5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amidase, hydantoinase/carbamoylase family
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
2GLFA 2PJ5A 3D7HA 2PJ3A 3FEDA 3SJXA 5CPAA 5LYLA 4IHMA 2ZOFA 3VARA 3SJFA 1LFWA 3D7FA 3HLPA 2ZEEA 1UWYA 1XRYA 4RUHA 4NGQA 2HB6A 5JH9A 5HXDA 4MRIA 3K2KA 5JM6A 3S9NA 2OR4A 4NGMA 2PIZA 2CF4A 2XEFA 1YLOA 5THWA 3WABA 4H2KA 3FX6A 3CT9A 2PRQA 5DS0A 5HVHA 4NGPA 1Y0YA 2Q51A 4R6TA 3B2YA 4Q7AA 3CPAA 5D29A 1XFOA 4WJBA 3FMCA 1QQ9A 2ZOGA 3PB7X 4JZ0A 2JEWA 3IEHA 2XEIA 4MHZA 3KQZA 2HC9A 1KWMA 3KL9A 4IAVA 1CX8A 4A94A 3RBUA 2V77A 3LMSA 3BI1A 1AYEA 1Z5RA 3FEEA 3SI1A 5CBMA 1H8LA 3HUVA 4OIWA 4OC5A 4R7MA 1BAVA 5I4MA 3BHXA 4P4EA 4X2TA 4PXDA 1Z2LA 3ISXA 5K8PA 3KGQA 2QVPA 3PBEA 2PJ8A 4OP4A 2PVVA 4F8ZA 4NGTA 3D7GA 1LAPA 3DGVA 3SI0A 3D67A 1TXRA 4OC2A 1ARMA 4ZY0A 3V38A 3GLJA 2F8HA 2EK8A 2ZEGA 2V8HA 2QJ8A 4ZY2A 3PBBA 1F57A 2EWBA 3D7DA 3B35A 4UIBA 1LOKA 1VHEA 3B3SA 1OBRA 4A39A 4YWYA 3JRUA 4DJLA 2GU2A 2J9AA 2V8DA 2BO9A 4JYWA 4NGSA 1CPXA 3B3VA 4PQAA 3KQXA 1VIXA 2QYVA 2ZEMA 3CDXA 3PB6X 3B3CA 1CP6A 3WC5A 2GREA 5LRJA 3WC7A 5JGFA 3PRTA 2PJBA 2PJ6A 4Z65A 4PXEA 1M4LA 2C6GA 1IGBA 4UEFA 1Z8LA 2AFZA 1F2OA 3QNVA 3SJEA 3PFOA 3FVLA 2WZNA 2BOAA 4GM5A 2AFOA 4MXUA 1TKFA 3H8GA 7CPAA 1VGYA 1LAMA 4AXVA 3MN8A 2V8GA 3KI9A 2VL1A 1CP7A 3IO1A 4UEZA 4P4FA 3FF3A 4YU9A 1TKHA 1PCAA 3KHZA 1Y0RA 2Q4ZA 3NH5A 1XJOA 5LRKA 3KR5A 1QMUA 4NGRA 4MCPA 4P45A 2JBKA 3B3WA 1R43A 2ZENA 3TX8A 2ZEHA 4MCRA 3IIBA 4OC0A 5F09A 2WYRA 1ZG9A 2PJ4A 3L2NA 6CPAA 5LYFA 1IY7A 3GB0A 4LQGA 2O4HA 4TNUA 4BD9A 4P4DA 4OC3A 3NFZA 4DUKA 1FNOA 3T8WA 4NJRA 5K8OA 2ZEPA 4NJQA 1BPNA 3NH4A 3PEIA 3PB8X 2PJ1A 2ANPA 2GLJA 2PJ9A 2O53A 3FECA 4B6ZA 4R8FA 3WT4A 4PXBA 1ZLHA 4P4BA 4OKOA 1EE3P 4K3NA 4UEEA 2RB7A 4FWUA 4A37A 4UIAA 3NA6A 2OOTA 3VATA 3PB9X 4OC1A 4MMOA 3LWUA 4UF4A 3KR4A 2C6CA 1RTQA 2V8VA 1DE4C 4FUUA 4CPAA 4F9UA 3IJ3A 5K8MA 3S9MA 1VHOA 1AMPA 2ZELA 1HDUA 3SJGA 2F7VA 1TKJA 1ZG8A 3FJUA 5LYDA 4EMEA 4NGNA 5LRGA 4NFRA 1HDQA 2I3CA 1YMEA 2EK9A 3H8FA 1LANA 2PJ7A 4ZYQA 5IB9A 4P44A 3IC1A 2JBJA 1TF8A 2ZEDA 4PPZA 2PIYA 2ABZA 3PB4X 2PVWA 4X8IA 2IMOA 3SI2A 1ARLA 3B7IA 4G1PA 4OIDA 1NSAA 4A38A 4P4JA 1GYTA 1LCPA 1BPMA 1TF9A 2AFUA 3IFEA 4P4IA 1BLLE 1YW4A 4KSIA 4TWEA 1CBXA 3D66A 2XEJA 3TC8A 3K9TA 4F9VA 4P10A 3BXMA 4OC4A 3N5FA 2IJZA 2AFXA 4R76A 4EFDA 3V7ZA 1FT7A 2G9DA 4MHYA 1PYTB 2IQ6A 2ZEOA 4PXCA 3D68A 4MHNA 3FH4A 2PE3A 1Y7EA 5D8NA 5LYIA 3RAMA 3B3TA 2AFMA 1R3NA 2PJAA 5HVFA 3DLJA 2PJCA 4P6YA 4WWVA 4O23A 3MRUA 3BI0A 4MCSA 1Q7LA 5J1QA 4ZI6A 2PJ2A 1JQGA 4FBEA 3RZAA 1ZG7A 1ELMP 1XMBA 1ELLP 2FVGA 3IWWA 1YW6A 3CPXA 3GUXA 1F2PA 4DYOA 2CTBA 2AFSA 3KZWA 3WC6A 2XEGA 1HEEA 2C1CA 2CTCA 5K8NA 2NSMA 3KHXA 4MCQA 3PFEA 1ZLIA 3ISZA 4FAIA 2NYQA 2Q43A 4ZX9A 8CPAA 3VH9A 3D4UA 5HVGA 1CPSA 2RFHA 1CG2A 2POKA 4OMEA 4W9YA 4MHPA 3H8EA 3KASA 4ZY1A 3NH8A 2DEAA 2AFWA 4ONWA 2C6PA 5ELYA 1YSJA 3S9LA 2ZEFA 1XBUA 3I1UA 4EWTA 4X3RA 2CIJA 4ZX8A 1DTDA 4IK2A 2PCUA 2BCOA 2PJ0A
chains in the Genus database with same CATH superfamily
4E0AA 4QBUA 1V3ZA 1BQXA 2Z3KA 2DGQA 1QTMA 2DXQA 1UEUA 5CPAA 3MR7A 1PYOB 4CAXA 4ZHRB 4TNOA 2CZ4A 3EC4A 4NCGB 4OZ3A 2BM1A 1PBAA 1RWVB 1ZZFA 5ETTA 3OHBA 4UY8T 2ZBRA 4AL5A 2FXFA 3M8SA 2GHWA 4ELUA 3TP2A 5EUHA 3NKYA 2VQYA 4H2KA 3TO8A 1W25A 3MGDA 1MK4A 1MJAA 4C2YA 1VHSA 4KUAA 4KH1B 3K5LA 2OH1A 4DZDA 1T05A 2MKIA 3GCXP 3W5ZA 4DFJA 3QIPB 4J90A 2WCXA 1WKKA 1PO6A 5ETMA 4GKKF 4X2TA 1Z2LA 2CNMA 3D2WA 2MKHA 3KJFB 3EICA 2V2VA 2QVPA 2H5MA 2JFDA 2AHOB 1DQ9A 2WW8A 1RT3A 4OI1A 2QECA 3D67A 1M5HA 3QO9A 1OQ3A 2GO9A 1KN6A 3NEKA 2HQIA 3CJTA 4R87A 2EWBA 3DDDA 1QAIA 3AD9C 4C11A 3Q89A 3C14A 3OL6A 1HWIA 3JRUA 1WG5A 3M7VA 3N0VA 3PEHA 3G6ES 3CDUA 4H4OA 2KCWA 2ASYA 2Z56B 5MLCV 4CLTA 4NZ6A 1OWXA 2MKCA 1KHWA 4F4KA 4ED0A 1S57A 3IG1A 2AV5A 4DR7J 5D15A 3EO4A 4PSWA 1JXEA 4TN2A 1YRTA 5KFSA 2HZAA 3N01A 4C8KA 3SJEA 1HQ2A 5JPHA 2C3OA 4RPFA 4UUWA 1NU4A 1VKCA 2H54B 2HRYA 2YXLA 1REVA 3DMJB 4K4YA 2KH9A 3B8HA 3C26A 2VL1A 2QN6B 4P7TA 2W2MP 2M0GB 2OI2A 3UCGA 3PX6A 3NH5A 1UFWA 4B9SA 3UCZP 5LSRA 3PY8A 1Y7RA 3OTOJ 3B3WA 5KTDA 2ZW5A 2YH1A 1ZM4A 2WONB 1GX6A 1VLYA 2HZCA 3DM2B 3D1OA 3DRRA 2Z58B 3GG0A 5DDPC 2AE6A 4OV6A 2WVBA 4KR0B 3HKWA 1XBWA 4IYQA 3FRMA 4JV2A 5KG4A 4C68A 1N6QA 2RNEA 1VHFA 4LF6J 2ANPA 3MM8A 1Y9OA 3M8WA 1TUWA 2I1RA 4TYAA 1JLCB 3FYNA 2DNKA 2G2OA 4J5OA 4DR4J 2CPIA 2HQFA 2N7CA 3FFIA 3ZZRA 5HP1A 2H4WB 2LDYA 2MSSA 1RXTA 3R9EA 4ZN1A 5D4NA 1DE4C 3T5LA 2OB0A 5F3TA 3JTNA 3EZUA 2HS0A 3TWZA 1S7NA 2ZELA 4OX7A 2WOMA 4HNXB 2WPWA 2VPWB 4QOTA 2RF2A 4A8MP 4KOUA 2IPOB 1H2TZ 4O3PA 1NHVA 2ZBQA 4B3SF 4C8YA 1SH2A 4P44A 3IC1A 4B10A 3R8YA 1IOIA 1H38A 1SC1B 1DRZA 3NE8A 4H4KC 4HACA 3SI2A 2NXUA 4K2XA 2JVRA 4OIDA 2L48A 4MI4A 5AE1A 2YNFB 3PXGa 4MKAA 4KO0B 5J8CA 3DCAA 2QLFB 1TIQA 1NZAA 3NGKA 3OL8A 3EGZA 3HHLB 2HZVA 1ZAWA 2NLWA 3BXMA 2JVOA 1VQPS 4E98A 2R7HA 3H40A 2BYCA 3IGNA 3OFFA 4LF5J 5EHHA 4ZN3A 4EZ9A 2B4BA 2AMCB 4I2QA 5AT1B 4DV7J 1YRXA 3R5BA 1FRJA 3EVMA 1W7WA 4FNHA 3UR0A 2QC3A 1FKPB 3LTOA 2W7AA 2DCUB 3MPUB 2ZZNA 2HFZA 3C16B 4DNCA 