5I4MA

Crystal structure of amidase, hydantoinase/carbamoylase family from burkholderia vietnamiensis
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
414
structure length
413
Chain Sequence
ALDTSIKVDGRRLWDSLMEVAKIGATPKGGVCRLALTDLDKAARDLIVGWAKAAGCTVTVDTMGNVFMRRAGRVADAAPVVTGSHADSQPTGGRFDGIYGVLGGLEVIRSLNDHGIETEHPVEVVIWTNEEGSRFAPAMVASGVFAGVFPLEYGLSRKDVDGKTIGEELARIGYAGDAPCGGRKLHAAFELHIEQGPILEAEKTIGVVTDAQGQRWYEITFTGQEAHAGPTPMPRRRDALLGASRVVDLVNRIGLDHAPYGCATVGMMQVHPNSRNVIPGRVFFTVDFRHPDDAVLAKMDAALRDGVARIAADIGLDTALEQIFYYAPIAFDSACVAAVRAAADRFGYSHRDIVSGAGHDACYLAQVAPTSMVFVPCIDGISHNEIEDATPAWIEAGANVLLHAMLSRACEPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Amidase, hydantoinase/carbamoylase family from Burkholderia vietnamiensis
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Hydrolase
molecule keywords Amidase, hydantoinase/carbamoylase family
total genus 148
structure length 413
sequence length 414
chains with identical sequence B
ec nomenclature ec 3.5.1.87: N-carbamoyl-L-amino-acid hydrolase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01546 Peptidase_M20 Peptidase family M20/M25/M40
A PF07687 M20_dimer Peptidase dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.360 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5i4mA02
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 5i4mA01
4YWYA 3KGQA 3TC8A 1ARMA 3RZAA 1IGBA 3KHZA 4NFRA 3B3SA 2GU2A 3WT4A 3PFOA 1F57A 3VATA 5K8OA 2PJAA 1NSAA 5LYDA 1HEEA 2EK8A 2Q4ZA 3PB8X 3BI0A 2OR4A 3PB4X 3S9NA 4FAIA 2AFOA 2PJ5A 4NJRA 2QYVA 2VL1A 3NH4A 3FF3A 1AMPA 2V8DA 2XEGA 4MCRA 2RB7A 4MMOA 2PIZA 2AFXA 3PB9X 3KI9A 1CPXA 3D67A 3FVLA 2IMOA 4OC4A 2JBJA 3FX6A 4AXVA 2F7VA 1ARLA 1KWMA 1R43A 3FEEA 2PRQA 2J9AA 3TX8A 4EWTA 2ZEEA 3KR4A 4NGPA 1IY7A 3KASA 1BLLE 4PXBA 3PBBA 4H2KA 1XJOA 5D8NA 5ELYA 2GLFA 3FMCA 5K8NA 3IFEA 3SJFA 3WC6A 4JZ0A 1DTDA 2PJ8A 2XEIA 2WYRA 5HVFA 2V77A 3ISXA 4P4DA 1Y7EA 2Q51A 3D4UA 4O23A 4PXEA 3KL9A 4R7MA 2F8HA 1CP7A 1BPMA 2HC9A 2G9DA 5LRJA 4IK2A 2ZOGA 3S9MA 3H8GA 1GYTA 3T8WA 3B35A 1CG2A 5THWA 3VARA 4ZY0A 3IO1A 8CPAA 4PXCA 2AFMA 3PBEA 4NGTA 1CP6A 4X3RA 1YMEA 4PQAA 5K8MA 2EWBA 4R8FA 4TNUA 4OMEA 3IC1A 2POKA 4NGQA 4MCQA 3BI1A 5IB9A 2AFUA 5CPAA 2IJZA 1PYTB 4MHYA 3IJ3A 1Q7LA 2PJBA 2O4HA 4MHNA 4ZY2A 6CPAA 2PJ6A 5JM6A 4NGMA 2PJ4A 4P45A 1TKJA 4YU9A 4KSIA 4OIWA 4A37A 2ZEDA 2C6GA 3MRUA 4OC1A 5LRKA 4ZI6A 3WC7A 1BPNA 1H8LA 2ZEOA 3SJXA 2Q43A 4EMEA 4OKOA 1FNOA 4OC5A 3B3CA 3PEIA 2JEWA 3VH9A 2ZOFA 2PJ0A 4UIAA 1TKHA 2WZNA 4A94A 4NGSA 4RUHA 3LMSA 2PJ2A 2CF4A 4MHZA 1ZG8A 2C6PA 