8A 1YGYA 3R5BA 2C42A 1CJWA 2LMIA 2D9OA 3EZ5A 4NI2A 2BE2B 3R27A 2IBOA 1MSWD 2YNHB 5KFIA 2PJ3A 2MQMA 3DU5A 4U95A 2NXJA 1NDCA 2MGZA 3HLUA 1UZHA 3BEGB 2HHUA 4ILLA 4CAVA 4ZJOA 5ELYA 1YRXA 5A76A 3RG6A 4OI1A 3R7NB 2JWNA 3TARA 2HRUA 2Z3LA 4MHYA 3R96A 4E8OA 4RW7A 3I0RA 1RAGB 2BKNA 2W2OP 2BCOA 4A37A 4NGRA 3W9JA 2DGTA 3DMJB 3AA8A 1WK4A 3KDNA 2Q3PA 4DR6F 2F8MA 4LFAF 3P8BB 9ATCB 4RNMA 2J0XA 2KYZA 3TP2A 2MKIA 2V4RA 1YTYA 4C2MA 1BUXA 3EPIA 3CNQP 3GR1A 1V5IB 4NZ6A 3EXCX 4NLXA 4FD4A 4AL5A 5ETSA 1BE4A 4Q44A 2GAGC 1FFSB 3H4BA 1FKPB 2ODFA 3EFAA 3JS9A 2KKHA 2CY2A 3W1YC 4RBUA 3LPYA 4YRHA 2Y3YA 2D9PA 3M8SA 1K1QA 2ROGA 3ZC4A 2DEIA 1U47A 1J4JA 3QLHA 2GAHC 4XPKA 1SL1A 3MOJB 3I5CA 5HL7Q 4OLOA 4ZCIA 1QAYA 3D68A 2C6PA 2P6EA 2V4JA 4PXCA 3F73A 4HNWB 4X4NA 2OTJS 1KZFA 2ZJPQ 2Y8YA 4W90B 4OZ1A 1PCAA 1EQMA 2J6UA 1D09B 5DGAA 4DV3F 1RWMB 2YX4A 2X1FA 5BYSA 4ORFA 2NPFA 1JLEA 2DGWA 5JH9A 3KLEB 1H8LA 1JLAB 1N0VC 2Y0MA 2EVNA 4B9TA 3D67A 1HYSB 2RMLA 1RBOB 1KUYA 2B8PA 1RXOB 2M5YA 2PFFB 1BO4A 2K3IA 3OUYA 3I5AA 4WZQA 3EGVA 1FI4A 4NLWA 3T9ZA 3V5RA 2VFTA 3VAFA 4ECYA 4WIIA 3FC9A 4NCBA 1TL3B 4B9UA 4NGMA 1Q2YA 4UIBA 2G9OA 1M5KC 2DR8A 5JJBA 1Z4UA 4CM0A 4OX9J 4ID5B 3DOLB 4LBPA 2AYGA 4DNCA 1DTQB 5HQ8A 3BJ7A 3MFHA 5L46A 2KO1A 4YWYA 4CO0A 5A8KA 1BQXA 2AEJA 3G71S 5ADZA 4E0AA 4ZIWA 4ED1A 1SC1B 1V3ZA 3BSAA 2BRKA 2XZWA 3G8TA 4WKYA 2RB7A 4N56A 2XEGA 1WHXA 2CVIA 2RF2A 4M5LA 4R8UA 1FT8A 3JQKA 2BJ3A 1VRTB 2K5TA 3IG1B 3WX8A 3FEZA 3JUWA 4C7QA 3V6DA 2UP1A 2E5HA 3HSDA 3M8WA 4YB6A 2CKWA 5KTQA 3NOGA 3NH8A 1GYTA 4YQWA 4MCRA 3GIUA 3PX0A 3KGQA 1WWHA 4EFAC 2G2OA 2R7HA 5CHCB 2HMIA 2F9DA 2UZAA 4X8IA 2ZWPA 3FSXA 4B17A 3P6YC 3HZEA 1JKHA 1WF2A 2I8EA 2YQ1A 