1GXTA 1K8AT 1X5TA 4B12A 5G21A 2C28A 4LSZB 5BYQA 4WP3A 5JMNA 4DYOA 4EZ6A 3GJSB 3R9FA 3WC6A 4CLPA 1D9DA 2MY8A 3N6NA 4J91A 2ARHA 3MDFA 2OD4A 4JUZA 3DLKA 3KUEA 4NF1A 3ICLA 5D0EA 5L8RC 1ZAVA 2Q43A 2GIQA 5GAGI 3VH9A 5KFYA 3W6XA 8AT1B 1RQ0A 2OSQA 4TY8B 1G3OA 4BINA 1XIXA 2MTLA 3IRXB 3O8WA 1WWZA 2A2DA 3PZJA 2K5TA 1TK0A 2Y1LB 1DLOA 4V19X 4OI0A 1FI4A 1KOOA 2RDDA 4IK2A 4CO3A 4PRFA 4DR3J 1Y7PA 2DK2A 3E8OA 1SL1A 2JOQA 3MGJA 2KJVA 2GQCA 2UXBJ 3UDEA 2HFNA 2HQCA 5LYLA 2D41A 3J7YI 4GMKA 1HIYA 3MUTP 2B58A 4RUHA 3IR5B 3PEJA 3E01B 2OGUA 4FVMA 1X9SA 2XEFA 5EWEA 3ULHA 4AXIA 1N5YB 1MNEA 3DDKA 5J2PB 3IU1A 2MLYA 3AB4B 2WVFA 1N71A 4C6AA 3PKMA 4HVZA 2ZOGA 1SI9A 5F8IA 3QRPA 1GHEA 5KT4A 3QFHA 4DV2F 4OADA 4KGKA 3LMSA 3FEEA 2ZEJA 4DUZF 2CQ4A 1DHMA 4NLPA 3DDNA 3ISXA 4LUBA 1FE4A 4DL5A 2BEFA 2CPFA 1BC6A 3MPDA 1VQSA 1RT6B 2VICA 3DGVA 4ZIWA 3D6HB 4HH0A 4ANCA 4NLGA 4RBUA 2QJ8A 3JB9k 4DPWA 2CUYA 5IT4A 1DQAA 4IFYB 1AB8A 3GPAA 1AZSA 2RQCA 4EU0A 2RKIA 5I3PA 3S6EA 1IQTA 3W6SA 4AQYF 1EIYB 3DI6B 3PO5A 1HNZJ 3B8GA 4LR9A 5KFBA 4K30A 3NWGA 5IWAJ 2CDRB 1RHQB 2W4DA 3KQXA 2Z57B 4RW4B 2GNKA 3SSQA 2B7BB 4GC7A 2GREA 3WC7A 1FDBA 4ED6A 3K2YA 2DNZA 3MR5A 1N5SA 3F56A 4CO4A 3MURP 4NZ7A 4M6HA 2IJNA 2OH2A 3OW2R 3KWMA 3LA0A 3SXLA 1KUXA 3L4BC 1RBOB 1VQLS 2E5IA 1XNRF 3GIJA 4H6ZA 3ENQA 3QJLA 2B9WA 5HSPA 2P6SA 1N33J 3JQJA 1TKHA 3CCQS 2HIYA 2VD3A 2NMTA 1UETA 2LU2A 2Y8WA 2UUCF 3EY5A 1CJVB 2WRMA 1K73T 4UFXA 3CO0P 1K47A 2UVWA 2XCAA 3QGHA 2Z4PA 2NXJA 3D7SB 2EW9A 1WK4A 1WKJA 4M1KA 2FHJA 3HPOA 4J9UE 3GB0A 4Z2XA 2MSTA 2AJ2A 2KYXA 1SUQB 4CT8A 1RTJB 3R2CJ 1YZ7A 2CPYA 3CJ2A 2QA2A 1BPNA 3KYLA 3U27A 1C1CA 4Q44A 3NMAA 2FLOA 3BGLA 3WT4A 4QIGA 1BY9A 2AP6A 3VWEA 2LA4A 3BSOA 3D2PA 4K3NA 1S6PB 1BQNB 2JDCA 3VV2B 3EE3A 1L5UA 1UVNA 4OHZA 2PE8A 3KLIA 1BOBA 3DLLQ 3HHDA 2D4PA 1FRLA 3DNCA 2C3YA 2LEAA 2B3VA 1IKXA 4NXMF 5E0OA 2NXCA 3A12A 1JJ2R 1HDUA 1RHJB 4LRFA 5I3QA 3V8IA 3SV3A 1TU0B 2XY7A 5DQHA 2PJ7A 4JI6F 4ZYQA 5IB9A 3WIVA 2C3PA 3QNWB 1XMOJ 3BEGB 4H89A 2E1PA 3IAM9 4X4RA 2Y0MA 3FSIA 2PFDA 4ZLLA 3EM1A 3UFCX 1EZZB 2OELA 5C24A 1C0UA 3QSIA 4KSFA 4TWEA 2YKNA 4M5KA 4DL6A 2CJKA 3MAAB 3ZO7A 3A3NB 3HO1A 2J8AA 2XEJA 3K9TA 5JQ4A 2CQ3A 1ZOTA 5IX3A 4C9DA 1T05B 1YVOA 4DOZA 4B3MF 2AJ1A 4DR1J 1RT5A 4PUOA 2RJZA 1MROA 1IR1A 2IQ6A 3EWGA 4LR8A 1MMDA 2HK2A 1YBTA 4DUYF 2I2YA 3CCVS 5D8NA 3BKFA 2GFFA 4ZITA 4JXRA 3VAHA 4WWVA 5G20A 5DDOC 2XLIA 3TARA 1YITS 2IMWP 2VA2A 1R27B 2WAQD 3QO9B 2DT9A 2PJ2A 5HANA 1ZG7A 2Y1JA 3N6LA 1YBAA 1S6QA 3H59A 4A8XA 2E9ZA 3QLHA 2JEGA 4C11B 3CPXA 3C14B 3FZ2A 2QTWA 3KZWA 5FLXU 4JI0J 2BJ9A 4RR5A 4H4OB 2CNLB 5HQ8A 3IU2A 3CJ5A 3M2VB 2BBEA 3R7NB 3W65A 3ZZTA 4IG3B 1HR0F 3FXTA 2GVZA 3EVOA 4ICLA 4FDFA 5KG7A 1U6MA 4GRSA 3S8SA 5D0GA 4B9LA 3GU0A 3K9UA 1REVB 5IQQA 1RWKB 3H5YA 1Z9UA 5ELYA 2B4UA 3QAYA 1RAJA 4DV1F 2ZOMA 3W63A 1SKSA 3JYTA 4F0HA 1M44A 2JDJA 2KTQA 4UOGA 4LQ3A 2IRXA 4Y28C 2G9OA 3RB6A 4AB7A 3GKRA 2OPRB 1LFWA 3D7FA 4X2BA 1X0FA 3BGRA 4YB7A 4DFPA 3DRRB 1RHRB 4N5SA 2HB6A 1C4CA 2DPJA 3M30B 4CM2A 3WABA 4ITSA 1T9UA 2NSBA 1N6QB 4C7IA 4V19J 3TRGA 5AGEA 1FFWB 2CQPA 1B7YB 2BACA 1U09A 5KFAA 5DZ7A 2GMHA 2HFSA 2MQLA 1X4BA 3K17A 2Z3MA 5KFWA 2FHOB 4PKDB 2QRRA 4JI4F 4RU9A 2CRLA 3LODA 3TOQA 3AOAA 1N0UA 1PJ5A 1Z5RA 4IRCA 2EBEA 2XZDB 2DB1A 5I4MA 3BHXA 4JOUA 3ZTQA 1R7IA 2AX0A 3J7A1 1S9EA 4QUSA 4ZVUB 2BL1A 2R7SA 3NS7B 1JLAA 2LEPA 2O28A 1KVKA 3QGPA 4I6YA 3NS5A 3GE9A 4RNMA 5HMZA 2WOMB 2HVEA 1U24A 1KLMB 4W4MA 2G4BA 1T9YA 2RF2B 3J81j 4NASA 2ZM6F 3D7DA 1GEHA 3FEYB 3PW0A 1L3UA 2VOPA 4UCPA 2R1IA 4JYWA 4NGSA 2R8VA 4HACB 1D8ZA 2XI3A 2E9RX 3MTJA 1R57A 2M2BA 3CMES 4KHPF 2B8PA 2HG4A 3EGVA 2WZNA 2MJUA 3OXFA 2NPFA 2KJWA 2QA1A 1NMEB 1NSQA 2DGVA 3KG4A 2Z0GA 4WU3A 3BGUA 3BDPA 3FIXA 4NEYA 4UEZA 4P75A 3K57A 2IM3A 3MM7A 3QJPA 2D4OA 1KRPA 1ITPA 4J9MA 4UFWA 3R2DJ 2IFXA 1YREA 4DDFA 1SPBP 1WOPA 5L9NA 3T9YA 3DOMB 4KRWA 2EC2A 4QW8A 3CIZA 1FD2A 4RNHA 2X3GA 2UP1A 3A9LA 4TNUA 4BD9A 2U1AA 2EBJA 3TOBA 4XNHB 3A1YG 1D9FA 2GIFA 1VK3A 4DMZA 3TZZA 3T19A 1WOSA 2DXDA 2ZEPA 1RLDA 2XLKA 2ZW6A 2ZHBA 2VONA 4B6ZA 2E9TA 4NX9A 4UIAA 1TKTB 2DH7A 2ZDPA 5FVJA 2IRYA 1EQMA 1LW0A 4EI2A 2C6CA 2UUBF 3T9ZA 3H8YA 2J9CA 4F9UA 1DLOB 1EQ0A 4RS2A 4QW9A 1WHYA 5HLFA 3OL9A 1RDRA 4IUFA 1Q8KA 2DNPA 1SL0A 2I0XA 3L3CA 4OX9F 2EK9A 1S1XB 4YY3F 3G3SA 3S1TA 5KFKA 1Q2YA 2C2DA 2R3VA 1XEZA 2G2YA 2OMLA 3GV5B 3RW7A 3G82B 1S0OA 3TZWA 1HNVA 1VRTA 2XCPA 2XMWA 4WBFA 3ZNJ1 4ZPVR 2Y3YA 4LF7J 5LL6d 1WTFA 4HL9A 2DHSA 1I94F 4XO0A 3J80U 4B3SJ 2MZRA 3R1HA 2B4DB 2OAUA 2BXJA 4KH0B 3C6UA 2IJZA 1Q2CA 2PN6A 3V7ZA 4YQWA 4B5PA 2P9EA 4NA1A 2M88A 2KKHA 2PMWA 5L1LA 4PXCA 1IWGA 2VU5A 4C98A 4RUAA 4B9MA 3FVYA 1G6BA 4NXNJ 3K5OA 2PSZA 2KVQE 1UA0A 5F8MA 1B3TA 4KHRA 1XC9A 2XMAA 4G3IA 3JSMB 4FBEA 4IH6A 2I6WA 5ETVA 3VAGA 3E0KA 1AZSB 3UDCA 2RKIB 1R8HA 1N8RT 2BMBA 3K7RA 3CXSA 1KSPA 1FO1A 1IBCB 3RB0A 3NL0A 2VDIA 5BR8J 3KG0A 1SJ1A 4W98A 1M4GA 3QIDA 2DD8S 1WC0A 1X5PA 4RWXA 1IIDA 5A2QY 4PSXA 2VPYB 4ES3A 4NEXA 2QLJB 2ZH3A 2RHQB 2FZGB 3O44A 3OTBA 3DGPB 3LD2A 4O4GA 4OYWA 2HHXA 3E2EA 2QMWA 3CO9A 