4MHPA 1UWYA 1VGYA 3SJGA 3B2YA 4DYOA 1QQ9A 2ZENA 3H8EA 4OP4A 4OC2A 4X2TA 3CDXA 2XEJA 4A39A 4TWEA 4ZX8A 1AYEA 2NSMA 1Z2LA 2BOAA 2BO9A 4MCSA 1VHEA 4NGNA 1DE4C 4ONWA 4PXDA 4G1PA 3BXMA 4P4FA 4W9YA 2V8GA 1LANA 2PJ3A 3FH4A 1ELLP 1HDQA 1LAMA 4UIBA 1FT7A 1TXRA 4Q7AA 1ZG7A 4F9VA 3LWUA 3CPAA 5DS0A 2IQ6A 3B3TA 3PB7X 3IIBA 1TF9A 2ZEHA 3HLPA 2C6CA 2ZEPA 3GUXA 3I1UA 3D7FA 4Z65A 1LCPA 4ZYQA 1EE3P 3S9LA 2CTBA 1YW6A 1QMUA 4UEEA 4P10A 3N5FA 1XMBA 2OOTA 5HVHA 1TKFA 1F2PA 3SI0A 3V7ZA 2PIYA 4P6YA 2ANPA 1XRYA 3CT9A 5HXDA 1HDUA 3B7IA 3CPXA 5F09A 1CPSA 5I4MA 4B6ZA 3GB0A 4A38A 3RBUA 4UEFA 4MCPA 3PRTA 3WABA 1R3NA 2XEFA 4DUKA 2PCUA 4NGRA 1CX8A 3SI2A 1OBRA 3PB6X 7CPAA 3ISZA 3KZWA 3FJUA 4CPAA 3NFZA 5LYFA 2ZEGA 4UEZA 4FUUA 3K9TA 3IWWA 1ELMP 4DJLA 3D66A 3NH8A 3NA6A 4GM5A 1CBXA 1LAPA 2PJ1A 3D7HA 4LQGA 3HUVA 2AFSA 3B3WA 2ZEFA 4P4IA 1YLOA 3NH5A 1PCAA 3L2NA 5D29A 5J1QA 5CBMA 4UF4A 3IEHA 2PJ7A 4F9UA 4R76A 2EK9A 1VIXA 5LYLA 3B3VA 1XBUA 4BD9A 1Z5RA 3K2KA 1Z8LA 3FECA 4R6TA 3DLJA 1LFWA 3D68A 1Y0YA 5LYIA 3DGVA 1YSJA 2NYQA 4WJBA 2PVWA 4IAVA 3SJEA 1F2OA 1JQGA 2GREA 3MN8A 4OC3A 4PPZA 2PJ9A 2BCOA 2ZELA 4EFDA 4NJQA 3GLJA 2DEAA 3QNVA 3JRUA 1BAVA 2C1CA 2RFHA 4WWVA 3D7GA 2ZEMA 4FBEA 2QVPA 2PJCA 3SI1A 2PVVA 5HVGA 4P4EA 5LRGA 2CTCA 3D7DA 4MRIA 3KQXA 2JBKA 2O53A 1RTQA 4IHMA 3KR5A 3KQZA 3BHXA 3H8FA 3RAMA 4ZY1A 2AFZA 5JGFA 2V8HA 2GLJA 4P44A 1LOKA 2ABZA 4P4BA 1TF8A 3KHXA 2AFWA 4F8ZA 3FEDA 1ZLHA 1YW4A 2QJ8A 3PFEA 2FVGA 2I3CA 2PE3A 1XFOA 1VHOA 2HB6A 4K3NA 1M4LA 1Y0RA 4OC0A 3V38A 5K8PA 1ZG9A 3WC5A 4JYWA 2V8VA 4OIDA 4P4JA 4ZX9A 4FWUA 2CIJA 4MXUA 5JH9A 1ZLIA 4X8IA
chains in the Genus database with same CATH superfamily
2DH9A 3SCKE 2MZRA 1T05A 4QBUA 3I6PA 1W2BR 3U1LA 5DM6Q 4P2XA 3VATA 1HEEA 2HZCA 4K30A 1NE9A 4UCNA 3OJSA 3NH4A 3WDOA 2XEGA 1U6FA 1K1SA 1RWUA 1YBTA 4WFYA 1IQZA 2R7RA 3DLGB 3D67A 2P5VA 3SEOA 1VK8A 2YH1A 5LMNF 9ATCB 1T95A 3A3PB 3IS9B 2P9CA 1YTYA 1W25A 4EYIB 4XNHC 2D7SA 2C2EA 2GNKA 4U6PA 3SJFA 3GIJA 5HL7Q 2CQGA 4M5NA 3S01A 1JLEB 5HVFA 2P6SA 3T9NA 1HW9A 4DV7J 4U96A 4OADA 4XPLA 2Q51A 2CPXA 3C14B 3UVJA 3BSAA 2B56A 2QO3A 3PZJA 4QZVB 2DGQA 3HHKA 1VYAA 2ROEA 2WB4A 3HKZD 5T7LB 4CAFA 2KL8A 2ZBQA 4KV8B 4F02A 1Q5YA 4DV0J 1HHSA 3VWDA 1PYOB 4OX9J 5CPAA 1CQNA 4RW9B 1A2ZA 4ZY2A 6CPAA 1FRJA 1SIZA 4MHDA 4PPDA 2WOMA 4K2XA 4XTTA 4YU9A 3OFHA 1RISA 2B4VA 1RT1B 4PWDA 2REEA 3RB4A 4DNCA 2MKYA 2HVHA 1VI7A 3MPWA 3FRZA 4QIWD 4S0MA 3JSMA 4EMEA 3N79A 3NOGA 4BBYA 3T19A 4QWCA 4OLOA 1WSRA 2KN4A 2WZNA 3OW2R 1C4AA 2BUNA 1SBRA 4Q0BA 1M4IA 4OZ3A 2CF4A 1WKKA 3CMQA 2YNHB 2C1EB 4WFNQ 4JI2J 1WEYA 4L8AA 