5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
molecule keywords Amidase, hydantoinase/carbamoylase family
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
4G1PA 2ZEGA 3TC8A 4R8FA 1TXRA 2XEIA 4MHPA 3NH8A 1QQ9A 3PFEA 3B3SA 4OIWA 1CPXA 3DGVA 4ZX8A 2Q4ZA 7CPAA 4MHZA 4NGMA 5J1QA 1AYEA 5K8NA 4NJQA 1XJOA 1TF8A 1VGYA 1VHEA 3D7DA 1NSAA 1VIXA 1TF9A 1TKFA 4O23A 3RAMA 2AFUA 3PRTA 4B6ZA 2PIZA 3ISZA 4IHMA 3IO1A 3BHXA 3IIBA 3IFEA 3HUVA 2GU2A 3H8FA 3D66A 3PB9X 4ZY1A 3FF3A 4NGRA 4MHNA 3RBUA 1PYTB 3TX8A 3D7FA 2AFSA 1Y0YA 4P45A 4P4FA 4KSIA 1YMEA 2ZEFA 4R7MA 3PEIA 4P4BA 3KL9A 4EFDA 3S9MA 3FVLA 2CF4A 3FEDA 2PJ6A 4X8IA 2IJZA 4MRIA 1UWYA 1R43A 3PBEA 1Z2LA 1BPMA 3NH5A 3MRUA 2I3CA 3WC5A 1Y0RA 1YW4A 5I4MA 3KGQA 1CP6A 2PJ7A 4Z65A 3B35A 1FT7A 3KHXA 4NGPA 3WC7A 3LMSA 3IEHA 3S9LA 3JRUA 1ELMP 4P44A 5LYDA 1Q7LA 4MCPA 2BO9A 4OP4A 1DTDA 1IY7A 4OC1A 3ISXA 4EMEA 2PJ0A 3SJGA 2EWBA 2RFHA 2PJ9A 4OC0A 4R6TA 4EWTA 4A94A 2F8HA 3SI1A 4PXEA 4OC2A 1LANA 4P4DA 3NFZA 4ZX9A 2CTBA 2VL1A 1CP7A 1Z8LA 3BXMA 4NJRA 3SJEA 3VARA 3D67A 3D4UA 4FAIA 2PJ5A 4R76A 5CPAA 5HVFA 1F57A 3KQZA 4WWVA 4JYWA 1PCAA 4ZY0A 1GYTA 4ONWA 5D8NA 4NFRA 5K8OA 3FEEA 2ZELA 1TKHA 4P4IA 2PCUA 4IK2A 1HDUA 2PJ1A 1HEEA 1Z5RA 4GM5A 2V77A 2WYRA 3L2NA 3MN8A 1BLLE 2FVGA 3SI2A 1CBXA 2PJCA 5LRJA 4PXCA 3N5FA 4PPZA 4DUKA 3SI0A 1IGBA 2BCOA 3H8EA 4MCSA 2XEFA 2ZENA 3LWUA 1BAVA 1ELLP 5JGFA 3FJUA 2AFXA 3DLJA 1DE4C 2QJ8A 3BI1A 4LQGA 2POKA 3GB0A 2EK9A 3IJ3A 4DYOA 3V7ZA 3PB6X 2ZEHA 2O53A 2ZEPA 4MXUA 4A38A 4NGTA 1LAPA 5ELYA 2HC9A 1LAMA 4AXVA 2V8GA 1ARMA 2PJ3A 2CTCA 3B3VA 3FX6A 4YWYA 1VHOA 4X2TA 1YSJA 1ZLIA 1KWMA 1XMBA 4PXBA 2PE3A 2V8VA 2AFZA 3VH9A 3RZAA 1CX8A 3WT4A 3CPAA 2IMOA 4NGQA 3K2KA 5CBMA 3PFOA 2CIJA 3K9TA 3NH4A 1R3NA 3B2YA 4P10A 4OKOA 2NSMA 2EK8A 3D68A 4P6YA 3VATA 1Y7EA 1LCPA 2C6PA 1EE3P 4X3RA 5JH9A 2QVPA 1YLOA 3KR5A 4IAVA 4RUHA 3IC1A 3KI9A 1ZG8A 3PB8X 3QNVA 4UEFA 4A39A 3B3WA 5K8MA 3KZWA 3B3CA 1QMUA 3FECA 2JEWA 2Q51A 2ZEEA 3BI0A 4CPAA 3HLPA 2AFMA 1XBUA 1JQGA 4MHYA 3CT9A 3SJXA 4Q7AA 2PJBA 2JBKA 3GUXA 2C6GA 3WC6A 2IQ6A 3FMCA 1ZG9A 5HVGA 4K3NA 1HDQA 2C1CA 5THWA 2HB6A 4WJBA 2ABZA 2RB7A 1ARLA 2GLFA 5LYFA 3D7GA 2G9DA 1YW6A 3PB4X 4P4JA 1H8LA 1ZG7A 4PXDA 3I1UA 2ZOFA 8CPAA 4OMEA 1XFOA 4BD9A 3SJFA 4UF4A 3T8WA 3GLJA 2OR4A 3V38A 1FNOA 4MMOA 4H2KA 4ZI6A 2PIYA 3CDXA 3B7IA 1CG2A 1CPSA 1BPNA 2NYQA 2GREA 1RTQA 4UEEA 1LFWA 3H8GA 4FUUA 3KHZA 2AFWA 2C6CA 4NGNA 4TNUA 5F09A 2F7VA 4ZYQA 2Q43A 6CPAA 4MCRA 1F2OA 1TKJA 2PJ2A 2PRQA 2ZEDA 5LRGA 5IB9A 2WZNA 4A37A 5LRKA 2ZEOA 1LOKA 3CPXA 4JZ0A 3D7HA 4MCQA 5DS0A 4OIDA 2PVVA 2ZOGA 5HXDA 3WABA 4PQAA 4YU9A 1OBRA 4P4EA 1XRYA 2DEAA 3KQXA 4TWEA 1M4LA 2PJ4A 5JM6A 3IWWA 3KR4A 2ZEMA 4ZY2A 4F9UA 2XEJA 2V8HA 3B3TA 2PJ8A 4UEZA 4NGSA 4FBEA 5HVHA 3PB7X 1F2PA 2V8DA 3FH4A 2GLJA 4OC5A 2PJAA 5LYIA 2QYVA 3S9NA 1AMPA 4UIAA 2BOAA 3NA6A 2ANPA 4FWUA 2J9AA 4DJLA 2AFOA 5K8PA 2PVWA 3KASA 5LYLA 4F9VA 4F8ZA 2JBJA 5D29A 4OC3A 2O4HA 2XEGA 4UIBA 4W9YA 3PBBA 1ZLHA 2OOTA 4OC4A
chains in the Genus database with same CATH superfamily
1S6UA 2EWHA 4HDHA 3EXNA 3DLBA 3TOQA 2FSRA 4C7IA 1HNXJ 5LMUF 5KFJA 3JSYA 2B5JB 1SUQA 3ETMA 1HQEB 1YREA 4BHQA 1GTEA 3Q8QB 1VGYA 1T9WA 5I3UA 2DISA 3RAMA 2FVCA 5D0GA 1KLMA 3ISZA 4RNHA 3IWLA 2M4MA 3IM8A 2WW8A 1NH7A 2DYAA 4PR6A 3I5AA 4G65A 4YHHF 1N33J 4NSQA 2H9ZA 2XHCA 5C42B 2JEVA 3HM9A 5BYRA 1NNDA 4RUAA 4TU9A 3OR2A 1Y0YA 1T0TV 2YNIB 4CAEA 4O44A 2UUAF 2WZ1A 1QJHA 4LRDA 2Z8QA 2ADBA 4JI1J 1Z2LA 4BS2A 4MJ8A 3M6XA 2W9CA 1Y0RA 3I0RB 1TTHB 5D4PA 4RW8A 2KCWA 4X66J 3S9LA 1S1TA 4QJVA 1D09B 1ELMP 4P44A 3TJAA 2BO9A 4MY3A 3G6VA 1AUDA 2RQKA 4HT5A 1U2FA 4EWTA 4MIAA 1G7CB 4DV5J 4IG0B 2VPXB 1HNZJ 2HZCA 2UUCF 2BA9A 2VU5A 2HNYB 3D3SA 2EK1A 3ENWA 3M8PA 1U0SA 4RWWA 3GILA 1PIEA 3EVWA 4J5OA 2RNEA 3VVUA 2CXEA 3M8ZA 1AA1B 2K1RB 2GVDB 4YN3B 1EIYB 5T7LB 2UUCJ 3R5JB 3MXHP 4X84A 2P8IA 5GVQA 3G71S 4CLZA 1S9GB 1LK5A 3E3XA 1CJTB 2N82B 3JSRA 2Y1RI 2RU9A 3UR0A 4EI2A 4DLEA 4DJBA 2OU2A 4NMLA 3C6TB 3DLJA 5ETPA 2EK9A 1CJUA 2M8DB 1RWOB 4J9OA 1U26A 2BW7A 4OZ2A 2GQCA 2CPEA 3FC9A 4NA3A 4M5LA 3IG1B 2B4PA 1LAPA 1IR1A 1O6XA 1WC3A 5L46A 1X7VA 4OI1A 2XSJB 3C2PA 3P4UB 4NX9A 5EUHA 1FXRA 1QUPA 1YKWA 4DUTA 1JLQA 2HVEA 3MEDB 1YSJA 3TWZA 4CNYA 3Q8SB 2B56A 3UN2A 3OVBA 2LP4A 2LYVA 2OSQA 2QSFA 1WKKA 3PZPA 4ED2A 1WOSA 4U95A 3M32B 3T5JA 2BX6A 3M2RA 1HFEL 2VDIA 1LWCA 1FJGF 4X3RA 2YQ1A 1OMSA 4I4BA 2YVSA 4NYOA 5A6WA 1NSKL 3TQEA 1RBOB 1FKAF 4S0MA 3PIOQ 4HKFA 1NKCA 1WHXA 4TY8A 1QDUB 4WK3A 2ASLA 4FF2A 1RT4B 1NDLA 1Q2DA 1A0OB 3C3LA 2IM1A 2HGMA 2DO4A 1L3UA 2Q51A 2E1CA 3PRBA 2HFVA 4R5PA 4B9LA 3K5PA 2FC8A 4NYZA 3UW1A 2CQCA 3BGUA 2RRBA 3SJXA 2CQ4A 3DDDA 3I55S 3GUXA 1YVOA 1ZG9A 3NKYA 2WTFA 2C1CA 2HB6A 2QA4S 1VK8A 5B0GA 1KFSA 2B4DA 4PXDA 4GVBA 1MROB 3I5BA 2R8KA 3RR7A 3RAQA 2J8SA 1KC8T 1NDPA 3IAS9 2VBZA 2RF2B 1I94F 3QMQA 2ZKUA 4K4YA 3M6UA 4DR4J 4KHMA 9ATCB 2QSWA 1G2EA 1E6VA 2ZPAA 1CPSA 5KFSA 3W2WA 2R7HA 2AFWA 2EFQA 4QQBA 5CZXA 4NGNA 4Q36A 3T5LA 1OSDA 3KK3A 3HHLD 2W2QP 4MIBA 2Z10A 5HAOA 2QX0A 2HUZA 1RI7A 4LUBA 2OFGX 1UZDA 