5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
molecule keywords Amidase, hydantoinase/carbamoylase family
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
3D68A 3NH5A 1LAMA 3H8GA 2PIYA 2O4HA 2PJ8A 1CP6A 2PJBA 3IWWA 5K8NA 1KWMA 1YMEA 3B3CA 4EWTA 3PBBA 4P4EA 4NGMA 4YWYA 3NH8A 4X2TA 1H8LA 2IQ6A 3T8WA 3LWUA 3SJEA 1FT7A 3BXMA 5K8OA 4PQAA 3KI9A 4MCQA 1PYTB 3B3VA 3PBEA 1XRYA 4OC2A 3FECA 2NYQA 3V38A 2ZOGA 3FH4A 4MXUA 2XEJA 5K8MA 4A37A 2F8HA 4NGPA 2CIJA 3S9LA 3IFEA 5CBMA 4OIDA 1TKHA 4ZY2A 2J9AA 2ZEMA 3B3WA 5HVFA 2AFZA 1LCPA 4CPAA 1CPSA 3VARA 3WC6A 3GUXA 4A39A 1ZLHA 4UIAA 1DE4C 3KR5A 2V8GA 2IJZA 2PE3A 4G1PA 3I1UA 5D8NA 3FEDA 5JGFA 4FBEA 3PRTA 4DYOA 1NSAA 2NSMA 1HEEA 1XFOA 5LYFA 4OC0A 2POKA 3VATA 1Y0RA 2V8DA 2V8HA 3QNVA 5HVHA 3IEHA 1Y7EA 4UEFA 3D67A 1BPNA 3D7HA 2I3CA 1M4LA 3KHXA 1BLLE 4ZYQA 3BHXA 4W9YA 4AXVA 2OOTA 2QVPA 3D7DA 5CPAA 8CPAA 1CBXA 2EWBA 4K3NA 1QQ9A 4O23A 3CT9A 3D4UA 1CX8A 4MCRA 1VIXA 4P4JA 2GLJA 2HC9A 4PPZA 1QMUA 1PCAA 4WWVA 3S9NA 1Z5RA 4NGQA 2C6PA 2BCOA 1TXRA 3V7ZA 4PXEA 1HDQA 4EFDA 1DTDA 2PCUA 2ABZA 3PEIA 4NFRA 4RUHA 4Q7AA 2XEFA 2RB7A 1XBUA 4MHZA 3WC7A 3PB4X 1FNOA 4ZY0A 4PXBA 1VHEA 3CPXA 5LYIA 5IB9A 2CTCA 1LFWA 4R7MA 5JH9A 3KASA 2QJ8A 2PJCA 2RFHA 1ELMP 1YW6A 4P4IA 3H8EA 1ARMA 3GLJA 1ZG7A 2ZENA 4F8ZA 4TNUA 3NA6A 2AFWA 4A94A 4R8FA 3PFEA 2C1CA 4F9VA 1UWYA 4ZY1A 2F7VA 4OKOA 2ZEGA 4NJRA 4MCSA 3IC1A 4ZI6A 4EMEA 4DUKA 1Y0YA 4P6YA 4B6ZA 1JQGA 5JM6A 1TF9A 1Q7LA 1TKJA 1CP7A 2PJ6A 1XJOA 2V77A 4YU9A 3KHZA 3KZWA 4R76A 1AYEA 1F2PA 1VHOA 4MHYA 4JZ0A 4PXDA 1AMPA 2VL1A 4IK2A 4UEEA 5HXDA 2Q43A 4TWEA 1OBRA 3B3TA 3FEEA 2ANPA 3B2YA 4IHMA 4Z65A 1CPXA 3LMSA 5I4MA 2ZEDA 3ISZA 3FF3A 3SJGA 4ONWA 2ZEEA 2PVWA 1LANA 1RTQA 4P4DA 5DS0A 2AFSA 1F57A 4ZX9A 3HUVA 3K2KA 3KQZA 1TKFA 1HDUA 3WABA 3H8FA 3RBUA 4MRIA 5HVGA 1YLOA 2PRQA 3FX6A 6CPAA 4MMOA 1EE3P 1CG2A 2PJ4A 3PB7X 2ZEOA 4FUUA 4OP4A 2PJ1A 2AFMA 2ZOFA 4LQGA 2AFXA 2PJ2A 5LYLA 3NFZA 2EK8A 3SI1A 3B3SA 4GM5A 4R6TA 4X8IA 3JRUA 2PJAA 3CPAA 3NH4A 5THWA 3DGVA 1ZG9A 2BO9A 3D66A 3GB0A 4P4BA 1TF8A 2PJ0A 3KQXA 4OC5A 2JBJA 1F2OA 2G9DA 2Q51A 3KL9A 4P10A 2QYVA 3FVLA 3CDXA 4ZX8A 2HB6A 5ELYA 3KR4A 4NGNA 4OIWA 2CTBA 2WZNA 4OMEA 2C6CA 2XEGA 2ZEPA 3FJUA 2PVVA 3IIBA 3K9TA 4P4FA 2C6GA 1LOKA 5LYDA 2OR4A 4BD9A 1Z2LA 2AFUA 3VH9A 1Z8LA 2GREA 4NJQA 4X3RA 4UEZA 4WJBA 3SI2A 2EK9A 2Q4ZA 3D7FA 2BOAA 4OC4A 2IMOA 2PIZA 3S9MA 4UIBA 4IAVA 1BPMA 1YSJA 4FWUA 2PJ5A 3FMCA 1R3NA 3WC5A 1ELLP 4A38A 3PFOA 4MCPA 3BI0A 4JYWA 2PJ7A 1ZG8A 3SI0A 5LRGA 4PXCA 3TX8A 3SJXA 5J1QA 4H2KA 5K8PA 7CPAA 4UF4A 5D29A 2PJ3A 2DEAA 2XEIA 4OC1A 1VGYA 1LAPA 3SJFA 2JBKA 2JEWA 3HLPA 3IO1A 1YW4A 2ZELA 3ISXA 4NGTA 3PB8X 4P44A 1ARLA 1GYTA 3IJ3A 5LRJA 3PB6X 2PJ9A 1BAVA 4MHPA 2V8VA 3WT4A 2AFOA 4OC3A 3N5FA 3B35A 3D7GA 2CF4A 3PB9X 1IY7A 3L2NA 2WYRA 3MN8A 2GLFA 2FVGA 1IGBA 4P45A 3RAMA 2O53A 2GU2A 3DLJA 4NGRA 5F09A 2ZEHA 3TC8A 3RZAA 4FAIA 3MRUA 1XMBA 1ZLIA 3KGQA 3B7IA 3BI1A 4KSIA 4MHNA 4NGSA 4F9UA 2ZEFA 4DJLA 5LRKA 1R43A
chains in the Genus database with same CATH superfamily
2RDJA 4U96A 4RJVA 3H5ZA 2Z0GA 3IRXA 3N9UC 2KVQE 1EB0A 1QM9A 4KSAA 2V50A 3P4UB 2HWHA 4ZHRB 2C2ZB 5A6PA 2RF2A 3EGWB 2XS5A 3CJ8A 1H8LA 4OX9J 1FX4A 2AEJA 3J7Z5 1KFSA 3ZZOA 4TLRA 2QL5B 2ZH4A 1T3NA 2CPZA 3I31A 4ER8A 3PX6A 3RBXA 4LF9J 1HR0J 3GSDA 4OIDA 3RUBL 4X4TA 3F5BA 4JI1J 2MKSA 4JXRA 4X5KA 1VHSA 1WKJA 6FD1A 2Z3LA 2V9WA 2PE8A 3PACA 2Q3PA 3C6UB 4Y65A 1TKTB 1RJJA 1IBMJ 5F0UA 4B3TF 3CVKA 2BE2B 2AV5A 1Q2DA 2UUTA 4LFBJ 2JEIA 2VASA 1R89A 4FYXB 4LRBA 1AB8A 5LYFA 2HUZA 3VATA 3BSOA 2ACMA 4DS4A 1FKAF 2CYYA 2IJRA 4NLXA 1F5CA 2KZZA 1VLOA 4ILRA 2XSJB 3MPUB 4KY3A 4MIAA 2GA7A 1CEZA 1MMLA 8CPAA 2WONA 3FRZA 3DLKA 1S0MA 4JD6A 2ILZA 4X65J 4M85A 1HYSB 2APOA 3V6JA 1FRJA 4NOHA 4IG0B 4WIQA 4C11A 1ZAWA 4IOBA 1KSPA 3W91A 1XBUA 2AE6A 2PT0A 3PB4X 3WR7A 4HH1A 2ILYA 4NCZA 2KXFA 4ZGYB 3A9LA 3KK2B 1RWOB 2Z0ZA 3W8GA 4B9VA 1ELMP 4XPDC 2BW7A 1RAFB 1X4AA 4WK1A 3TJ9A 1RU2A 1LXNA 3PFEA 1AFIA 3O44A 3E01A 2B4DB 2ZEGA 2XZDB 3P96A 3W7BA 1O8BA 3CPWR 4AQYJ 4DL3A 1VQ9S 3SXOA 4YB7A 4TLQA 3ZFVA 1BC6A 4XNHB 3R2CJ 3THPA 2R4FA 2DR5A 1XJOA 1IR0A 2EFQA 4ZVGA 3AXKA 1VISA 4M5KA 3S6FA 5E0OA 2VL1A 4LSNA 2OPSB 1EIYB 2V94A 1SL2A 3JTNA 4MK9A 4L72B 2Z8QA 1F6TA 3ISZA 3K17A 3W5YA 4I6YA 3GFYA 1FXDA 1MN9A 2JJ4D 1LANA 4ANDA 2W2OP 1MROB 3DN9A 4J9OA 3RRHA 1F57A 3T90A 3CCSS 4DOZA 1JJ4A 1IB1E 5HLFB 4CYQA 1WC3A 2HNDB 1D9AA 3KNGA 1RAAB 1YLOA 5LSOA 5BYRA 2ZEOA 1DTTA 4IOAQ 1Y7RA 4RS2A 2B7CB 3NKYA 4LF5J 4UFXA 3SCLE 1OY9A 4FNHA 5IQQA 3GP9A 4R57A 3J81j 5THWA 3JYTA 4QC6A 1Z8TA 2YKPA 5MLCV 1QSMA 1NK0A 3BBBA 5KFAA 4UY8T 3MWBA 2JBJA 1OPIA 4PWWA 2W25A 2KJWA 2ZPAA 3DOLA 4TY8A 3N01A 3AJ1A 5DWMA 4P74A 1VYAA 1E6YA 3DYAB 4R5PA 2DHHA 2RRNA 3ILOA 4UY85 4B5OA 3BLNA 2ATLA 3G4SS 4DR1F 1RLCL 2GJFA 2EBEA 2P9CA 2FVRA 1SH0A 1YI2S 1NB2A 4J90A 1S3ZA 2ADBA 4UIBA 2VU5A 1RT6B 3MI7X 2N3LA 1WC1A 5CZXA 1OO0B 4FNIA 1RT2A 2C2NA 2M8HA 2IRYA 2L48A 1RHJB 2B0GA 5DZ6A 4BDPA 1EKSA 3EZOA 5J1NA 5DM6Q 4M8LA 2LEPA 2ZHOA 1RWPB 5F9LA 2V67A 2C2DA 2DXEA 1YVFA 3QAHA 