3K57A 2CNNB 1EX8A 4DV0F 3HVWA 3CDXA 4A8KA 3J7YU 3AD9C 1RAOA 1M5VC 1FK9B 4TY8B 2M4MA 2HRUA 4C7QA 4X65J 2NSMA 2QZ8A 1Q78A 3BKFA 2C22A 1KQGB 3MDFA 2GVDA 2JHEA 4UA3A 1IXKA 3V6KA 3IWXA 3BXMA 3KNGA 3OVSA 2X1FA 1P9QC 2UUTA 1YI2S 4NMXA 4LF4F 1B6BA 5GAGU 2YPZA 2ZEJA 3TTHA 3V6HA 3A8KA 1U8WA 4KR0B 4I0WA 4TY9A 3EICA 4CAWA 4ED5A 2MSTA 4A31A 3HPOA 4DV7F 1GH8A 2J9CA 2JDJA 1S6PB 2YTCA 2E5LJ 4KOVA 4B9NA 2IDLA 4JI0F 4G1QA 1YW6A 4NEZA 2Z0ZA 1CSJA 3EUNA 2H51B 3HCXA 3MGJA 2KT2A 8AT1B 4M6GA 3RB0A 2JLMA 1F2PA 5FDLB 3T3FA 2FY8A 3FDSA 4P6YA 3MCNA 3TQ1A 4F25A 5KFIA 2L48A 4EK2A 4UQGA 1M1HA 5L38A 1S0OA 3Q8VA 4KGZB 5F8NA 3NS5A 1TKTA 2OPSA 1RCOB 2FS5A 3EC4A 4BWJA 2I5JB 3C3LA 1RU2A 2QLJB 4Y2MA 4NLYA 4X4SA 2IJNA 1QAIA 2JX2A 1HKAA 4DJLA 1U0HA 2C2NA 1V5VA 2RHQB 4AVAA 5IT9U 1EJ7L 2ZEFA 1OJ4A 4KJIA 1E6VB 4R9MA 1S79A 2FXFA 3T9ZA 1RLCL 2RNEA 4OZ5A 2K8GA 2ZWOA 1BO4A 3HF5A 3D3BJ 1UWBA 1JXVA 5KFKA 1QVGR 3FB3A 5KFLA 4F0MA 1XE4A 3OV7A 2BE9B 3OL7A 1M4GA 2MQNA 1RTHB 4URQU 4LRBA 4DXLA 3DGVA 2VQEJ 4N5SA 1TMJA 2ZW5A 2KM8B 4J9OA 1CJUB 4NXNJ 2BJ7A 2E44A 3MEEA 5A0YB 3PTWA 4IOAQ 1HMVA 2HYIB 4AL7A 4B9MA 2BKPA 5A76A 1TFWA 3MMJA 1BAVA 2V2QA 2UV8A 1Z1ZA 2VPZB 4C8OA 2WVBA 3BKUA 2C3PA 4RO0A 3MI7X 2IJRA 3GFHA 2NPFA 2OTLS 4GO5X 2G4BA 3NL0A 2DNPA 1RKJA 2XZTB 4CWBA 1SH3A 2M88A 4X84A 2VHGA 1X9MA 4DJBA 4M63A 2ZW4A 2ABZA 1TF8A 5DJBA 3KHXA 4Y2IA 4C98A 2HW3A 2L9WA 2LQJA 4LF5J 2HNZA 2W2OP 2MJUA 4WIQA 2XO7A 2NXEA 3TUJC 1S1UB 3UFCX 2XMTA 3LW5C 2GJ2A 1RAGB 4JYWA 1RSCA 4CLWA 4KGMA 5ETPA 3S1TA 2XSJB 4USTA 3BR9A 3Q0AA 2JEFA 1ZLIA 3IA0A 1FTRA 1ARMA 1MROB 4NFRA 2CQIA 2JSXA 2AF6A 2HWIA 5F3TA 4YR2A 4LF7J 3EJMA 1F3VA 3PB8X 4JV5F 4F6AA 1MMLA 4B10A 4FAIA 5I3UB 2E1RA 3ZZPA 1RXTA 2RH3A 1HYSA 3GV8B 3FSIA 4Y28C 5C7PA 1D09B 1SV5B 1U1RA 2VH7A 3EXNA 3NGRA 2CAJA 3POTB 3KI9A 1CPXA 4ANEA 1N56A 3TE4A 4KOYA 4FS2A 4EUVA 2DXDA 4ED1A 1S1XA 4WU2A 2DHSA 1YVFA 4KGXB 3TX8A 4E0AA 1JLAA 4KV8A 2MQOA 1MN9A 1RTHA 4F2RA 2GLFA 2CQBA 3QFHA 1ZAVA 1OYEA 4HKQA 2FHOB 2B9WA 2C2KB 1FX2A 1S4FA 5J2MA 1U1MA 3QLHB 4OHXA 4WTOB 5LSOA 4R7MA 4WKYA 6AT1B 4A8OA 1N34F 1RAFB 4NEYA 2HQCA 2MLXA 2G0JA 4CLSA 4CO2A 5F49A 1QAYA 3JSMB 3G71S 3C16A 2EFVA 3Q83A 3VQSA 4DU8A 1RTDB 2K3IA 1IKVB 4YOEA 4LF2A 2YNHA 4IOCQ 2HZVA 4QW9A 4O44B 2AJFE 5JVGQ 3FZBA 2GO8A 4TY8A 2J8NA 4WWSA 2BJDA 4W92B 5C24B 2GCFA 3N6NA 4J9PA 1RUSA 4DQPA 2RSQA 4E0DA 1Y3KA 4DLGA 3DLHA 4PRFA 2YKMA 4JUZA 2Q43A 4WP9A 4ETXA 1YJRA 5ISVA 1NBEB 4ZVGA 1OS5A 4RUHA 2V9WA 3GJQB 2D9PA 2JWNA 4O3OA 4NLDA 4DHVA 1H3DA 2MKJA 3D9BA 4KHRA 1JKHA 4KPYA 1JJ2R 3W2VB 4DR3F 3K5LA 4GC6A 4F4YA 2CPJA 3N01A 2LEBA 