2DXFA 4OX8A 3Q24A 5KTCA 4HI1A 5C24B 2GW8A 3J81j 2B4OA 3RBXA 2Q3PA 3WABA 4JV0A 1YVKA 1YQEA 3DRSA 4O3SA 4CAXA 4UFXA 4HTIA 2NXUA 3HO1A 1FD2A 1Z8TA 1YBTA 1FY7A 4ZPBA 4DF8A 1IKVB 4ZIVA 1Z1ZA 1URNA 1K4JA 5F46A 3N6MA 3LP2B 4CYUA 3VGUA 4C6AA 2YWEA 3FBBA 5HBMB 3JTOA 1XR6A 2ZH5A 2NPIA 1ZAXA 3NWGA 3POTB 1TK8A 2AGQA 1DZ5A 3AD8C 2JBJA 2UU9F 1DJ0A 3BGFA 3W9HA 2WSAA 3ADAC 3CDAA 4W9YA 4LSNA 2RJZA 2WBRA 3J7YI 1ZYQA 4KOTA 2XLIA 2XS2A 4R87A 4FN5A 2HVZA 2ZH6A 2GIRA 1TXRA 3DLGA 2RHQB 3LAKA 2FIUA 2JEJA 3ILLA 2Q66A 3TOAA 4H4MA 2GO9A 1LW2A 2G3TA 1CJKB 4ETXA 2C27A 5EHHA 3VTIA 1WTFA 3B8GA 2IL4A 4ES1A 4ZCMA 3H8FA 4AL5A 3TZWA 4Y0FA 2VXKA 4B3SJ 4DUYJ 2R8VA 2YGWA 4MHNA 4X64F 3TA1A 3EZOA 2FJWA 3GYNA 3R9GA 4U8VA 2F4VF 1FRLA 1JWWA 2ROEA 2V94A 1IR0A 1AT1B 3S9MA 3LD2A 4LF9J 2RU3A 3H4DA 3G2XA 2PFFB 1HNVB 1T8EA 4M5JA 4U7UD 5HMZA 2FIWA 3VR1A 4YY3F 5B09A 5I4MA 3GY9A 1GXUA 1YIJS 1CP6A 4K2JA 4NGPA 4O3PA 3P49B 5HQMA 1XEBA 2R7RA 2YTCA 4C7QA 4EZ9A 2Z3OA 1MWQA 1N4LA 1IY7A 4EMEA 1HQUB 2J9CA 3CMES 2AEFA 4I2QA 5AG4A 2F8HA 4UCPA 4KS9A 1GX6A 1XF8A 3LO3A 3NRBA 4XDCA 3SYZA 2DVIA 3BXMA 3ZZZA 3SJEA 3VARA 4CO2A 1YTYA 1I12A 1Z4EA 3VGVA 5LMNF 4QUSA 4CI0B 2QA2A 2DR5A 4IYQA 4NZ0A 3UFCX 2CPZA 4ZP6A 3AOAA 2CPDA 5J1EB 1YZ6A 2HVDA 3G6XA 1SC4B 2AYBA 3NWRA 3IA0A 4USJC 2HBZB 5DGBA 2Q1LA 5AG6A 1JIHA 3SCIE 1HI8A 2YNIA 4CO0A 3V4IB 2EG2A 5E3PA 4DV7F 1Z2ZA 1YRTA 4F4WA 2G1HA 5AXNA 5F0UA 1RTHB 1TU0B 4C3MA 4LF4J 1LV5A 1M90T 3AXKA 1KEKA 4DR1J 3PB6X 2ZEHA 4PG6A 4Y34A 3MCNA 4I64A 2E9ZA 4H4OB 3R5DA 4MFBB 1VK3A 4OHVA 4K7QA 1TFYA 4G1QA 4DQSA 1UMJA 3P2FA 2MQOA 1U02A 4ANEA 3IWXA 3B78A 3GFXA 2BKOA 4DQQA 2JEFA 3IMQJ 4IG0A 3CJ2A 3MUVP 2RH3A 1KDNA 3K2KA 1QAYA 4KGVB 4ZP7A 3K9TA 2KU7A 3MTJA 2FHJD 3LA0A 2D41A 4QWAA 1YRUA 3IC1A 2VG7A 1ZG8A 2J8RA 4E8UA 5L9XA 5IQQA 2CQBA 1OS5A 5A8RA 3H2UB 5K8MA 1Z9UA 4Z7YA 1JLCA 3I96A 3HJVA 2XMAA 4B3OA 4C4WA 2NMTA 4F04B 4RU9A 3CT9A 3MGDA 2CJBA 3OLBA 1Q7YT 2J6SA 2CNNB 1T05A 3FMCA 4QIEA 1R8PA 2H5EA 1O8BA 3RW6A 2OPQA 2WVDA 4NLWA 1SXLA 2MB0B 2VF3A 2LA6A 1RT7B 5KFXA 1RXOB 2GJFA 4XO0A 3G82A 1FNOA 3DOMB 3MEDA 2H5MA 4RWXA 2RD5C 4ZPWR 3MAQA 3CDXA 4URQU 2P6FA 3SMZA 5ETKA 1WJ9A 2VBWA 1CJVB 1PBUA 1U1KA 4EBCA 1Q81T 2MZQA 3QRPA 2ABYA 1JLEB 3AY0A 1EAYC 2ZH4A 1IOIA 4ZHRB 2GS8A 2PRQA 2VHGA 4QWBA 4KLVA 3N9UC 3W6XA 1S7FA 2A6OA 4N77A 4O3OA 2OP5A 2AMCB 1Q8KA 1IKXA 4A47A 5GAHU 4WCEQ 4P4EA 3GSIA 3N79A 3SCLE 4PKDB 1QE1A 3EGWB 4CGNA 4ZPAA 1ZH5A 3FUYA 3CMAS 3CCES 4A33A 4QOTA 2HQCA 1MN7A 1W26A 2KFZA 3K5MA 2L3MA 1NK8A 3D6TB 5IT4A 3OR1A 4EVYA 2JLFA 3OSNA 2X3GA 4UIAA 5E3AA 4USWA 3R5AA 2XY5A 2B51A 3KHRA 1U49A 3OLAA 5FLXU 4F9VA 3QGIA 2ZBPA 3JAMY 1Q2CA 2B58A 5I3QA 6FD1A 1E6VB 2DPIA 2IDLA 2XS7A 5F9LA 1M5OC 4EUVA 2HFNA 1XMQF 4DV2F 2JNJA 4DCPB 5L1KA 4C2MA 3D1OA 2F1FA 2MXYA 3D6MB 7FDRA 4OIWA 3OSPA 4LIRA 3TAQA 1URRA 3W5XA 4QWCA 7CPAA 2GAGC 3NGSA 1JLGA 3FNCA 1V3ZA 2GJ2A 4OX7A 3DDKA 4F4KA 1RBLA 2XY6A 2P9CA 4XDDA 2XMJA 2D69A 2QO3A 1IOFA 5HP1B 4GXHA 1LRZA 2J9DE 4QBUA 3DYAA 5KFWA 4WFNQ 1HYSB 4B9MA 4DSLA 4BINA 2XZTB 3TP2A 5KFFA 2AEMA 2P5VA 1TL3B 3O6QA 1JLFA 1R43A 4DHVA 2W7AA 4J9MA 2B5JA 3OTEA 2HK3A 3J7Z5 1JK9B 3T90A 3MWBA 2IRYA 1BMQB 2K1RA 1QY7A 3MMAA 4FF4A 5GAEI 3S01A 4LREA 3DOLA 2LQBA 1IKYB 1D9AA 2LXUA 2BM1A 1EZZB 2A2CA 3L7UA 4OX9F 2PA8D 4G6VB 2FZCB 3HDSA 3OFEA 1TKTB 3SXNA 1J5OB 3RRGA 1NUEA 3D67A 4IDKB 4R76A 3BBBA 2IJNA 3ENVA 3QB8A 4NLSA 4A48A 2Q0YA 4OI3A 5CYJA 1HI0P 5KFHA 2XSJA 2DPTA 3FEEA 2W9CB 2XSFA 1HDUA 3W64A 1SB6A 1NM2A 1P9QC 4KOYA 4A8OA 1GQEA 1FDDA 3SI2A 3N5FA 3IRXB 4AG9A 4GRSA 4M8LA 5IOLA 4XNHC 5LL6d 2NSBA 2XEFA 2ZENA 1LWCB 2AP6A 1U09A 4N8NA 3KHHA 4QW9A 4LQGA 1Y5NB 2BANA 2HG4A 2J5AA 3VAIA 2OUGA 1S12A 1LK7A 2BJ9A 3QYYA 1SC6A 2E1AA 2AIRB 4LF5J 1FCAA 2FZGB 4R5PB 4DUYF 4J9RA 1HQUA 2AE6A 2GFFA 4X65F 1VHOA 3OD2A 1KWMA 3SFGA 3MR3A 1WI6A 3VH9A 2CQDA 4J37A 4X64J 1YJNS 3X1LB 2B6AB 1RQ0A 2XBPA 2KTQA 3BBFA 1B0VA 1DY3A 3RBDA 4WIIA 4RW4B 3LAMA 1I6JA 2HQYA 5F9NA 1V0CA 2Z4PA 1YLOA 3GIMA 2Q44A 3H20A 1CS4B 1RT1B 1TMJA 4WP8A 1FFWB 4MFZA 1VQ5S 1FESA 2UXBJ 2A2DA 1YJ7A 2B4UA 2QJ3A 2MYFA 1C0TA 2HURA 4IH5A 5DDRC 1OPZA 1N34F 2LVWA 3BI0A 1C1CB 5G21A 4TQSA 1Y7RA 3W6SA 2PJBA 1RTHA 1RGVA 4ID5B 2KZZA 3U27A 1CQMA 2IQ6A 3GYGA 4CGOA 3NG8A 1HDQA 2R98A 3H4QA 5C24A 1FRMA 2K7JA 2R42A 1YW6A 3OQ2A 3DR8A 1HWIA 4OYBA 4L3KA 3SJFA 5LXRA 2V34A 4TU8A 3MCOA 1T7PA 3NS5A 3V38A 1EQMA 4FNIA 5A8KA 3TT2A 3EGZA 2Z3KA 3IU1A 2IC3B 4IFYA 3TFYA 3EDRB 4DFPA 1RWNB 2CPYA 2FXFA 4CGLA 2V4JA 4IQXA 2B3TB 2Q43A 4OV6A 3PW4A 1F2OA 3MAHA 2LDIA 4DR6F 2RQ4A 3CCTA 1RKJA 2P6TA 1R8CA 1KOOA 5FJ4A 1R8AA 1M4IA 1LOKA 2Z2YB 4OZ0A 3J81Y 4WYWA 2WOMB 1H98A 2ZOGA 3WDOA 5IV0A 2HFUA 2IJFA 4PQAA 3KLFA 4LT6A 4JB8B 1X5PA 4B3OB 4RW6B 2M7SA 2BKPA 2CJAA 4W90B 3C15B 3Q86A 1VRQC 2FLNA 3B3TA 2A6MA 1LW2B 4IRKA 1U6MA 3FH4A 2VFTA 1IU8A 3VF0B 5IV4A 3N28A 1NKBA 2RMLA 3KK3B 2UUWA 1F5CA 2X1BA 4ES3A 3D6FB 2QC3A 2Q6BA 2QLXA 5B7WA 1HNXF 3QQCD 2EEYA 4RNFA 2GIFA 1NK4A 3F56A 2ZEGA 3CEDA 3J80U 4ZN1A 1R0AB 4ZLNA 3HHLC 4F0YA 1NCLA 3K59A 2IJRA 1XMOJ 3NLCA 2FGOA 1ZZNA 3G96A 