3MM5A 2R9LA 1P8GA 3W6XA 2KI2A 4N41A 4J9NA 2HFVA 4DFJA 4YOEA 1CPZA 4IOCQ 1IKVA 3V81A 4C97A 2ZXVA 3MEGB 3PNIA 2OPPA 2V2VA 4QQBA 3GG0A 1IKXB 4TY8B 3KJVA 3IGNA 2OPQA 4NX9A 2GFQA 4ICLB 1YJWS 1RT7B 2ERRA 3SXLA 3M8YA 1OYDA 3EUNA 4DQIA 3I31A 2BO9A 3IRWP 2GHVC 5C42B 4FP9A 1OQ3A 3BGRA 2JJ4D 1OO0B 2RVJA 4Q45A 5GMDA 5DDPC 4ERDA 4RN7A 4KGMA 3AY0A 4N77A 3EWGA 1WEXA 4Y49C 3HT3A 3W6SA 2RU3A 2CNNB 3EGNA 1LNQA 2ZPAA 3L09A 2OPSB 5A6WA 1DLOA 4IAVA 1EAYC 1S99A 4RNFA 4R3LA 5LSLA 2H54B 4KT0C 3H20A 2YY3A 2G4BA 4WFNQ 3RNZA 2B4OA 3PYDA 4CPAA 2CUYA 3VGVA 4DF8A 1EQ0A 5G1ZA 1CX8A 3IBWA 3KLIA 1M1DA 3BM7A 3MRUA 3R1LA 3JSMA 2MXYA 3JAMU 4OC0A 4KKOA 3LTOA 1VKCA 1TV6A 2FIAA 2QLWA 1HNVA 4PG5A 1SL0A 4MBUA 2NSCA 2RIJA 3T1YJ 1S1TB 2GHWA 4IDKA 1UJ4A 2PDAA 3AOCA 2Z3PA 3UDCA 1XRYA 4KHPF 4JI5F 3GIMA 2KG1A 3SCJE 3TI0A 4KSEB 4PUOB 5IC4B 2OD4A 2CJQA 3Q8SB 1M5PC 4NE9C 2A6OA 2KT2A 5HSPA 4ZY2A 4KLVA 3NLCA 1VI7A 3H90A 1PU9A 3PB8X 1T11A 4ZVSB 5LYIA 2XSJA 3LOUA 4KSAA 5EUHA 1WHVA 3SYZA 2VC0A 2MJNA 2IA0A 1NZ8A 4P75A 3CDEA 3I1UA 2VG7A 4DYOA 4B5OA 3GV5B 2XY5A 2OB0A 4DV7J 2FHJA 1U8WA 3U1MA 5GADI 3CD6S 4A8XA 2DITA 4KY3A 4DV5J 3KG0A 1YLXA 3RYOA 4EBDA 2BQ3A 2DEAA 3TZXA 4OC4A 4QWBA 2HQDA 4YHHF 4JI7J 4DFPA 5E0OA 2CTBA 3TVKA 4G3IA 5ISVA 3C14A 3ZZZA 3S1TA 4XIUA 4ELUA 5C24A 2KCWA 3MCNA 2Q1LA 3M8QA 1F3VA 4ZI6A 5B0EA 4DR1F 3IBCB 4OI0A 2VQFJ 3KHXA 5I0CA 1M4DA 3UD3P 2ACYA 2DNLA 3GJTB 4DDFA 5JM6A 1K8AT 5IX3A 4RW4B 3KR5A 4IRKA 3B2YA 4UY85 2FQQB 3A9LA 4ZVPB 1IKWB 1GMWA 4OZ0A 3ZZ0A 2XTJP 4W92B 4B08A 4ZLNA 1M1HA 1NSAA 4LSLB 3T90A 2JEVA 1NH8A 5GAHU 3M2UB 1DHMA 4C11B 4X65J 2VU5A 4Q2MA 2Z3MA 1HBOA 2DPSA 3LGMA 2P9EA 4NCGA 4ILRA 4OZ2A 1RT1A 3R1HA 1X60A 