1EKRA 3CDAA 3W3SA 2RUSA 3BF4A 2PE8A 2MKCA 3SIPB 1QSSA 3I5BA 4IH5A 2D41A 2BO9A 1HFEL 4ED2A 4NLPA 4AE5A 1MJ9A 1E6YA 4WFAQ 3DMJB 1VDHA 3KFWX 3BYPA 3BS9A 3NGKA 5DG9A 4UIBA 3R5JB 4NWBA 5KFJA 1TXRA 1S6OA 2HQ3A 5HO4A 4RW7A 1TL3B 3CSKA 4WP8A 1UVLA 1TF9A 2DXFA 4EBDA 3TA2A 3RUBL 3V6DA 1VQMS 1U2FA 1WHVA 3FBEA 2ADBA 2JOQA 2OH1A 3HFZB 2HBRB 5U47A 3GILA 2ZZTA 3VR1A 1VRUA 5F47A 2OOTA 1CULA 5EN1A 1LWFA 2BSWA 4D3GA 4B14A 3LODA 5G22A 4DZ6A 4XO0A 4BLGA 4G1IA 3T5HA 5IV4A 5BR8F 1J5OA 1FKOB 5KFVA 1Y7PA 4DX5A 1D9AA 1KSPA 4FYXB 2EFPA 1XERA 1VS3A 4RNHA 5ETSA 4TXSA 2CG8A 4TYBA 1UEKA 5K14A 5ETNA 3EO4A 2VKRA 4LRCA 3OSPA 3FGVA 2Z8QA 5IB0A 2AFSA 4F50A 4DSEA 1C0UB 1KBRA 2FIWA 2DPSA 1YLOA 2HIQA 3L2NA 3M32A 1VQ6S 1N32J 3UY5A 3FFIB 1WG5A 4PWWA 2G9OA 2HURA 2DK2A 3IGRA 1ULRA 2N82B 2DH7A 1VRTB 4CO4A 1C1BA 4MKVA 5GADU 4RW8B 2RF2A 2J0SD 1N34J 3MM6B 1UW4A 3PJWA 4LSLA 2AJ0A 2W2QP 4ANDA 2UXBJ 1S1WA 3SXOA 2PEHA 1HARA 4CZCA 1B7FA 3AXMA 1YSJA 4PWUA 1T7PA 4KSEB 4JV5J 4B3MF 1BQMA 4RW7B 1WC0A 3GLJA 3G8TA 4Z2XA 1RT3B 2QLBB 1EP4B 3BH7B 3GY9A 3D6FB 3ENQA 3SZ2A 1QSMA 2LFVA 4FZVA 3N9UC 2MTLA 2H9ZA 3AT1B 4QYZK 2DNZA 4CYOA 3ETOA 2IDEA 4YB7A 4R5PB 5AG7A 1PBAA 2AFZA 2M70A 2C3OA 1X4BA 4Q5VA 2LEAA 3CCSS 3JS9A 1RWVB 2EXUA 1UAWA 2CQDA 2PE3A 2B9EA 4GMKA 2I00A 3TZXA 3QIDA 4ZVTB 1IKWB 3WC5A 4UFXA 5DDQC 4FWUA 1TFYA 3VGUA 4DSLA 2M8HA 3DLBA 3QBCA 3G8SA 1FJGJ 2Z3MA 4WFBQ 2K1RB 1F57A 5KFUA 2FLOA 3KHRA 2ZUGA 1LW2B 4ZLPA 4CGNA 2CKWA 1FRMA 2RU9A 1T0TV 1NDLA 1YGYA 2Z2YB 2O5DA 1L3TA 1QAXA 3D1HA 4LF8J 1RAEB 1ZYQA 1TKTB 5ETTA 3DYAA 4I68A 4AYBD 2AMCB 4LR8A 5GAGI 4NLOA 4Q36A 3GJSB 1G2EA 3KLGA 1QJHA 1S1UA 2UVVA 4QCLA 4MK8A 1F3FA 1R57A 2ZEEA 1UEVA 3HKWA 2AJ2A 3CTRA 1IWAA 4CLUA 2RU3A 1WC3A 1X4GA 4DUYJ 1N48A 5E2QA 2VICA 3TRGA 4QYRA 1R8AA 4P4DA 2BE2B 1BQMB 3CCES 3D4UA 2X1AA 1K1QA 4EBCA 2FVPA 4LF7F 2ERRA 5EC4A 4ORFA 2FUG9 1S99A 2GGPA 4ZY0A 2IM2A 5KT6A 1CLFA 1RT7B 3TARA 2AFMA 4PK2A 4FYWB 1FJGF 2OPQB 5K8MA 3KDNA 3TOAA 2H1YA 2PA8D 4F0KA 1TK0A 1C0TA 3DM2A 2FVQA 3RGIA 5IT4A 3P96A 3PCOB 3IJ3A 1UPPA 3I0SA 2D1CA 3F56A 9RUBA 2QA4S 3R7BB 4M5IA 3K5OA 4NXMJ 3KDOA 2X1GA 1VMBA 3T5JA 1BE4A 1YBAA 1RWKB 2R9LA 4B3MJ 3W9JA 2KG0A 4OKOA 1S7HA 4Q2MA 3BPDA 3C6UA 2M8DB 5ETOA 1B87A 4ILRA 2B8QA 3CVKA 3FMBA 1JJHA 1NJZA 2C6PA 4QR2A 1QM9A 5B0EA 4MHPA 5J1EB 5A28A 1BQNB 2Y0BB 4OJHA 3E8OA 1D1UA 4L75A 2YWWA 1Q2DA 1NJWA 3PJ9A 1DURA 2YKOA 3OR1B 3M8WA 3KLHA 2ZH1A 4A4JA 4Q8EA 1Q86T 2JL9A 2BOAA 4AD6A 3HT3A 1F0XA 1IKYA 2KJWA 3R9GA 1FKPA 4M5JA 3PW2A 4P4FA 1NJYA 1LANA 4RW6A 1J2VA 3DXBA 2G1HA 2YX4A 3W5YA 2UUCJ 2AEJA 3JTKA 1ZG7A 2FHJD 