2BANA 4P44A 4B11A 1GYTA 3D28A 2M5YA 3CXPA 3THVA 1IBCB 4MHPA 3WT4A 2RDIA 5AG5A 4RL1A 4R3LA 3UCZP 5J2PB 4UOHA 4RBUA 4I7FA 1J5OB 2MQNA 2R9LA 4OV6A 4CYOA 5KFHA 1MWZA 1SIZA 1EX8A 3ISND 2DB1A 3QRQA 4Z7CA 4FAIA 1V9OA 1NMTA 5GVQA 1XIQA 2ZD1A 2JEJA 2OZGA 4CH1A 2Z3KA 3T1HF 3CWJA 2GFFA 3C16B 3ZZZA 3GZ7A 1FRLA 1IBMF 3O3LA 4E2FB 4MJ8A 3D68A 3RB3A 4RUBA 1NXIA 3NGKA 3G86A 2M88A 4CLYA 1EETB 4OX7A 3QZ7A 3UN2A 3UWTA 3NE8A 1HBUA 1N5VA 4B9SA 2DGOA 3E0KA 5D0GA 2AU0A 3NH8A 4X2TA 2E1AA 1W2IA 3ZTPA 4LR9A 1IKVA 3U1NA 3PEJA 2MKJA 1Y10A 2QRRA 1JLGA 2V4RA 2OPPA 2OEMA 4Y49B 5KFIA 4LF9F 4MXUA 3TFYA 4HHJA 5JPHA 1RB0A 3ITHB 4F3QA 2I5JA 4NZ0A 3VAKA 1KS2A 1YJVA 2CJXB 4NSQA 4YFUA 1JK9B 4YQWA 2DXDA 4CO3A 3CJKA 1NK4A 4KR0B 3FBBA 2B4VA 4FYWB 1UA0A 3J80Y 5BR8F 2DKOB 1C4AA 3EFAA 1I1DA 1KUYA 2EG1A 2MJNA 4OYBA 2DO4A 4QIFA 3JB9k 4LREA 4X4OA 4QZVB 1FX2A 4OHZA 4JB8B 2UUCF 3M30A 3W5XA 4WXWA 4DV2F 4ED2A 1M4LA 2NPIA 2IHR1 2OKQA 3M6VA 1VLYA 2YKMA 1VBKA 4KVME 1SKWA 3KK2A 2AMCB 3LPYA 3BR8A 2R7OA 3AD7C 3PYEA 3K5MA 2GHPA 3V4IA 1J5OA 2ZXVA 1IKYB 4OI6A 3ETOA 2MKYA 4LJMA 2MJUA 3FEYB 4NGQA 3I5CA 5KT4A 2W7OA 1QVFR 1TQLA 5A8KA 1N33J 3K5NA 4U5YA 4CYPA 2WHOA 3PCOB 4ERDA 4Q7AA 3EZ5A 3OD2A 3DLLQ 1F9HA 4OYPA 4X4VA 5JVGQ 2CNSA 4KOVA 1VQOS 1RWMB 3IR5B 2Q0YA 4OJHA 1JLCB 4QIWD 2AJ4A 1T02A 1N4LA 2ZH3A 3DRPA 2R7QA 5B0CA 4O4GA 4KFBB 3SZ2A 3TWZA 1B64A 3VVTA 2R8IA 4TYAA 1PUAA 1HBOB 1HYSA 2F7VA 3ZNUA 2E9RX 2GQCA 1DQ9A 2AGOA 4ZJOA 3RBDA 3RAQA 5F8NA 2CJAA 3W2VB 4NRTA 2R8GA 4H4OA 3QGHA 4CAXA 2WVFA 1WDTA 1VHOA 3HJFA 2YQ1A 3L9ZA 4MHYA 1Q79A 3HD1A 4CGLA 3T5HA 1OBRA 1GX5A 4M5DB 2HFVA 1FHTA 2W8KA 3NGSA 4LR7A 1YJ9S 4PPDA 1L5UA 1JLQB 2B58A 1B4SA 2A0FB 1VDHA 4A95A 5DRKA 4DFPA 2V69A 1N0VC 2ZH8A 1NEEA 2YNEA 1C4CA 3CCTA 2FLNA 1REGX 3EO4A 4HLBA 2BDPA 1IKWB 3HKWA 2MZSA 3MM5B 5CNPA 5D4PA 2XZTB 5AG7A 3HVRA 5CAAA 4V19X 3RBUA 3PJWA 3IR6B 5IT9U 3FMWA 2GIVA 2VFTA 2KRRA 2NXCA 4KFBA 3RYOA 2CRLA 4MFJA 1R6VA 3S6EA 1HQ2A 3NFZA 1VRTA 2D41A 2PJAA 2HNYB 5CYMA 3NCPA 3W62A 2G9DA 4ZKAA 1QSNA 1XBWA 3FCVA 2LLZA 1IYLA 4ZX8A 4HH0A 2AJFE 2DNYA 2HB6A 2UVUA 1JNRB 2GNKA 4F6AA 5KFVA 2HWTA 3RRKA 1IWGA 1RE1B 4JLYA 1GMWA 1ZTWA 3QAYA 3OUYB 3BGRB 2HZVA 1Q8IA 5CCLA 3S6GA 1U6FA 3M4XA 1DLOB 3CJ0A 4FF4A 2C1EB 2NS1B 1R3NA 2FJBB 1SH3A 3E51A 4WP8A 2GANA 3E8OA 4LUAA 1RT5A 4HACA 1AA1B 4YEAA 1B7FA 1JJCB 1LAPA 1S59A 4USIA 1SC1B 1T9VA 4HTIA 1PYOB 1FKOB 2XMTA 2ZBPA 3IJ3A 2V8PA 2Z3MA 1X5PA 3VZIA 4LSLB 3T6JA 2QG9B 1RA6A 4KH1B 4ELVA 4C4WA 2VG6B 3Q2SC 2DTJA 1URNA 1GT8A 4A32A 3RZAA 3CCRS 1QVGR 4PAAA 3OR1A 2QA2A 1RT7B 2MHNA 5F8JA 3HSDA 2Z58B 3MM5A 3UVJA 1FRMA 2WTFA 5K20B 2BJ8A 3Q22A 4PKDB 2Y8YA 1FI4A 1CSJA 4X4QA 4WIIA 4JI4F 3MMCB 4LQ3A 4Y6IA 2BRKA 2BJEA 3FXTA 1LFPA 3SEOA 2JDCA 3QPIA 1U48A 1JWQA 3PBBA 1RLDA 3DI6A 2HHWA 3LWUA 5GAEI 3SJEA 1RTIB 2OIHA 3TOBA 4RNNA 4QU6A 1UPPA 2PI4A 2CJBA 4ED0A 2OSQA 3NXZA 5HP1B 3R5BA 3H4BA 5J2PA 2GZOA 1R7IA 1XMQJ 1LNQA 2AYGA 1JXVA 2WB4A 1CVJA 2PI5A 1Q78A 3HZEA 5HVFA 1CPSA 3WC6A 3CULA 1JLBA 2XLKA 1Y9OA 4A46A 4ZK7M 3BGOP 2HWIA 2CQDA 5IC6B 1KVKA 3NNHA 3C2PA 4YY3F 1U8SA 4DR4F 3R6GB 1EP4A 4LMZA 2W9CB 1KZFA 4QOTA 5A8WB 2POKA 1S7LA 2YKAA 5KTAA 2GHVC 1QAIA 1JLCA 2Q6CA 1XR5A 2VKZG 4KRWA 4J9PA 3NOGA 3IU1A 2KRBA 3WX8A 4M94A 4UOFA 2OAUA 2MB0B 1S76D 4JI1F 2B7BB 3QFWA 4LF8F 5C24A 1ZZNA 4LSNB 2WW4A 2J7KA 1NNDA 2EWBA 3ZZYA 3QIPB 1BQXA 1VIXA 2CQCA 1U1LA 3HHKA 1U47A 2OO4A 1BGXT 1RT4A 2WB1D 2UUBJ 4B5PB 1Y00A 2W2PP 1HDQA 1ELOA 2Y1JA 3TVZA 2KT5A 4CGOA 4L8AA 1FNOA 3FSYA 4QR1A 1N54B 2XNRA 5EWGA 2OTLS 2AP6A 3AAWB 5C42B 1VR6A 2OZHA 1HQEA 4R7MA 2CQ0A 1RBOB 2I8EA 4LX9A 2P6FA 3ZTRA 2EFVA 4DQSA 3K58A 3Q8YA 3IRWP 3ZZTA 2PDOA 2Q1LA 3QLHB 1S57A 3CC4S 4RBVA 3T1YF 3TVKA 4B6ZA 2BXJA 2F1FA 2WBMA 4ZPAA 2DNNA 3EWGA 3I32A 2GIRA 2V77A 2ZW6A 2G13A 3BPDA 4M5JA 5C24B 4CNZA 2QMWA 3D0GE 2HW3A 4C7QA 2IBOA 2Q43A 4U8VA 4B9UA 2VBWA 4C3KA 5C2GA 5IM0A 3PJXA 3F56A 5KG7A 1CM0A 2QSWA 4DF4A 1UJ6A 2MQLA 2FDNA 1VMBA 4HR2A 4OLOA 4KGZB 1GXLA 1X31C 5KOWA 4BBHA 4NXMF 1H98A 1FFGB 2QLFB 1YJNS 3DOMA 4NYZA 2H48B 2YNDA 2NSCA 4ZX9A 1M4GA 4USJC 5L38A 1LW0A 1RACB 1TKFA 2ROPA 4ITSA 4L3KA 3WABA 4WYLA 1RYSA 4M63A 4QJVA 2FY8A 2ERRA 4URGA 5M2UA 3POTA 3OWCA 2KB2A 3I5AA 3PB7X 1ZO0A 4FUUA 1L3TA 4C8KA 2AFMA 2ZOFA 2X7IA 2JH3A 4F3MA 2AFXA 5LYLA 3MECA 3H4DA 5AE2A 3LTOA 3CF5Q 3R5JB 5KFEA 3NNCA 1O51A 4DQQA 4ED8A 1H38A 1S1UA 2B3VA 2WSEC 5JJBA 3VAIA 4ZLNA 2UUBF 1H73A 4U8YA 1HNXJ 3D1HA 2WOMB 1FJCA 1Q2YA 2VG7A 4Y0FA 2ROGA 4WFNQ 1M5OC 1S1VB 1IN0A 2CZVC 3DRRA 2MY8A 3BJ7A 2XSFA 1UVJA 1JKHB 3BO4A 3FRYA 2ZITA 2L41A 3OHAA 2XS7A 4QPTA 2C6CA 2B5GA 4NEZA 2FGOA 2GIFA 4A8YA 3PXGa 3BF4A 3I9V9 2DH8A 2E7XA 1X0PA 4PCQA 1Z2LA 4YDDB 1W7WA 2GO9A 3KK3B 3VWSA 3O5TB 4DJBA 5ETVA 1S1TA 1VRTB 2G2YA 4NCAA 2LMIA 1LWFB 1R8CA 4IH5A 3MM6B 4AVAA 1S1WA 2PJ5A 4A38A 2B51A 4BLGA 1A0OB 5F41A 3SFUA 1TK5A 4OQJA 2XCAA 4D3HA 3D9BA 3VR1A 4M6GA 4PEOA 1B7YB 4ZLLA 3A13A 4UZBA 5DG8A 3NGTA 3WZ0A 5K9FA 3IWNC 2FZGB 4WCEQ 5A8RA 2JEFA 3IWXA 4HEA9 1H7WA 4TKTA 1S6UA 3R1KA 4ZCIA 1WSVA 1NMEB 2DNRA 2Y1RI 5AE1A 4IRKA 4CAWA 