5BYQA 4HDHA 4CAEA 1RCOB 1LKZA 4EMDA 3MGJA 2GHPA 2W4PA 2R8JA 3KQZA 5ETVA 2AX0A 4JI4F 3ZTPA 3Q2TC 4ED6A 1OPIA 1TK8A 2QT7A 2GMLA 2R1IA 4M5DA 2HG4A 2A6MA 3FQLA 1I6JA 1LRZA 4J9KA 4DQSA 1CPXA 2YPYA 1QM9A 3UDLA 3JTKA 3I4PA 4DZ6A 4I49A 4KQZA 4AYBD 1QY7A 4E2FB 4OC3A 5F09A 2Z3KA 5GAHI 2BKPA 4DLGA 4HLBA 2WHOA 4GRSA 3DDIA 3VZIA 2LP4A 3DLEB 5FDLA 1RJJA 4BHQA 2BUEA 3DOKB 3R5GA 1TK5A 1OJ4A 2MYFA 2UUBF 4R3KA 3UFCX 4Q7AA 1TUGB 2RU9A 3MEDB 1M90T 4LVNP 4O3SA 2PJCA 5FLXY 3MTKA 2HGMA 2WSFC 4U7UK 2CNKB 2GCFA 3GIRA 3VQSA 4ZPWR 4XPLA 4UZBA 2NREA 1HHSA 2ASJA 4AQYF 4AFFA 1ZZNA 5A8RA 1NK7A 2CFXA 2DB1A 3ELHA 3POTB 1CM0A 4EZ9A 1Y7PA 3CWJA 1IYLA 2ZH7A 1IOFA 2HS0A 3N4WA 2C1CA 1HR0F 3WIVA 2XMKA 1VQ7S 2V2QA 3ZZOA 1P4NA 1PC5A 4EO6A 3OJUA 5IQ6A 2B4BA 4FNHA 2FVQA 4N8NA 5HP1B 2LFVA 2VQEF 4PQAA 1SUQB 1N4LA 3QB8A 1RT5B 2UV8A 1AMPA 3FVYA 2YX1A 2FZGB 1URRA 5HBMA 3VF0B 2YKQA 1VMBA 1QE1B 1JLFB 3S7RA 4DV3J 4KBIA 1KVKA 1ZG7A 2CQIA 4WJBA 1D9DA 3PRTA 3D0HE 4KJIA 1DZ5A 3V6KA 3GYXB 3JSYA 2VZYA 4MFBA 3CCRS 2XHWA 4FKXA 4NGNA 2AFUA 1T94A 4DL3A 3KMSA 1TKDA 4NLGA 3IAM9 1Q81T 1SQHA 4DSLA 4YS2A 5L1JA 3QAYA 5H1SV 2BA9A 4I64A 4MJ8A 5K5MA 4LSNB 3PJ9A 1TFWA 1XBUA 1WC1A 2NMTA 2FLPA 2XYGB 2LDIA 4I56A 3T3FA 2JLMA 1PYOB 4PPZA 5JMNA 2V68A 2VC1A 1FWPA 1X4GA 3KHZA 2G1DA 3PG9A 3ENQA 3OV7A 1IYKA 4HNYB 3QPIA 4YDXA 2GQCA 1WJ9A 4U9RA 4I7FA 1UJ5A 2B4PA 3T1HF 2ZW4A 1AUSL 5ETNA 4OC5A 4NEYA 2VL1A 3OD2A 4PWDA 3RTVA 3BPSP 4CLUA 3VVUA 1U24A 5G21A 1M5SA 4JI3J 2WVEA 2PA3A 3IWWA 4ELTA 2RUGA 4AE5A 3OL9A 2P9CA 2CDRB 5LOQA 2Z0ZA 4WU3A 2OMLA 3ET6A 4RI1A 3Q22A 1BHNA 2M4MA 3QATA 1IBLJ 4LF4J 2ASDA 1KLMA 3M4XA 3K0JA 1WKKA 2Z2LA 1S1VB 2DO0A 4L8AA 4NXNJ 4CNZA 2EK9A 