2KM8B 2A4NA 4DI6A 2UUTA 5BJRA 2PJ5A 4OZLA 4XPDB 4CRYB 2WVEA 5KFOA 3CF5Q 2HIQA 5JUMA 2R7QA 4WZMA 4NLQA 1WG4A 4CO1A 2Z2ZA 1TVRA 3ZNUA 4ES2A 1QSTA 2ZXVA 5GAEU 3ILOA 2GAGC 3Q8UA 4J9LA 1FRKA 1Y3KA 2GJIA 4PQUA 9ATCB 1BHNA 2QX0A 1QSOA 4YHHJ 4IR9A 3P45B 4Q0BA 4K7QA 4G1QB 3FMCA 2IM1A 4LX9A 1U6BA 2ROEA 2VBWA 3W9IA 1AROP 4KJIA 4WFBQ 2ZNYA 3QT8A 1Q8BA 4BCAA 3DOKA 4R7MA 1BAVA 2Q04A 2IC3A 1SKWA 3N5BA 2K1RB 1IKXB 2L41A 1B6BA 2AEMA 2GO8A 4NGTA 2XNRA 1HI1A 1NH7A 2HQYA 2UV8G 3TTHA 5DDQC 2PD1A 1QSSA 3A8EA 1AUSL 3DXBA 2IM2A 2G0BA 3GIUA 2NQPA 1OBRA 3KOAA 3NY0A 2HFVA 4KORA 1XTZA 3TJ9A 4F7VA 4DX7A 2NR0A 3LAKA 1MMNA 4GKJJ 3SDEA 2VQEJ 5IT9Y 1Q78A 4DSFA 2XS2A 2KZMA 5C24B 1JJCB 2YKNB 3U1LA 1CVJA 1N0VC 4B3TF 4IDKA 2QA4S 4D3GA 2YPYA 2ZH7A 1X12A 3PV8A 2V4QA 4C8ZA 3W8PA 3FMBA 3ZJ0A 1TKFA 1VGYA 4H54A 4PUOB 1MROB 2FE7A 2HWHA 1V6HA 2MDAA 3OTDA 1G2EA 4F4ZA 1NO8A 2ATRA 2AZ1A 3ZZPA 3R5JB 4YU9A 1YGYA 2XM3A 2XZWA 2OSRA 2RIJA 3M6XA 1XNQJ 4BHQA 3I6PA 2J0XA 2F3JA 4F4AA 2XI2A 2W2OP 2YX7A 1S6QB 1LV5A 2YH0A 4ZPWR 4C2XA 1RWOB 3QMQA 1FDAA 2FVCA 3OTCA 2XMVA 4OC3A 1TUGB 2YWWA 2FIWA 2K7JA 1FNOA 1AUGA 3JTPA 1TL1A 4N41A 2VG7A 2B4OA 5J1EA 5KG5A 1RHMB 3LP2A 1KQGB 1MW7A 1SC4B 3FC9A 2CKWA 2HVZA 1T94A 4R25A 4BWJA 1R8PA 1LW2A 4QR2A 4NCBA 4DFKA 3I87A 2GVZB 3T1YF 1Z1ZA 4MK8A 4ICLB 4MFZA 4L73A 1FCAA 5KFTA 2W24A 4NLUA 3S7RA 3AJ2A 1J4JA 1S4EA 1RUSA 1PC4A 1YJVA 3L7PA 2J7KA 2DR5A 2V2QA 3NAIA 3JYTB 3BV8A 4K4XA 2CQ1A 1FEEA 4U67Q 3HDSA 1IBKF 3WZ0A 3NNCA 1TKZA 1JKHB 2YNIB 3QAHA 1FKAF 4XDCA 3KLHA 3LUYA 4Q2LA 2I3CA 2Z2MA 3WR7A 4ZCMA 1ICEB 2KDOA 5E3AA 2GHPA 2ABZA 4OZ2A 4DCJB 1WORA 1ARLA 2CJQA 5D0RA 3OJUA 1I3OB 1A9NB 3K89A 1J5EJ 4B14A 4NXMJ 3PW5A 2MZ1A 2A6MA 3IGVA 3ZZ0A 5H9FJ 4TVAB 4Y2AA 5E3PA 1V5IB 3BS9A 2D69A 4ZVTB 3OFGA 3MI7X 1VQNS 2RRNA 3R6GB 2GQQA 3MM9A 4CIOA 2HNDA 2AFXA 4DEZA 1UZHA 2ASLA 4ZMMA 2V69A 4KSEB 2RRAA 2C2EA 3D1QA 1FJGF 2LP4A 2CIMA 2IRUA 3Q8RB 2Q4VA 3Q86A 1S9EB 5HQLA 3OXGA 3OVBA 3FRZA 2PJCA 3Q23A 2EFGA 1JLAB 2JZ5A 4CLFA 1FNMA 4C8NA 4C8OA 4U9YA 1B64A 3OFEA 3M8ZA 1NDLA 4DZ6A 2A1BA 2DCLA 1S7KA 4I2PA 3SHPA 2WSAA 2J9DA 4KOYA 1XR6A 3KKWA 2R8KA 4NLXA 4IR1A 4PG5A 5A8KA 4JI8F 4X64F 4JJXA 1IVZA 3A4TA 4LSNA 4M8LA 1VLOA 4NSQA 4LIRA 4DN0A 1Q16B 1T11A 2P8IA 3L7OA 5FIIA 1X5SA 1TMJA 2H65B 5GAHI 1P0HA 3KNAA 4ETZA 3R6LB 1HNIA 2ZFHA 3HMJG 1NCLA 4X4OA 3MM7B 4N77A 1FWKA 1YQHA 2HVIA 2D74B 4L75A 4NFRA 4FD4A 5C82A 2PJ3A 3BQ1A 4HHJA 2HSEB 2WHOA 4BC7A 4M95A 3H5SA 1MWYA 3GSDA 5C2GA 1ZA1B 2R7WA 3T3FA 4DR5J 2ZEEA 2HQGA 1VBZA 2AX1A 4URGA 5KFDA 1VBKA 5T14A 3S9NA 2CADA 3KHLA 2W7PA 5L39A 2ZZMA 3WQPA 3LWMA 3M9MB 3G86A 3CDEA 2Q51A 2J0WA 1K0VA 3VCDA 3KMQA 1KHVA 2Q7BA 3D28A 2ZW4A 2IAJA 1KWMA 3M32A 4IAVA 2DY9A 2V4JA 1KFDA 3UN3A 3I5BA 2KG0A 3HUVA 4ANDA 5AJ3J 1N5QA 3HHLC 2E44A 3AODA 1A6LA 2IA6A 1YDLA 1O6XA 6AT1B 4YR2A 3IBFB 3SFUA 2VC1A 3KNGA 4EYIB 3QGGA 3GV7B 4EBCA 5HLFB 2V6AA 4HDGA 1RKJA 5D78A 2EK8A 1TQLA 2R8JA 2V8HA 3ZZIA 2E1MC 3QPIA 2QLXA 1HFEL 1FF2A 3NRBA 5JVHQ 2ZUAA 4LQ6A 2V8DA 2UUWA 2YWHA 4N8OA 3OQ2A 2K3KA 3SCJE 4R0JA 2IA0A 3CDAA 3ENVA 2QYVA 1T02A 1YVFA 1HNVB 1R6YA 4HT5A 2V34A 1M1DA 1FXLA 2DXFA 1RHKB 4Y65A 5KT7A 2IDLA 1F60B 2OU2A 2HMIA 2MGZA 4ZPDA 4ZLPA 4MXUA 3OR2B 3AH6A 4A8YA 1NJYA 1WACA 3V4IA 1D8YA 4AXVA 4B5PB 1NE9A 2OEMA 4DL0C 4K4TA 4DV3F 3CCRS 4CNYA 5B0EA 2FHKA 3T90A 2ZE2A 1HI0P 3CCMS 2OPSB 3MAHA 3EZ5A 4ER8A 5CABA 3QWPA 3M2RA 2MLZA 1QMUA 4NGRA 4O3RA 3CD5A 1M4IA 2PC6A 2CFXA 2PA8D 5KFFA 3U1MA 1RT1A 1CJTA 3AXMA 5IFMA 2IHR1 2KN4A 3T8WA 2BUEA 1I51B 3CD6S 4O3NA 4OLLA 2VPZB 2E7VA 4IF5A 3S01A 2F4VF 2QGFB 4NRTA 2FS5A 2DYAA 4OI4A 4A37A 2VV5A 1TR0A 1BLUA 1SC6A 4MAKA 1I21A 4I6WA 1KUVA 2JC1A 4O4GB 4ED8A 3SZ2A 3DKDA 4JV1A 3OVSA 1FDNA 1SCJB 4QWCA 1U26A 4F6AA 3P2FA 5AE3A 3ISNC 4KLVA 3DC2A 4MKYA 1SXLA 3K0JA 5B0AA 4Z7YA 1TVRB 3FMWA 1RTZA 1F3VA 1S0NA 2JEFA 4LT6A 2IMOA 1X4AA 3RRGA 4LFCJ 2GV1A 5GADI 1RTHA 4LF8F 4M5NA 1WKLA 3S6KA 4KSIA 2JWNA 3VAMA 1S1VA 3GFHA 1EARA 1RI7A 2Z30B 4YY3J 4WTYA 4NE9C 2QE5A 4R76A 3SCIE 2OPPA 3KTQA 3UDVA 3ONQA 3ILJA 4U7UK 2HHHF 3DOKB 3T5HA 4OHYA 2PC1A 2R7TA 2HURA 2IC3B 2X51A 4FXDA 2B9EA 2B6AA 3TAMA 1TFWA 2N7YA 4JI2J 4MCSA 5H9FK 2I5JA 5ETPA 4ZI6A 4DU7A 2XMKA 4TY9A 2A6OA 1S7LA 4CTAB 2CPXA 4YFJA 1F3FA 1JWQA 2N4DA 2KT3A 3TI0A 2JEJA 2NZCA 4DPTA 4CH7A 4CM0A 4DSJA 3EYZA 2C1CA 1REGX 2XNQA 2W9CA 3Q24A 1H98A 3SDEB 1T9TA 4M63A 4KTQA 3V6JA 4IO9Q 2RDJA 1OS5A 5ETOA 1KD1T 4X66F 2PI4A 3TVKA 2FSRA 2JSXA 3TNVA 3PJ9A 2BUNA 2XSJA 4IDKB 4LF4F 5HROA 2GC8A 2KFZA 4L72B 1O51A 4NA3A 4RBTA 3MM5A 2KI2A 5EC4A 3NAHA 1KDNA 1RK8A 3FQLA 1RYRA 3G87A 1IYLA 2GLFA 3AA9A 2P0WA 1VDHA 1NSLA 4ZP6A 1QVGR 3N4WA 4Y3CA 5IV0A 1U45A 4B9UA 1OYDA 3LANA 1T3OA 2R8GA 1VJWA 2PIZA 1Z4UA 1YLOA 2XBPA 4TU7A 1IYKA 1TL1B 2VG7B 1VQ8S 5J1EB 5AG6A 3LP2B 4DHVA 5HVHA 1KC8T 1A2ZA 5F8NA 5I42B 4K4SA 1VS3A 1U48A 1LW2B 4F0XA 5A8RB 2HC9A 4KGVB 3CJ8A 2HGMA 1YR0A 4J9KA 3RBUA 4CYQA 2DO0A 2BEIA 2HNYB 3GCWP 3GFZA 5LMUJ 4MIAA 3PACA 4CRZB 3D0GE 3G6YA 1HNXJ 2PJ8A 3FBUA 2HKEA 3SXNA 3N9UC 3SSSA 3SXOA 2Q1LA 4NI2A 3QIPA 4FPIA 1RISA 1TKZB 