1VJQA 3T9ZA 2YXLA 4NGMA 5L8RC 3TUJC 1N5SA 1LWEA 1TF8A 3VWDA 4F26A 3D7DA 1VIXA 1VRUB 3T1YJ 2Y8WA 2KXNB 3BDEA 1BWEA 2LFVA 3V6JA 1HHQA 2JEIA 1Y3KA 1AUGA 3R96A 2KDOA 3IFEA 1KRPA 4J7CA 2GU2A 5U47A 5BXIA 2C3MA 4DCJB 3AOCA 1RT3B 3H5XA 1JLBA 2DNNA 4B9SA 3VHQA 4B12A 4FYXB 2C3OA 3D7FA 1RTIB 4A8YA 2VI7A 4QVTA 1VRTB 3DDIA 5HLFB 3FVLA 3M8QB 1KQGB 1FVQA 5KG5A 1CM0A 5A6PA 1TKXB 2B3VA 4F0XA 3NH5A 3MRUA 1YW4A 3F0NA 1CJWA 3V5RA 3QAUA 2DNKA 3K89A 4HNWB 2R9LA 2M5YA 1N36F 1MN9A 2BM0A 2ALYB 3BQ2A 1YLEA 1DTDA 3H5ZA 4M5DA 1MMLA 1MMNA 2B7CB 2QE5A 1S7HA 4HNYB 4Y3CA 4P2SA 1X4GA 4RW7A 1VQ9S 2OAUA 3W62A 1HW8A 1NJWA 3HD2A 4N8OA 1REGX 3OJUA 5CPAA 3CF5Q 3TA0A 1WK4A 3L9ZA 1BY9A 4OV1A 2HHVA 3RYOA 2JX2A 1TL1B 5D8NA 1WI8A 1ZM3A 1GMUA 1IBLF 2XCAA 4WWSA 4G1QB 4CAVA 1RE1B 2PCUA 3ONQA 2FUG9 1MLAA 2HHHJ 2XWYA 1SL0A 3TAPA 3UCGA 1NPKA 2VH7A 1NK9A 3NAIA 2AX0A 1WUUA 5ETQA 1VQOS 5KFRA 3GR1A 3R7BB 4F4AA 2DPSA 3DMJA 3QWUA 3US5A 3NNAA 1UPPA 1NB7A 5CCLA 3A4TA 4ZA1A 5A8RB 1K0VA 1S6QA 1HBMA 3KYLA 2BJ3A 2F5GA 4AVCA 4EBEA 4Q8EA 2YNGA 2Y8YA 5K20B 1TZ0A 3M9MB 1RLDA 1PC5A 3V6KA 2DH7A 2BABA 3M7VA 3EGVA 2QA4G 1NO8A 3OTCA 2QEXS 1T05B 4YB6A 5G0RB 2HYIB 4PRFA 3BQ1A 3ZZPA 2V6AA 1IBMJ 3EGNA 3UDVA 1ZM4A 2VOPA 4UY8T 2WVBA 1DQAA 4K5SA 5I0CA 1Q78A 4LUAA 1M1DA 5JH9A 2CNTA 2E7WA 1RDRA 3EPGA 3CJ0A 2HBYB 4IAVA 2ZHOA 3BH7B 4P73A 3BEGB 3I31A 3PXGa 4CO1A 4NCGA 3BB5A 3D5MA 4UEFA 1N71A 3B3CA 2H1YA 2AX1A 1Y9WA 1IQZA 3ZTQA 3CE8A 2AKWB 3OXLA 2CQ1A 1OSCA 4Q45A 4ECXA 4ZHRA 2M2BA 4F67A 3RYLA 2WSCC 4LFAF 4DMZA 3WX4A 4Y00A 2CWXA 5THWA 2CPIA 2ABZA 2VG5A 3I1UA 2LQ5A 2NUHA 5KG1A 5ETNA 4JV5F 3N7ZA 5HBMA 2PR8A 1LNQA 5D78A 4CT9A 1TUWA 1R8BA 1IN0A 8RUCA 4C11A 1WHYA 3F5BA 3S1TA 1BPNA 1NK5A 4OYXA 2CQPA 4H6UA 4JP8A 3PKYA 4NWBA 3MECB 1K1SA 2XS5A 3ZTPA 3UE2A 1SQEA 1MJBA 2ZEJA 3RBZA 3TO7A 1VCTA 2GVZA 3G3SA 2G0JA 3OL6A 1E6YA 1RWXB 3QT6A 4PPDA 4A37A 3W61A 2ZEOA 3SCKE 2OH2A 2VPWB 2N7CA 3H25A 3VQTA 5D0RA 4ZJQA 2AGOA 2HHPA 2VQFF 4OIDA 3ZZUA 2RVJA 2YWWA 5BR8F 1NMTA 2KM8B 5CYQB 4YR0A 2DGOA 2DEAA 4TWEA 2YWFA 2IA0A 3KR4A 2MTLA 3KG1A 5DZ6A 1Y0HA 3K5LA 1XNQF 4CTAA 4KFBA 2MZTA 3HVRA 2B5GB 5C2GA 3KDNA 4OC5A 2ZUGA 1RU1A 3FCVA 1JB0C 1QM9A 2ZITA 3ISND 3HKWA 4H54A 2FHJA 4K8RA 5J2MB 1SKRA 2HHXA 4FWUA 1NZAA 2KZMA 2KI2A 3CC2S 3SV3A 3M9OB 2PVWA 1QSYA 2BXJA 2O4HA 2MZ1A 1Q2YA 3D8PA 2IC3A 3VAFA 2ZH7A 1N32F 4KGKA 1IBKJ 4B02A 2YPYA 4C8NA 2IHR1 4MHPA 3AA8A 1RAFB 2BUEA 1TFWA 2B8PA 1NEEA 3T6JA 3JQMA 3OXGA 1CPZA 3W5YA 3AQOA 1NE9A 5K8NA 2J9DA 3HK2A 1WOOA 1WTBA 4JI0F 1S10A 4RBVA 4OLLA 3NGUA 3CTRA 3NY0A 1S57A 1Q7LB 3PRTA 3NCPA 4HHHA 2ARHA 4FYWB 2MQNA 2E5LJ 3BQ0A 1YBUA 4YB1P 4P71A 2HRUA 3C6UB 5H9FK 4GO5X 3A1YG 3D0IE 2DNYA 4J91A 4KVXA 2AFSA 2RIJA 2UZAA 2NSCA 2M70A 3DLEA 4RLEA 3E0KA 2LEAA 1SL2A 2HQFA 4PSXA 1HNWJ 5KTAA 2QLBB 2PFDA 3L3CA 1WDDA 1HARA 2R8HA 2I2YA 4DV1F 3FNNA 2DNHA 4PCQA 1NJYA 4ZPTR 3VWSA 2ROPA 4C2XA 2EUIA 4MYTA 1WG4A 1S5KA 2CVEA 2H5JB 3GIKA 5EWFA 1V3SA 1R6YA 3DFEA 4J9NA 2W2PP 1KVKA 2DGQA 2V4RA 3ILIA 4F4YA 2AF6A 4R6TA 4H4KC 3R2CJ 5F41A 1T9XA 1Q53A 3D4UA 4FAIA 3MCMA 3CJ4A 4KE5A 4ECYA 1YK9A 3A8JA 4K4TA 3DRYA 1TL5A 2ZELA 3FIXA 4I1TA 3E2EA 4EEYA 4I6AA 4ZVHA 2VFSA 3PJXA 4LFAJ 1WACA 1TK5A 1T3NA 3UDEA 4DOZA 4PXCA 1QSLA 3FGVA 1DFDA 2FT0A 4PPZA 2KXHA 3KK2B 4HLBA 4MCSA 3N4WA 2EK6A 2AFXA 4F25A 2PEHA 2PIIA 1Q82T 8AT1B 4BLGA 3VWEA 4DYOA 1U4BA 4DN9A 1C0TB 3MUTP 2V9WA 3QSIA 4C9DA 2PJ3A 4YQWA 3SSRA 2GHVC 1L3KA 5J8CA 4AB7A 1XMBA 3IWNC 3MM9B 2LA4A 3HX9A 2V8VA 4P75A 1U1OA 3UD5A 1VHFA 1JJCB 2IMOA 1Z4RA 2WONB 3PRVA 3KLIA 5DJBA 1VFJA 1Y9KA 4CLLA 3UN5A 4ECWA 1W2BR 2AEJA 4USVA 4E0AA 2KJWA 1EP4B 4KJIA 1RWPB 2F8EX 1KP6A 2FB0A 4OYPA 3WIVA 3MPUB 3BH6B 3GONA 4I7FB 4QYZJ 3ZTOA 4CAFA 3N01A 2REEA 5HJYA 4PK3A 4DNCA 1VQKS 3GCXP 1ZPVA 5K5MA 2WVCA 2NPFA 2HHHF 2W9AA 4BDPA 3OFFA 5E3QA 4DG1A 3QO9B 4DR2F 3OVSA 2ZOFA 2HHSA 3GPAA 2XNRA 4I67A 1XFOA 2DT9A 5E41A 2YKOA 3I0SA 4RO0A 3KHLA 4KUBA 3G86A 3R5GA 3I4PA 4C2ZA 3AD9C 1I51B 1RWUA 4ZVTB 3UN3A 5ADZA 4FUUA 4DPXA 4ELTA 4K4ZA 3TUZC 3DN9A 3A9LA 4X4TA 3HSJA 4RUBA 1NK6A 4IUSA 4DL6A 5B0AA 2YKAA 3CUNA 3FQKA 3BZQA 5KT2A 3UWTA 5D4NA 3RW7A 4EMDA 2E1MC 4PUOA 1CULB 4DFMA 4P2XA 2AJ6A 3QRRA 3BO3A 2ZH3A 2FJVA 4B3MF 2JFDA 3ISNC 1DTQB 4DFKA 1FKPA 5DETA 3SHPA 1HKAA 1M5VC 2LMIA 3I4HX 3HULA 2KO1A 3JS9A 4GS4A 3I6PA 4DV4J 2NXNA 2GJIA 3H5UA 1YGYA 4NZ6A 5G20A 1NU4A 2PT0A 3ZNUA 3PB7X 1RT5A 4F36A 3BGOP 2QYCA 4CGMA 4WTYA 5DGAA 2V4JB 1UJ5A 2VG5B 3IR7B 3JSBA 1SV5B 2DGTA 1K73T 4D3GA 1U6FA 2ZVIA 2B7BB 1H0HB 2VKZG 3NE8A 4OYIA 2VICA 4DBQA 4ZVFA 3W65A 3HF5A 3QAYA 3DOLB 1KONA 2WAQD 1IKYA 3MR2A 2WOMA 3FJ2A 2UUAJ 3NOGA 3SZ2A 4G1PA 2C1EB 3TC8A 4B5PB 3S6FA 5D6GA 5E3RA 3AJ1A 4HACA 2P6SA 3C15A 1Y4ZB 2CJ9A 4YHHJ 1F1BB 2C2DA 2Y0MA 4IDKA 3M4XA 2MKCA 3N6NA 4NJQA 3T9NA 5LOQA 2BR0A 3ZZIA 5KFEA 4CO5A 2ZJRQ 1QD1A 4MK7A 5F8GA 2R7TA 2PIZA 2Q6CA 4JI3J 3LUYA 2OPSA 3IIBA 4FKXA 2BJEA 3D66A 4K4SA 2Z3NA 3PB9X 1FX4A 1B0TA 2E5GA 3FF3A 5KT7A 4RW7B 3C14B 4AXJA 4A46A 2PN6A 3F0AA 2Y1JA 4K0KF 2YY3A 1MG7A 5HH1A 2MQ8A 4DV6J 3TANA 3RU0A 3FEDA 4ZS6A 4MRIA 4O0IA 