4P2SA 4LF2A 1UZHA 3L2NA 3ZZIA 4DR2J 2DHGA 1UFHA 3G6XA 3U1LA 5LJ5Y 3G96A 3NMAA 3IWEA 3TP2A 2G3TA 3F8KA 1SV5A 5E96A 3N7ZA 4H4MB 2O01C 1YIJS 2DPTA 2Q04A 3LA0A 4F9UA 3ONQA 4CLPA 5F0WA 3DGPB 5L1IA 1K0VA 1FXLA 2O4HA 2MPUA 2AHOB 4J9LA 2CIMA 1XEZA 5D6GA 3EDRB 3MFHA 2YXLA 2ZH6A 3R2DJ 5EN1A 1HWUA 4I4BA 2LEBA 3P45B 2P9GA 4KTQA 4UTGA 3SMZA 2OHDA 1Y11A 3HDSA 2FC9A 1KLMA 2GX8A 3OXFA 5GAHU 3NBPA 2F5IA 1KLNA 2ZNYA 4ZS6A 4FKYA 1C0TB 3L95X 2PSWA 2PO4A 1AUSL 1LK7A 3GR1A 1U2CA 4KT0C 2A6MA 1ZLHA 5J2MA 1SQHA 4KIAA 4ORFA 4NLUA 4TQRA 4AFFA 4LIWA 2EFPA 5KFLA 4TY9A 3DHXA 1CBKA 3QAUA 3D1QA 2J9EA 3SQGB 2HK2A 4NLYA 2NSMA 5I3UB 1XFOA 4Y49C 4C2YA 3GG0A 3G71S 4FF3A 2Y0MA 2V8DA 3BBFA 2OUGA 1VC0A 3QNVA 3IEHA 2IIHA 1VBYA 1K44A 3SSQA 1C1BA 4DF8A 4QYRA 2XO7A 1REVA 1U4BA 2B8QA 2GJIA 1K9MT 4ZYQA 3TAQA 1NPRA 3BN4A 3BHXA 3OL6A 2FIAA 4DUYJ 2XWXA 1S5ZA 2H5JB 2OOTA 5CPAA 1FWPA 3WDOA 4CYUA 1GEHA 2LQ9A 3H42A 4O23A 2BW2A 7AT1B 2F63A 4ZCMA 1HW9A 9ATCB 3OTCA 1Z5RA 3GIKA 4ZVUB 4UQGA 2UUWA 3TO9A 1NO8A 4EYIB 1YG0A 4UA3A 3OLBA 2H5IB 5J8FA 5HI7A 1HIYA 4G1IA 2J8SA 4ZCLA 4GVLA 2D4PA 4ENOA 4NEYA 5CD4A 2QJ8A 3HJVA 4HNXB 4J9VA 1GH8A 1EARA 3NS6A 2RKIB 3HMJG 4YOEA 5C82A 2AJ0A 5A0YA 5JM6A 4KKOB 1MROA 3L09A 5I3UA 1WJ9A 2NMTA 5RUBA 4C0HA 2CXEA 1B0TA 2JX2A 1ZETA 2EG2A 2VA3A 3EXCX 1S7IA 4A8QA 1T8EA 3FUYA 1UZDA 3MEEA 5ETTA 5AXMA 2YKMB 2UUAF 4NLTA 1X5OA 1N5YB 1QAXA 4OYMA 2B5JA 3M8PA 1K1SA 2XTJP 3AQOA 1SJQA 4J37A 1U0HA 3V8IA 1KQGB 4I2QB 1WHVA 3TZYA 2DEJA 2E7VA 3I9ZA 1MJ9A 3S01A 3ULHA 3K2KA 2DNGA 2YWFA 4KUBA 3MEGB 1N36J 4QYZJ 1YK9A 1KQFB 1H74A 2HS0A 5GAGU 3T9ZA 1U24A 6CPAA 2PQ8A 4NPOA 4NA3A 3MPYA 1SUQA 2K7JA 2G3AA 2FJEB 3BQ2A 3PGPA 3BJYA 2PIIA 3WC0A 3DFEA 3UDEA 3GB0A 2MGZB 2VG6A 3AQPA 2KDOA 4RWXA 3KNAA 2ZC3A 2HFZA 3IM9A 5AJ3J 1NDPA 5G22A 3F41A 1BQNB 3CDXA 3DHWC 3KFWX 3J7YI 5IXUA 3MR6A 4ZVQB 2V9KA 2HBZB 1OSDA 2NCKL 2BANB 3TVYA 3GIJA 3MXHP 4F2RA 4CP5A 4DV0F 3RW6A 4X4PA 1HWKA 3NGRA 4IR9A 4K4VA 2FJWA 1S9EB 4O4GB 3TARA 3D7FA 3TZZA 2WUUA 4B13A 4YRHA 2HAIA 4ZP7A 1Q2CA 3LP1B 5D0HA 1HI1A 4EEYA 3A3PB 2VBXA 2OZUA 3F73A 2Q66A 4DR2F 2YGWA 2BEFA 1KTQA 4O3PA 4AE5A 5K8PA 3CEDA 8RUCA 4OC1A 4I1TA 5LJ3Y 4X64F 4G6VB 4NGTA 5I3PA 2XSJA 1HBMB 2CQ1A 4OC3A 3P5TL 5AE3A 2YQ3A 2QMLA 3LO3A 1IY7A 3PHTA 3MN8A 4DMZA 2B5JB 1K0TA 5T7LB 2GLFA 5BYQA 5DZ7A 4PG5A 3D3BJ 1TUWA 3RAMA 1WD6A 1WKLA 1S12A 5JXSA 4EBEA 4EK2A 5A27A 1I21A 3US5A 2HAFA 4LRAA 3CJ5A 2WK4A 5AGEA 2DGTA 1PJ6A 2XWYA 1XWLA 3FRMA 3MCOA 3NH5A 1NK6A 1FJGF 3CO0P 1LAMA 3G3SA 2SXLA 1VS3A 2ZDPA 1U1OA 2UXBJ 1JXLA 1HW8A 1FNMA 2NUHA 1OQ3A 4DS5A 1T3OA 3L7PA 3PEHA 1V5IB 5HQLA 4BS2A 1AZSA 3TOAA 1WKKA 1TKZB 4P71A 1S0OA 5IB0A 2ZOGA 1Q86T 4NGPA 3GJRB 2WPXA 3MEDA 3H40A 2H54B 3FFIB 1T7PA 2J9AA 3LF0A 2B3TB 4F4WA 3W3SA 3JSRA 2ZJQQ 4H4OB 4ECYA 3GSIA 3GILA 2JLGA 4UIAA 1IR1A 1V3ZA 3KDOA 2YNIB 4IKAA 3BKTA 1RCOB 3IG1B 2KU7A 4LF6J 3E3XA 2AIRB 2KM8C 4AG9A 3BSAA 4R8UB 3UFCX 4CAVA 3NP5A 4ZLJA 4RPFA 3DDDA 1S6OA 5HVHA 3IGRA 3D67A 1VQSA 2MY7A 2AJ6A 4PG8A 2HQDA 1S49A 3CD0A 1KDNA 2ZWPA 2ZH2A 3ITHA 5KFUA 1S0VA 4AXVA 5KFMA 4ZHRA 4QVTA 2DNLA 2I38A 3HHNB 2CY2A 1CX8A 5ETMA 5G1ZA 2YWHA 2HHQA 1PCAA 4FZVA 2PSZA 4BC9A 3T5LA 1A7GE 1EQMA 5B0GA 4EFAC 4RZRA 2H65B 5KOXA 4DSKA 2AKWB 3C6TA 2BABA 2JC1A 3G87A 4L6V3 3R1LA 2ALYB 2QX0A 4WTYA 1KP6A 1QSTA 5KG1A 4PYDA 4OZ2A 1NJIT 3M8PB 2J9DA 3KJQB 2B9YA 3MD3A 3BZQA 2YNIA 2HG4A 2XGQA 2LU2A 2V6AA 1YW6A 3GR0A 5GAEU 2G1DA 4L76A 2W9CA 2CNTA 1NSLA 4WBFA 2ZW5A 2D9PA 2KM8B 3TOQA 4K0KJ 1WG1A 4EGLA 4B3MF 3LH2S 4CRZB 3W5ZA 2VG5B 3B6BA 5KFTA 4Z2XA 1Q7LA 4KGMA 2JFKA 3MGJA 3D6FB 3SQOP 4DL0C 3W8PA 3I4HX 2C27A 4JI8J 2B5GB 4DV5F 4P2MA 1GFWB 1KC8T 1RA7A 2ZKUA 1KBRA 3TA2A 2I0XA 3HVWA 5IV3A 2ANPA 2Z2LA 2QFJA 4NE9C 2E5JA 2YPZA 3DXBA 4Z65A 1TK0A 3RG6A 1IWAA 3EUNA 2NXUA 3FF3A 4XDDA 4ZVPB 5J2QB 4YHHJ 1EP4B 4IH6A 1EQ0A 4ES1A 2MMYA 2FIUA 3Q0AA 4P4DA 2J6TA 4CLSA 2R7XA 4KSFA 4KOSA 3GQCA 1JLFA 1F9EB 2KG1A 3EVOA 1TTHB 4DZDA 4CCHA 1GTEA 1N0UA 3FX6A 3AHPA 3M6WA 3V6DB 3NNAA 4ZJQA 2B9WA 1N48A 3NGUA 3FQKA 2DGQA 3BBCA 1TU0B 3PG9A 4MIBA 2I6WA 3F0AA 4QCLA 1NH8A 4K30A 5GMDA 3CPAA 5IV0A 1SI9A 3BGFA 3FCHA 1QSYA 3UVJB 4I7FB 3CCZA 4UCNA 2Q51A 3KL9A 1R8AA 2HVEA 1F3FA 1ZM2A 1HHTP 4UOCA 1YRXA 4A4JA 2BKPA 1HBMA 2UV8G 3CXCR 4MFBB 1WC6A 1Q1KA 2B4UA 2BV3A 5FDLA 5B09A 3FSXA 3IIBA 2ZE2B 2A3JA 3DLGB 4B3MJ 2CG4A 1D3WA 3BSNA 4LFAJ 2Q7BA 1M5PC 4X3RA 3QGPA 1H3DA 5E3PA 3J80U 4B9TA 4N5SA 1YBTA 4IAVA 4PK2A 2XY5A 1XMOF 8AT1B 2C2EA 2LXIA 1KN6A 3WQPA 2W7PA 3EZUA 3LAKA 1LXJA 4DUTA 1MN7A 1T9UA 4H2KA 2A2DA 1B3TA 2C22A 2RC4A 3TJ8A 2XZWA 3TUZC 4DSEA 3B4MA 4U7CA 2RF2B 2B4PA 4F50A 4ELTA 5LRJA 1LWEA 4K4WA 1F5BA 4C8YA 2OEKA 1WTFA 3M2UA 4USHA 2DH9A 2YNGB 1NHKL 1PAEX 2VFRA 3M6XA 3DLJA 2CFXA 4C98A 1T03B 1FJEB 1RAGB 2W9BB 2KFYA 4ONUA 3GWCA 1RAEB 2U1AA 1IYKA 3QT5A 4NXNJ 3T1HJ 1FDDA 3ZXWA 3TO8A 2VZ9A 3JVNA 2ZE2A 2ATCB 1GMVA 3Q89A 4NLRA 4B3OB 1CJTB 4J9RA 1Q82T 4F4KA 2ACYA 1G4CA 4MH8A 2N4CA 3PKMA 1RBLA 5IT0A 3MURP 2BVZA 5I42A 4UW2A 4IG0A 4N8OA 2ZFHA 1FD8A 1QE1A 5K8OA 2ZUGA 5E3CA 2QMUB 2LCWA 3VAJA 4M6IA 3KOAA 