4USTA 1Y5NB 3PBBA 2Y1RI 5KT2A 3CCWA 4BBHA 4P71A 4UIBA 4KT0C 2W2PP 4X5KA 1LKZA 1Y4ZB 3B3SA 4DSEA 2NCKL 2LQ5A 4OYPA 5F8LA 4USJC 3CJKA 4RW8A 2EG1A 3H0PA 3RUBL 2GX8A 3EXCX 1K1SA 4IOAQ 4RWWA 5LRJA 1KEKA 3VZHA 4AFFA 1GMWD 4O0IA 4P7VA 4M5JA 4C0OC 4OYAA 3FEXB 4NOHA 1Z8LA 1VR6A 3F41A 5K9FA 5GAGU 3PFOA 5K5MA 5CCLA 5K20B 2VG5B 2HNDB 2Z0ZA 4RNOA 4WFXA 1ZO0A 2MKKA 2MHEA 3CGIA 2XTJP 3MUMP 2W9BA 3GY9A 4YEAA 3FEZA 5GVQA 2DGOA 5SUHA 4C2MA 3KHZA 1ZPWX 3HVTA 3MAQA 2CPDA 5HBMB 4B3TJ 1H2UX 1KOHA 3JQKA 2OPQB 2FC8A 3I0RA 4OX6A 1Q0NA 2V94A 3J7YU 1U1NA 4OFZA 4I2PB 3SFGA 1CEZA 1VC5A 1Z4EA 4DUKA 1VBYA 4ERDA 1QSNA 2CG8A 5KT6A 2HLUA 3PIPQ 1YX2A 5A8KB 3UD4P 1FJEB 2GLJA 3O6QA 5IT9U 4JP8A 3HHNB 5HK4A 2WONA 3GYGA 1HHSA 3GIMA 4ZVOB 1JLQA 4OKOA 1HD1A 3D1HA 1EE3P 3NA6A 2Z2LA 4PWWA 4UF4A 2UXDF 1X10A 2DTJA 2HRUA 3S6GA 3PX0A 1VJQA 3ZZYA 1L0CA 2YKOA 4Q5VA 4FUUA 4HNYB 4CH1A 4N47A 4RNNA 3TUJC 3ZZZA 5KG6A 5ETLA 1AMPA 2F63A 4DR2F 1SH3A 4PEOA 1ZG8A 1UA1A 1RU2A 3UQSA 3T1HF 1FY7A 4NCAA 4NGNA 3NBPA 2C27A 4CZCA 2OMOA 4OYOA 4UBRA 3KHGA 1QSLA 2DJWA 3QT5A 3B54A 3KK2A 1S6OA 5LSOA 4FYXB 3SCLE 3ENAA 5IS2A 4HH1A 2RVJA 3WDOA 3PYGA 3S6FA 1V3RA 3NP5A 2YX1A 3CC2S 3MWBA 2AGPA 4NCZA 1YW4A 2R98A 2RQ4A 1TAQA 1YJUA 1CBXA 3D66A 5F49A 3UD3P 4WU2A 4ZDNA 2KHCA 4EBEA 1LWEA 2D7SA 1F5BA 5DG9A 2IAJB 4E8UA 3M32B 2G9DA 4MHYA 4MJKA 4YB5A 4MJ8A 2YNFA 2ZEOA 4CLZA 3P96A 4PWDA 5KTAA 1Y7EA 4AT1B 4RW9B 3UI3A 3J7AN 1KONA 4QZVB 4WP9A 1DTTA 4ZP9A 1FEHA 1N32F 2RSQA 3HSJA 3HZEA 4C0BA 5J1QA 1QY7A 4MK7A 4ZS6A 2ERRA 4EFAC 2W9AA 1FJ7A 3U7JA 5D6GA 5JJBA 1KBRA 1B4SA 5C5JA 4BBYA 1YQEA 2BJ1A 2OTJS 1FFGB 3B4DA 3BR9A 1YJRA 4O44A 1EKRA 1LEOA 2APOA 5B0CA 1BE4A 1B0PA 2DISA 4OHVA 1JXVA 3BN7A 2R2SA 3D4UA 5A6PA 2HMIB 2MGZB 2QSWA 3ZZOA 4W9YA 4MHPA 4WXOA 1YHQS 1X4DA 3KASA 4Y49B 4WIIA 4PABA 4USVA 5IV4A 3V4IB 2P6GA 5H84A 4U6PA 2E5HA 1XBUA 2WB1D 4GVBA 3G9CA 2DF5A 4EWTA 2CVIA 3H98A 4X64J 2KXFA 1PC5A 1ROFA 4K4WA 2ILZA 2ZWPA 2UUAJ 1U4BA 2PCUA 2DEJA 2BKPA 2B3TB 2K3IA 1URRA 2ZE2B 2FGCA 3D7HA 3CIMA 3OXLA 4X65F 2BDPA 2J9EA 3IRXA 3M2RB 4A8OA 3GJTB 4P73A 2JDDA 1FX4A 3MZIA 3Q2TC 2HHQA 4IHMA 2NS1B 3C3LA 3PX4A 5F48A 1EAYC 4ZOSA 4JI7J 3TOAA 2LYVA 5JH9A 2KZZA 1ZAXA 2HS4A 2PO4A 2OR4A 2VQFF 3DLBA 2IY5B 1CJTB 3PVXA 1NJIT 1ZM3A 5THWA 3I9SA 1EKSA 1OY6A 1Y0YA 4NLTA 2R2RA 1KZFA 5HQMA 4NXYA 2QZ8A 2DR7A 3SBMA 2JEWA 4OLOA 2N82B 4MHZA 3KQZA 5F41A 3C15A 1X4EA 3MD1A 1L3SA 4X4SA 4RKUC 1S12A 2V77A 3KLFB 5DGBA 4F2RA 1Z2ZA 2MZSA 2AZ3A 2ZHOA 4I7FA 1FX2A 1ZBTA 3HHKA 4GXHA 2ZH5A 2C22A 4QU7A 2UV8A 3P5TL 1IB1E 3SI0A 3OSPA 4OC2A 1H6KX 1ARMA 4ZY0A 4C7QA 3GLJA 4Y2CA 3TQ1A 3OFHA 3VVTA 4CLUA 5DS7A 3D6TB 1LOKA 1VHEA 4YWYA 4ECSA 2HPUA 4CDIA 1P1TA 5RUBA 2XLJA 1WTBA 2Q3PA 4YS2A 5KTCA 1OSDA 3U1NA 3CDXA 1RTHB 4YDDB 2XO7A 4M5MA 4IFYA 2OLWA 3KLVA 1D3WA 1M4LA 3G71S 3HP6A 1S1VB 1VQKS 3UN2A 5DDRC 2RU3A 1F2OA 3N6MA 2PDAA 2QJ3A 1F9HA 5HH1A 1YG0A 3AFGA 3DYAB 4L6V3 1FTRA 1NJWA 3CJRA 4HTIA 5M2RA 1YJWS 1RLCL 1WI8A 5IC4B 5DLGA 4DR6J 2L9DA 2PEHA 2L3MA 3Q8VA 5B0BA 2B6AB 3TAMB 4OZ1A 1HNWF 4U9RA 2Z3LA 4XPCA 1OJ4A 3R5AA 2FJVA 4EEYA 2D3UA 2FLLA 2BSWA 1EHWA 4XPDC 1GNKA 3TVYA 2H3EB 5B08A 4C48A 4ID5A 1F1BB 1GMUA 2W9CB 2AQ4A 1N88A 2PR8A 3RRKA 2WSFC 1CJVA 4AYBD 2DNRA 5KFUA 3IS9B 2XYPB 1RTDA 1XK8A 3KHHA 3PG9A 3SQOP 1XIQA 3GIIA 3K5NA 2XSJB 1FD8A 4QIEA 5IV3A 3QRRA 4WK3A 5HROB 2E66A 4Y2IA 2FJAB 2JC0A 1X4GA 5B0FA 4RLEA 1YGHA 3MXHP 2IYGA 2AEJA 3KXDA 1R0BG 1VQ7S 4KAIA 5E33A 2XQCA 5LYDA 2E7WA 2ZWOA 2RAQA 2HFUA 1T3NA 2J8SA 3W7BA 2ABYA 2ALYB 4R3LA 3JTKA 3D8PA 2HHWA 2WB4A 4IOBA 3LACA 3IRWP 1MSWD 4ILMA 2BRLA 2UXCF 2IVYA 3MHYA 1YTYA 4OL8A 1UCNA 3W1YC 4DV0F 3GJQB 3HK2A 2HS3A 3LGHA 1XWLA 2O66A 5HMYA 4K5RA 2MLXA 1BLLE 4QWBA 1T8EA 4ZCLA 3FGVA 2QIFA 3TC8A 3B78A 4MIBA 3FJ2A 3CCUS 1N34F 1YLXA 3THPA 1RXOB 2KYZA 4ZK7M 3BYPA 1NKEA 1K0TA 4FXWA 1RAIB 5CH7B 2N4CA 4PWUA 1U1PA 4HYKA 3FH4A 2JLEA 1N36F 4LF8J 3MAAA 5G22A 4C3MA 1HMVB 4LJMA 3HT3A 4DF8A 1WELA 4OYZA 4KOSA 1B0TA 5LMNF 3D54A 4NI2B 3KUHA 5AG4A 2GGPA 3DFEA 3MMBB 3I32A 5CYQB 2LA6A 3SV4A 1MJ9A 4HT7A 4CQ1A 1GXUA 4O0NA 3CD7A 1TKDA 2AFSA 4R0EA 1AFIA 4QR0A 3CJKB 4RW8B 2VPXB 4KE5A 3FQKA 4YMEA 3KHXA 3C2PA 3TT2A 4ED1A 3MCOA 1ZLIA 2F9DA 1JJHA 5SZTA 5J2NA 2FGOA 2VKZG 2VBYA 4ZVGA 4MFKA 1M5PC 2ZKUA 3OJSA 1NB2A 4MBUA 4C8LA 3WBZA 4CGLA 4LREA 4YB6A 4F8RA 4JB8B 5KFHA 3M2VA 4ECVA 2IJFA 1WC1A 2CDQA 2WUUA 4NWBA 3QFWA 2RHSB 4IG3A 2X3DA 3CMAS 2FJXA 1S60A 2W9BB 4UOFA 1NK0A 2V2KA 4DQPA 2RS2A 1M1KT 2VC0A 4OLPA 1TK5A 4M94A 3CVKA 3FEDA 1UPPA 1WHXA 3HVTB 2YWEA 2W1BA 4LF4J 3TA0A 1N5VA 1JLFA 5LXYA 4GS4A 1RAEB 3I0RB 2XHWA 1IJFB 1RWXB 3SCKE 4FYVB 2PSWA 5AXKA 2DNGA 4Y0FA 3LPYA 3RNZA 4CNZA 4MY0A 2JL9A 1UMJA 4NGPA 1RABB 1QSMA 1RYSA 4TXSA 2OPRA 1Q1KA 4C8MA 4RUBA 1CULA 2XY6A 3CJSA 2FTRA 1JLQB 1KNZA 1WUUA 4N8NA 3M30A 2V67A 2B51A 3BI1A 3IWXA 4C0HA 2UU9J 5GMEA 3BM7A 5KG3A 4KGMA 1RWNB 4FYYB 4HR2A 2XULA 3A8KA 3QWUA 1S1WA 3FNCA 3NBPB 4DL7A 3TFYA 2VFRA 2W25A 5KFQA 3B35A 3GP9A 2MZQA 4B9VA 4NLVA 3KK2B 2QMXA 2LKZA 4PQAA 3PKYA 3RBXA 4WFNQ 1KLMA 2XO6A 4DX5A 2PJBA 4N76A 