2GA7A 2ZH2A 2DIVA 5H84A 3NOCA 2G0IA 4KYZA 5A0YB 2PJ7A 5CABA 3KKFA 2QLJB 4KKOA 3BGLA 3ILJA 2OKQA 4DV3J 3CDBA 1YJUA 4RR5A 5AT1B 3H0PA 1KVIA 1VQLS 1I1GA 1GT8A 4OC2A 1IBCB 3A13A 1UPMB 4WP9A 3T3FA 3K58A 2ATRA 4L6V3 1Z8LA 3MD1A 1OO0B 1V6HA 4CWBA 4ZIWA 5E5NA 4L3NA 3TOBA 5KFYA 1RISA 4J9LA 1XNRF 2ZW4A 4R8UB 2I5JA 2P9GA 3ELHA 3TO6A 4DUZF 4UZBA 2EFGA 4KIAA 4M5NA 1CLFA 2XMKA 3CMQA 1RT2B 3MPDA 2OPPB 4JI4F 4JXQA 4XPCA 2VZ9A 2AJQA 3BYPA 3O8WA 2BQUA 1VQPS 1V9OA 5GAEU 2HWHA 3DLEB 3ILOA 3TEHB 2Y1IA 2V2VA 1YBAA 2DR8A 3FSXA 2XO7A 2RS2A 5JPHA 2NXJA 3M2VB 4NCGB 2EC2A 3Q2TC 4WXOA 2HRYA 3KG0A 4NGTA 2R8JA 3O2IA 2FVSA 2HC9A 4WIQA 4B17A 3QRQA 1KUXA 3FYNA 4JJXA 1TL7B 1S97A 2XM3A 1IVZA 4Q5VA 4DL7A 4KB7A 3OXFA 2GGPB 4OJ1A 5DDOC 1ELOA 1Q16B 1UFLA 3PFOA 5RUBA 2E5JA 3TVYA 4F02A 2RQMA 1M1HA 1HBNB 4DL5A 3HP6A 4IQMA 3TO9A 1F3VA 4YS2A 4F3MA 1OY9A 4Y28C 5AE1A 1UVNA 3H59A 2YNCA 1H3DA 3VZHA 2ROGA 1FFSB 2GVDA 2ZJQQ 3HZGA 2CPHA 3L7OA 1S6QB 1O51A 3FECA 2JEWA 2B8QA 3KLFB 1Z8XA 2BEFA 5GAGI 2E44A 3QWPA 2VD3A 1IKWB 2GHWA 2AFMA 3PG9A 4J9VA 2VEZA 3C6TA 3EC4A 2JBKA 2RT3A 2NZ4A 2NZCA 2RDDA 4GC7A 4YB7A 4GMKA 3Q8UA 3H4BA 1H8LA 1IIDA 1KZFA 2HQDA 4IG3B 1IWAA 3U1NA 3CC7S 1IM6A 1FRXA 5C25A 3Q89A 1NHUA 3PW7A 3T8WA 1A9NB 4MMOA 4X4SA 2FJDB 2MGZB 5DM6Q 1H2VZ 4N7TA 4LFCJ 5CQGA 2C2KB 2LXIA 1LFWA 3KMQA 1S6PA 4TLQA 4FXDA 4KGMA 2JDDA 2WB1D 1SJ3P 4NRUA 1R8HA 2CJYB 2L9WA 5IT9U 5H9EJ 1BE4A 4LR9A 1EJ7L 2ZBRA 1EP4A 2HV2A 3D9BA 4B14A 1VISA 5FDLA 3FMWA 2PVVA 4HYKA 1U48A 3D28A 2FJAB 4UFWA 3QLHA 2KG0A 2B9WA 3PEJA 4EO6A 1H38A 3HFVA 1M5KC 5LSOA 3TUIC 4WXWA 1X4EA 4FD4A 1JLBB 4ZY2A 3CSKA 4F9UA 1I21A 2HFSA 1TKZA 1WEZA 4XPDB 1H7XA 3I5CA 1U24A 3MHYA 2O1PA 3DKDA 5HMXA 3M8QA 5HROB 4C48A 1IQTA 4QBJA 3MMBB 2AFOA 3DI6A 4ED0A 2IPOB 4QIWD 4F8ZA 4UOGA 3DLHA 5A76A 3FKBA 1BGXT 2XNQA 4OC3A 1U0HB 2NQPA 4G3IA 3IBWA 4CYPA 3M05A 4NXMF 1S0MA 1D8YA 5EC4A 1VKCA 3JSMB 3MPYA 5A8WB 2K06A 1ZM2A 4DX5A 3EM1A 4ZX8A 3W5ZA 2MLZA 4CTAB 4OLOA 3PYDA 4HHUA 5BYQA 1MSWD 4Q44A 4JI3F 2A18A 1DTTB 4JI5F 2E9TA 4PWDB 1FD8A 1Y5LB 2WW4A 2NREA 2WVFA 4MFQA 3EFAA 2R2TA 2IA6A 4LF7J 2HNYA 4P45A 4JI6F 3HI9A 1IYKA 3LP2A 5B0DA 1FTRA 3Q2SC 4P52A 2K8GA 1WWZA 2AT1B 3FSIA 1ITPA 3HHLB 1ZM9A 2J7UA 3B35A 1F0XA 5AJ3J 3LWLA 2EPIA 2YWKA 1UVLA 3QJPA 1X9SA 2YNGB 1OWXA 4ECZA 4UOCA 5IB0A 2XG8A 4CH1A 3OTOJ 4B3RJ 1F5AA 1V5IB 4ZDNA 4LF5F 4Y2IA 4NE9C 2FY8A 2ZW6A 3IN5A 3QT5A 3MR5A 1CVJA 3BKFA 1N6QB 4AQYF 2B4VA 3FQLA 1EKSA 1P9YA 2YX7A 5G0RA 2VL1A 4ZPVR 4WFBQ 1YG0A 4QWDA 5LMNJ 1RAHB 1BLUA 2PJ5A 5FD1A 2DNQA 3MEKA 4YEAA 4J9KA 3IG1A 3FEXB 4X62F 4MK8A 2WUUA 1S7NA 2BRKA 3L09A 2KVIA 3R1LA 1WHVA 2QRRA 2PQ8A 1S72S 4CLPA 3DU6A 2G3AA 4M85A 3MM9A 5GMDA 5AE3A 3I9SA 2DNZA 1Y7PA 3C14A 1X4FA 2ZBQA 3GJRB 1HHTP 4LBIA 4TVAB 3HSGA 1TV6A 4CM2A 2M8HA 1SQHA 2LEPA 4DUKA 1RAAB 3H5YA 2QG9B 2PE8A 2QJ8A 2E1PA 3ZJ0A 3IGRA 1D0EA 4NASA 1B99A 4YFUA 1NAQA 1NXIA 4A38A 1QUVA 1VIOA 5CHCB 3S8SA 4QU7A 4KPCA 2HNZB 1DARA 4NL5A 1ICEB 4WPAA 2O28A 3PHTA 5J1PA 5HN0A 1ZAWA 3OTOF 4B3RF 4B08A 4AVAA 4B9UA 3W2VB 4A8XA 3M6WA 4JV1A 2MQPA 4C68A 2EFOA 4PXBA 3HLUA 4RNMA 3THPA 3TRGA 3HSZA 4FYVB 4DUZJ 2MSSA 4OYZA 1J2VA 2CIJA 1M0SA 2AGPA 3SQGA 2I5JB 3R7SB 3I82A 1WKJA 1Y7EA 1IM4A 4ZCIA 2CUYA 2Y9HA 2XLKA 4LRAA 4LIWA 1Y3JA 1EHWA 2J0WA 5IM0A 4CLFA 5KG6A 1Q1KA 4DU8A 2IDEA 4EO8A 3OFHA 4HNXB 4A39A 1YJVA 1XTZA 1RHRB 4OZ3A 1K44A 2FHKA 4ZKAA 1NZ8A 3CW2C 2KM8C 2D3ZA 1S0VA 3HLPA 4NXMJ 3EUNA 2QFJA 4L75A 3C16B 1VR6A 3MUMP 2G9DA 2CJKA 2BE2B 1S76D 2FVQA 3M2RB 5KT3A 5KFDA 1YHQS 4CIOA 1NK0A 5C2CA 3CD5A 1XEZA 1C1BA 3UO0A 1Q86T 4NXYA 3DSBA 2OR4A 5IS2A 5GMEA 3CVKA 2JLGA 1ACMB 4UFVA 1CG2A 2Q04A 1JXEA 2NCKL 3H8GA 3PJ9A 4I7FA 1RZMA 4YFJA 3DXBA 2IM0A 4C0BA 5ITHA 2D4OA 4PG5A 1H2UX 1JKHA 3R3TA 4E8OA 2XEXA 2XY7A 2VG7B 1U1RA 4JZ0A 2XMVA 3DLKA 2BUNA 4NA1A 2YQ3A 3QO9A 1HWJA 3QATA 3DHWC 4DCOB 4YU9A 3NCRA 5M2RA 1LWFA 2R8GA 2HWTA 3FFIA 4MT1A 2GV1A 4ZPDA 3THTA 1I3OB 2QL7B 3TI0A 1RAOA 2AQ4A 3CDEA 2VC0A 2V8DA 2GLJA 5KFTA 1RT7A 1RSCA 4JI8F 2MLYA 2U1AA 5K8PA 4WF9Q 4FPRA 5LYLA 1SJ1A 1WC5A 2KRRA 5D29A 2VC1A 4DR3F 4X4PA 3MM5A 1DLOB 1XWLA 3OJSA 5DDPC 4EFAC 4GVLA 1KHVA 1F2HA 2DIUA 4B5OA 1M5HA 1FJ7A 2NR0A 2R7OA 3HT0A 2KFNA 3TARA 2RSQA 3PFEA 3B3SA 2HWIA 3RRKA 3DXSX 2DK2A 3K7RA 1ZPWX 2BV3A 2V0NA 2DJWA 1YZ7A 2HS0A 3U7JA 3ZC4A 2I8EA 1DQ9A 2PEBA 1IKVA 4AL7A 2QGFB 4MFPA 2JOQA 4USMA 5LT5A 1VQNS 3IO1A 2QV6A 1VC6A 4XK8C 4CQ1A 4JXRA 3W66A 2C2ZB 2E5LF 4NGRA 4CLSA 3AFGA 2X3DA 2VBXA 2VQEF 2MZSA 3WBZA 2XMTA 1JJ4A 4KSIA 4LBPA 1YMEA 2ZEFA 2VQEJ 3SEOA 3ZZOA 3OR1B 4EFDA 4HACB 4R0EA 1PYSB 4R25A 2E1RA 4ERDA 5F8IA 1NH8A 4G1IA 3MMBA 3WC5A 2KJVA 2CWKA 4Z65A 2FQQB 3KHXA 1H2TZ 4A4JA 2FJEB 2VQYA 3W60A 3LMSA 3WC7A 1FHTA 4KVOE 4LRBA 3JAMU 2HHQA 3PZJA 3V6HA 1DHMA 1RHMB 4QU6A 3PYFA 2A0FB 1EQ0A 2XYHB 4K4WA 3NXZA 1G3OA 4FDFA 3T1AA 3GE9A 3G8WA 1YJRA 2YX1A 1UWAA 3M2VA 2A4NA 3QNWB 3OUYB 3D2MA 3LGNA 1JLGB 4MY0A 4XTTA 2FD2A 4DR2J 1T02A 5HP1A 2KT5A 1IR2A 2E7XA 3BS9A 1NB2A 3D1QA 3W9JA 3J7AN 1RT4A 5KT5A 2VASA 2OSRA 1PU9A 2B0GA 2FVGA 4JI6J 3G8TA 4JI4J 1CBKA 2W9BB 