4F9VA 3NLCA 4PG5A 2BX6A 3CO9A 4RWXA 3TNVA 1R0BG 3AB2B 3NCRA 1WUUA 5CXTA 4DS5A 4CO1A 3I1UA 1C0UA 3P6YC 4Z65A 2I0XA 4ZPBA 3EFAA 2UUAJ 3J7Z5 1EE3P 2WW8A 1IJFB 1HNWF 2ZWPA 2Z57B 2I1RA 2QFJA 2CPIA 2I2YA 2Q7SA 2WBMA 4DQIA 2RIJA 1TKZB 2BANA 2PT0A 3RBDA 1X5OA 1JJ4A 2DJWA 1ROFA 2EG2A 1SUQB 3R2CJ 4ZIWA 1XMOF 3TW0A 5F46A 2M7SA 4LQ6A 4WCEQ 3EZOA 4X66F 1FFSB 2PGCA 4DUKA 3CCTA 2V9KA 5DDRC 3FXTA 5D4OA 4ZA1A 5G4DA 7CPAA 1MNEA 5KFRA 2Q3PA 2XWYA 1IWGA 2HG4A 2FIUA 2WVFA 2MQQA 3DSBA 1ELMP 3GFXA 3FEXB 3WBZA 4K59A 4ZP9A 4UWIA 1VISA 4GM5A 1LAPA 3CIZA 1IM6A 4K4ZA 5HROA 1KKHA 3PW7A 1CS4B 3H20A 4QQBA 3HMJG 3MR5A 2B3UA 1UP1A 1RAHB 3UDEA 3H2UB 4HYKA 2I38A 4YFJA 4F9UA 2IVYA 1CJKA 4C2XA 4M5LA 3KLHB 3H4DA 3LOUA 1FJCA 1XBUA 3AOBA 1NKCA 2DHGA 4JYAF 3M7VA 4LJMA 3I32A 5L9XA 1UVNA 4Q44A 1FESA 1RDRA 1RYRA 3QGIA 3D2WA 1O6XA 1XR6A 3WC2A 4F4ZA 4OJGA 3EGVA 4OAEA 2DNKA 1RWMB 3UNGC 2HNDB 1WKJA 4KZTA 3ZZTA 2YQ3A 3TVKA 2FJXA 4B11A 1X4FA 4OFZA 2CYYA 2FC9A 2LXFA 2PVVA 1SCJB 1PC4A 3UR0A 2NLWA 5D4NA 3G8WA 1ZAWA 4V1Ak 3DLEA 3NWGA 4RW9A 4K7QA 4ES2A 4PQUB 4YY3J 4ZPWR 1KS2A 5JGFA 1YX2A 3U02A 2VQYA 4MIWA 2HWHA 4U7UD 4NLQA 4AVCA 5A6PA 2A1BA 4ZLLA 2VA2A 3ICLA 4LFBJ 1FFWB 3J80Y 3SBMA 3R5GA 4JI7J 5CZVA 3MECA 4JI4J 5JH9A 1JMTA 2JLFA 2OELA 3RAXA 4KSFA 5HH1A 5ETKA 3OBIA 3CJKA 4DQQA 5EUHA 4Y49C 3I56S 2GFFA 2D3O1 2VIHA 5LYDA 3QYYA 2BQ3A 2OR4A 1U1NA 1PJ5A 1RT6A 4YRHA 4PEOA 1SH2A 2D9OA 1CJVB 1HI1A 5GAEU 2CJQA 4HHUA 3GU0A 2U1AA 2ZKTA 4TQRA 2BJ8A 3BBCA 3ILLA 2PIZA 1HR0J 2AFXA 4B3RF 4DV6J 1Q8BA 4EFAC 1J5EJ 4P7VA 2HV2A 1HBNA 4A8SA 3VZHA 5KTQA 2ZH2A 4WKRA 6FDRA 4EWTA 5GMEA 2NREA 1BLLE 2YNIA 1T03B 5E41A 3DM2B 5K8NA 3D7SB 3QO9A 3K58A 3RNZA 2PR8A 2YXLA 5J2NB 2O01C 2PJ8A 2XEIA 4ZCIA 1N33F 1DARA 2VASA 3FC9A 3O3LA 3DU6A 1KUYA 1EKSA 1U45A 4FD4A 2DCLA 1JWQA 4USWA 3SSSA 2R98A 3H8GA 1LWXA 3TUZC 2CZ4A 4KO0A 1CC8A 1YX0A 3ZTRA 4MIBA 1A9NB 3PBEA 5KFYA 2AW0A 2R7OA 4HNYB 1S0MA 3ILIA 4OMEA 1HQEA 3LPYA 3KHLA 2B9YA 2ZHOA 4IFYA 2PJ6A 2NXCA 2DR6A 4LFAJ 4P45A 4CH0S 4FVCA 2J8SA 2Q7BA 3IGNA 2ZHAA 3I3GA 4XDCA 1HNZF 2GIVA 4FPIA 3HK2A 4DFMA 3MEKA 3AA8A 3D2PA 4IG0A 4E98A 1J5EF 1ICEB 2HHHJ 4RW4A 3H4QA 2AD9A 1HBMB 3IU2A 2YNGB 3DI6B 2IM3A 4MKYA 3RRKA 1FRKA 5E7OB 2GIRA 1EHWA 3JVNA 1P1LA 2OD6A 2GZOA 1SC6A 2O1PA 3M8SA 1Q16B 2JRSA 4USKA 3RB6A 4M5DB 3GTYX 5A0YA 4B3TJ 3IWLA 3GQCA 4X4TA 4ENOA 2DCUB 2P9GA 3SFUA 4DL4A 4X2BA 1HBNB 1K0TA 3B54A 3CXPA 1NUEA 2VQEF 1Y5LB 3MEEB 2JDDA 1T03A 4C3KA 1M5PC 2W7OA 1Y10A 2VC0A 2IQ6A 1U4BA 2CXEA 5ETRA 4NPOA 3NY0A 2ZEPA 3GZ7A 4R0EA 4ZPTR 4OYAA 2J0QD 3LWLA 1F2GA 4ZJLA 4Y2AA 2QSWA 3EE3A 5GVQA 