5DRKA 2HRTA 2CQIA 4LF9F 4A33A 4AVCA 4MFBA 2GQ2A 4R5PA 3VAJA 1LWEB 3F0NA 4B3RJ 2CQBA 2K2PA 1CP7A 2CQ2A 4PWDB 2LXUA 4CYUB 1M4DA 3DHWC 3ILIA 2Q79A 2Z2YB 1RA7A 1HI8A 1DTTB 2FCKA 1FT8A 1XR5A 3BQ0A 5F0WA 1U1OA 1WI6A 2JBKA 2OIHA 2MMYA 3UCUP 2I79A 3IIBA 1ZS6A 3DRSB 3MCMA 1LWFA 3HSDA 1NPPA 5E3RA 1FWPA 4P4DA 4JYAJ 1WF2A 1I1GA 3UVJA 4J37A 3W2VA 4O44B 3JTOA 3B82A 3NH4A 2VBXA 2QFJA 1U7LA 4XPEA 2A2CA 2JEIA 3DOMA 2X1FA 3OLBA 2K06A 1T9VA 2K7KA 4AE5A 4DR7F 2OOTA 2Q44A 4EO8A 3PB9X 2LMIA 1GK8A 5C2CA 4HEA9 2GCFA 5HJXA 2J8NA 4KHMA 4ZLNA 4PZVA 3M6VA 2QMUB 1V0CA 1HQEA 5ISVA 2HNZB 4GVBB 2DHHA 2HHSA 5A8WA 1HHQA 4ECTA 2EG2A 5F0UA 3DHXA 4OI2A 2VFTA 4LFBF 4WYWA 1B99A 1YJ7A 2F7VA 4X4NA 3NCRA 1KKHA 1TKTA 4E2AA 3AY0A 1YMEA 4M3SA 3GSIA 4ZGYB 3OTOF 4BMHA 1R8BA 4IH5A 2XB2D 2VKRA 3CEDA 4KSAA 2IVFB 4E0DA 4ZCIA 4JXQA 1TL7A 4P4JA 4YP3A 4PAAA 1IM4A 3BJ8A 2YKPA 1S1XA 4W92B 4OX8A 1QSYA 4MYTA 2XG8A 1VIOA 3LH2S 3SI8A 3G82A 2C1EB 2Y0SD 1E6VA 3R95A 3C15B 4DR4F 4QWDA 2Z11A 4I7FB 4OYMA 2OFHX 2DRAA 3IP0A 2B4DA 4W90B 2CG4A 1HBMA 1FFSB 4ZP8A 2EFOA 2YKAA 2AJ6A 2B3UA 1FKOB 2CQCA 4DXLA 3UW1A 3MUVP 3POTA 2CTBA 1X9MA 2M8DB 2G1DA 3GMGA 1RHUB 4J9SA 3JSMA 4TYBA 2VJVA 4J9QA 2MKSA 4ZCKA 1N32J 4URQU 2B5GA 1VBXA 3TZYA 3QJJA 1SJRA 2XMMA 4DPYA 3OBIA 1O5JA 3H2LA 5KFGA 4WFZA 2W8KA 3T5KA 3CE8A 4YR3A 3D3CJ 1CJKA 3G8QA 1G1XA 3LAMA 1LNQA 2MZTA 1RZMA 4LF5F 3LO3A 3PGPA 1RT2B 2SXLA 2YNCC 2QLWA 2XEXA 4DV7F 3HJVA 2A3JA 2BOPA 1FDDA 3BKTA 5KFXA 3P5BP 1XMQJ 4B08A 3HSGA 4M85A 1RAAB 5KT5A 1S59A 3DGPA 4DL2A 1CPZA 1IR2A 3KUGA 1RT7A 4B9TA 4CLSA 4ZJLA 3TAQA 4OHWA 2DNMA 3GIRA 2B4PA 2QYGA 2NZ4A 3RJMB 3FX6A 4ID5B 6FDRA 2JRSA 4PV6A 2OFGX 2OJ3A 5D29A 2VG6A 1PKUA 2VFSA 1QQ9A 2QV6A 5BWAB 1RTDB 1JWWA 4TLRA 2DRBA 4F0KA 1LXNA 4K0KJ 3AD7C 3KL9A 3PRDA 1C1BA 4QCLA 4NL5A 4OC5A 1ZM2A 1U6ZA 4P4EA 4PXDA 4I49A 3V6KA 3LW5C 3BZQA 4F3QA 5M2UA 4G1QA 2DVIA 5GMDA 3TA2A 4XPKA 1LAPA 2FY1A 1QVFR 9RUBA 2ZH1A 1HHTP 2YBVA 1DFDA 4X4TA 1TL5A 3RRHA 1EX8A 2H9ZA 2WBRA 4QIWD 3OUYA 3AAWB 4DR3F 2X7BA 5AE2A 4Y6IA 2UXBF 3AOBA 3N7ZA 4HLBA 3H42A 2K1RA 3RGIA 2R8HA 1TV6A 4AXJA 1VIXA 1H0HB 5LJ3Y 1EB0A 1VQ6S 1DJ0A 1DY3A 3PRTA 4R9MA 4JI3F 5H9EJ 1O0PA 1NHUA 2BE9B 3KJVB 1NMTA 3ETOA 2QFIA 1J2VA 5ITHA 4Y34A 3DRYA 4FF4A 3K59A 1L3TA 2F1FA 2J5AA 3IO1A 3QT6A 1HBOA 4FPRA 5A27A 1G4CA 3D6MB 3ITHA 5GAHU 3FF3A 3VGSA 4Z37A 4C3LA 4ED5A 3A8IA 2H5IB 2Q4ZA 1LQ9A 4DU8A 2PGCA 3O5TB 4NLWA 4P45A 3NLCA 3T5JA 2BZ2A 2CAJA 3H7HB 2VODA 3UY5A 2DXEA 2GGPB 4A8WA 2B8QA 2NUHA 1GFWB 3FSYA 1OSCA 3FRYA 5KTQA 5A0YA 4JI1F 2PI5A 3PW2A 2UVVA 4MFPA 3HZGA 1HNZF 4NJQA 5IWAF 2W2QP 4F02A 2R2UA 4Q45A 2LVWA 3ELHA 2IBKA 1HNWJ 2FB0A 5D4PA 3FECA 3EPGA 3T9NA 2H5JB 2DNLA 4PXBA 5D77A 4CGOA 5J2NB 2JLFA 2NYIA 4OV1A 3HHEA 1IKWA 3VGVA 3KHRA 2FVRA 3T6JA 2AGQA 3M2UA 2ALZA 3HFVA 1R0CB 2FJEB 3S9MA 3G8TA 3FKBA 1T7PA 1S3ZA 3BSAA 4OJGA 4NMLA 4IG0A 1UJ4A 3LWLA 5HI7A 3D9BA 1WEYA 4ED4A 1UJ6A 2LFVA 2CA9A 4F36A 1OPZA 1TKXA 3CJQA 1S48A 4DN9A 3CB4A 3Q2SC 1JLFB 1HBUA 2J8MA 2E5LJ 4PPZA 1VC0A 4ZPTR 3ZTRA 1S49A 2QL5B 4A38A 3DOLA 4O3QA 5C42A 1LCPA 1YVKA 1NEEA 1JKHA 2YNIA 1S5KA 4FKXA 4P4IA 2XHCA 5EWGA 4CRJA 2MQNA 2M52A 3H25A 3BN4A 4LF1A 1CULB 3LF0A 3CJ3A 4XK8C 5HJYA 1WC3A 4J9PA 2UXCJ 3TEHB 1FWLA 2PE3A 1PJ6A 4DV0J 5LYIA 1QD1A 3M6WA 3B3TA 3ZZUA 1SKRA 3L95X 2RS8A 4PR6A 5IZHA 1HWUA 5AXLA 2AF6A 1UW9A 2O67A 2WPXA 4DS4A 4R8UB 3EZOA 3HHLD 1N34J 1S1WB 1Y11A 5KOWA 1IXKA 1CJUA 5F8GA 3JAMU 3G8WA 1XMOF 2XGPA 1N36J 1O8BA 4MIWA 5K8NA 1P4NA 4JV0A 3QB8A 4CAWA 1M5SA 2GJ2A 3PFEA 1QM9A 1UW4A 8CPAA 2V9KA 2E5JA 4WYLA 1QLNA 5CAAA 4WCEQ 1ON0A 4B11A 3VR1A 4TU8A 1RA6A 4GKKJ 4OYIA 4MFBB 5ETKA 4R5PB 4KBIA 1YJ9S 4DR1F 3NOCA 1ZYQA 4X3RA 2QYCA 2R7XA 1U1KA 1N52B 1D1UA 1NK7A 8ATCB 2B5JA 2FY8A 3NCPA 2JEVA 3ETMA 3G6XA 3IBWA 4MFJA 3KK1A 2AYGA 3Q8QB 2PRBA 4PK3A 3PJXA 4MFQA 4CO0A 2CNTA 5HMXA 2ILYA 3CC7S 1T95A 1MJBA 1S97A 2IL4A 2IVMA 4NGQA 5HXDA 2V8PA 4DG1A 1LWFB 3K2KA 1XF8A 2W8LA 1UVMA 2RE1A 3UVJB 1NPKA 1S4FA 3LP0A 3W2VB 4RO0A 4JI0F 5GADU 1RSCA 3CPAA 1IBLF 1NK8A 3US5A 4JZ0A 4KKOA 2R7OA 4KV8A 2H5EA 1J5OB 1J27A 5B7WA 1CX8A 3MOJB 2VB6A 1SJ3P 4OIWA 3CPWR 2W2NP 4M5GA 3KDNA 4M5HA 5HAOA 2N3LA 2D3OR 4II9A 2EEYA 4OP4A 1HQEB 2GJFA 5A8WB 4QR1A 4R57A 4GO5X 2G1HA 2G0CA 2GHVC 1NHKL 3BBBA 2HHPA 4A47A 1Z4RA 3HI9A 2HHVA 4P2SA 4YN3B 1TTHB 4H4MA 1Z8XA 4A39A 2XZTB 4U8VA 3ISND 4F3OA 3VF0B 4QBJA 3MOZA 3BH6B 1KR4A 3GZ7A 1HQUB 3NMRA 1R0AA 1TL7B 1FK9A 2ZH9A 5L9XA 3IM8A 4OYBA 3PB6X 2PJ6A 1MN7A 3D4JA 4ALZA 4PPDA 4AVBA 2C6GA 1H7XA 4DQIA 2X1AA 4CYPA 4DJBA 5KFEA 4ECUA 2YVSA 1NKBA 4A8SA 4KGZB 3MR2A 1E6VB 3P4UB 4NRUA 4ZBGA 2DR6A 4O3SA 3MEDA 4PG6A 4EYHB 4A2ZA 4FF3A 1Q95G 3OHAA 1PCAA 3FBCA 4Y49C 4J9OA 2RILA 3QAUA 4TQSA 5LRKA 3OR2A 3Q22A 4LVOP 4LF9J 1HBMB 1R43A 1SQEA 1S99A 5H9EK 3OR1B 4ELVA 5F09A 3BKUA 4TKTA 1ZG9A 4LSLA 3KK3A 1HYSA 4A4JA 3JSBA 5KFCA 3POTB 1IBMF 3NFZA 2OPSA 1NLKL 1W26A 4DV5F 4EGLA 1OQ6A 3EX7B 4NLRA 3U02A 1T0TV 5ETSA 2M7SA 3MCNA 1S0VA 5HL7Q 3BPSP 3CMQA 4P4BA 2B5GB 2RD5C 4ECRA 2AYEA 4ZVEA 3RBDA 2XSFA 2XMJA 3RBZA 1CJWA 1X31C 2E5GA 4USUA 