1YVOA 5K9FA 3H5SA 4MI4A 3S6KA 2XLJA 2AEFA 3R95A 3SI0A 2XMJA 5J2NA 3FDSA 1MWQA 2DO4A 1B6BA 1WG5A 3SFUA 3CIZA 4KGVB 3BBFA 2YNFA 4KH1B 4LF6F 4OI3A 1DBDA 2E5JA 4IQMA 1R8HA 2V8DA 4KOYA 3KNGA 2ZKUA 5EX0A 1IQTA 5HQLA 4ETXA 2QEXS 3V4MA 1A9NB 4UFWA 2K8GA 2E9RX 1FX2A 5E33A 2N7YA 3WQPA 5KT6A 1NK6A 4ES1A 3IAS9 1PBAA 2IVFB 4DSJA 3B82A 4HTJA 3P49B 1S60A 3WHIA 3DNSA 1X4CA 1IBMF 2OH2A 1E6VB 3H4DA 4OHVA 2IQ6A 1Q5VA 1SJ4P 2BR0A 3OVSA 4NZ7A 2O1PA 4UUXA 3D9BA 4DV6J 4TNOA 2UXBJ 2ABZA 2HB6A 2DR7A 5JUMA 3RAXA 1VQ8S 5LMNF 5A2QU 2CPXA 3FYNA 1H2TZ 3GFZA 3MMBB 4BWMA 1TKJA 1ZAWA 1WC4A 1DURA 2WZ1A 2CPIA 4F3OA 3PW0A 4IQXA 2XZDB 3CJ8A 2MKCA 1H74A 1VK3A 3PRDA 2KH9A 1W2IA 5I3UB 4CS0B 4KSIA 1IWAA 5GMKa 4GM5A 1P9YA 4WBFA 3TJ9A 4CO5A 1BOBA 3UDVA 4QCLA 4UFXA 2KFZA 3DRRB 2P6FA 5H86A 7FDRA 5CD4A 3CCVS 2LA4A 3WDOA 1QD1A 1SBRA 2GVDB 1PO6A 3QT6A 1XMQJ 4IOAQ 3HFVA 4B9SA 1VQOS 2ZEPA 3TUPA 1NKBA 4QUSA 3NA6A 3LALA 2GO9A 3KLGA 3KLHB 4DL6A 2CPFA 2PJ4A 1K0TA 5A28A 2YNIB 2VKRA 1KVJA 1LAPA 5IT0A 3PJWA 3H5XA 2YNCA 4WE1B 1TVRB 2ZC3A 2YNDA 4RL1A 4KHPJ 5KFOA 4DV1F 4K4XA 4JI5J 3OTOF 2PI4A 2QVPA 3PEIA 1T05A 4LF9F 2GIVA 1CJTB 4RUHA 5M2PA 1FNMA 1FJGF 3V2UC 2JC0A 1KC8T 2VQYA 1FD8A 3QT8A 4CO2A 4CCHA 3K5NA 2W9CB 4KO0A 2E7XA 1T8EA 1VK8A 3FEYB 3I4HX 4FXDA 1UEKA 4ANEA 3PB4X 5GVQA 2P6TA 4J9UE 5DQGA 1Z5RA 3UCUP 4QWAA 5L1IA 3CJ0A 2BJ9A 2XSFA 5F46A 4A8YA 1PG5B 1IJEB 4DR5F 3PHEA 3R5JB 4H4KC 2PE3A 1FHTA 3GG1A 1HD1A 1WACA 1BPNA 1YLEA 5DWNA 4KGXB 3HD2A 1VIOA 4B10A 3QIPB 4QYRA 3H42A 2DJWA 3BS9A 2MDAA 3GIJA 3IRXB 4YHHJ 3TC8A 4MFZA 1JNRB 4MHNA 2BE2A 3P5TL 5AXMA 3D4JA 1IB1E 2YNHA 4J9LA 1U2CA 4QW8A 1GMVA 1F2HA 3HK2A 5EWFA 1YREA 2B7CB 3GV7B 2LECA 1KNZA 