2I1RA 2DHGA 4WKYA 3BR8A 2LDYA 3V4MA 1FNXH 2BCOA 4WBFA 5JGFA 3BKUA 3RAXA 2RE1A 2MQMA 1R31A 4MKBA 5E96A 4OJGA 2GC8A 1YQHA 2L08A 1MW7A 2KHDA 4GVBB 1JLCB 2C22A 1JNRB 3IXQA 4QIVA 4KUAA 1LAMA 2HAFA 3UPFA 1H72C 3B3VA 3G4SS 1RK8A 2YNHB 2AW0A 3MTKA 1LW0B 1A6LA 4DPWA 4CO4A 2R7UA 1FDBA 4ETZA 4LF7F 3PYEA 4URGA 3V4IA 2IVMA 1TK0A 1H74A 1EE3P 3OL7A 2GANA 4XAKA 5E2QA 4PZVA 2PSWA 4ZITA 4CM0A 1SVDA 3BSAA 2OPRB 2P0WA 1WF2A 4F2SA 2GZOA 4TKTA 4UZCA 2ZD1B 1QMUA 5EWGA 2KG1A 3MOZA 4H4OA 1KSPA 4MFBA 4B9TA 2HGNA 1S1XA 3GG1A 4U9ZA 1FRJA 1XBUA 3HVTA 4Z2XA 4XPKA 4M6GA 4KOXA 3PW2A 3WHIA 3O5TB 2G2ZA 1TQLA 3BREA 3BPSP 2ERRA 3D3CJ 5KG2A 5C7PA 1APSA 2M9KA 1SV5A 4KORA 4WTOB 3G6ES 1IKXB 5DO2A 2DGXA 1FX2A 2CQ3A 4NZ7A 1BO4A 2ZDPA 4ENOA 1X60A 2DNMA 2FL4A 4ZMMA 1KQSR 1QE1B 4LFCF 1NHVA 3I32A 5KFAA 2W8LA 1RUSA 3R9FA 5EN1A 1NLKL 4KOSA 1UJ4A 4FBTA 3MOJB 1RTJB 2GREA 1X4DA 3W8PA 4K2XA 4OIXA 3U1MA 2GAHC 4AUKA 2DPJA 1J5EF 4XPLA 3WX8A 1NK7A 1DAXA 3PACA 1HNIB 2AJ2A 3BJ7A 1IKWA 3TZYA 2V68A 1TKJA 2XZDB 1FNMA 2HK2A 2J8NA 4ICLA 5G1ZA 3HJFA 5LRGA 2ZWPA 3FCWA 5IB9A 4P74A 5IM0B 3GKRA 2Q4VA 4CLWA 3FBUA 2CG4A 3A8IA 4MCQA 3QGHA 3DNCA 5DS0A 1OY6A 3L4BC 4AFFA 4X65J 1OBRA 2QIFA 4KQZA 2YX4A 2HEKA 1V3RA 1C1CA 3HKZD 3U02A 5A2QU 3TYTA 2PJ4A 2J7WA 4JUZA 3D0GE 3NNHA 3IWWA 2HBRB 1XQIA 5KTDA 4DPUA 3H7HB 2XEJA 3IAM9 1BUXA 2LU1A 2MZRA 5GAGU 3C16A 3CJKB 4Y2AA 2R4FA 3V6DB 1WG5A 4RU2A 4AG7A 2CY2A 4DQPA 3NA6A 2EW9A 1JXVA 4PWDA 4YDXA 3MEEB 4DR5F 3ZZYA 1XC9A 4X66F 4R3KA 3D4JA 1T11A 4BBHA 4DSFA 4RNNA 5A8KB 2DKOB 4UIBA 2KRBA 4KSFA 1HYSA 3EVMA 1RO5A 2VDHA 4KOWA 4I68A 5DG8A 1VOMA 5ISVA 2BACA 4R8FA 3VCDA 4DX8H 2QL5B 3MAAA 4X62J 3FXTA 4NCZA 2D3OR 3DOKB 2HZAA 4UW2A 4ECSA 2DGWA 4WKRA 3HHLA 3FBFA 4FXVA 3P5TL 4AQYJ 1HWLA 3UCZP 4ZJOA 3OTDA 2ZUAA 7AT1B 1NBEB 2AFUA 2AZ3A 1SJ4P 2YH1A 3BHXA 5F3ZA 3H42A 2UVWA 3RRHA 3S6GA 3DI6B 4RW6A 3B8HA 5CXTA 2KYXA 2MZJA 1U0HA 5BR8J 1FEEA 2F9DA 3R95A 4AYBD 4MFJA 1C0UA 3CIZA 1QAXA 3T1YF 4IH7A 4KV8A 4RBTA 5AG5A 1EETA 5M2PA 4RL1A 1UCNA 3BSOA 4V19J 1GX5A 1UEVA 3M8YA 4KHRA 3I56S 4KHPF 1BPMA 5L1JA 4QR2A 3DCAA 2VZYA 4BC9A 5DRKA 1RWKB 2OEJA 2H51B 2LECA 1K1QA 5F8JA 3MM5B 3GCWP 4ZBGA 3UNGC 3PX6A 5DQIA 1UFKA 1SIZA 2HHTA 4E98A 4OL8A 2ATCB 3SJGA 2Y3YA 2UVUA 3OFGA 4EYHB 2JHEA 3DYAB 3SI1A 2ZZMA 4PXEA 1BQMB 5KOWA 3NFZA 1Q0NA 2EC0A 5F8HA 4LF8J 2CTBA 3HFKA 1FXDA 1CP7A 2DR9A 4E2FB 4O3RA 1B4SA 1BC6A 2C3UA 3G9CA 4JYWA 4XPDC 3RR8A 1X10A 4RNOA 4NLRA 3NS6A 2GMJA 1U1QA 2ZJPQ 5HATA 4CYOA 4I69A 4P4IA 3W2VA 4KTQA 3GJSB 4M94A 2E7VA 4NLQA 2I6WA 3DM2B 2MJUA 4R0JA 1V5VA 2OZGA 2WPXA 3LGMA 5D0HA 3EMTA 1K9MT 5ETRA 1VJWA 2A3JA 5I3PA 2XGQA 2MY7A 4HHJA 3Q8YA 3LWUA 1F9HA 4DSKA 2KB2A 3UDLA 5IFMA 1J5OA 3GWCA 3KUHA 4DL2A 1N5TA 4OFZA 4ID8A 2MKKA 6AT1B 3PP9A 4V1Ak 2HVHA 2VUGA 1WF1A 1EB0A 2OPQB 2M88A 2RHSB 2ZEPA 4Z37A 4MXUA 3JQJA 4ITSA 2NLWA 2NUUG 1SQGA 4XIUA 1U47A 3TVZA 3ET6A 4ANCA 3CCLS 2CA9A 3CNQP 2KHCA 3M1VB 1ZLIA 3UI3A 2X7BA 2ZHBA 3EY5A 4L8AA 3WT4A 3R5CA 4YMEA 4P10A 4OI0A 4M3SA 5BWAB 4ZVSB 5K9FA 1LCPA 2AJ0A 2EFVA 3SFUA 2W4DA 4B13A 3GR0A 2BANB 2CXAA 4LMZA 2JSXA 3PB8X 2UUTA 5FDLB 1UA1A 3OL9A 4ZJLA 4QYRA 2RQCA 4BCAA 4L76A 4DSJA 2MQQA 1T9VA 2Z57B 4C8LA 4MHYA 2ZE2A 2Q7SA 1JKHB 1TIQA 5J2NA 4X4RA 4ZGYB 1REVA 2W2NP 3DLKB 2EXUA 4P4JA 1N0VC 2W4PA 5HI7A 2ATLA 1HBMB 1YDLA 2ZDOA 4DFJA 3W9IA 5HANA 4ED3A 2GIQA 5KFMA 5GAHI 4B9NA 4J90A 4V19X 3G8SA 1KN6A 2YH0A 2GO8A 3CO0P 3NBPA 1FWLA 4Y2KA 4IO1A 2FZKB 2KT3A 4NCBA 4TNUA 3EX7B 1XN9A 2P2CB 5FIIA 4MCRA 3CCWA 3FEZA 2V69A 1M4GA 3KLHA 2PJ2A 3PVXA 5H1SV 5KG0A 3MFIA 2VODA 4PYAA 4W98A 4ECRA 2FY1A 3ZTSA 1KUYA 4OZNA 5K14A 2A10A 2XYGB 1FJEB 5M2UA 5HXDA 4RN7A 1FXLA 3CD7A 4LF8F 3OV7A 4PWUA 4GKJJ 4IKAA 2HKEA 2MPUA 4YP3A 1HQ2A 3PNIA 1WF0A 4X4VA 2RKIB 4HPSA 1RTDB 3JTPA 5LYIA 2QYVA 5IWAF 2CNOB 4M5IA 3CO9A 4Q38A 1P1LA 2K3IA 2CIMA 3EZ5A 1H6KX 1FT8A 1RABB 2ANPA 1HPZA 3EO4A 1UEKA 2AYMA 3QIPB 2ZW5A 4DJLA 5J2QB 2UVVA 2YKMB 1I1DA 4A8QA 3KASA 3KJVA 1OY8A 2CZVC 2E66A 4R57A 3MPWA 4I49A 1WEXA 3CWJA 4YGOA 4JOUA 4CRJA 1MNEA 3P6YC 2GCFA 1VRTA 4MFKA 2E29A 3PIPQ 2OGUA 3TEGA 2XEIA 3FFIB 1HNIA 1TKTA 2OTJS 2YKPA 1VBZA 4X4QA 2CDRB 2EKYA 3SBMA 3NAHA 4TY9A 3PO4A 1NSAA 1TF9A 3UR3C 4K50A 1RHJB 4ZPCA 2V2ZA 1GK8A 1IWGA 4HVZA 2WPWA 4IHMA 4ECTA 5D77A 3OW2R 4NLDA 1VHSA 3RB0A 4OJHA 4UQGA 1QTMA 1M5PC 4OI6A 1YX0A 4HT7A 4NLYA 1FRKA 2DBBA 1F5BA 2OHDA 4Y49B 2JDJA 2G2YA 1T03B 4I2PB 2QZ8A 4P4BA 2Z30B 2CG8A 2Y0BB 2UUBJ 1UWYA 4DV2J 4UA3A 1QSOA 1FKOA 1UETA 4KGXB 3MMJA 1O5JA 2CQGA 3CCJS 3HCXA 1U1PA 2R7SA 2MKSA 3BPDA 4QPXA 3CCMS 3FSYA 2DY9A 2HSEB 7FD1A 1EKRA 5C82A 4OC1A 3V81A 4KC5A 2PJ0A 5HO4A 2AYEA 4DV5F 4OQJA 1HD1A 3IM9A 3NGKA 3TR5A 4K30A 2YNFB 3BJYA 1PYTA 2C2MB 1S9FA 2RUGA 1B3TA 5DM7Q 1IB1E 4CRZB 5JVHQ 3OL8A 3FB3A 1PJ5A 3SIPB 4DX6A 3AXMA 3LP1B 2LQJA 1Z5RA 5G22A 2V77A 1WG1A 3HVAA 3L2NA 2X51A 2KYZA 2XULA 3OR2B 2PJCA 1OZPA 2QTWA 5MAOA 4IUFA 5H9EK 2BL1A 2V4QA 3H8EA 4PV6A 1ELLP 2CVIA 2V67A 1QSNA 1RYRA 3GB0A 2IFXA 3DRRB 3V7ZA 3GQCA 2UXCJ 2AJ1A 2FVPA 4MAKA 1TR0A 1K8AT 4ED8A 3NEKA 2RDIA 1ZAVA 3CCRS 2BQ3A 