2HUZA 1H7WA 3R5CA 4QYZJ 1AUDA 2NUUG 2V8VA 1CJKB 2U2FA 3MD3A 2PQ8A 3UPFA 1D0EA 1SIWB 3IJ3A 3PW7A 4L3NA 5F8HA 4Q36A 1RKIA 1U1MA 2PDOA 4WP8A 2QA4G 4RNFA 2DGSA 3UO0A 4M6IA 3DNSA 3ZC4A 4UT4A 1V9OA 3FDSA 3GONA 3UDLA 1LANA 3GIKA 2YNDA 2FLNA 2OZUA 2KO1A 3O3LA 4CGNA 4GO7X 1RT7B 1ZH5A 3OSNA 1XOVA 2H51B 2KRBA 5KOXA 3W91A 3NGUA 4LFBJ 3H20A 1JK9B 3HXMA 3Q0AA 3TUPA 4LR7A 3K8VA 1Q7YT 1V3SA 2VG6B 4ZVSB 1VYAA 3GV8B 4K5SA 3V5RA 2OEJA 4OC4A 4CAVA 1DQ8A 4OHXA 2V0NA 4EFDA 4MY3A 4CWBA 5LM7E 1PYTB 7FDRA 1C1BB 3IBCB 1H72C 4HDHA 1NK6A 1PSDA 4DSIA 1S1UA 2G0IA 3K5PA 5HVFA 4UA3A 3DLJA 4MK9A 3MRUA 3HLUA 1GQEA 4Q8FA 3VGUA 2EI5A 3J80Y 3LALA 5DM6Q 4N56A 2Y8YA 3HVAA 3OUYB 4ZPAA 1TK8A 1SJFA 1XMBA 1XJWB 1CLFA 3IWWA 3GFXA 1GH8A 3DRPA 2DEIA 2HBQB 2Y1IA 5HMWA 1FVQA 4DV6F 5IQ6A 4OQJA 6FD1A 1HPZB 4CGPA 5LT5A 4I6AA 3CCES 4L89A 2I00A 4KUBA 1TV6B 3M05A 3BGOP 5MAOA 1M90T 3HKZD 4FAIA 4CTAA 1UVIA 4E2FB 3R1KA 1XE4A 2PMHA 3M6UA 4DV2J 4LF7F 4FD6A 3VWDA 4DUZJ 4OMEA 2AYMA 2HVDA 3VGTA 1UPMB 4KGXB 4IKAA 1BMQB 1RP5A 1B70B 2RDIA 4UTGA 2MEWA 2QIRA 3CDWA 2ZEFA 1U1QA 1KQKA 4Q2MA 3BF4A 1HBOB 4ELTA 3ITHB 1IUJA 1HL6A 4AD6A 1CS4B 1HWLA 5F3ZA 2BCOA 3NXZA 1XEBA 2BABA 4MYUA 4NXNF 1RAGB 2W01A 3TZXA 1QAXA 4AQYJ 3IGRA 4UUXA 3V6DA 3RAXA 3R27A 3S6HA 1JIHA 2DPSA 5JM6A 5A0YB 2J8RA 4NGMA 5E96A 2ZVSA 1FTCA 2FIUA 1U49A 3UNGC 1NH8A 5IOLA 4XTTA 3PO4A 4LRCA 5DS0A 4S0MA 3GYNA 2R4FA 3WC2A 4R6TA 2ZH6A 1S9GA 2C2ZB 2RH3A 4OZ0A 3CCTA 4X4QA 3LP1A 2BANA 5BR8F 3PB7X 1VISA 1EP4A 3CJ4A 3J7Z5 3G8SA 3THVA 1H74A 3BJYA 2YWKA 4AG9A 1XNRJ 1IKWB 3RYLA 1UVKA 4KFBB 3M2UB 4OJHA 3D0IE 5I42A 2HAFA 4EO6A 1VQ5S 1SB6A 2OUGA 3BSCA 1HBNA 2UUCJ 1VHIA 4IG0B 5A8RA 2YPZA 3V38A 5D0HA 4TU9A 2ZEGA 1NNDA 1NSPA 1X60A 2HNYA 4RX6A 2J7UA 2BR0A 2BE7D 3RO0A 1TKXB 4QWAA 2BJ3A 4DJLA 1VI7A 1QUVA 1HBUB 2BO9A 3B3VA 4Y2KA 3DOLB 5C42B 3B3CA 2EFVA 2DGTA 2VI7A 5KFNA 4Z65A 2DGUA 3P49B 2AYBA 1IGBA 3WC0A 4YHHF 1U02A 3W2WA 4DPXA 4GM5A 3KFWX 1Q81T 3RTVA 2HBYB 2YX4A 3H8GA 4OZNA 3J81Y 4K4ZA 5BXIA 2MKJA 3QBCA 2HEKA 3CSKA 1IICA 1RBAA 2QO3A 2DY1A 2XC9A 3OT9A 4YDXA 4XPLA 3D0HE 1FNXH 5LXRA 2GIRA 2P6EA 4FBTA 2IM0A 4JI3J 3PHTA 4JI6J 2VG5A 2FPHX 3PCOB 2C2NA 2PT0A 2WYRA 4P9SA 2PJ4A 3L2NA 3OL7A 3QZ8A 3DXSX 5H1SV 1IY7A 1ZM9A 1CJUB 1OY8A 2DBBA 2M9KA 3MECA 3F0AA 1JXLA 4ONUA 5HBMA 2VZYA 4JWPA 4GKJF 2VQEF 2PJ9A 2LXFA 3M8QA 2V2ZA 1KUYA 1BXNA 2OPQA 4B3MJ 5A6WA 3QRQA 2GVDA 4HKQA 1SJ4P 4KZTA 2EXUA 1PIEA 4Q38A 2WVDA 4DLEA 3VATA 3BO4A 3VAKA 4DUYJ 1LWCA 4JI1J 1UAWA 4QPXA 3BDEA 2C3MA 4D3HA 4C2ZA 2MXYA 3NNAA 3EUNA 2YQ3A 4PYDA 2RMLA 2VF3A 1VQ4S 2ZJRQ 4QC6A 2B5JB 4LRDA 3D3SA 3X3UA 1FRXA 4ECXA 2V5HG 3T1AA 3KK1B 4F4XA 3AD8C 5L38A 4FS1A 4P52A 1XNQF 4IQMA 1RBLA 2EK1A 3NGDA 2AU0A 2JBJA 2HQ3A 3PZPA 3MPYA 1ELOA 2MYFA 2AEFA 5KFZA 4DG1B 1VMBA 3BREA 3H2UB 1NSAA 1HR0J 1U0HA 3H2VE 4QYZK 4LMZA 4WE1A 1LWXA 3LP0B 2BJDA 2ZC3A 4F4WA 2Q4YA 4ZJQA 2CWKA 5KFIA 2LQBA 1VQMS 5IXUA 4MTPA 4MFLA 4EVYA 4L74A 3IA0A 3R97A 4KKOB 4Y2MA 1IOFA 4KV8B 2YKQA 1FT7A 2FLPA 3UD5A 4DV1J 4ENOA 1QUPA 4OAEA 4B5OA 1R3NA 5CA5A 1JLGA 3C8YA 2AJQA 3ADAC 3D3BJ 2L08A 5IB0A 5KG2A 2Q7SA 3VALA 4X62F 2CQGA 1JQGA 4MHDA 4FVCA 2A10A 3FCHA 1ELLP 4FYWB 2FVGA 2Z10A 3OWCA 1TFYA 1I12A 3BBCA 3GUXA 1IWAA 1F2PA 2F65A 3CUNA 2VUGA 4H4MB 4RW9A 4J9RA 4PCQA 1HEEA 3W3SA 3MFIA 3MMJA 3VQSA 1RE1B 5KAKA 3AJDA 4UOCA 2DHXA 2NSMA 3W8GA 2OHDA 4ZVPB 1R0AB 1FK9B 2QMLA 1J5EF 3R3TA 2NPIA 2HVHA 4JI4J 1GAOA 1YIJS 2EK6A 5IC6B 1VK8A 2RFHA 2POKA 3H8EA 3QQCD 1R8CA 1Z8TA 1CC8A 2FZCB 4ZY1A 2DR8A 2AFWA 1PYSB 4ZIVA 2GAHC 4ZVFA 5J2QA 1YZ6A 4A31A 4A32A 3MEDB 4FN5A 3EGNA 2ZDOA 3IAS9 3TO9A 4RZRA 4EK2A 2ZM6J 3UN5A 3M8YA 2E1CA 1CM0A 3M4XA 5M2PA 2E29A 4P2MA 2JLMA 3EMTA 2ZOFA 4FF1A 2LCWA 2NXNA 4GVLA 5ETQA 1HARA 2EO8A 1X4FA 2HHTA 5JXSA 3AHPA 4LSLB 4MRIA 3KK3B 1HYSB 5F9LA 4G1IA 4U95A 1DARA 3ILLA 4LFAF 4KS9A 4DQRA 2EVNA 2D3ZA 3CXQA 4KHPJ 1NDCA 4DSLA 2HHUA 3B2YA 1FESA 5U47A 2LQ8A 1OMSA 1RT3B 4CT9A 1N56A 2H48B 2EPIA 1S9FA 3H5ZA 4O3OA 3BPDA 1AYEA 3TW0A 1X5OA 2BRKA 5CZVA 3BGFA 2FHJD 1AFJA 1NRKA 2G0JA 4NLSA 1SQFA 2R8IA 2YKMA 3PBEA 2E7XA 2ZJPQ 4TLQA 2VZZA 2D1CA 1RTIA 3W5YA 1SV5A 1IBLJ 3B6BA 1U2CA 4P2FA 5J1NA 3A3PB 3KLFA 3IG1B 5E3CA 2GU2A 3OTEA 4HI1A 5T41A 2IBOA 1VQOS 1F5CA 1S7HA 4DR5F 3BLNA 4A8FA 1WDTA 2ZH2A 4FKYA 4DL3A 4CYOA 3O2IA 2F8MA 1P8GA 5F9NA 2ATLA 1TL4A 2DRDA 3TJ8A 2ZJQQ 4KYZA 3KDOA 4LBHA 3ZXWA 2AFZA 3TR5A 2C2KB 2UUBJ 3AQPA 1WF1A 2V50A 2O3DA 3MEGA 2VZ9A 7CPAA 2Z3NA 2G2ZA 3M1VA 4LQ9A 4I1TA 3KJNB 3KI9A 1PJ7A 5HN0A 4ED3A 5AJ3F 2MB0B 1R8AA 4DBQA 5J8FA 1S1UB 2FDNA 4OX9J 1YK3A 1XR7A 1KFSA 3KR5A 2QSFA 2EWHA 3MM8B 2ZENA 2R42A 3QGIA 3DYAA 4K50A 3M8PA 3THTA 3QZ7A 1IM6A 3JS9A 3DRPB 3VQTA 4NLYA 3E3XA 2HAIA 1YJTA 3FFIB 1JLEA 2B43A 5HP1B 4UY85 1I94J 1RCXB 2OD6A 1WEXA 1QTNB 1SL2A 4AL6A 3AOCA 2O53A 1NZ8A 2FYXA 3JSRA 5DO2A 4H6UA 2ROGA 3FBEA 1QDUB 4CAFA 2ZBIA 4MMOA 4UWJA 5CYJA 8RUCA 5IT0A 4UQGA 2WBMA 1IBMJ 4QJVA 4CLWA 1B0VA 3LOUA 3IS9A 2CJ9A 2CJYB 3V81A 2GFQA 4DV5J 4H4KA 1RAHB 3IMQJ 1GMWA 2ZD1A 3SJGA 2CQDA 2VBZA 1TKJA 3GG1A 4BS2A 2JH3A 3AB2B 1S77D 2CPJA 