3R5AA 2DBBA 2FIWA 2C3OA 3IFEA 5SUHA 3L4BC 1ACMB 2QO3A 4PUOB 3HHEA 3K9UA 4ZY2A 1D0EA 2AWZA 5HMWA 1LV5A 1LCPA 3W63A 1FEEA 2J8NA 3KK3A 2D69A 3GTYX 4IRCA 1S60A 3P2FA 3K8VA 2J0XA 1T9WA 5A2QY 4OJ3A 2AJ2A 4DPXA 1MJAA 4F4YA 3CD6S 4F0YA 4QWEA 2K2PA 4E98A 4U7UK 2FL4A 4IOCQ 2VD3A 4P7TA 1X4HA 4P2FA 3ZNJ1 1UETA 4IFYA 3G82B 3R9EA 1ZTTA 1VQ6S 4MCRA 3VZHA 2REEA 2WSFC 5KFZA 2CVIA 4RUAA 2REFA 3S9NA 1QUVA 4YS2A 1S99A 4MTPA 2J6SA 3TZWA 4JI7J 3C26A 4YDXA 1Y5LB 2RB7A 1SBRA 4B3RJ 2HURA 3G8QA 3LW5C 1LK5A 2EO8A 5KFXA 4PUOA 5IB9A 4JV2A 4TVAB 5J2MB 4RU2A 4PSXA 4JI2F 2DITA 3RW7A 4DLGA 3GLJA 3UCGA 2R8JA 2VQEF 4OZLA 1T11A 2I79A 5EMIA 1OMSA 3NCQA 3EE3A 1FFSB 1LKZA 3SQGA 3M8QB 2BL1A 4DR3F 2YNHB 3JTOA 3WBZA 5H1SV 3OHBA 1S6PA 3AB4B 3ET6A 2XMVA 2M4MA 3R5DA 1UTAA 2E9ZA 3BN7A 3MAAB 2OLWA 1X4FA 2VZYA 2B56A 2IJNA 3VAMA 3LMSA 1X60A 2NZCA 1Y7PA 4E0DA 1NHUA 3BQ1A 1FWLA 5CHCB 2B43A 3OTBA 2OJ3A 2DGSA 1X10A 2LDIA 2IA0A 3M2UB 1RHKB 2D9OA 4IQXA 3O8WA 1CPZA 1N5QA 2XY7A 3F44A 4FN5A 2CDQA 2DNOA 5L1JA 4OI1A 4Q44A 3KLFA 3RB4A 3C16A 1SKRA 2YX4A 3D4JA 2G0JA 5DDRC 4ECXA 5JMNA 3C3LA 2EK8A 4GM5A 1RWVB 3D66A 3GG1A 3G8TA 5T41A 1TKZA 3C14B 1X0FA 1NPPA 1RZMA 3NCRA 3GJTB 3LALA 4TU7A 2BE7D 1S7KA 2OMLA 2DIUA 3UDVA 2AT1B 4PQUB 3QIDA 1LWXA 4OZJA 1Y0HA 1P4NA 4B02A 4TQSA 5KFCA 1TIQA 3VH9A 2HBQB 2CNKB 2CQIA 2VG5A 5JQ4A 4RO0A 5EUHA 2Q4ZA 2IYGA 3H2UB 1XNQF 1PO6A 2G2OA 1QDUB 3GYXB 3BH6B 1BPMA 2YX7A 2VDHA 1QTNB 1U1RA 5M2PA 5IWAF 3SJXA 2QT7A 4C68A 1NUEA 5HP1A 3QSIA 1M5KC 1KUVA 4Q43A 1RWNB 2AX0A 2K06A 2BJ9A 3TR5A 3BDEA 2J76E 3TQEA 4HT7A 1UEVA 2KYZA 3VHQA 3ZTSA 5E41A 4OX9F 5GAHI 2CF4A 3PB9X 4Y2CA 1AW0A 4NXNF 2FVGA 1Y9KA 1RO5A 1CJVA 4OZ1A 1FKPA 1IJEB 1RT1A 2CJYB 2NLWA 3OFFA 2VUGA 4M95A 2D1CA 3KGQA 1YK3A 1V6HA 4F26A 2DO0A 3MM7A 5KFSA 3TA1A 3A8KA 3C15B 4UWIA 2GVDA 2C28A 3MECB 4QBJA 1BQMA 3KHRA 3KXDA 4LT6A 5C42A 1U1NA 1YVOA 3JQKA 5K8NA 2GFQA 4IO9Q 1Z1ZA 2WSCC 4LF4J 4XK8C 2ZNZA 4RW8B 3BSCA 3LPEA 1VCTA 1FRIA 5J2NA 1ZM9A 3PRBA 4YB1P 4JI0F 1IVZA 4HACB 3PBEA 2YVSA 2LKZA 1XF8A 3TAPA 4WU3A 2IDEA 3DLGA 1FTRA 2CJKA 2CNLB 4ED7A 2DIVA 2DK2A 5IQ6A 4Y3CA 5IWAJ 1X9MA 1HQEB 3HHLD 2CQ3A 4F8RA 3MM9B 4ZA1A 3VARA 2CQPA 4KOXA 1MW7A 2FVPA 3OR2A 4FS1A 5GADU 1FXRA 5HSPA 1A2ZA 2V8GA 4DLEA 4CTAA 4IRDA 1N6QB 3QLHA 4FD6A 3DLBA 2JVOA 2VC1A 1N5YA 5D8HB 1FY7A 4RW9B 4X4RA 2YWEA 3CJSA 2QGFB 3TUPA 2Z4PA 3SCKE 1SL0A 1YBUA 3CB4A 4Q36A 3M05A 1UVLA 4KPCA 3D7HA 1U25A 4O3QA 1CULB 2OTJS 2XMMA 3ETMA 1U02A 2MLYA 4GKJF 3KMQA 2EBGA 2ZH5A 1HHQA 1MWQA 3GONA 1X5TA 1QQ9A 5AG4A 2J7WA 5LMNF 3PO5A 2RUSA 3HLUA 3DI6B 1DTQB 4ED1A 2YBVA 3KJNB 4FXDA 2YWWA 3NE7A 3RBEA 2VPWB 1KOOA 4DBQA 2ZBQA 2ALZA 3GFZA 5HQMA 5IOLA 3WC2A 1KFDA 5KT5A 1ZAVA 3FJ2A 3GKRA 4ZY0A 1AFJA 2BQ3A 2OPPB 4NLVA 3FFIA 4BC7A 4X66F 3UNYA 1ARMA 1S1UB 3LWMA 1TFWA 4CLLA 3P3DA 4R8FA 4XPCA 3H5YA 4DR7J 1VRUB 4IFYB 2VFUA 3D7SB 4RBTA 1ZOTA 4AXJA 2HMIA 3BGUA 3M1VB 4C8NA 1E6YB 3PRDA 3E2EA 2CWKA 1PKUA 2IC3B 4AD6A 1F2PA 1YHQS 1FO1A 2WSAA 4KBIA 4F2SA 4PG7A 1P1TA 1S9EA 2DHAA 1JKHA 5LOQA 2V2KA 4TWEA 5LT5A 2VPXB 3I0SB 2VH7A 4ZOSA 2V2VA 5J1PA 3S6HA 4YUDA 3QYYA 1ZA1B 5G0RA 2DPIA 4B14A 3CIMA 4FS2A 5H86A 1FA0A 2N3OA 3VVUA 3V5RA 1PBUA 1D09B 1C1BB 4Y2MA 2WRMA 2LQ8A 3RO0A 4K0KF 4CO5A 1RT3B 1VI7A 3MAQA 1CLFA 1HNIB 1N5SA 3A8JA 2XB2D 2HHUA 1BWEA 2KYXA 5A8KB 1HD1A 5FLXY 2Z11A 4LSLA 2ZH9A 4JI6J 2LQ5A 4FVMA 3CDEA 1ON0A 3NG8A 4GKJJ 2Y1LB 3PR5B 4LSZB 5F8IA 2HS3A 3KLHA 1Z4EA 4DL6A 3L7OA 3R9FA 1RT1B 3QFHA 4JI8F 3B3SA 5U47A 3G9CA 2O67A 3NH4A 3FKBA 3CDWA 2LYVA 1FESA 4I2PB 2ZWOA 2Z3PA 4BHQA 2ASYA 4KC5A 2VFSA 1TK8A 2QYVA 2CPFA 3GE9A 4DN9A 4B12A 5D15A 3PX0A 2MXYA 5MAOA 3IU2A 4DV6F 4H4MA 1TZ0A 3LGMA 2LXFA 3EY5A 2ZEPA 3FJUA 2PVVA 1SCJB 1YX2A 2UXCJ 4J3GA 5J8CA 1UFWA 1H2VZ 1XE4A 4ED5A 4C2MA 1CJUA 1M0SA 4O4RA 4IDKB 3M9NB 2FB0A 4ECZA 4DR5F 2HQCA 2GVDB 3R3TA 3ZJ0A 4BBYA 4JYAF 5LRGA 2GQ2A 3R6LB 2KG0A 4UF4A 3IXQA 1WEZA 1G6BA 3EGZA 2AJ1A 2K1RA 4ES2A 2R8HA 3M30B 1WI6A 4GKKJ 2DY1A 3IO1A 4KOTA 3VCDA 5A8WA 3X3UA 1ARLA 3HCXA 5F46A 4JI3J 1Z2ZA 4DX5A 1APSA 4RNMA 3ZZ0A 2ZC4A 2DNMA 5CQGA 3ILIA 3IAS9 2GU2A 1VC5A 4X4NA 4OADA 5F09A 4NI2B 1TL7B 2G2ZA 5FLXU 5KTCA 1FK9B 3TANA 1Y3KA 4KE5A 3B7IA 3OPKA 3FK4A 4RW7B 4XPLA 4R25A 4USKA 4PWDA 2PIYA 2WVBA 3DR6A 4PV6A 1XMTA 1BXNA 1YTYA 2X7BA 3KK1A 2UZAA 3KJVA 1CQNA 3TAMB 3U02A 3N6LA 4NGMA 2K8GA 4A8FA 3T8WA 1GX6A 4CI0B 1FT7A 3Q24A 3BXMA 3NY0A 5LSRA 3B8HA 4PQUA 3VWDA 2WOMA 3N28A 2RQMA 3W61A 1S1VA 3SHPA 1S77D 2F65A 2RT3A 4RW4B 4A2ZA 4X62J 2ZJRQ 1FVQA 3T9YA 1PSDA 2DISA 1TKHA 2YKQA 4FXWA 1LWEB 5K5MA 4R0EA 2F9DA 3NLCA 5IZHA 4ED3A 2DHSA 3H4QA 2W7AA 2MQPA 4ZPBA 1VOMA 2R7UA 1XIXA 2XLIA 2IA6A 2LA6A 4G1PA 2XHCA 1PILA 4ZMMA 1X4CA 3KMSA 3R27A 4KAIA 3R7SB 3W2VA 4MT1A 4DX8H 4C8ZA 4KHPF 2A18A 2R8VA 3KKFA 5DO2A 3PY8A 3OFGA 5AXLA 1HBNA 2DCUB 1PYTA 4W4MA 3ENQA 2UXDJ 3LUYA 5IFMA 4DG1A 1RI7A 2HNZA 3SXNA 2RQKA 4AVBA 1L3UA 2QIRA 2QVPA 4KO0B 3HFVA 1I12A 1J5EJ 2GLJA 4PPZA 2ZM6J 5KG5A 2GS8A 4WWVA 3GIUA 2MTLA 4Q5VA 1L3SA 4XPEA 1FK9A 2OPQB 5ETPA 1U49A 4C8OA 2D3UA 2QL9B 2ABZA 1NSKL 2ZBIA 5F49A 