4XPCA 4B5PB 4J37A 5ADZA 4MYTA 3MM5B 4N77A 1EETB 5L1IA 3CMAS 1JNZB 2HMIB 1RKIA 5G1ZA 2AU0A 3D6MB 4QW8A 2ANPA 1YG0A 1NXIA 2OMLA 2R7WA 5F09A 3PNIA 4IOBA 3BJYA 3DDIA 4UY85 3RBUA 2Y1IA 4CH7A 2PQ8A 4HEA9 3BSCA 2HHTA 2XEFA 4FF3A 1U47A 1GX6A 4C8KA 2PCUA 4P2FA 3I87A 3G9CA 4MFLA 2D3UA 1YVOA 4QJVA 5JVHQ 4ZK7M 1FDAA 4QU6A 4P2SA 1JLBB 3CIMA 3AHPA 5B7WA 2C2DA 2M9KA 3KK1B 1LWCA 7FD1A 4USMA 1FNMA 4BC7A 5HMNA 3IEHA 4A48A 3R2DJ 1JXLA 3MR2A 1UZDA 1X5PA 2J8RA 1ZPWX 3QAHA 3ENAA 1NSPA 3HT0A 3E0KA 3QAUA 4DQRA 2F5GA 1Y0YA 4RUCA 3QRQA 3QLHA 5IWAF 5KFQA 2HK3A 3C6UB 2GX8A 4J5OA 4ZVQB 1J27A 4ALZA 3GJRB 2B43A 4USJC 2ZELA 4DCOB 1RLDA 1M5OC 5CABA 1AW0A 2DEAA 1R7IA 3TVYA 1EQMA 2LECA 5M2RA 5D8HB 2XMAA 5MAOA 3EZ5A 1KNZA 3DGPB 1N52B 1NZAA 2MHEA 1SB6A 3CGIA 1T02A 3MR7A 1FKAF 3QJPA 3KG4A 2HQGA 1KRPA 3H8YA 1N5VA 4QPXA 2UUAF 3DHWC 4FXWA 5DO2A 4IG3A 4I56A 2W4CA 5C5JA 4CYQA 1IVZA 2CPEA 4CLFA 3TX0A 3ADAC 2BR0A 3LA0A 1JB0C 4NZ0A 2OD4A 1KDNA 4RU9A 2GQCA 3GV7B 2XEXA 4X4OA 1NB7A 5HSPA 3NBPB 5EHHA 3TA1A 3EGWB 5EDWA 3KK3B 3QJLA 2VZ9A 2PJAA 2ZJPQ 3TUIC 3BSOA 5J2PA 4II9A 3R1HA 3B6BA 3RG6A 2YWKA 3C6TA 2KG1A 1M44A 4CP5A 1RWOB 2Z2MA 3FX6A 5IQ6A 1Y4ZB 4TLRA 1I94F 1KWMA 2QLWA 1QSNA 1Q8KA 1V3RA 2H4YB 4Y6IA 1S9GA 2DNMA 4CLPA 4K0KJ 2VJVA 4F4KA 1VHIA 4OV6A 1B70B 3MWBA 5D0HA 2ZVSA 5AE3A 2GQQA 4B5OA 3C16B 2J0XA 2ZOMA 2HQFA 1YK9A 1HNIA 2R42A 4C0OC 3DDNA 5ETVA 1NEEA 4JOUA 2RRNA 3H90A 4DV3J 3VARA 1KLMB 1S9FA 3IO1A 1FEEA 2UVWA 2V67A 4CI0B 5J8FA 2DY1A 4TU9A 4ICLB 2POKA 2G3AA 3BI1A 1XMOJ 1CC7A 1IN0A 2CA9A 4RI1A 4O4RA 2ATRA 2XULA 5CH7B 1XNQJ 2HRTA 1IBKJ 4OYIA 2QJ3A 1T3OA 2HLTA 3MCOA 1XMQF 5K14B 4OC1A 5M2UA 3HO1A 1U1QA 2DGUA 3VAKA 3R5AA 1DZ5A 1BPNA 2RILA 3M9OB 1KLNA 1R8PA 3HVTA 3IBCB 2HGLA 4B3SJ 2A6OA 4NGSA 4J9MA 3FCWA 2J9EA 1EETA 8ATCB 1ZG8A 4KOUA 1KTQA 4BS2A 2BKOA 5DGBA 5D4PA 5C2GA 2FHJA 2ZENA 4X2TA 4DF8A 2HVEA 4YMEA 3D54A 1VBKA 2D4OA 3IM8A 4NXYA 3AY0A 2CWKA 1Z2LA 3UN5A 4HHHA 2XMMA 3VAFA 4K4TA 1JWWA 1DE4C 4PXDA 4W98A 3TOQA 1ELLP 4R3KA 3PEHA 4OZ2A 4XNHB 5D15A 4GS4A 4DFKA 2HFSA 1DTQA 2ROGA 4KKOA 4C48A 3KJNB 1T9VA 2AIRB 2PR1A 3LGNA 3BV8A 4ZP6A 3R9EA 2V2KA 2QMLA 1V5IB 1X7VA 5B0AA 2GFQA 2KFYA 2ZBIA 3HSJA 2CPZA 4TYAA 1BOBA 2OZGA 4JI6J 3GCWP 1QVFR 2J8MA 3QGGA 2MSSA 2Z56B 3B7IA 4M5GA 1TUGB 3ZTSA 1R27B 3CD6S 2ILZA 3PRTA 3Q24A 4LVOP 1IKWA 2ZDPA 5GAHU 1DTTA 4FF4A 3LD2A 2ASLA 3A3OB 3CCWA 5L8RC 4B9LA 2VOPA 1CJUA 4UFVA 1Q0NA 5FLXU 3CDWA 4I1TA 3P49B 2ZM6F 3PW5A 3EVWA 3DC2A 5KG2A 2L9NA 3KK2B 2PJ1A 1S59A 2H54B 1FXRA 1U2CA 4F67A 3DRXA 3QAEA 4NCGA 1S6UA 2EBGA 3FCHA 2CZ9A 2UU9J 4PAAA 5CCMA 2X3DA 1HHTP 