1U1LA 4LRAA 1LFPA 5CZXA 3H4QA 4QVTA 1GXLA 1M5VC 1KP6A 3TUIC 3AT1B 1IKVA 3V6DB 1OYEA 1RAFB 5K14A 4JI5F 3N28A 1UEKA 1BWVA 1S7FA 4R3KA 3K58A 4I2QB 1T9WA 3FBBA 1MLAA 1MG7A 1NDKA 1M1HA 1S9GB 4B02A 1FHTA 2AW0A 1RADB 4LVNP 4Z7CA 3LP1B 2AT1B 2BANB 2LLZA 4X4UA 1EP4B 2BJEA 1U2FA 4KQZA 5ADZA 4YGOA 3C19A 3RR8A 3ZTSA 1HWKA 2X1GA 4CGMA 1BD6A 3MR3A 2WSEC 2PJAA 4KB7A 1HBNB 2EFNA 4P6YA 1T9XA 2HQDA 1DURA 2J6UA 3BI0A 4KOVA 5A2QU 5F8JA 3DLKB 2B56A 1C0TA 1VC6A 4QPTA 3IR6B 2MQPA 2R7RA 1KQFB 2RU9A 3AXKA 5B0GA 5CQGA 2BX6A 2VBQA 3L7UA 4MT1A 4FYDA 3DSBA 1HMVA 3HFZB 3TAPA 4CO5A 2HGNA 2AIRB 3R96A 4LFCF 3JSYA 4CAEA 5CHCB 3MMBA 2JFKA 2BKOA 4ZX9A 3KMSA 1U8SA 5CYQA 4CH0S 4KVOE 2P6TA 3WHIA 1PAUB 3W2WB 5BYSA 3D2MA 2VASA 3GR0A 5EDWA 4G6VB 2CWXA 2YQ0A 2DEAA 3H4DA 2J7WA 5E3QA 4DV6J 4CLYA 2P2CB 5AXMA 2UVRA 5G4DA 1YSJA 3HVRA 2JLGA 1Q5YA 4ZA1A 2Q6CA 3R1LA 1IKYA 4RW6A 4U7UD 1UJ5A 3VARA 4JI2F 1QE1A 1N48A 4ES1A 1NJXA 3AQOA 1OPIA 4RL1A 3V2UC 1NJZA 3GQCA 3NCQA 2O01C 2CJXB 2FVQA 3EXNA 2MQQA 3NWRA 3MECB 4Q8EA 2OEKA 1MWQA 1RCOB 4K4UA 4ANEA 3GWCA 3W64A 3M8QB 4XAKA 2XEIA 3IXQA 3MMCA 2YNGA 2B9XA 1Q8LA 2GVDB 2O5DA 4WWSA 1BUXA 4HHUA 1LWCB 3HSZA 5KG0A 3CCJS 2CPHA 3KGQA 3HCXA 1N4LA 2AD9A 4DWIA 2BA9A 2PVVA 3CDBA 3L9ZA 3D7GA 2OO4A 3VVUA 1UFKA 2DR9A 2XGQA 1JNZB 3I96A 4KOWA 3Q8PB 1U47A 4AG7A 1OO0B 4CLKA 4QB9A 2YNCA 4QU6A 4UQTA 3PYFA 1YJNS 3UWTA 2KT2A 3RR7A 1WSRA 4TQRA 5CXTA 2LQJA 2ZBPA 3WX4A 1T03A 1TL3A 2ATCB 4B17A 3DR8A 1PAEX 5B09A 1U0HB 1H3DA 4WE1B 1U25A 4GC6A 3T1YJ 2OP5A 3G4SS 2COLA 2XY5A 3FSXA 3MEKA 2QLBB 1AA1B 3HVWA 2C3UA 1FVSA 3FBFA 4L8AA 3H90A 2YY3A 5FDLA 1LAMA 3MN8A 3I4PA 2ZNZA 1ZTTA 1Q86T 1ZA2B 4U5YA 3NGRA 5LMUF 1IBKJ 5IM0A 2BE2A 1JLGB 3F73A 1HNXF 4NYZA 5GMKa 2KL8A 1KVIA 3ZTOA 2PEBA 1C1CB 5ETNA 2DNOA 1WOOA 1K1QA 4I4BA 3OVAA 4JD6A 4LQGA 2O4HA 1UL3A 3MR6A 4CYUA 1WC5A 3CCSS 4ATNA 3IR7B 2KFYA 2CY2A 4C4WA 5DWMA 2ZW7A 4NJRA 3KLIB 2ASJA 2HK3A 4NLDA 5EGYA 3TO7A 2BQRA 3EGWB 3DRSA 3R7BB 2ROPA 4UCNA 3H4BA 4UEEA 2YWFA 4ZVHA 3SQGA 1FJGJ 3CULA 3W5XA 1JJ4A 2L9WA 3LWUA 4OJ3A 2GMJA 2P5VA 4A8QA 3BJ7A 3K8WA 4LBPA 1NUEA 4B9NA 3J81U 5J2QB 5K8MA 3TA1A 5LOQA 2WTFA 3DRXA 4DX6A 4JV5F 3CW2C 4XNHC 4EMEA 3BSNA 1C0UB 1TELA 4UCMA 2RUGA 5KFRA 1TF8A 2DNNA 2PIYA 3PB4X 2HNZA 2O1PA 4JI8J 4BDPA 1Z8WA 3IM9A 4I64A 2FVSA 1RT5B 4WKRA 4QIVA 1BPMA 4LRBA 4USKA 2AFUA 3I5AA 2VA3A 1PBUA 2XYHB 5CCMA 4EUVA 1URNA 1NK5A 3DN9A 2KXNB 5C7PA 5LSLA 4KOXA 1TP7A 2PIIA 1MU2A 2ZZTA 3DLEA 4WXWA 3QLHB 1JMTA 1LK7A 4LIWA 3C6TA 5DZ6A 4YRHA 3RAMA 1DTQA 1NPRA 2YKMB 3HFKA 1SQHA 3TO6A 4O23A 4F0YA 2VDHA 1AW0A 3FNNA 1RTIB 2B9YA 3I4HX 1SV5B 1V5VA 3I9ZA 3RZAA 3C46A 2M70A 4XIUA 3I56S 2VH7A 4QIFA 2BQUA 2F5GA 2A18A 2R7VA 5KFJA 2CTCA 4RN7A 3I5CA 3T41A 3W66A 2KRRA 3CXCR 4DF4A 3CCZA 2P9GA 1FJCA 2DPTA 2JHEA 4WK1A 1FKOA 5DQIA 2KVIA 5L1JA 2NYQA 4X62J 5DWNA 4F50A 1FERA 3QATA 2M8HA 3TEGA 2LECA 3LGMA 3VAIA 3HF5A 4F0MA 4FXVA 4OMFG 5FJ4A 3NH8A 2XS7A 3MEGB 1QSRA 3I0SA 4NYPA 5KT3A 2PMZD 3M1VB 2BJ7A 1FXDA 3BGRB 3TANA 4M6GA 3KLEA 1Y10A 3PJWA 2CJBA 4JLYA 1Y9KA 4A48A 5E2QA 2GE3A 1F6TA 1C2PA 1N5TA 4I67A 1WNEA 2VIHA 4YR0A 3SJFA 2HBRB 3M8PB 4B3OA 3KKFA 3GYXB 1RT2A 2C2MB 2DPIA 4AVAA 3DLGA 2RC4A 3F8KA 3HX9A 3M8RA 2F40A 2CF4A 1JLEB 1K44A 2ZPAA 3TCVA 3TJAA 1Q2DA 1D9AA 5D4LA 4Q7AA 1ACMB 1XFOA 2AJFE 1XMTA 2YNEA 7AT1B 3RG6A 3OPKA 2KM8C 3QSYB 2BW7A 3T6BA 3FZBA 1OZPA 2Z3OA 1G7CB 4A94A 4FNIA 4DCOB 3SI1A 4DV3J 5CBMA 1PUAA 1ZPVA 2V68A 2X7IA 5K8PA 4LFAJ 2DITA 2D9PA 4DPUA 4F67A 1YLEA 3V81B 2IDEA 2MY7A 4UFVA 3I3GA 2UZAA 4IUSA 3NGSA 2AJ0A 2ZD1B 2FL4A 4CO2A 2J6TA 2JJ4D 2XYGB 2GANA 2UUAF 2F8HA 2KU7A 4CS0B 4ZVQB 4ILLA 4P2XA 1F57A 4PG4A 5A76A 3JVNA 2VFVA 4NZ0A 1S1TA 1YI2S 1P9QC 4ECQA 1SJQA 3K5MA 2XMTA 3PRBA 4G65A 2J9AA 1IKVB 2CPZA 3HULA 4JI7F 4OI3A 5K14B 1W2BR 1X9WA 3HT0A 2ZEMA 1P27B 3D6FB 4M5LA 4J3GA 2F9JA 1GTHA 5C25A 3VTIA 4OI6A 2Z3PA 2KG1A 3WC5A 2F4VJ 2E1AA 4USMA 4DSKA 3RB4A 1S5ZA 2G3TA 3QNVA 1UFHA 2KFNA 1VOMA 2NYHA 5JVGQ 1EJ7L 1CBKA 4K2JA 4KPCA 2HWTA 2V8GA 1FRHA 4F2SA 4JBCA 2E1RA 1LRZA 3OV7A 1XQIA 4KIAA 2F5IA 2IJRA 4QWEA 5AXNA 2CNNB 1R6VA 3P6YC 5DQGA 1Y0RA 4ETXA 4WFAQ 3KJVA 4RI1A 4I69A 2YNHA 1U1RA 1CSJA 4MCPA 2VFUA 4PK2A 2ZEHA 2QT7A 1QJHA 2J0QD 1C0TB 4CI0B 3MPWA 2REEA 5LYFA 3A8JA 2EBGA 2BVZA 3DU5A 5L46A 4UW2A 1LW0B 4FD5A 1TMMA 1ZZNA 4A30A 4RW7A 5K8OA 2F4FA 3PEIA 2PJ1A 2BJ8A 1MWZA 2LXIA 4IFVA 3VZIA 2NREA 4E8OA 4FWUA 2HW3A 3HD1A 1U0SA 4OC1A 3HM9A 2HHHJ 1HA1A 2BW2A 4ZPCA 2HFOA 3W9JA 3EJMA 2Y9HA 1EETA 1JNRB 1RAOA 4M5DA 4BC9A 3UE2A 4DV4F 3V4MA 4CPAA 2ZC4A 1RACB 4CLLA 2B7CB 1VHOA 1TAUA 1B7FA 2FQQB 5G0RA 3FB3A 1VRUA 4DR6F 3Q8SB 3MEEA 1VRTB 3I55S 2M3DA 2WZ1A 2CJAA 2DGXA 1IKYB 4ZJOA 4RW6B 1PU9A 1NSKL 4XDDA 2CVEA 1QE1B 2MQOA 1NXIA 4N7TA 2ZEDA 1I6JA 2PVWA 2EKYA 3C6UB 2DKOB 1FXRA 3B7IA 4G1PA 3W60A 2CXAA 3X1LB 1GYTA 4DQSA 1F9FA 4F04B 1RWWB 4X66J 1KS2A 1IN0A 1E6YA 1R89A 2NXEA 3ET6A 3EVWA 5DM7Q 2ZUGA 2ADBA 2F8EX 2GMLA 3RAQA 2K8GA 4C7HA 3N5FA 2I8EA 3G96A 2EFPA 3MMCB 2YNGB 3QAEA 1Q53A 3RU0A 2DO4A 4JI5J 3LQVA 1X4HA 4BWMA 1L3KA 2CNKB 3TVZA 1FRMA 2XWXA 