2VB6A 5L9XA 3PW7A 4WFXA 1XMQF 1NRKA 4L74A 4KV8B 1VHEA 3CPXA 3R7NB 2ASDA 1LFWA 3UW1A 2IM0A 3EPIA 2OU2A 3GYGA 4P52A 4RWWA 2LU1A 3H8EA 2E66A 4XPDB 4NX9A 3QIPA 3D3CJ 1QSRA 1S48A 4USWA 3TCVA 2F4FA 2AD9A 4OKOA 2V68A 4USVA 4J9NA 4O44B 5DDOC 2GAHC 1KR4A 1SC6A 4DCJB 4P6YA 3IS9B 4AYBD 3B54A 4YB6A 1HBNB 1N5TA 4MJKA 3UDCA 3D2MA 4X65F 4X4SA 1RT4B 4ZN3A 3GY9A 3M7VA 2VQFF 1K73T 4KHPJ 1R0BG 3K7RA 2WVDA 1RAOA 3CJKB 1WORA 4B3SF 1RWUA 4CGPA 2EI5A 2VBYA 4LIRA 5EGYA 2ZM6F 2ZEDA 3HT0A 1YVKA 4KO0A 2NREA 1XR6A 1G2EA 3ZZPA 4PYAA 3D2PA 5EX0A 4ONWA 1GQEA 5BXIA 1RWKB 4XO0A 1CS4A 4OL8A 4Q0BB 1ICEB 4M6HA 3N6MA 1C1CA 5L39A 4UBRA 2MKCA 2UVRA 3W6XA 4IG3B 2GJ2A 3M6UA 1HDUA 3A3NB 1V3RA 1WF1A 1Q5YA 4K7QA 3PHEA 5HVGA 2PRQA 1QSLA 1FTCA 3MOZA 1OZPA 2GIQA 2W2NP 5LXRA 4MHDA 4OI0A 3GIIA 3BKFA 2C2KB 2ZHBA 2I9SA 3AOAA 1JLAA 4NYOA 4R6TA 1VC6A 1GTHA 3R97A 3QSYB 3HPOA 3DGVA 2R3VA 4C48A 2XHWA 2X51A 1Q81T 4WE1A 1BY9A 1KRPA 4Y2AA 3NAHA 4RR5A 1Y4ZB 1CQMA 1NJYA 4FD7A 5ELYA 2R98A 2FQQB 4NGNA 3OXLA 3PP9A 3MMCA 4K50A 4F3OA 4P4FA 5HH1A 1KLMB 1TL7A 1Z8LA 3SDEB 2GREA 2DXQA 2YNGA 2FJXA 3MHYA 2HVIA 3HM9A 4JI3F 2E44A 3OSNA 1JB0C 3GCWP 4YMEA 4K4XA 4LUBA 4FWUA 1W2BR 2WZ1A 4X2BA 2AJQA 2LVWA 4NCGA 2DEAA 2EUIA 1RXOB 2ZVSA 3FMBA 4OLPA 2MZQA 3SV3A 4JYAJ 3D0IE 4ZITA 2ZELA 3MM9A 4F25A 3R5GA 1TKXA 2GGPB 4GO5X 1RK8A 2BBEA 5L46A 4V19J 5KFDA 1P9QC 4MYTA 1F9FA 1C0UA 1HLWA 1UA1A 1UVIA 3T6BA 1FVSA 2O53A 1M4DA 3QRRA 3LWLA 4AXIA 5ITHA 3RGIA 3M2VB 3C66A 4TYBA 1P6TA 2CADA 4FPIA 1J4JA 3A1YG 2BJDA 3UD3P 1SJ4P 2MEWA 2EWHA 4KSIA 1OIAA 4NL5A 3KLEA 2ZEFA 3G6VA 3BJ8A 5DWNA 3FNNA 3D8PA 1YGYA 3GCXP 3H8GA 2PJ8A 5KFOA 1NPKA 3HVTA 2X1BA 2Q4VA 3PDNA 2OI2A 3V4MA 2ZZTA 3AFGA 5I3QA 4C7HA 1H2UX 2CZ9A 2CNOB 5HN0A 2CPDA 2VDIA 5GAGI 2RSQA 1IM6A 3MZIA 5BJRA 2Y9HA 4NCGB 1UJ5A 1G3OA 3FVYA 4MCQA 3G8SA 3OTEA 4P6QA 3DLHA 1T9XA 4I6AA 4OC2A 2NYQA 4WK3A 4I6WA 3BEGB 4OYIA 2GGPA 1P0HA 1R27B 5E33A 4ES3A 4UWJA 3OL8A 1HMVB 1NKEA 4FBTA 5B08A 2BUEA 1XEBA 2ZVIA 3KJVB 4GVBA 2O66A 1S7FA 1DE4C 4ID8A 4OAEA 2ZEJA 4DFKA 1V5VA 2IAJB 2MLXA 3DKDA 2CPEA 4BWJA 3UR0A 5ETQA 1DRZA 4I49A 3ZTOA 2FJVA 3Q8RB 5JVHQ 3KG0A 4LBPA 1IOIA 4WXOA 3H90A 1RBAA 4L73A 3KHXA 1SKUB 1UW9A 3SIPB 1YRTA 3MDFA 5KFBA 1PC4A 4ETZA 5HROB 4CQ1A 2MZRA 1LRZA 1S9GA 2DXFA 3Q8SB 4J5OA 4DCOB 2C6PA 2FPHX 2HFOA 3ICLA 3KLGA 1O0PA 3C8YA 2MDAA 5C88A 4RNOA 3PEIA 1N34J 1HR0F 2H3EB 1ZPWX 2OD6A 2VC0A 5KG0A 5HAOA 2YY3A 5B0AA 2VJUA 2HNDA 1H0HB 2AX1A 3NOCA 4DPTA 3C6UA 3ZZUA 1A6LA 1I94F 3KLHB 2RUGA 2WVEA 2R7VA 2NR0A 2CPXA 2UP1A 2PJCA 3G82A 4I2QA 4KOYA 1BWVA 1SIWB 4Q0BA 4R8UA 2MQOA 2P6EA 4FDFA 2W1BA 1S1XA 4F9VA 1VQNS 1RKJA 4JI4J 2BE2A 4AL7A 4NJRA 3FB3A 4EMEA 2J7UA 1NM2A 1UMJA 3R7BB 3K57A 3BR9A 4JOUA 1HARA 3KLIA 2NPFA 4CM0A 2HQ3A 1PG5B 3Q2TC 1UPMB 1S6QA 4I69A 3V81B 4WFBQ 3NRBA 2Q6BA 4JZ0A 4PXDA 4GS4A 1DLOA 4IK2A 4IH7A 1ZAXA 1JJHA 2FE7A 5F48A 5DM7Q 2JHEA 1I1GA 5L1LA 1B0VA 2WONB 1F1BB 4ZJLA 5CYMB 3SJGA 3PVXA 1RTDA 1YZ7A 1KTVA 1X8DA 2W4DA 3W60A 3SYZA 4ALZA 5DS0A 2XMKA 4NLOA 1ZYQA 1YWXA 3SFGA 2XCPA 4EO6A 4DR7F 2FVSA 3IWGA 2XMWA 4J7CA 2XY6A 5BWAB 2JEVA 4WFYA 4J9UE 2K5TA 3BQ0A 1Q8BA 1B87A 2HEKA 3VTIA 1PBAA 4PWUA 4URQU 4F7VA 3MR2A 3SI1A 1L3KA 3JRUA 1H72C 1S79A 3D5MA 4ZPWR 5D77A 3H2VE 2AGPA 4P4BA 2R2RA 5D3GA 4JV5J 4FP9A 1XJWB 4DU8A 3QRPA 4DR4J 3CXQA 2DGUA 4WKRA 3I96A 1HPZB 1FDAA 2QTWA 1VQMS 2CVEA 1BE4A 2EK1A 2Z10A 3IWLA 2KT3A 3TTHA 4O3SA 2XEGA 3FBUA 3CJRA 4OJ1A 3I55S 3NS7B 3IM8A 4JWPA 3K9TA 2P6SA 3DDKA 1LOKA 4BD9A 1IU8A 1WWZA 2PIZA 1VQ4S 1WC0A 1XMOJ 3DOMB 4OV1A 1NCLA 3H25A 4PXCA 3RU0A 2VPZB 2A4NA 2LECA 2H5EA 4A8XA 3KLIB 4WFZA 3B82A 3KYLA 4DFJA 4FYDA 3J7AN 4ICLB 3JSBA 3CCMS 2UUAJ 3TZXA 4UQTA 2DVIA 5D0RA 3N5FA 3D7GA 3DC2A 4II9A 1CULA 1FEHA 5CA5A 1MLAA 3M2RA 1G7CB 2JFDA 5F9NA 2FS5A 2XYPB 4O0IA 4DQRA 3DDIA 3MMAB 2QLJB 1S5KA 4RW6B 2DR8A 4KVXA 4MHNA 5HMYA 3FSIA 1RISA 3OJUA 4R5PB 1WEYA 4ZIWA 3QT7A 5EWFA 3W65A 2PJBA 3CJ2A 4OI4A 4TXSA 3V4IB 4M5GA 4DZ6A 1LWCB 1U1KA 5H9EJ 5E3RA 3FZ2A 3HSGA 2OSRA 1OWXA 4Y2IA 1M5HA 1PYSB 1YKWA 2AF6A 3CGIA 3GV8B 4OYXA 4YN3B 1IM4A 2FHKA 1VK8A 2Z30B 4FYYB 3W1YC 2PFFB 1RT5B 2RHQB 3DU5A 2HK3A 4FBUA 2AFZA 3GV5B 5A8RB 1S4EA 3BYPA 3M8SA 3HI9A 3KR5A 2YNFB 3TO6A 1T03A 5ETKA 5KFWA 4NWBA 3FEXB 2HVZA 2EVZA 2HHHF 1IUJA 2DNZA 2XMAA 2Q4YA 2F5GA 4ECUA 1TUVA 3TNVA 3HXMA 1UL3A 2F8MA 1C0UB 1VQ5S 1DQAA 1X12A 4KKOA 3QNWB 3W9IA 4DU7A 3JSMB 4ECWA 4CLZA 1U1QA 2IDLA 2DNKA 1VJQA 1YJRA 3D7DA 1BD6A 2BX6A 2P6TA 2W01A 3H7HB 5E7OB 2RILA 1TR0A 1LOUA 1URRA 3Q8UA 1PJ5A 3MM7B 2FHOB 1H7XA 2QFIA 1Q8LA 3GYAA 2YH1A 3N0VA 3C14A 2PRBA 3AH6A 4AQYF 1IKVB 2RS2A 2VHGA 2HGNA 4F0XA 2YKNB 2F40A 2DR9A 3NWRA 4E2AA 1HA1A 4IUSA 4P73A 1FE0A 1WF2A 1FRXA 1X4GA 2EBJA 5ADZA 1YREA 1WACA 3JS9A 5D4LA 3RR8A 1EETA 4A47A 1HWIA 2VICA 2J6UA 4XAKA 2HRTA 3CDAA 2RFHA 2GVZA 4P4IA 5KT6A 2D3OR 4B17A 4YR2A 1Z4UA 1ROFA 2KN4A 3CCVS 2OD4A 1RAHB 4LF1A 3PX4A 5GMKa 2RRAA 4MCSA 4ZI6A 4M5NA 2MZJA 1LW2A 1RUSA 4ZIVA 4LF6F 4LF7J 2F3JA 1TF9A 3HFKA 4ZVRB 2Y3YA 2PJ6A 4LRFA 4FYVB 3DM2A 1RTZA 3NBPB 3OTOF 3UDLA 4J9QA 4UEEA 1F3VA 