3FX6A 1S1XB 2BE9B 3LTOA 5KG7A 4USHA 2PE3A 2ZH8A 1CX8A 4UUWA 3CPAA 1JWQA 4NGQA 4ZVOB 1J5EJ 3PDNA 5ETSA 1FE0A 1B70B 4JYAF 3R6GB 1UVJA 4OKOA 3IGNA 4NYPA 3C19A 3UVJA 2CPFA 2ZBIA 1HHSA 2RS8A 2P6EA 3KR5A 5F47A 1NPPA 3P3DA 1JLAA 4DPOA 2ACMA 2FPHX 2ILZA 4C97A 3CXCR 2HQ3A 4N56A 3QGGA 1UVIA 3TCVA 2YKNA 3K2YA 2Z2MA 1ZETA 4ILRA 1S9GA 2DCLA 5LM7E 3MEGB 4EGLA 1RYSA 2J8MA 1F6TA 2REFA 3GYAA 1YJTA 4FXWA 2RRAA 2AV5A 5D4OA 4JD6A 2GVZB 2OEMA 4Q7AA 5H86A 3ZZTA 3D0HE 2C6GA 3KLEA 5KFVA 3T5KA 1XJWB 4LQ3A 1XR7A 2I00A 5LYFA 2BQRA 3PB4X 3MMCB 1PUAA 1VC5A 8CPAA 5HQLA 1X0PA 1L0CA 3TTHA 2CZ9A 3C8YA 3T19A 3TJ8A 5KFOA 1GXLA 1SJQA 4NLOA 1FERA 1UP1A 3BV8A 3KWMA 1S49A 2B5GA 1M1GA 2OB0A 1MU2A 4P2MA 1S1VB 1J27A 4IO9Q 3FBCA 1W2IA 1NKEA 2HFOA 2B4BA 4QR0A 2MEWA 3G6YA 2IM2A 3DNSA 3MR6A 3MEEA 2UUBF 2UV8A 1ZA2B 3TZZA 1OYDA 2IAJA 4DL0C 4IRCA 3D7HA 2HPUA 3HFZB 2GFQA 1VRUA 1WORA 5J2PA 2VPYB 3FEYB 1X4BA 3K5NA 2UV8G 5CD4A 3VGSA 3UDCA 2GMHA 1RT3A 4DPTA 3DOKA 5ETVA 1N52B 1RTIA 5IWAJ 4UT4A 1F2PA 1HMVA 4IH6A 3QJLA 4KPYA 1OYEA 4KO0A 3GFZA 2PC1A 2B4DB 4IOAQ 3BJ8A 4Q43A 2DNPA 1YR0A 2EI5A 4YOEA 5KFLA 2ZH1A 4OX6A 5C42A 1UW9A 3M30B 1SI9A 3C6UA 1S0OA 1FI4A 3A3NB 1OJ4A 4AL6A 2BZ2A 1WELA 3UQSA 2JRSA 4HH1A 2IMWP 4LQ6A 4MI4A 2YBVA 1R57A 1HD0A 2Q4ZA 4Q2MA 5J1QA 1AYEA 1CULA 4RW8B 3K57A 2EVZA 2VFRA 3C66A 4CYNA 4IF5A 3DRPB 3B54A 4WFXA 4I0WA 1PILA 4O4GA 3E01A 1N48A 1WHWA 3P8BB 1VHIA 2H65B 4ZCKA 2IYIA 5DLFA 4GKJF 1XR5A 2YQ0A 3LALA 1AROP 1RWMB 4FP9A 4W4MA 5G4DA 4LF6F 4RKUC 2DXDA 1G4CA 2NS1B 4DL3A 4WK1A 2EBJA 3LODA 4R7MA 1QAIA 1NRKA 1VYAA 4FD6A 1HBUA 2PGCA 3UD4P 1S4FA 3OT9A 1N5QA 3PBEA 4ZVEA 3KJNB 2XI3A 1WWHA 2KT2A 2I3CA 4LR7A 3KGQA 4M95A 4DXLA 1HNZF 3EWGA 4URSA 1RAEB 1U1NA 4B11A 4HDGA 3JRUA 5I3UB 2I38A 3Q23A 5ETTA 4MCPA 4U8YA 3FZBA 2QECA 4BMHA 2G4BA 5B0EA 3BR9A 1SC1B 3DRXA 4OC0A 1Q8BA 2OMOA 3NE7A 4A94A 4I56A 1CSJA 2CNMA 2Z2ZA 4IR1A 5EMIA 3DLGB 4B10A 4PG4A 3BKTA 3MM8B 2VG6B 4M5HA 4KSEB 4A8WA 3CGIA 3A8EA 3AB4B 1HI1A 2DNOA 3LQVA 3I9V9 1VDHA 3ET6B 4L74A 1U2CA 2IRUA 2PJ1A 4CGPA 4NLPA 2XB2D 4DX7A 2B9XA 1FK9A 1VC0A 1T03A 4DR7J 3L95X 3KLIB 4WFAQ 2R1IA 4C8ZA 3LH2S 5GADI 5E33A 2WBMA 1TL4A 1B6BA 3PR5B 4AVBA 3PX4A 1UL3A 1FKOB 5L38A 3ZFVA 2B43A 2H4YB 5LJ3Y 3PEHA 4DR4F 4TNOA 1TVRA 4DQRA 4IFVB 4KKOB 4AD6A 4QWEA 4MH8A 4C0OC 3GIJA 3IU2A 1X5OA 1ZBTA 2M3DA 2DR6A 3MZIA 2CQIA 2ZE2B 2ZXVA 4F4ZA 4YR2A 2QMUB 3SSQA 1RXTA 3KUEA 1P27B 2U2FA 2BOPA 3B2YA 5CZVA 2V63A 4R8UA 4M5MA 2EO8A 4A8FA 2IVFB 2QVPA 4KOUA 2HNDA 3H8YA 1RAGB 2OPPA 3DGPA 4UOFA 1CJUB 2CDQA 4QYZK 2JJ4D 1S7IA 4USUA 3Q0AA 3CCVS 5CD4H 3T6BA 3B3WA 3M8RA 1SJFA 4LF4F 3R5BA 3A12A 3NBPB 3VAKA 4KLWA 3NMAA 3FRZA 4OYOA 1YGHA 1JNZB 1UAWA 2HHWA 4B3TJ 3WC6A 4K3NA 3GFHA 2Y1LB 2WONA 4C8KA 3HSDA 3I87A 3DRRA 4CH7A 3CCZA 4ED7A 1D1UA 4C0HA 1D9DA 5MLCV 5J2MA 4OMEA 2PI5A 4A8SA 3P96A 5IX3A 1HBOB 3ENAA 2P6GA 2PMHA 3DRSB 1YI2S 4DL4A 2F63A 2VV5A 4TY8B 4PEOA 4CLTA 4PQUB 1TL7A 3FMBA 3UY5A 2GQQA 4LJMA 1U7LA 2GGPA 3B4MA 4C98A 2L9NA 1Y5IB 3KHGA 3FK4A 2R7VA 2VBQA 2F7VA 5F09A 1FWKA 3GZ7A 1UVKA 6CPAA 5DG9A 2AYGA 3QIPA 1RACB 2JL9A 1R0BG 3D54A 2PI4A 3KJVB 4R3LA 2W2MP 3POTA 2YKQA 2V8PA 2I79A 4C7HA 1WC0A 3WR7A 1S7KA 1IXKA 4LSNB 2F4VJ 2ZNZA 1NDCA 2DGVA 3H5SA 4BC7A 5IQ6A 2ZVSA 8ATCB 1X31C 4MKVA 2BW2A 4HEA9 2XLJA 1A7GE 2QA1A 1FVSA 2DF5A 2QMXA 4ORFA 1F9EB 3LF0A 2VONA 2L9DA 3W2WB 2N3OA 4B3SF 1ZA1B 4N41A 3LACA 3RBEA 4BWJA 1DRZA 1U1LA 3HMJG 4ECUA 3CCSS 3JQKA 2Z0GA 1X9WA 3R9EA 3ULHA 1RLCL 1S0NA 1F9FA 1ROFA 3PR4A 3KLHB 3CJ3A 1PG5B 3FCHA 2FTRA 3KDOA 2G9OA 3M9NB 1RBAA 1S1TB 5GADU 2ADCA 3PBBA 3CDUA 1NDKA 1FEHA 3DU5A 4DF4A 1VI7A 3F73A 2DEJA 2Q4YA 1S1VA 4CRYB 2BMBA 1HNVA 1QQ9A 4K4XA 2W7OA 4QR1A 3VAMA 2CJXB 4RZRA 2KVQE 4ZVUB 2DH8A 3M6VA 4ILLA 3FRYA 4PG8A 2GMLA 5KFQA 3PYGA 4I6YA 2DO0A 5ETMA 4U67Q 4OX9J 4WYLA 1S99A 4ER8A 5KOXA 1NJIT 3R1KA 2PDAA 5J2QA 3HUVA 1R27B 3QLHB 3E51A 3C46A 2VJVA 5DWMA 3CCUS 4CCHA 3RBUA 2RRNA 4F0KA 1DURA 2CRLA 5B0FA 4X4OA 4U9YA 2DRAA 3KL9A 1RHUB 5DZ7A 1PSDA 2IJZA 3MDFA 4DPYA 5HROA 1XIXA 3T1HJ 2D7SA 3ZTRA 1SH0A 2W24A 3IS9B 1HWUA 3J7A1 3VAGA 4ES2A 5HJXA 2JLMA 2FVRA 5A28A 3IBFB 4F8RA 1GMVA 4GC6A 2ZC3A 2MKYA 2PJ9A 2SXLA 3JSMA 3QPIA 1LANA 1O0PA 2UXDJ 1YVFA 4USKA 3JUWA 4FD5A 2DHSA 3VALA 1SQFA 2ILYA 1F57A 2JVRA 2MQLA 4WWVA 4HR2A 1GYTA 1QVGR 3F41A 3BLNA 2VIHA 4XPEA 4A31A 3DRPA 4DV7J 2HAIA 2VQFJ 1DTTA 1WC1A 5HQ8A 4YDDB 1HEEA 4GM5A 3ENQA 2W7PA 5T41A 3DHXA 5F8LA 1X4HA 2LQ9A 3W91A 3X3UA 3QAHA 2CPJA 4ILMA 3V81B 2XMMA 2GHPA 3F44A 1RA7A 4I2QB 3UVJB 1HBNA 3FJUA 4OYAA 1DE4C 5KTQA 2POKA 5DWNA 1N5VA 4B3TF 1JMTA 5SZTA 2RC4A 4EK2A 4CZCA 1KS2A 3NGTA 4EYIB 3GIRA 2L48A 2NXCA 2G2OA 3AA9A 1P0HA 3M2UB 4A32A 2HRTA 2WSFC 4KSAA 2V8GA 2O67A 1RT2A 4P72A 2CTCA 3UCUP 4M6HA 5J1EA 3ZZRA 1N8RT 2CQ2A 4JI2F 5IV3A 1N6QA 1YITS 3B6BA 2VG6A 2C3PA 4LRFA 4MK9A 1P6TA 4M63A 3CJSA 1VQ8S 5KFKA 2WK4A 4ELUA 3PCOB 4RW9A 4LF9F 1X5TA 1FFGB 1SIWB 1IICA 2HGLA 4HTJA 1S1UA 1FDNA 5F49A 5KFBA 1P4NA 1HA1A 3CC4S 3IRWP 5C88A 2KKHA 1X4AA 1FKPB 2E9RX 3AODA 4CNZA 2DR7A 1MU2B 2ZEEA 2ASJA 2KL8A 2ZBCA 3QT8A 4MBUA 