3U1LA 3TCVA 1RT3B 2BJ7A 1ZM9A 3B3WA 5B0DA 1N0UA 4K2JA 2YKNA 3UD4P 3IXQA 2ZVIA 4MK8A 4NLOA 5CQGA 1TKXB 7AT1B 1S12A 2HHXA 4LR9A 2HQGA 2W7PA 2LQJA 3N79A 4ZVEA 2DR6A 1H6KX 3DMJA 4JI8F 3FFIB 2QYCA 1BQNB 2APOA 4AG9A 3RR8A 3TUIC 4PK3A 4EEYA 2OTLS 1X7VA 2D4PA 5EBVA 1IIDA 3KXDA 2Q6CA 3CJQA 1NCLA 2YQ3A 3TUZC 5ETOA 3FCVA 4DS5A 4B11A 1Q79A 1HWIA 1QUVA 1WKLA 3IFEA 3T9NA 3ZJ0A 3CCMS 1NB2A 1RTDB 2ZH9A 2KG0A 1XE4A 3BPDA 3G2XA 3CDUA 1FKPA 5K8PA 2D3O1 4M6HA 2BJDA 1ZS6A 2I1RA 2GANA 2B9YA 5HLFA 5DM6Q 5EWGA 4WK1A 2DNNA 4LX9A 1RTIB 2DPIA 3UQSA 5HO4A 1JLCB 4JI4J 2M8DB 4M5NA 1H3DA 2FT0A 1C1BB 1RWXB 4ZVFA 1N36F 4CZCA 1TAQA 1R0AB 1RB0A 1PAEX 5CCLA 2AW0A 3M6UA 2XGPA 3BSCA 1Y0YA 1G6BA 1XK8A 4JZ0A 1F2OA 2LEPA 5AXNA 2V8HA 2DH7A 2DY1A 3W66A 2NSMA 4DSEA 3CMQA 4KH0B 2MLXA 4HACB 1NJIT 4OC1A 1XJWB 2IM3A 1NPPA 3RBEA 1NO8A 2UUBJ 3KLEA 2VXKA 1JLQB 1JLAA 2PIZA 1HYSA 3ZTQA 3F56A 1RSCA 1FKAF 3BF4A 1CP6A 1S9FA 1RT2B 4KOXA 3H2LA 2OO4A 4AQYJ 1RAJA 2M0GB 2Q79A 4Q8FA 3BXMA 1NHVA 3R3TA 4ZP8A 1U1MA 2C2EA 5F41A 1FRMA 5IT9U 2CQ4A 4F2SA 1HR0J 3N7ZA 4A8FA 4C9DA 1HL6A 3WR7A 1Y5NB 4ID5A 3DOLA 3EZOA 3O5TB 4NLPA 4C8MA 3NNCA 1JJCB 4NLYA 3J81Y 5KFXA 2XMUA 5ETTA 3PCOB 4FAIA 2VQEJ 2YWHA 4BLGA 3ZNUA 2I6WA 4ECWA 4OHXA 1R6YA 2MKSA 3IGVA 4C98A 3HJFA 3G87A 2EFGA 2AE6A 3ONQA 1UVIA 2HHHF 1VQ6S 4ZK7M 5KT4A 1S9GB 1SPBP 3IG1A 3J7AN 2HWTA 5CCMA 4CAXA 2CG8A 3RB3A 2E1MC 4TXSA 1RWUA 4MFKA 1S5ZA 2WVCA 5CNPA 2ZVSA 2N3LA 4NLSA 1RWNB 4HT7A 5IV3A 1XEBA 2KZMA 2IBKA 2Q51A 2ACMA 3ENAA 4OV6A 3B54A 2R4FA 3CCES 4C2XA 1YBTA 3IS9B 3NE8A 3OFHA 1FO1A 2XS7A 2EKNA 2HUZA 2CIJA 1TL7B 1UL3A 2IVMA 4F0XA 4PR6A 2FDNA 4DV4F 1TKFA 2KXFA 1IJFB 4C2YA 3NE7A 3GJRB 1LW2A 4LF5F 2HWHA 