4CYUB 3U27A 1JXEA 3JSMA 2Z2MA 3LP2B 5DG7A 3IBCB 5FJ4A 2YKNA 1IKYA 3A3OB 3ENVA 2ZEEA 3RNZA 1RTQA 4IF5A 1OYDA 2AFSA 1WSRA 2FHMA 1RT7A 4URSA 3OSPA 3MCSA 5G4DA 4CO2A 3KQZA 3TUJC 5A6WA 3HHLB 3J81U 1K1QA 1U8WA 2HFNA 2UXCF 3EICA 4OHVA 3HVTB 1GXTA 4D3GA 5KFFA 1NDLA 5F3ZA 2OPRB 2Z57B 2PJ4A 5BYSA 2P8IA 3I9SA 4N8NA 2PJ2A 5I0CA 5EDWA 2DEIA 1Y9WA 2HFUA 2E29A 2BO9A 1E6VB 2HBRB 1RT6A 3S8SA 4RN7A 4EI2A 1CC8A 4ZN1A 4P10A 5KFPA 1X9SA 5HK4A 1SPBP 2NUUG 4LR8A 4NLGA 4DCPB 2F4VJ 2GC8A 4OZ5A 2B8PA 5KFQA 5B0FA 2IM1A 4FVCA 1NE9A 3PZPA 1J27A 2LFVA 2PEBA 4F36A 1ITPA 4OIWA 1TVRB 4MI4A 4AL6A 5IV4A 4OMEA 5GADI 4QR2A 4ED6A 4FKXA 3ET6B 2N7CA 2U2FA 2CJQA 3QQCD 2JWNA 4HTJA 5KT3A 2UVVA 2CXAA 1OY8A 2VOOA 4WJBA 1EAYC 1JLGB 3MUVP 3UQSA 2PFDA 3S9MA 4I2PA 3MF5A 1VKCA 1HL6A 2L3MA 3PR4A 2CQHA 1ZG8A 3EM1A 2ZBCA 4MFQA 2HZCA 2AYMA 4MFBA 2IRUA 2EVNA 5HMNA 2JBKA 3FDSA 3OFEA 2BA9A 3KUHA 1B99A 4M5IA 1CJWA 5DQHA 4J9KA 2PD1A 2VODA 2E1RA 1UFLA 1IBKF 3G6ES 2E1CA 3LGNA 1TL1B 1T94A 3W6SA 2ZEHA 2FLOA 4OX6A 3J81Y 3UN3A 1OYEA 5DS7A 4CIOA 4ZBGA 2V2ZA 3NWGA 3CMES 2EC2A 4K4TA 2ZBRA 3GJSB 3N4WA 4IG3A 3J7A1 2I00A 2D74B 3BS9A 2V34A 1ZM3A 2C3MA 2IY5B 1RT2B 3NGDA 2D4OA 3NAIA 3BV8A 5KFJA 3OFHA 1SJFA 2NZ4A 1J5EF 1N36F 3CD7A 4YWYA 2FHJA 1S9GB 5LXYA 3BH7B 1VRUA 2B4DA 4PQAA 1G1XA 3SI8A 3VGTA 1CJKA 3QGIA 2JRSA 1PYTB 3A12A 2W9BA 1S1TB 4KHMA 2BOPA 4ZPTR 3AD8C 1P8GA 1XRYA 1VIOA 5H9FJ 4DV2J 4A37A 1JIHA 4M5LA 1T0TV 2BYCA 6FDRA 4XDCA 1K8AT 1QUPA 1FKOA 1U1MA 4OYAA 1NZ8A 1XERA 4ED4A 1QLNA 4E8OA 3I1UA 3VQTA 1JLEA 1UEKA 4MK7A 2PEHA 1M4IA 4FBEA 3MM8B 4HHHA 5G20A 1PC5A 1NSAA 2HIYA 3MTJA 3AY0A 4QUSA 5DG9A 4OC0A 1O6XA 2E1PA 1T05A 1F2GA 2KFNA 1KKHA 2LA4A 4UEFA 1HQUB 2HMIB 3KLEB 3IRXB 3VAGA 4JV0A 2HHVA 5KT2A 4E8UA 2VIHA 4OHYA 4K2JA 4OHWA 2L9NA 3UI3A 1RTJA 4GKKF 3IS9A 2BE9B 2BR0A 5L8RC 4RW7A 1I6JA 3NMRA 3JUWA 4KGXB 4DR6J 4AT1B 5D78A 4JJXA 2KXHA 4RNHA 1QD1A 3TA0A 1RTDB 2E5IA 2PCUA 4NFRA 4BINA 3EGNA 4O0NA 1NH7A 2HNYA 4NZ6A 2VV5A 2BQUA 3KLFB 4QYZK 4CAFA 2VPYB 2R7TA 4AUKA 1Q95G 3QO9B 3MMBA 4ZVTB 1S6PB 3W9HA 1X9WA 1TAQA 4DPYA 2K3IA 1R57A 1TFYA 3AD9C 4LVNP 1SQFA 2QLBB 3HF5A 4DFMA 1N6QA 3DR8A 2Y0BB 2GMLA 4WPAA 4TNUA 4UOGA 2IVMA 2AFWA 2C1CA 2QIFA 1Q0NA 3LOUA 1B70B 1UCNA 2CNMA 3T19A 2YNFA 1OPZA 3QZ8A 4QQBA 3LP0B 1AXQA 2P6GA 1JX4A 4DXLA 2DYAA 4TN2A 4WP3A 3PW2A 3KZWA 2AEMA 2HHTA 4J9SA 4Z37A 2HSEB 4LRCA 1U2FA 2XM3A 1WHXA 4EZ9A 4ZVHA 1I3OB 2IVFB 4QU7A 2VJVA 4IHMA 3GFHA 4DSIA 3MUMP 1SKSA 4K4UA 2IJFA 4OYZA 2K3KA 4J9MA 3OQ2A 3KWMA 2MZ1A 2Y8WA 2YQ0A 4JI6F 5DQGA 3AOBA 2PR8A 2MKKA 1YQHA 1J2VA 4DV3J 2RH3A 4XNHC 1DBDA 5DQIA 3S7RA 4ANCA 1N71A 3J7ZT 3D54A 4G1QB 3BO2A 4JI7F 2HQYA 1MSWD 4IFVB 4ANEA 3MR7A 4MMOA 2A6OA 1CG2A 3Q86A 1WK4A 2PMZD 2PJ1A 4QWBA 4A8SA 2GE3A 1VBZA 1NAQA 1TL3B 2EFGA 1GAOA 1RXTA 3LD2A 3DNCA 2AYEA 4MK8A 2YX1A 4K5SA 3DRYA 3OBIA 4JI2J 2ZD1B 4ATNA 3JAMY 4OC5A 3PNIA 3CXSA 3B78A 1NZAA 2JEGA 2PMHA 2BJ1A 3KR4A 1T95A 4I67A 2VBZA 4YR3A 4HVZA 3M8YA 2EFOA 1HNZJ 2QL7B 1KOHA 1IBKJ 4H6ZA 4KUAA 3D1OA 2EK9A 4ECTA 5IT9Y 4DV7F 2OPRA 1K47A 1RADB 3DM2B 1ELLP 5I42B 2GO8A 3I0RB 1WG4A 2W2QP 3MTKA 1Q5VA 3OR1B 7CPAA 1IICA 2PJ3A 3P2HA 5FVJA 2DR6A 2XEIA 3VF0B 1KHWA 4Y34A 2D3ZA 3GFXA 4C97A 2JEWA 2X3GA 3MCNA 3ISXA 2LQBA 2V4JB 4WWSA 3UPFA 3TO7A 4CTAB 3RTVA 1HNWJ 3ZO7A 2PJ9A 2JZ5A 4PG4A 2EKYA 1S4FA 1DY3A 2G4BA 1FRKA 2W4PA 1WHWA 3EC4A 1NDKA 5K14A 5F8GA 4P75A 3OUYA 3DOLB 3OVAA 3H20A 1Y5NB 3DYAA 5LRKA 2WPWA 2CQBA 2ZDOA 2JDJA 1Q8KA 1M1DA 4OZ3A 4QIGA 2LQJA 1U6BA 4KV8A 3V6HA 1Q16B 1RWXB 3I5BA 3CMAS 3K59A 4RI1A 2ZW7A 3UO0A 4CGNA 4P4EA 2Q44A 2FGCA 2JLEA 4JI5J 5H9EK 1F60B 3R95A 4Y00A 2IQ6A 5B0EA 6AT1B 3O1LA 3K0JA 4IQMA 2XEXA 3MM6A 2BZ2A 2RDDA 5CYQB 5A0YB 2J9CA 1SJRA 3UCUP 2RRBA 3T3FA 3K5OA 5K8MA 4MFPA 2VEZA 2VKRA 5CBMA 2OMOA 2CAJA 3T41A 4CGMA 1FKPB 4HL9A 9RUBA 2ZEMA 4R9MA 7FD1A 3TYTA 1Q7LB 3C46A 1MG7A 1S6QB 2M70A 1FFWB 1S1XB 4Q38A 4U95A 4DUZJ 3MD1A 3GIMA 3CO9A 1HBOA 4CLTA 4CLWA 1W25A 4P9SA 1AUDA 5D8NA 3FEDA 4FXVA 3MMAA 2AQ4A 5JGFA 1M5VC 1HEEA 4UFVA 4B10A 1S72S 3Q8PB 5AXNA 4ZPDA 4EBDA 4C3LA 1RHRB 4DV4J 4AL5A 3IP0A 3MMBB 1U09A 5GMEA 4I0WA 1RU1A 2WW8A 2DR7A 1F0XA 1RHQB 1M90T 1QY7A 3D2WA 4ZVSB 3CNQP 4CAEA 2XYGB 3GPAA 2RE1A 4K3NA 2F4VF 1SJ3P 1OQ6A 1NK5A 4P4JA 4O3NA 4LFAF 4EZ6A 4LF4F 2HC9A 1EKRA 4KGKA 2BCOA 4A8WA 4HI2A 3AJDA 2KKHA 1NJWA 4NLSA 5LMUJ 1DFDA 1DQ8A 4LRDA 4RUHA 5HMXA 4JBCA 3P49B 1NK9A 4DL4A 4U9YA 3T9NA 2HQFA 2WBRA 4WU2A 2A10A 4PXBA 3KTQA 1T05B 1YDLA 3KHHA 1YLXA 1F5AA 3IBWA 2BACA 2VBQA 2M8DB 1ZG7A 2ZENA 4OHXA 3FBFA 1A9NB 3UD5A 4DR3J 3H5XA 3DOKB 1DTQA 2FT0A 2YNCC 4EVYA 4U9RA 2PDAA 5AG6A 2QYCA 2R7RA 4DUKA 1X4EA 1Y0YA 4USTA 4F0HA 1JQGA 4LQ6A 1ZS6A 1CP7A 3BKUA 4DR5J 2QZ8A 1Q4RA 4PG6A 3VV2B 4F0MA 1N52B 4ZLPA 1MK4A 1REVB 2MQ8A 2HHXA 2J8AA 3CC7S 1Y5IB 4KPYA 5T14A 1KD1T 5KTQA 2ZH1A 2YNCA 4W98A 2FD2A 1IIDA 1YLEA 1Y3JA 4DV3F 1U26A 4KOUA 3JYTB 2PGCA 2H4YB 4Q2LA 3MCMA 3KDNA 1RHMB 4CZCA 4UFWA 3TW0A 2VZZA 3LP0A 4B9MA 3HUVA 4DV5J 3PW5A 1IR2A 3HO1A 4DSFA 2FXFA 1WEXA 4ELUA 2XULA 2IM3A 4F0KA 1PU9A 1QTMA 4DG1B 4RX6A 4L3NA 1V0CA 