1HWKA 5CA5A 4C8YA 4RX6A 2DTJA 1RKIA 4RBUA 1PJ7A 1ULRA 1FWPA 1UVMA 2R3VA 1FRHA 2DITA 2PC6A 3OHBA 4CT8A 1Q8LA 1RTDA 2YNCC 2RDJA 5GMKa 2BRLA 3GJTB 4CYUB 4IFVA 4LVOP 2JVOA 4ED4A 1HW9A 4TN2A 3N5BA 3TZXA 1DBDA 3RO0A 4UF4A 4TYBA 2YKMA 4OZLA 4BWMA 1YJ9S 3MPVA 3PO5A 1VQ6S 4N5SA 2R7XA 1TKZB 1Z8WA 4CO3A 4UEEA 5KG4A 3KK1B 4UWIA 2PMZD 4C8OA 3TUPA 2V2KA 1U8WA 2WHOA 2M52A 5IC4B 3OWCA 4HI2A 3EXCX 3ZO7A 2ZEDA 5LRKA 1CS4A 1RT1A 4NMXA 2R7WA 3CPXA 1CJKA 2CYYA 2JDCA 4DR5J 2HVIA 4QC6A 3QT7A 4QZVB 3RB4A 2X1GA 4YR3A 1S79A 2JC1A 4B3MJ 1BWVA 2JLEA 1XIQA 4Q0BA 4JI1F 3QFWA 4LSZB 2OLWA 4LSLB 3KQXA 3OTBA 3CXQA 4IOBA 4QCLA 3IP0A 4PWWA 2F3JA 3E8OA 1VLOA 3DC2A 4OI4A 2PJ8A 4ID5A 4NGSA 2K7KA 4FBEA 5HVHA 4NEZA 1D3WA 1CJVA 2PJAA 3IBCB 4A30A 1XNQJ 4UQTA 1KQKA 3AHPA 3SV4A 3KJQB 4O4GB 2L41A 2LKZA 3O1LA 1IJFB 1SH2A 1UFHA 3WC2A 3W7BA 4F7VA 1UJ6A 3NNCA 4DV6F 1ZLHA 1FA0A 5L1IA 4HH0A 2WSEC 3KG4A 1FF2A 1TELA 2W1BA 3JB9k 1NHKL 4C3LA 2J8AA 3NH8A 3MF5A 1AXQA 4OHYA 1LXJA 2FC9A 2RILA 4A95A 2FCKA 1GEHA 1M5SA 3GIIA 3MMAB 2EVNA 1HMVB 3LANA 3AT1B 2CPXA 2FJXA 4GO7X 4OMFG 3MGJA 4Y6IA 1WC4A 4B6ZA 2H4WB 4QB9A 4JI2J 1I5OB 4QW8A 4F2RA 3KKWA 1K47A 3BGRA 1Y10A 2VZZA 4CLYA 4ZY1A 3M30A 5A2QY 1UWBA 2OIHA 1G1XA 1Q79A 4AXIA 2IRXA 3CJTA 4MKAA 1R6VA 5H9FJ 1RT6A 2MHNA 4UWJA 2EKNA 1RHKB 2X7IA 4H89A 1FJGJ 2CF4A 3BSCA 4NCAA 2X1AA 1XBWA 2YNEA 2QYGA 5A8WA 2EFPA 2ASDA 5BJRA 1XNRJ 3JVNA 1CC8A 3KLVA 2NYHA 3ICLA 1U45A 3KXDA 3BDPA 1GXTA 4ZVRB 1B7FA 2MDAA 4DI6A 4WFYA 5E7OB 5D3GB 2D3UA 3WQPA 1JX4A 3FRMA 3ISXA 3D2PA 3IRXA 2AJ4A 1P1TA 4DSIA 3D7SB 4OYMA 4MHDA 3V8IA 4LBHA 1XE4A 2XC9A 3CJ5A 4KVME 4NJRA 3NGDA 5HL7Q 5IT0A 1TVRB 2VJUA 2IM3A 2D3O1 3KQZA 1NPRA 1PCAA 4ZY0A 1TL3A 4ZOSA 1R0CB 3OPKA 1JLFB 2HNZA 3ZZ0A 1SC3B 1GMWA 5JQ4A 1MWZA 1TKHA 2BE7D 1VQSA 1Q4RA 2J76E 1N5YB 3AJDA 2A1BA 1SBRA 2WYRA 4D3HA 3P45B 3LPYA 4WU3A 5EDWA 4CYQA 2B6AA 1CQNA 3MEGA 1TKDA 4NRTA 2QL9B 2O3DA 2JWNA 2FGCA 3PRDA 3RUBL 3SQOP 3T1HF 1T9YA 1GAOA 1TKXA 1MWYA 5KFPA 1RAJA 5AE2A 2CNKB 4N47A 4TXSA 4ATNA 3PV8A 2OZUA 1X9MA 5IXUA 3R6LB 3L7PA 4IG3A 1S9EA 2WCXA 1KKHA 2J0QD 2PDOA 2EG1A 4YWYA 2VFUA 2EFNA 6FDRA 1SH3A 2CAJA 3AJ2A 1FTCA 2OEKA 2BJ8A 1FK9B 2JH3A 4TLRA 2Q79A 2H48B 3D68A 3VATA 5DDQC 1LOUA 4X5KA 3NMRA 4WFZA 3LOUA 4JYAJ 4DS5A 3THVA 5AG7A 5EX3A 1F60B 3AD7C 2W4CA 3CD0A 1IBKF 4ELVA 2HLUA 1RHQB 3QNVA 5J2PB 4OLPA 2HQGA 1AB8A 4NLTA 3CPWR 3VAJA 1N36J 5B0CA 2E5HA 1WNEA 1NSLA 4DSEA 4NI2A 2WRMA 1SPBP 1N0UA 1N32J 2QMLA 1JQGA 4NLUA 3DDNA 3MURP 4CLKA 1S6OA 2Q7BA 3QZ7A 1UZHA 3OVAA 4U6PA 5KT4A 5HVGA 2LCWA 2Z58B 2HLTA 3MR7A 3D7GA 3HZEA 3PJWA 3T9YA 5I42A 4C2YA 4XNHB 2FYXA 4II9A 2UU9J 4BD9A 1PJ6A 4KY3A 4L73A 1T9UA 3D2WA 2HNDB 2AU0A 3GYXB 2FDNA 1YLXA 3KOAA 3TJ9A 1LW0A 4JI5J 4ZN3A 2QIRA 1NJXA 2NYQA 4WP3A 4ED1A 2UP1A 1XMOF 4WE1A 3S7RA 3KHZA 1GMWD 5DS7A 2FLPA 2QLFB 1PO6A 2O5DA 4DZ6A 4FYDA 4Y49C 3JTNA 4OZJA 3VV2B 1QLNA 1GNKA 1M1KT 2J9EA 5C5JA 3W63A 2VBYA 2YWHA 5LSLA 1VMBA 4DWIA 1TAUA 4ZVPB 4C3KA 5CYMB 3WZ0A 2DHAA 1DLOA 3NP5A 4DR7F 4FYYB 1RB0A 2NXEA 1C1BB 1GHEA 3DR6A 2DHHA 1ZZFA 3KFWX 2HW3A 5B0BA 1BHNA 3JTKA 3HVTB 2XWXA 1S7LA 4YUDA 4YRHA 4OHWA 1N54B 1NSPA 4KBIA 1S5ZA 4FS1A 3C26A 1LWEB 3K17A 2ZHAA 1SL1A 3HVWA 5LSRA 4ANDA 1KBRA 4F3QA 2HHUA 4J3GA 2XCPA 2Z3PA 1PGZA 2C28A 4A8MP 2JC0A 2E5IA 4OC4A 2ALZA 4H4KA 4MFLA 2OTLS 2H3EB 4M5KA 5KFGA 3RNZA 1WDTA 2IY5B 5HLFA 3KJFB 2VOOA 5D15A 4EZ6A 2IYGA 3PW0A 2D1CA 1YRXA 4FPIA 1S60A 3GV7B 5HMNA 1LQ9A 1KNZA 3D6HB 2BYCA 2CQ0A 2UXBF 5DG7A 1VHEA 4NA2A 1QSRA 1KVJA 4K5RA 1B0PA 1X8DA 2YPZA 1PKUA 1S77D 4AE5A 3ETOA 3NS7B 2OELA 2HIYA 2OH1A 1NSQA 4KH0B 4LX9A 4QIGA 1UKUA 3P2HA 2VKRA 3TX8A 1TUVA 4ONUA 2MMYA 2VPZB 4P4FA 2MY8A 3VZIA 1UA0A 4CDIA 3OUYA 3PEIA 2WVEA 1R0AA 3A8KA 3RB3A 3LP0A 5JUMA 2YWGA 4O4RA 3R1HA 2FLLA 4IRDA 3SXOA 2Z3LA 4P7VA 5F0WA 3DLLQ 4KR0B 3IEHA 3RTVA 4KH1B 1X5SA 3H2VE 3T5HA 1VBYA 1UEUA 2W9BA 3G87A 4CH0S 2EWBA 3MAAB 2DHXA 4TYAA 2GNKA 3KUGA 3B82A 1Q5YA 3DMJB 2XMUA 3LWMA 4JWPA 2J0SD 3Q22A 3KMSA 4OHXA 1HQEA 2ZM6J 3EJMA 1L3SA 1BQNA 1IBLJ 9RUBA 1HIYA 3SCJE 4ONWA 4NFRA 3GV5B 2ZNYA 2V2QA 4RW4A 3M2UA 1ZS6A 3K8WA 1KLMB 2KN4A 5K8OA 3GG0A 3DGPB 3BGRB 4PYDA 2YNHA 4IK2A 1S3ZA 4DDFA 1AFIA 5L39A 2COLA 1BLLE 3MN8A 2PR1A 1HL6A 4H6ZA 2V50A 1BOBA 5AJ3F 4M5DB 3R97A 3GV8B 5HK4A 1IGBA 2PO4A 1WC6A 2D9OA 3TAMA 1S1UB 1RADB 3F8KA 1FDAA 1U8SA 1X12A 4GKKF 2GIVA 2AHOB 2BE2A 3O44A 2OI2A 2ZD1A 5D3GA 4Y2CA 4AXVA 1TP7A 3BBCA 2LEBA 4F50A 1B7YB 1GH8A 3RZAA 5CNPA 2C42A 4IFYB 1ZTTA 4TU7A 2IBKA 4KHPJ 2EK8A 4P6YA 2CFXA 2C6PA 5KFNA 3QAEA 3JYTA 1WKLA 3J81U 1QSTA 4ZVGA 1D9FA 2AJFE 3A3PB 2FHMA 4N76A 4UOHA 5L1LA 1QSSA 1PYOB 5JXSA 4DR3J 1MJ9A 3MECA 1LWFB 1CJTA 4JV5J 4ZVQB 1AZSA 1KR4A 4JI8J 4X4NA 3EZUA 4LFBF 2HBQB 4FKYA 1YWXA 2AZ1A 4DV0F 1ARLA 2GLFA 3ZXWA 2J0XA 1T95A 1DQ8A 2XO6A 3MM7B 1XERA 2UVRA 2OPRA 1LEOA 3M1VA 4DLGA 2K3KA 1UTAA 1I94J 3J80Y 2LXFA 1ZOTA 4DS4A 4LVNP 4KFBB 4DZDA 5J8FA 2HS3A 4KRWA 2UXCF 1PAEX 3EYZA 3QIDA 3V6DA 2C6CA 3VVTA 3M32A 4ZYQA 2F8MA 1IBMF 1KOHA 5GCNA 3KLGA 4P7TA 5EGYA 2WZNA 3K8VA 3KNAA 3PM9A 2CZ4A 2F4FA 4PG7A 