2DHHA 2Y1JA 2RQCA 4ECSA 3MEGA 4F25A 4QWDA 1IKXA 4TY8A 5H9EJ 3VALA 3TVZA 2HQYA 1REGX 4ZY0A 2QN6B 2Y1LB 4O4GB 4BC9A 3OSNA 2C3MA 3UR0A 3DN9A 3TOBA 3MEKA 2C2OB 4ICLA 4X2BA 4C3KA 2F65A 1RT7A 5DS7A 4ZPTR 1L5UA 3FGVA 4IH5A 3FCHA 2WTFA 3SCIE 1X4BA 3KASA 2Z58B 1S4FA 2V50A 2ZM6F 4H6ZA 1S0MA 3UCZP 1G3OA 2ZOMA 2VIHA 5C42A 4F4WA 1JIHA 4BMHA 3KJQB 4DR3J 1B0TA 4DX5A 2CTCA 1KD1T 4J9QA 4LQ9A 3MCSA 2ZC4A 3NWRA 2MZTA 2KU7A 3CSKA 1QLNA 1NDPA 2OPSA 2MQOA 4DLEA 4CM2A 1W2BR 5D0GA 4DPUA 1TKHA 4LF6J 2FLOA 2MB0B 2J8MA 2PSZA 3LMSA 4DFMA 1UWBA 4LSZB 3TEGA 1VHOA 4CQ1A 4WFZA 2PIIA 3EMTA 2KN4A 1H0HB 4C6AA 4UA3A 2AFOA 2BZ2A 1LOUA 1R43A 3ILJA 2MKJA 4ZVTB 1IR0A 2C2RA 2GW8A 2Q4ZA 3TTHA 2ARHA 4OI4A 4P4JA 3FBEA 3G4SS 2H9ZA 4CAWA 2Q04A 1YBUA 3M9OB 4YFUA 4J9RA 2PVVA 3AH6A 3K5LA 1S1TA 3BQ1A 2F8HA 4CAFA 1H2VZ 4DG1A 2NR0A 3PX6A 4O3QA 1SKUB 5KG0A 2PJ0A 4DEZA 4F0HA 1VLOA 1QSRA 4K4ZA 4I69A 3GWCA 1X0PA 1LWEA 1WHWA 2PJAA 2D3UA 4CRYB 5G20A 3AHPA 1NHUA 3SZ2A 1SJFA 4RX6A 2DRAA 2V4JB 3RRKA 3SIPB 3DRSB 3JB9k 4FYYB 5E5NA 4ZKAA 2HGLA 4K30A 1N5YB 2KT3A 4OFZA 1FD2A 4HTIA 2XWXA 2F4VF 4RO0A 2A10A 2HVIA 3T8WA 1HPZA 4DZDA 1JLEB 3B35A 4X66F 4LBIA 2OEJA 3GR0A 4XAKA 3CDBA 4FPIA 2GIRA 3CCSS 5HMNA 1J27A 1YG0A 4ONWA 1LOKA 3D7SB 3DFEA 1Q4RA 4F0YA 3R9GA 5HMWA 3NCPA 1UTAA 2IJNA 4YN3B 2YNCC 2YWWA 1ZOTA 3MWBA 4B5PB 4ZY1A 3SQGA 4DV1J 2A2CA 5C2GA 5CXTA 3QIDA 5H9FJ 1FEEA 2Z0GA 2A1BA 1N6QB 3PW7A 4RW4A 4KUBA 1PAUB 1VBYA 4Q38A 3DR8A 1Y0HA 2R7SA 1Z4RA 3T5LA 4ZIVA 4A33A 2DISA 4CLWA 2AGPA 2AD9A 3HP6A 1IKWA 2RS8A 2Z4PA 5GAEU 2L41A 5DG8A 5D6GA 4UQGA 4DFKA 4QC6A 4LSLA 1RHKB 2HQFA 3W3SA 1RWWB 4DR5J 1RO5A 4KVME 1GEHA 1OMSA 3M2UA 1WWZA 3AB4B 4C11A 3H98A 1N33F