2HRYA 1U0SA 2HLUA 3N6NA 2Z2ZA 5IT4A 1IKXA 3K2YA 3M2VA 5F8HA 5EWEA 4A8KA 4L89A 5T7LA 3TRGA 2BUNA 1HWJA 1TF8A 2MKIA 4EU0A 1HBUB 3SSRA 1NJXA 3BB5A 3MMJA 4CLUA 3I0RA 3V6KA 4K2XA 2MQMA 1CJVB 2JSXA 4OI3A 2N82B 3H0PA 3CCLS 4DV7J 1WC4A 4OIXA 2ODFA 1BQMB 5KG3A 4F67A 2RVJA 1SC4B 1MMNA 2PC6A 3CCQS 2CTBA 2WZNA 2BSWA 1TUGB 3WIVA 3HHLC 4ICLA 1I5OB 2C6GA 5LYDA 3R9GA 5KFGA 1ULRA 2BM0A 2B6AA 4M5HA 3MAAA 4NJQA 3BM7A 4OC4A 2IMOA 2DRDA 1PGZA 3M2RB 3MEKA 2B3UA 4FPRA 5HATA 3PIPQ 3AODA 2GMHA 2RKIA 3NS5A 1HI8A 1IKWA 4QW9A 1RYRA 2E7WA 4ZVEA 5J1QA 4YB5A 1DJ0A 3MGDA 5AT1B 5J2NB 4Q45A 1RAJA 3CJ3A 4BMHA 4OMFG 1HQUA 2C42A 4V1Ak 1FF2A 2VF3A 1XQIA 1YW4A 4R3KA 3IGVA 1JLFB 4C3MA 3PB6X 1KUXA 1X4BA 3RYLA 3MOJB 5G21A 1DZ5A 2AFOA 1IBLF 4QIEA 2M3DA 3EMTA 1JLEB 3JQJA 3HT3A 3I3GA 2M52A 2EPIA 2VA2A 1VK3A 3OTDA 1UWAA 1U7LA 3TE4A 2KXNB 4NGRA 1S1WB 3TC8A 3KUGA 2O3DA 1NSPA 3RJMB 2EK6A 4WF9Q 1XMBA 3BI1A 2CWXA 2KVIA 1K4JA 1R0AB 4CH7A 4CO4A 4A30A 4HYKA 2B4OA 3ENWA 2IMWP 3M8RA 1TKDA 1Z8XA 4HNWB 4HI1A 1UVMA 4MFZA 2KL8A 1FJ7A 3R5CA 5J1EA 1QSOA 4YGOA 5EX3A 2GHWA 3Q8QB 5BR8J 2NQPA 5E5NA 2OH1A 2B6AB 3OV7A 5ETRA 4DSLA 4MYUA 4EBCA 2EEYA 1IOFA 1UVNA 3KI9A 4WYWA 1KQSR 3G8WA 5KFKA 2CQ4A 4B3TJ 1XN9A 3FH4A 5CXTA 3I4PA 1T9YA 5LMNJ 4A8OA 4DV4F 4DQPA 5CYJA 1ZBTA 3EVWA 2ZOMA 4DI6A 1BMQB 3L3CA 5A76A 1U2RA 4U6PA 3RRGA 3W9JA 3RR7A 2J8RA 2QYGA 3KHGA 4ILMA 4NLWA 4OFZA 4O44A 5HL7Q 3E01B 4JP8A 2C2MB 2DGXA 2R7WA 1ZZFA 3CMQA 4LF7F 4DYOA 3H5UA 1SJ1A 3TEHB 2OPQA 2DF5A 5GCNA 4MBUA 4QIVA 2DT9A 3SCIE 1S97A 2IYIA 4IR1A 2C3PA 2V8HA 1SV5B 1Y7EA 3MUTP 3RB6A 1IBLJ 4ECSA 3VWEA 4K59A 4ZVFA 4DL7A 5HLFA 1KNZA 4RW6A 3TX0A 2RAQA 1WTBA 2OH2A 2PMWA 3HHDA 2Z3NA 2XBPA 2HZAA 4W9YA 3HD2A 2FSRA 4CM2A 4CT9A 3CT9A 1X4DA 1CJTA 4X66J 3B4DA 2BJ3A 2MZTA 4A48A 1ZPVA 1B6BA 4YHHF 1WUUA 2FZCB 1DTDA 2ZKTA 2XMJA 1P1LA 2XI2A 2J5AA 3WC7A 3ZTQA 1VRQC 4JXQA 2Z2YB 3SBMA 5LYIA 4RW4A 2ASJA 3IG1A 4X62F 4B9NA 2XO6A 1JNZB 3OLAA 2RHSB 2GCFA 4DX7A 3HX9A 4XTTA 3DXSX 1SXLA 3FQLA 1X7VA 1QJHA 3T1AA 3KHLA 1YJTA 4HT5A 3PYDA 1XC9A 2M9KA 2YPYA 3DRRB 5CH7B 1YJ7A 2VG7B 4QR0A 1YRUA 3I56S 1NJZA 3KG4A 2BEIA 4YU9A 4USMA 2K7KA 2N4DA 4ID5A 5EHHA 1NKBA 2HS4A 1IQTA 2G1HA 1RQ0A 1HMVA 1KVJA 1SQGA 5HXDA 1I94J 1XNRJ 3O2IA 2KFZA 1TMJA 1H6KX 3B3TA 3FEEA 5DETA 1M5SA 4ZP6A 4PRFA 1LWFA 1DARA 1IJFB 2UXDF 3HSZA 5I4MA 3I87A 3UD4P 4IO1A 2IAJA 3T5KA 2UU9J 3ELHA 5K14B 2ASLA 3M9MB 2R8KA 1NSQA 3OT9A 2PVWA 3D6TB 1VQLS 4C8LA 4RW9A 5LM7E 3JTKA 1WG5A 3WX4A 4CLKA 4CRYB 2F8EX 3S6KA 1XR7A 2W4CA 3ZC4A 2DGVA 2W24A 2QE5A 2CPJA 3SCJE 2XS2A 4QWDA 4DV1F 4OYOA 1BOBA 3BPSP 1SH2A 1YR0A 3KJFB 3LODA 1GNKA 1RSCA 4CLFA 5FD1A 4NASA 1ZG9A 2RQ4A 2BRLA 2H5MA 3GMGA 1X5SA 5CD4H 4HDHA 1YQEA 4CDIA 1WOOA 3I6PA 5HJYA 4AVCA 3F0NA 3M8QA 2JNJA 5ETSA 1I51B 3ILLA 1S10A 2A1BA 3PKYA 3QAEA 5HMZA 4NA1A 2QA4S 4UEZA 1KONA 3DRSA 1T9TA 1BO4A 4CO1A 2DNQA 5DGAA 4Q2MA 3WC5A 5IX3A 5HANA 4RU9A 5CZVA 4MCPA 3MAHA 4DQIA 2QLXA 3TX8A 5HJXA 2VI7A 3QT6A 2CPIA 2AZ3A 3MR3A 2HVDA 4K4SA 3ADAC 4CNYA 4CT8A 2R1IA 3HLPA 1C1CB 1WELA 3PW0A 4C2XA 4EUVA 1VQ8S 4CRJA 4ZPCA 2AZ1A 3CIZA 3KKWA 4RNFA 1R31A 2MHEA 2WYRA 5DLGA 2EFNA 3CSKA 4MY3A 4CS0B 3VALA 3EXNA 3FIXA 4ZP8A 3NEKA 3QJPA 3ENAA 4PK3A 1RTJB 2YWGA 2CNNB 2JL9A 3W66A 1N32J 1FNXH 3OW2R 1HNVB 4NGSA 1Z9UA 5FDLB 2G0BA 2DRAA 4Z7YA 3V2UC 4DV1J 2DY9A 2LP4A 3H5SA 4MAKA 1CP6A 5D0EA 1TKXB 1FDBA 2P9EA 1Z4RA 4DX6A 3R1HA 2BMBA 3EX7B 4A31A 4KYZA 1QAYA 2NXNA 3WIUA 1WDDA 3BGRA 3D0HE 3PIOQ 2MQQA 4QB9A 3IMQJ 2AW0A 2QA4G 1LW2B 3B3VA 3MPWA 2WVCA 3QGGA 5L9NA 3FECA 2JLFA 2MKHA 3IGNA 1B0PA 2I1RA 4GMKA 1M1HA 2F8HA 2W2MP 2O5DA 3S9LA 4G3IA 1BLUA 2BQRA 3D3SA 4DL5A 3M1VA 3B3WA 1N56A 5ETOA 4CPAA 4MIWA 4CH0S 2OP5A 3JSYA 2H4WB 2OB0A 4I64A 2IJZA 4B08A 4U67Q 5DDPC 2YKOA 4K4ZA 3KLGB 4DHVA 3CDBA 1NK7A 4WZMA 2JDDA 3EGVA 2NXEA 2NYHA 2XG8A 4P2XA 2HYIB 2EXUA 2ZUAA 5SZTA 2BKNA 2IPOB 2GV1A 2IFXA 4LBHA 1UJ4A 3CCES 4JV5F 4K5RA 4NXYA 3QJLA 1KQKA 5J2QA 4NRUA 3FYNA 2E1MC 3LAMA 3EXYA 1U45A 5L1KA 4DL2A 4IFVA 5KFRA 2ROEA 5B0DA 1CS4B 2R2SA 2DD8S 1VBXA 2L08A 2Y1IA 4EFDA 2HGMA 1RWWB 2DJWA 4MKVA 3DLEA 2XEFA 2CQ2A 1D8YA 5ETNA 4MHZA 5D3GB 4R0JA 5A28A 4B3SJ 4KJIA 5H9FK 2OFGX 2E5HA 3Q8VA 3AB2B 1NU4A 5JH9A 3KASA 1HNXF 2NXJA 3G6YA 1UW4A 3R96A 1L3VA 5E3AA 4F8ZA 1O5JA 3LGHA 4Y2KA 4A94A 4OZ0A 4KH0B 3D6HB 1XNRF 4DUZF 1UWYA 5B7WA 2RIJA 2JC0A 4W92B 3AA9A 4X4UA 4ILLA 1HFEL 1UFKA 3AT1B 4C9DA 2G0IA 1IQZA 1DTTB 2XMUA 4DNCA 3KHZA 1L0CA 2J8MA 3HKZD 1DHMA 1HNZF 3JXOA 3OTOJ 4DPWA 1OS5A 3OVSA 2QN6B 2VQYA 4KVOE 2O1PA 1GHEA 3P8BB 3G2XA 3FCWA 3RB0A 3OL7A 4ZP9A 3TEGA 5HROA 2WAQD 3M8ZA 2E9TA 2J0WA 3JAMU 1R6YA 2CA9A 3I82A 4QWAA 2PR1A 3PZJA 5KG4A 3UY5A 2L9WA 2HHSA 4NMXA 8ATCB 3QJJA 4M1KA 3DLEB 3VGVA 3H98A 2EC0A 1TP7A 4C11B 2MYFA 4MRIA 4C0OC 3AXMA 2G9OA 4OLLA 4OYWA 1WHYA 1EE3P 5B0BA 4LBIA 2UV8A 3QMQA 3HK2A 2L9DA 3C19A 4LQGA 4QW8A 2CQGA 3TUIC 5G0RB 4HNYB 1CJUB 3T5JA 4ZPVR 2PN6A 2VFVA 1HNWF 2HIQA 4DV6J 3HULA 1JMTA 4FD4A 4XPKA 4ZCKA 1HNIA 2GQQA 4P7VA 2C3YA 1GK8A 3MEDB 1WI8A 2HV2A 4WFAQ 1QAJA 5CYQA 3TT2A 3M8WA 2RU9A 4X84A 4U7UD 