3CNQP 2VG7B 2JC1A 1S10A 2CADA 3CDEA 3GG1A 4TVAB 3PVXA 3M8PB 2GJFA 2P6TA 4ECYA 5D77A 3KJVA 4TU7A 2C28A 4N47A 4IYQA 1JQGA 1H6KX 2AYEA 3CJRA 1VK3A 4JI1F 2B58A 4ELVA 4HR2A 2DTJA 2QEXS 3HSDA 5KTDA 1YJ9S 5F41A 2DIVA 3LGHA 4JLYA 2R8JA 1UVMA 4WWVA 1YK3A 2FJWA 5CNPA 2ROPA 2JVRA 2DRBA 3PRBA 4FBEA 2QVPA 2KTQA 2JH3A 5L1LA 2OAUA 5FJ4A 4UCPA 4KB7A 4NLXA 2N7YA 4CM2A 3LP1A 3MPUB 1VBYA 2F63A 3KQZA 2HBYB 3BM7A 5KFMA 2G0BA 3C15B 1U0SA 2VFRA 2XI2A 5AG5A 1Z4RA 2HQDA 1RHRB 4P44A 4P4BA 3FMWA 3K5MA 3I9ZA 2AFWA 3FEDA 2RAQA 1PAEX 3TO6A 4DR7F 2QJ8A 4ELTA 2DEJA 4UWJA 4I49A 3SQGA 1PSDA 5K8PA 4ECRA 4CAXA 4QPTA 2EBEA 5AXNA 1V3ZA 1NM2A 3KGQA 4CAEA 4PG6A 4CGOA 1WORA 2BJ9A 3BN7A 4A8XA 3MEGA 5KG6A 5DG7A 4I2QA 2C27A 1REVA 2LCWA 1IKYB 2DO4A 1RT2B 4ECVA 1ZS6A 2QYVA 2MY7A 2Z2LA 1IM4A 2DNQA 3A8EA 4J9VA 1S57A 1U25A 4ITSA 2PEBA 1HHQA 2JFDA 3JQKA 2OEMA 1NK8A 1WF0A 4UQTA 2MGZB 2W8LA 3PR4A 3ZZOA 1U48A 5A2QY 2LEPA 1FRXA 4KHMA 5B0CA 3FJ2A 2P6EA 1QUVA 3IRXB 1LW0A 2Y1LB 2PMZD 4J9NA 4RPFA 3B82A 4NE9C 3AXKA 4JI7F 2MLYA 1IR2A 4LF1A 4R8UB 2G9DA 5ITHA 4YP3A 2K7JA 3W9IA 3TI0A 3IMQJ 1V9OA 5D78A 2NZCA 1YMEA 1E6YB 3Q8YA 1HNXF 3BO4A 4GKJF 3QSIA 5EWEA 2E9ZA 4MCQA 2NS1B 1FE4A 1RGVA 2CG4A 4PSWA 1RO5A 4HNWB 4FYYB 3AH6A 1TKJA 2XMWA 1YLXA 3VZIA 1LV5A 2RF2B 4U9YA 4ECWA 4OZLA 3GCXP 4ZLNA 2FVSA 2BJEA 1NK5A 2Y8YA 1AA1B 3LP2A 3HVAA 1NPRA 4A94A 2F5IA 4EZ9A 4NLTA 4CH1A 1Z9UA 3M6VA 3CW2C 3SJGA 1QTMA 4FBTA 2KXFA 2ZM6J 2DR5A 3CXQA 4B9UA 3MMCB 1FKPB 3NCQA 4N41A 5C24A 4KOWA 1VQKS 2F65A 4ZN3A 4RS2A 2PDAA 4WTYA 1Z8TA 3MCSA 5A8RA 2N3OA 4QIGA 3UW1A 5I42A 4K4WA 4WYLA 1CULB 1S1VB 5LMNJ 4O3RA 4ZVSB 2WBRA 1YITS 3R1KA 4ID5B 2FLNA 1JLEA 3TJ8A 2JEVA 1QSLA 2IPOB 4GC7A 3CPAA 5DS0A 4TU8A 3K0JA 3NGTA 2U2FA 3M2VB 5CYQA 1SIWB 3GSIA 1H74A 2MZSA 4X4RA 2C6CA 3GIUA 5KFXA 1RT5A 3OSNA 3D7FA 1C1CB 1ZM4A 4OX8A 4U9RA 3M05A 3PW0A 4USVA 1SC1B 1WEXA 3POTA 3DNSA 2UUBJ 1S7FA 3IP0A 1SJ3P 2ZJRQ 3V7ZA 3R7NB 4DR4F 2HS4A 1I6JA 4YEAA 4K50A 3W61A 4LUAA 3I31A 1JLAB 1HDUA 4ZCKA 1TL4A 2ACYA 1RT4A 1N5SA 4AL5A 2KJVA 4MFZA 1UWAA 3HP6A 4CO0A 4WE1B 4UEFA 4E2FB 3SXNA 1T05B 2VC1A 3U1NA 4ZPAA 2H3EB 4NMLA 4JWPA 2JC0A 1M4DA 2X1BA 4WXOA 1HPZA 3R9LA 3CCZA 5LYFA 4AVBA 3ILJA 4F3OA 3IWWA 2WPWA 1NCLA 1WF2A 4X4QA 3D6TB 3FNCA 4LF8F 3NH8A 2BRLA 3B3WA 1XR7A 1YJNS 2A6MA 4P4IA 1WI8A 3KG0A 1OYDA 2EFQA 5HN0A 2YNGA 3CJ5A 5HP1B 1TVRA 3N6MA 2QA2A 2PJ7A 4DV4F 5IM0A 3C8YA 1M1KT 1IOFA 1KUXA 1FRLA 1DFDA 2OIHA 3FECA 3DLJA 2DVIA 2G13A 2EK1A 1VOMA 3KLFA 4LF9J 5LYIA 2CQCA 2Y0MA 4HL9A 4B3OB 3IWGA 3TCVA 4HDHA 3DR6A 3MD3A 2GMLA 5CQGA 4W90B 3QNWB 2OHDA 3L7PA 4QWBA 