4FBUA 3SDEA 4MTPA 3MD3A 4OJ3A 4QIFA 2ZOMA 1M44A 3D3BJ 3MM6B 1FJCA 3JXOA 2DNRA 2ZKTA 4DR6J 2PD1A 4NI2B 5D4LA 1X4CA 3EE3A 4C11B 1U6BA 1YX2A 1IJEB 1KD1T 2Y0SD 3BYRA 4L89A 4U5YA 2H54B 2C2RA 1MJAA 4IR9A 3EDQB 5KFCA 1U1MA 5L9NA 1MROA 3GSDA 5E0OA 3AOBA 3IS9A 4ICLB 4A8KA 2W8KA 3PY8A 1WD6A 1K0TA 4YY3J 3IR5B 2D4PA 4OZ1A 1S1WB 3BO4A 1RT6B 1Q5VA 4Q0BB 2C2NA 2DXQA 4WE1B 2I9SA 4M6IA 5HMWA 5CYQA 1B87A 4Q2LA 3CJRA 2C2EA 4RS2A 1EETB 3DGVA 2ZZTA 4J9UE 2BBEA 3M8SA 5IT9Y 3CJKA 3R8YA 1XJOA 2QN6B 3EXYA 3M8WA 5T14A 1TL1A 3TW0A 1TKFA 4O23A 3IWGA 2NYIA 3W8GA 4ZK7M 1YK3A 4DV4F 4NEYA 3VQSA 2G0CA 4PK2A 4NF1A 3OBIA 2OZHA 2CJQA 4MKYA 4NLGA 3EVOA 4UBRA 2V5HG 1ZO0A 2ODFA 5FVJA 1RT5B 3FZ2A 1KFDA 1D8ZA 1G6BA 2DRBA 3RG6A 1L3TA 2AD9A 5CCMA 1XOVA 2LU2A 1S48A 2PA3A 4ZLPA 2OO4A 2XMWA 5F3TA 2KXFA 5T7LA 1HR0F 3HT3A 3FDSA 1VS3A 1VBKA 2W01A 1CEZA 1OQ3A 5LYDA 1Q7LA 4OP4A 2F9JA 4HL9A 2VA2A 1OIAA 2BJ1A 3NGRA 2APOA 2RFHA 5AGEA 2EBGA 3EICA 1TMMA 5EBVA 4H4MB 2HMIA 1W25A 2ZFHA 4KV8B 5HVFA 2J6TA 1EARA 1S4EA 1SCJB 2FS5A 4RW9B 3HD1A 2BJ7A 2MKJA 2W25A 1LKZA 4E0DA 1P8GA 5HSPA 5IC6B 1WSRA 4ED5A 4U96A 5EWEA 1QAJA 3CZXA 3CXPA 1N33F 1L5UA 1X0FA 3ITHB 4J9QA 1CBXA 3SXLA 2DB1A 4WU2A 4I2PA 2ZC4A 4J9PA 1WSVA 4UCNA 5AXKA 2ZWOA 4DR1F 2XTJP 1HLWA 1BQMA 5LXYA 3PX0A 1RJJA 3BI1A 4DV3F 2HFZA 4I6WA 3IJ3A 2MJNA 2CQHA 1KTQA 4Y2MA 5F8NA 2O53A 4Z7CA 2CNLB 4CP5A 4F4XA 2DXEA 4ZP8A 3TE4A 5ELYA 1FRIA 1N56A 1ARMA 3IWEA 4DEZA 4JI7J 4X2TA 1W7WA 4K0KJ 5AXMA 3QBCA 1N5YA 4LF2A 4U7CA 1JXLA 4O3QA 1RCOB 3DM2A 5CAAA 1RTJA 3W1YC 3MI7X 3KK1A 4MJKA 1N88A 3WC0A 2DGSA 3R7NB 3AH6A 4K59A 4EBDA 4PSWA 2D9PA 5HMYA 1R3NA 1KTVA 2IIHA 2NSMA 2VA3A 4P6QA 1H7WA 3PW5A 3EPIA 3O3LA 1T9TA 2FE7A 1E6YB 3I0SB 3KNGA 4Y65A 2R2RA 2BJDA 3KI9A 3CCQS 4LF6J 4JBCA 4NEXA 2DH9A 2VFVA 3J7ZT 4TQRA 4LSLA 4CPAA 4CS0B 2XYPB 1F3FA 5J1NA 3QGPA 1UW4A 3GTYX 4MYUA 1VQ4S 2PMWA 2OJ3A 5DQGA 3PKMA 1SKUB 4QPTA 4NOHA 2XQCA 3S6HA 1WEYA 2ZM6F 2BVZA 1ZG7A 3RB6A 1ON0A 3CULA 3AAWB 3A3OB 3G8QA 4FNHA 5KG3A 2ZH9A 1Y00A 3UNYA 2EBEA 1RWVB 2XI2A 3RGIA 4ZI6A 2PIYA 2DNGA 2IBOA 4R9MA 2LLZA 2FJBB 4ZCLA 4FF3A 2LQ8A 1RTQA 3MFHA 4NPOA 4AT1B 4ZLJA 4KZTA 4DV1J 1J4JA 4ALZA 5BYSA 1GTHA 1SUQB 5LMUJ 1Z4UA 1FO1A 5J2NB 1HNWF 4P9SA 3D1HA 1REVB 2V9KA 2R8IA 4RI1A 3BO2A 3HHNB 1T94A 5SUHA 3LGHA 4DU7A 4C8MA 3TQ1A 3R2DJ 4LFBJ 2N4CA 1TUGB 3GJQB 1M4LA 2HS4A 2R2UA 3U1LA 4EU0A 4PAAA 4CLUA 1UWBB 2V8HA 1C0UB 2OFHX 3KLEB 2JFKA 1AFJA 4O3NA 4O44B 1QTNB 4JI0J 5DQHA 4JLYA 4DQIA 2B9EA 2GE3A 3CIMA 4F6AA 2UXDF 1C4AA 2OPSB 2DRDA 3I0RA 2XZWA 1LFPA 2G13A 3DOMA 2O01C 4UTGA 3KTQA 2RUSA 1F2GA 3QZ8A 5ETLA 1R89A 5IZHA 4USIA 3VGTA 5K14B 3N0VA 2XEGA 4Q8FA 2OOTA 4KGZB 4IOCQ 1AW0A 3Q83A 2PRBA 1DTQA 2DCUB 2ACYA 4LF1A 5KFZA 3CD6S 4OYWA 1SJRA 3LP0B 4M1KA 4ZLLA 5ETOA 1IUJA 1BQXA 2PSZA 1CPXA 4DV0J 2X1FA 1QSMA 4RPFA 3KLGB 4MHZA 1RAIB 5A0YA 1Y11A 4B9VA 2GX8A 2IAJB 3M8PB 2ZZNA 3WIUA 3CJQA 2JEGA 1Q95G 1VQMS 3SDEB 4RUCA 2IVYA 3MM6A 3K9UA 4U9RA 4OHZA 2H5IB 2AWZA 2DNLA 5E3CA 2OD6A 2YNFA 3BN4A 5F8MA 4NXNJ 4USTA 1PYTB 4NLXA 5CH7B 4A2ZA 1SKWA 2Z2LA 1PAUB 1XMQJ 4FF1A 2ASYA 2CKWA 1U2RA 1ZTWA 2MSTA 4J9SA 1BQNB 3S6EA 2PJ6A 4X8IA 3KK2A 3CDWA 2VB6A 3PGPA 4CAWA 1RU2A 1U6ZA 1RP5A 3MCSA 1LXNA 3PTWA 1FT7A 3H90A 3LW5C 1S59A 5FLXY 3P5BP 1WOPA 1S9EB 4WZQA 2ZW7A 4GKKJ 2HZVA 4OADA 2O66A 1L3VA 1JLQB 3GMGA 3GU0A 4MIWA 1NJZA 4P2FA 3J7YU 3I3GA 1KQFB 3K5OA 3QFHA 4P4DA 4K4VA 2Z56B 1KHWA 4ZX9A 3FVYA 4L72B 2OD4A 2N7YA 3TAMB 3ZNJ1 3BM7A 3IGVA 2MKHA 3VAHA 3BSNA 1LWXA 3I9ZA 4RJVA 3H2LA 1HR0J 4UUXA 4FS2A 4X4UA 4FD7A 2YNDA 2WB4A 1OQ6A 4O0NA 3TVKA 2B3UA 2P9EA 5KFUA 5AXLA 3N6LA 1JJ2R 4E2AA 3LPEA 5LRJA 4FVCA 3SI0A 1HBUB 1H73A 4F0HA 3NL0A 2CNSA 1BAVA 3T41A 1MMDA 1T3OA 3JYTB 4UY85 1TAQA 1PC4A 2G0BA 1XMTA 1JLAB 5F48A 2J6UA 3PHEA 1BXNA 3CJ8A 2K2PA 1VQ7S 2RAQA 3S6KA 4DG1B 1A2ZA 5I42B 1QVFR 2QMWA 4NLVA 3V2UC 2OMLA 3QJJA 2KFYA 4WZMA 1Y9OA 1N34J 4OI2A 2BDPA 5A27A 4LQ9A 2B9YA 1XK8A 2FLOA 2GQ2A 1KUVA 1AZSB 2RF2A 3LP1A 1GFWB 3B4DA 2FHOB 2AFZA 2KH9A 3MM8A 2HMIB 5CBMA 3RJMB 3NH4A 3Q8RB 2QLWA 2Z11A 3TO8A 4KT0C 1NMEB 4BBYA 1FE4A 3MMCA 3HHDA 3GIUA 1JJHA 4ED6A 5C25B 3BN7A 4K4UA 4PUOB 4RUHA 2BKNA 3HHKA 1YJWS 2G1DA 1C2PA 5CYMA 4PABA 2K5TA 5KT6A 2Z3MA 2MGZA 3KZWA 4DN0A 1MK4A 5B08A 3TX0A 2M0GB 3ITHA 1S6PB 2DD8S 3HHEA 3TNVA 1TV6B 4LRCA 1CC7A 3IR6B 2MLXA 4FZVA 3SSSA 4X2BA 4ECQA 3GP9A 3UD3P 3QSYB 2F5IA 4M5GA 4JI7F 2F40A 2JZ5A 2RKIA 2FIAA 1VBXA 4OAEA 2MHEA 1RWWB 4F0MA 3W3SA 2HIQA 4WJBA 2RB7A 4JV2A 2BSWA 4FVMA 3GFYA 2C3YA 1Q8IA 1BD6A 1HPZB 3AB2B 5EX0A 1RA6A 3Q8PB 3GLJA 5JMNA 1UFWA 3TA2A 4H2KA 3K0JA 4KOVA 1R7IA 2BEIA 2MKIA 1KLNA 3B7IA 3R9LA 4W92B 2YKNB 4HKQA 1VLYA 2C2OB 4F3OA 4U7UK 4B5PA 2DGUA 1OPIA 2I0XA 3CXSA 3SQGB 2DY1A 3HPOA 4KO0B 1RCXB 3FBEA 1VQYA 5KAKA 4YB5A 2Z0ZA 4UCMA 1RTZA 3SI8A 5D0EA 2F65A 2HQIA 5JJBA 1M4DA 2J7KA 3HXMA 4OZ5A 1S1WA 3Q8VA 2CADA 1C4CA 1EX8A 3BF4A 3G82B 1XRYA 3NCQA 4KAIA 3MM7A 5JM6A 3H98A 2ZEMA 2R2SA 4UEZA 4NXNF 2R7QA 5LJ5Y 2QFIA 3OHAA 2XHWA 1PBAA 3R27A 3S9NA 4ECVA 1AMPA 4LR8A 5JVGQ 2BOAA 2XGPA 2N4DA 1JLEA 3E01B 5KFIA 3AQP