4U8YA 4FBUA 2AFMA 3NOGA 2MJNA 4FS2A 1Q8IA 3UNYA 2W4PA 1UWBA 1Q7LA 2R2TA 5J1PA 1Y3JA 3R9GA 4ECYA 1NM2A 4RBVA 2VXKA 4HI2A 1RO5A 2CPEA 2Y0BB 4MKVA 3A3OB 2QG9B 1F0XA 3W61A 4U7CA 1F9EB 4NLOA 4DLGA 2BM0A 2V4RA 4KOTA 1T03B 1TL3B 2RT3A 3G6VA 4ECWA 4R8UA 2KXHA 2GA7A 4PG7A 3M9NB 2ZKTA 2DIVA 1BQMA 4EMDA 1UVLA 2DHGA 4ID8A 4X4PA 2FZKB 5DETA 2WW4A 2EUIA 2AJ4A 1S79A 5L1IA 3FCVA 5CYMA 5FDLB 3NGTA 5F46A 3CC4S 1WC4A 3S9LA 3CNQP 4C3KA 2FJDB 4Q43A 1AXQA 3PYDA 2CIJA 1QAJA 4ZX8A 5D4OA 1DTDA 1QAYA 1YK9A 3CTRA 3JQMA 1JLBA 1U2RA 4NYOA 2FIAA 5CD4H 3MM6A 3SSRA 4PQUB 5IM0B 7FD1A 2BE2B 4OJ1A 5AG5A 5E7OB 1WF0A 3PTWA 3TE4A 5I3UA 1X4CA 4Q0BB 1RU1A 1WWHA 2W7OA 1BO4A 1LOUA 2YQ1A 4QYRA 3KG1A 1KTQA 4IRDA 3CT9A 2PRQA 4PYAA 4IOCQ 3BO3A 1RT4A 3CCLS 2HV2A 1N54B 2V9WA 4OZ5A 3VHQA 5J2MA 4LF2A 4M5IA 1RWUA 1B87A 3IEHA 1VRQC 5T7LA 1RGVA 4F25A 2ODFA 3EDQB 3SQGB 3P8BB 1DBDA 4CP5A 2IYIA 3I82A 4X4VA 4P6QA 2DH8A 4KY3A 4BLGA 4F8ZA 2Q66A 1TXRA 4IQXA 2GS8A 5DGAA 1J5OA 2LEBA 4J9NA 1TZ0A 5D3GA 3SMZA 1HLWA 4ZY2A 3GILA 4WF9Q 3EPIA 4UWIA 1KVJA 1RJJA 3KJQB 2ACYA 3AJ1A 3TQEA 2J76E 3TX0A 1A0OB 2ZH4A 1Y0HA 2LU1A 1K4JA 5C88A 3IWNC 2MQ8A 4L3KA 1A7GE 1WEZA 2ASDA 2M5YA 1GMVA 1AT1B 2I38A 2GZOA 1NBEB 2A0FB 4UEFA 5G1ZA 2MQMA 5E5NA 3MMAA 2UXDJ 5KFVA 1U6FA 2AFOA 4K8RA 1YRUA 1SIZA 4HPSA 4CCHA 2EKNA 4ECZA 1HQUA 3GYAA 5EX3A 2WVCA 3KLGA 3PP9A 2OZHA 1MU2B 2ZITA 4DR2J 3DLEB 1WD6A 2MZJA 2UU9F 3Q83A 3T1HJ 3C6TB 3G2XA 4U9ZA 5E41A 1CQNA 3VWSA 1DTQB 1F5AA 2XWYA 4LF6F 1XJOA 2AKWB 1SVDA 1WDDA 4ZHRA 2FT0A 3TX8A 4NCGA 2X1BA 4MCRA 3DR6A 4KLWA 4KVXA 6CPAA 1HW8A 2V63A 3NS6A 1IQZA 5CD4A 4F4YA 3BQ2A 2ADCA 3ZFVA 3PB8X 3GTYX 2VOOA 1FA0A 2VEZA 2DHAA 1NK9A 3DDIA 1ZLHA 3MF5A 3OR1A 2Q6BA 3PDNA 1RWMB 1VQ9S 1CC7A 1GTEA 3CXPA 2MKYA 1NKCA 3KLHB 1S10A 3IWLA 1XERA 3I0SB 2Z8QA 2G13A 4ZLJA 4FD7A 4B3RF 3UR3C 2CXEA 3KLEB 3SIPB 1RB0A 1HW9A 2XMUA 2GW8A 5LRGA 2FD2A 1FE0A 3IWGA 4CYNA 1HDQA 3H8FA 5GAEI 1HWJA 2R9LA 3PR5B 1SKUB 1WC6A 3MM9B 1KLNA 2HGLA 1WJ9A 4B3OB 1OY9A 4DUTA 4ZPBA 3DLGB 1H2VZ 3F44A 4JYAF 4JV5J 2IIHA 2RQKA 3EDRB 3IFEA 3J7ZT 3VAFA 5KFPA 3D5MA 2QL7B 1M1GA 4DQQA 4F9VA 4P10A 4RJVA 3FUYA 1UTAA 4HKFA 3DMJA 1PILA 4PG8A 2Q0YA 3FK4A 3D68A 4MHNA 3LGNA 1GX5A 5B0DA 1L3VA 1LK5A 4X65J 1SQGA 4LBIA 5CNPA 4OIXA 1UFLA 2YWGA 3DM2A 3OD2A 1PYTA 2EFQA 4ILRA 3PM9A 4LSNB 3NG8A 4Y00A 3CZXA 3R9LA 3BB5A 2VQFJ 1X8DA 1S1TB 4L76A 1JX4A 3R5GA 3V6HA 4DL4A 2W4CA 2B0GA 4DPOA 2XEGA 2ZVIA 4IO1A 1PGZA 3TYTA 3W9HA 1D09B 3EXYA 1WSVA 1UEVA 2J9DE 1NK4A 4F3MA 3JUWA 2C42A 3PIOQ 1X0PA 3NE7A 1JLCA 5C25B 1HNIB 4FZVA 4F26A 3HJFA 2CZVC 2LDIA 4YOEA 4O4RA 3EFAA 4HHHA 1UP1A 2AGOA 4NMXA 5FD1A 5KFMA 1HPZA 2CQHA 2CYYA 1M5OC 1NDPA 4LUAA 2R7UA 2C6PA 3E51A 4K4VA 3I1UA 1YWXA 3MTKA 4URSA 1HKAA 5L1KA 2H4YB 1S76D 3GR1A 3PW4A 2FC9A 1MN9A 3SJXA 2YNHB 2ACMA 1LXJA 1S0MA 3SYZA 2KHDA 1IJEB 2H1YA 3HLPA 3FCWA 3ZTPA 1Y5LB 1UWYA 3RB3A 1XRYA 1ULRA 1S7IA 2V4JB 1Y5IB 5I0CA 5EBVA 1CS4A 4X84A 4KO0A 1M0SA 4WPAA 2JNJA 4HNWB 2QL9B 4RW7B 3A13A 3HHLA 1S6UA 4EBDA 4P74A 4WJBA 4KVME 2ZH8A 3JXOA 4WIQA 4UOHA 2B4VA 3OLAA 4IFVB 2P9CA 1U8WA 3PYEA 1M5KC 3MPVA 1H8LA 1EETB 4M5DB 1FKPA 4MKBA 4HTJA 3RYOA 5F47A 4ZKAA 4DFMA 2FVPA 4ED7A 3F5BA 3C16A 5G0RB 5AG7A 1VRUB 3R7SB 3QYYA 4I0WA 3MEEB 3R5DA 1XMQF 4KFBA 4WZQA 1RWPB 4AL7A 2C2RA 2WSCC 1X7VA 1IU8A 4YB1P 2RUSA 3GFYA 2ZHAA 5EWFA 1CPXA 5KFLA 3B4MA 2BKNA 2RRBA 4K59A 2BQ3A 1N33F 1CP6A 4DS5A 5JGFA 1F2HA 1SC3B 1OIAA 1E6YB 4PXEA 3ET6B 1UKUA 2WK4A 4USHA 4TY8A 5HATA 3O1LA 3WX8A 3FVLA 3WIUA 3P2HA 1VCTA 2BOAA 2DNHA 4A46A 2N3OA 3MFHA 4KC5A 2DH9A 2PFFB 4K0KF 4DX8H 4C97A 1RT1B 4P4FA 4ZVRB 3HD2A 3BH7B 3DU6A 2QEXS 4YUDA 1Q5VA 4USWA 4WKYA 1VQYA 2OKQA 4WTOB 1K9MT 2RQMA 4WFYA 5DLFA 1HD0A 2CNSA 2CQ0A 5EN1A 1UVJA 1I5OB 5ETRA 3I9V9 2MPUA 1UWBB 4P72A 1Q7LB 4OYXA 4KPYA 2FUG9 4J9VA 4OC0A 4J7CA 4V1Ak 4RU2A 2FJBB 3E01A 2YTCA 4ORFA 4DCPB 1YKWA 1N5YA 4UZCA 1P6TA 5HO4A 5J2PA 1Y9WA 1NB7A 4B13A 3M9OB 1YX0A 2BV3A 4R8FA 4NEZA 1NAQA 2J6SA 2CNOB 2RB7A 3ENWA 4FP9A 5LJ5Y 1BQMB 3H5XA 2CZ9A 2P6FA 4IRKA 2FJWA 3KR4A 3RW6A 1SBRA 2M4MA 1RTQA 5CYMB 4FF2A 1W2IA 2KB2A 1RT6A 3N79A 5LMNJ 5BYRA 1DZ5A 2LQ9A 5A28A 1JLBB 4USIA 3FJUA 3MM6B 1MMLA 3Q8YA 4ZP7A 1ZETA 1UWAA 1C4AA 4MH8A 2EC0A 1H73A 1WG1A 4QQBA 5I3UB 2G3AA 2DGWA 5FLXY 5KG1A 2HLTA 3H5UA 3IN5A 2J0SD 3DI6A 4DV4J 3BO2A 4X8IA 4RUCA 5DG7A 3P3DA 5GCNA 4NPOA 2OPPB 3I31A 4A8KA 4RW4A 5DJBA 2JX2A 2NSCA 1BWEA 3PRVA 3DLHA 2DIUA 1WHWA 1TF9A 3TUZC 2DNQA 2OTLS 1Q4RA 4IH7A 1IR0A 1RT4B 1YBUA 1JB0C 4U96A 5J2MB 4UZBA 1I1DA 4ED2A 3W62A 3LPEA 2I5JB 2KT5A 1FRIA 5T7LB 1Y00A 2EVZA 3GJRB 3C66A 5HMNA 1S72S 2REFA 3SEOA 1Q79A 4AUKA 2ZBCA 1TUVA 3AA8A 3BBFA 1Q82T 2HBZB 3PNIA 4NA2A 3MCSA 2PA3A 2L9NA 2C2OB 3PHEA 2HYIB 2OZGA 1BGXT 1PG5B 1UZDA 1GT8A 1APSA 3CJ0A 3PR4A 4I68A 5D3GB 2UVUA 1ELMP 3BR8A 1ZTWA 2MHNA 2YGWA 1YW6A 2FHMA 1XN9A 3IWEA 2DNYA 1VFJA 1P9YA 1SUQA 1RTJA 2I9SA 1P1LA 2XS5A 2E5LF 2D9OA 2VHGA 1WHVA 5D8HB 2HWIA 3MM5B 2GIVA 4MCQA 2VJUA 5EX0A 4OZJA 1DAXA 3ISZA 3CD0A 2D3O1 2PR1A 3L09A 5EMIA 1S6PA 1BQNA 5HVGA 1CPSA 1SH0A 1CG2A 5DG8A 5H86A