1S7NA 2DCLA 3N5BA 4H4KA 1FE4A 2YH0A 2OR4A 2C2OB 5J1EB 2ADCA 4MFLA 4C6AA 1N32F 1XOVA 5H84A 4KLVA 4UZCA 2QC3A 3ISNC 1SVDA 3W64A 3OL9A 4QWCA 1NKCA 3BI0A 4JYWA 5C7PA 3SI0A 2HGLA 1AZSB 1GMWD 3K5PA 4GXHA 3HHLA 1CJKB 3CC2S 1VHFA 2RJZA 4QBUA 5F3TA 7FDRA 4FD5A 1NLKL 5ETLA 4JV1A 2FHJD 4B3OA 2RQCA 3OR2B 5AXKA 1BAVA 2CZ4A 2V8VA 2GW8A 3B35A 2B9EA 2GMJA 1P9YA 2G0CA 2FVCA 1IGBA 4P45A 2X1FA 4BCAA 4DWIA 1IXKA 2OELA 4OI2A 1QE1B 1M44A 1QSSA 3RAXA 1NHVA 4G1QA 3FNCA 3MRUA 2I2YA 1ZLIA 3AA8A 2QSFA 4HKFA 4PABA 5KT7A 4OX8A 2O28A 3DMJB 3AJ2A 3UR3C 1U1PA 1U6MA 1R43A 2ZZNA 3QO9A 1TL3A 3DRXA 1NBEB 1KEKA 3IWWA 1P27B 1KWMA 4IUFA 3R9LA 1D1UA 3LP1A 3B3CA 2JLMA 4C2ZA 1R8PA 4KB7A 2RU3A 1XNQJ 1RCXB 4TY8B 1TV6A 2Q7SA 4YFJA 3SDEA 2HBYB 1V3SA 2RMLA 1FERA 2E5LF 3EPGA 4WE1B 2HNZB 3MR5A 2XEJA 1FT8A 4K8RA 1TMMA 3PO4A 2MSSA 4Y28C 2HVHA 2CKWA 3OVBA 3C6TB 2Z56B 3VAHA 1Z8WA 2XI3A 3CD5A 1UVKA 2HPUA 4UUWA 4EO8A 3I0SA 1RGVA 3J7YU 4A39A 3NL0A 4WZQA 2KHCA 2YTCA 3DCAA 3MPVA 1WOPA 5C5JA 3M32B 2PE3A 4CYNA 2DH7A 3QBCA 2E5GA 1RABB 1FD2A 3KK1B 2ZH7A 1N34F 1DAXA 2V4JA 1TL5A 4FF2A 3C15A 1HHSA 1HD0A 1AUGA 4N7TA 5IC4B 2I3CA 2PA3A 5KFNA 5HBMA 1WC5A 4PZVA 1EHWA 2AEFA 4LF8J 3BYRA 1FDNA 3UNGC 2VONA 3UE2A 4UCPA 1EZZB 4JUZA 1N8RT 2KZMA 1CBXA 2QJ3A 2V4QA 4O3RA 3D4UA 3MPDA 4GC6A 1N88A 1F2HA 1QMUA 3T1YJ 2RD5C 1S0NA 2E5LJ 4KLWA 1VQPS 3DGPA 4BWMA 4EYHB 2R7HA 1FCAA 4ZDNA 2VOPA 4O3OA 1HI0P 4J91A 4M5MA 2ABYA 3DNSA 2V0NA 4RLEA 3GV7B 2KTQA 2VQEJ 4CWBA 2QLWA 2V5HG 4HKQA 1JLAB 2FJAB 1WF0A 2CTCA 4G65A 1SB6A 3FEZA 3BDPA 4F4ZA 2LDYA 3EVMA 3FC9A 3POTB 3NA6A 1TKTA 2UUCJ 3IBFB 4ZVOB 2B4BA 4H54A 4ZY1A 5AJ3F 2HHHJ 1GXUA 2QEXS 2M7SA 4LFCJ 2KO1A 3MM8A 2H9ZA 1GMUA 2H51B 4L75A 4LVOP 2PC1A 1D9FA 1YITS 1PAUB 1AYEA 2W9AA 4Q8FA 3JTPA 4TNOA 4PR6A 3KLVA 2JVRA 3IAM9 2J0SD 4KORA 1FRHA 3B2YA 2EKNA 4KSEB 2GVZB 4NLQA 5M2RA 3EYZA 4MKBA 3GIRA 1OSCA 3LANA 4LF5F 3K5LA 1VQYA 3X1LB 1HKAA 1WWHA 1WNEA 2XQCA 4IDKA 2DRBA 1ZH5A 3Q83A 1HNVA 1RHUB 1TL1A 2OEJA 2ZW4A 1YJUA 2VQFJ 2K1RB 3H8FA 1TVRA 3FZBA 4PWDB 5HBMB 1N33F 3HP6A 2VXKA 3RBZA 1ZM4A 1MU2B 1RTHB 1EJ7L 2P2CB 4WKYA 2FYXA 4KZTA 1PIEA 4ECVA 2ZHAA 3AOCA 4A8MP 5F47A 4H4KC 4N76A 1KHVA 5FIIA 2PJ0A 3KQXA 3CUNA 2XLJA 3O6QA 1F2OA 4LFBF 3CCUS 4FF1A 3P6YC 5DLFA 1D8ZA 1AROP 1Q53A 4WP9A 2X1AA 1Q7YT 1UAWA 2CPYA 4YP3A 2OPSA 3FBEA 3DU6A 2OFHX 4UCMA 2AFUA 3QB8A 5KG6A 4OZNA 3B8GA 1R8BA 4Q8EA 3DSBA 2IBKA 1LWCA 2BOAA 2D3O1 4HDGA 3TAMA 3SXLA 5DDQC 3CZXA 2KT2A 3LP2A 3PFOA 4MKAA 2P0WA 4R87A 1YZ6A 3A4TA 1IKXB 5D29A 1FJGJ 4YY3J 2N7YA 2FC8A 3QWUA 3BGLA 5DGBA 4F4AA 5D4NA 3H8YA 5F8LA 2J0QD 2H1YA 4DR6F 3GYNA 3CW2C 2DPSA 5KFYA 4C0BA 5LL6d 5HQ8A 3BO3A 5HO4A 3R8YA 1R0CB 2C3UA 2Y0SD 3UN5A 2HHPA 3N79A 4JI0J 5CCMA 1NDCA 5EC4A 4DPUA 2XGPA 4USUA 1XK8A 1E6VA 2X1GA 1HPZA 2IL4A 4DJLA 3GU0A 5IS2A 4PSWA 1YX0A 4B5PA 3OJSA 5A2QU 1UWBA 1RAIB 3FBCA 3K89A 2FY1A 4HPSA 4W90B 2NSBA 1W26A 4HHUA 3HVAA 2C2RA 4N56A 1D9DA 4GRSA 1YMEA 2FUG9 2HRUA 4EWTA 2QA1A 3CE8A 2M0GB 1RDRA 1JJ2R 3PYFA 4JI5F 4H89A 3CCJS 4M3SA 3ZZRA 1YGHA 3CJTA 2ZJPQ 3V38A 3HZGA 3MFIA 3IR7B 5JUMA 2IVYA 2CIJA 1DURA 3FGVA 1HWLA 1NB7A 1SQEA 4NLPA 3CDUA 4AB7A 2XC9A 2ATRA 3M9OB 4MY0A 3HFZB 3QATA 4NCBA 3VQSA 4UUXA 3GUXA 4DPOA 4NI2A 4WTOB 2Z3OA 5C25A 2V2QA 3DRPB 4DEZA 3JQMA 3SV4A 4DR1J 3TI0A 4NLDA 3VGSA 1TL4A 1S7HA 3PRTA 5C2CA 2HQIA 1Y0RA 2R2TA 3KG1A 2FJDB 2HQGA 1BPNA 2BKOA 4NMLA 4E0AA 1RT3A 3PTWA 1BLLE 1LEOA 2RS8A 4KHRA 2ARHA 3OXGA 5F8MA 2DNPA 3PV8A 2J9DE 3MEEB 4OJGA 3BREA 1UP1A 3U7JA 2R42A 5CABA 1UEUA 2MGZA 3THTA 4XIUA 2IC3A 3U1MA 4ECQA 1MU2A 4N77A 3GJQB 3H2LA 3CJ4A 1TXRA 2M2BA 1YJWS 1C2PA 3V7ZA 4PXEA 1RKIA 1BQNA 2JOQA 2UXBF 4A33A 2FLPA 3LACA 3KUEA 4LFCF 4KOWA 3IA0A 2QV6A 3QT8A 2B9XA 1SL1A 2QECA 1H2TZ 3P5BP 1CC7A 2I5JB 5LMUF 3MEGA 1FWKA 1SUQB 4NA2A 2R7SA 2BM1A 4KS9A 1VHIA 2YWKA 2DNHA 4ECRA 1PJ7A 2Q79A 2V63A 2XNQA 1VFJA 2KHDA 1JLBB 3DDNA 2MLZA 4DN0A 2RNEA 3VAFA 2CJ9A 3IC1A 4C8MA 5D4OA 1MJBA 5E3QA 1XTZA 4I68A 5KTDA 3EJMA 4DDFA 1MWYA 1TKJA 4TU9A 1RTHA 2CUYA 2FTRA 4R76A 3LQVA 4N47A 1WOSA 4F02A 2FLLA 1AMPA 1VQ7S 2CG8A 2FZKB 3V6DA 2WCXA 4DSJA 3W2WA 3TJAA 2FVQA 2GAGC 4P72A 4B3RF 2P5VA 4GC7A 4GO7X 1CPXA 5C25B 4N41A 1BUXA 4ETXA 2CDRB 2A2CA 4F04B 2X3DA 4IYQA 3DLKB 4K4YA 3PRVA 3SSSA 2IRXA 4B9LA 1M1KT 3V81A 3A8EA 4S0MA 2HLTA 5DJBA 2HFSA 4EMDA 5EBVA 1R8HA 1VQKS 4NZ7A 1ZA2B 2EW9A 3WHIA 2PA8D 3PM9A 3L7UA 5IM0B 4OP4A 1MMDA 3EDQB 3K8WA 4RUCA 1TAUA 3DOKA 1UKUA 4X8IA 4UT4A 4KQZA 3HSJA 2D7SA 1SC3B 2W8LA 2R2UA 3ILJA 1AT1B 1TELA 2CPHA 4RKUC 4AG7A 3DMJA 3FVLA 1UWBB 3CTRA 3CJQA 4NXMJ 2YNHA 4NF1A 4QPXA 2IM2A 4KGVB 4DV0J 1MNEA 1R0AA 4YR0A 2AYBA 3W2WB 4H6UA 4MKYA 5KAKA 3QWPA 3PJ9A 3PYGA 3S1TA 1JLQA 1OJ4A 3A8IA 1LW0B 3IN5A 5KG2A 4NEXA 4ID5B 3CCWA 4M5DA 1M1GA 2ZZMA 3SI2A 2BJ7A 1LQ9A 2HKEA 4RW8A 2DGWA 1RP5A 2F9JA 2DPJA 2LXUA 2COLA 1YSJA 3FMCA 1BHNA 4LQ9A 3VGUA 2QMXA 4MFKA 1TV6B 2PJ7A 1KVIA 1RTIA 3TQ1A 1C0TA 1VGYA 4TU8A 2KI2A 1VJWA 3SJFA 2NYIA 4C7IA 4I56A 3PB8X 1JWWA 1U6ZA 2KH9A 4CO0A 2MSTA 3Q23A 4X64J 4F4XA 2DHXA 3DRSB 2FCKA 4GVBB 1OY6A 5E2QA 4DUYF 5ISVA 2XYH