4OJ3A 3H5XA 3CC7S 2HFUA 2DR8A 1H72C 3D7DA 2M0GB 1P9YA 2ZC3A 2FCKA 4U8VA 1RTQA 4WXWA 3H8FA 1MWYA 1S9EB 5H9EK 4FD5A 1JLGB 1NMTA 3W6SA 1LW2A 3WC0A 3LTOA 4F3MA 2JNJA 5KFFA 1DQ9A 1WDTA 4P72A 1ITPA 1UFWA 1I1GA 2AGOA 1IIDA 1D3WA 2V2VA 5HAOA 1R0AB 3C46A 3MMBB 4KE5A 2BEIA 4F3QA 1OZPA 4RW4B 2Q0YA 3QWPA 4P73A 2DXQA 3MEDA 4EBEA 3ZFVA 2I5JA 4YWYA 4AQYJ 4QWDA 4KLVA 2CVIA 1SKRA 5D6GA 4X62F 1T9XA 4QOTA 4AT1B 5BJRA 1Y11A 2QL5B 2XS7A 1XMQJ 1RZMA 1S6QB 2MKHA 2QYCA 3MZIA 1TV6A 4KVXA 2KH9A 2OO4A 4IRKA 1Q8IA 3BH6B 3M4XA 3I9SA 1F2HA 3VAMA 1GTHA 2AYBA 2XM3A 2OPQA 1RE1B 3TYTA 4LBIA 4R5PA 1SC4B 1ARLA 3K5PA 2D69A 3KKFA 4LRDA 4DV3F 2VUGA 4ED6A 3O44A 1IY7A 5HJYA 5F8GA 2MZTA 4Q8FA 3FMCA 4JBCA 2PMWA 1P0HA 4YDDB 4QWAA 3HHNB 3GYGA 2VI7A 2WVDA 2QV6A 2WYRA 4DX8H 2KFZA 1K4JA 2CIMA 3S6HA 3LUYA 1PC5A 1GYTA 3KUEA 1CG2A 5HQLA 3J81U 1BQNA 2XY6A 4TNUA 2QG9B 1RAJA 2FY1A 5I42B 1NNDA 3PYEA 4OZNA 4DEZA 4K8RA 1K73T 2B6AA 2KU7A 2KM8C 1KQKA 2IJZA 3ET6A 1TK5A 2GVZA 4ZIVA 1PYTB 2KB2A 4PV6A 1SL0A 2R7UA 5JM6A 5I0CA 4L76A 4OIWA 3MRUA 5LRKA 2QA1A 3WC7A 1SKWA 3KMQA 4PYDA 4KHPF 4TNOA 5E33A 4J7CA 2JEWA 3NS7B 2EK6A 4R25A 3EM1A 1TKHA 5HLFA 2PJ2A 3NRBA 2BJ3A 4KORA 1NZ8A 3VAHA 2K5TA 2ZHBA 2WONA 4A39A 1DQAA 3NCPA 4IQMA 4CYUA 5LJ5Y 2GS8A 4O3PA 2QX0A 2D74B 1WNEA 5ETQA 2XLKA 4RBUA 4ONWA 2UXDF 1PU9A 4UOFA 1YDLA 4JXQA 1QE1A 1DLOB 3ETMA 3OL6A 1MJBA 2CJKA 4CTAA 2Q6CA 2OEKA 3IIBA 2OSQA 2ZEHA 3IR5B 3MGDA 4KLWA 3F73A 4I2QB 2IMWP 4DUTA 1Y9OA 2H5EA 4F2SA 2NUUG 1N71A 3HHLC 2BUEA 1HNXJ 2RD5C 5IV3A 4OZ1A 4B9SA 2QSFA 3VALA 4H4KC 1MWQA 1QMUA 4JI1J 2AJ4A 4ECUA 1IKXA 1OQ3A 2R8HA 3MMCA 1UKUA 1XMBA 5F8IA 4MI4A 1XIQA 1TKFA 1RHMB 3LGMA 2FSRA 2R4FA 2V4RA 4MJ8A 4GRSA 1MG7A 1G3OA 3NMAA 5FLXY 1H7WA 5T41A 2H5IB 3ENWA 2WSCC 1MROA 2XMUA 2QLXA 4M8LA 3SDEA 4Z37A 1GMWD 3BGOP 3WIUA 4JI3F 1JLFB 2BRKA 3ISZA 4NCBA 5DZ7A 3GP9A 2W7PA 1XOVA 4A30A 1W7WA 3D4JA 1B4SA 4LF6F 4QVTA 4DL6A 3IR7B 3D66A 1FRIA 3QPIA 4X4PA 1Q5VA 4HVZA 3SCLE 2PC6A 2R2RA 1OPZA 4KHPJ 2FPHX 1NKEA 4BC9A 4ZP7A 4R57A 2BBEA 4GKKF 6FD1A 1O0PA 2VU5A 2EK9A 5LYLA 1M5HA 4JI8F 4BD9A 3DU5A 4DR1J 1S76D 4HTJA 3VVTA 2ZH9A 4DSJA 2YWHA 3SJEA 2W7AA 5HJXA 5MLCV 3MN8A 1GAOA 4I7FB 4DL7A 2E5IA 1EZZB 3Q2SC 1R0AA 1IR1A 3PXGa 2AX0A 3AJDA 4UBRA 4IR1A 2R7QA 3P5BP 1XN9A 4IUFA 1Q2YA 3TAMA 2GHPA 5IQQA 4OI6A 2NPIA 3F44A 4HT7A 1WEZA 1WWHA 4OYPA 1N5TA 1T11A 3OR2A 1TVRB 4ED0A 4L89A 1N33J 4O4GA 3A4TA 3MFHA 4OQJA 4CGMA 4ZP8A 1T9UA 1GEHA 3PFEA 3BKTA 2HGMA 2ASYA 2V2ZA 4ZDNA 2WB1D 4YGOA 3QT8A 5A8WB 2PFDA 4P4JA 4KSAA 1JLFA 1YZ6A 4MXUA 4DR6J 4X8IA 4RKUC 4KAIA 1IGBA 1RCXB 4D3HA 3GKRA 1L3SA 2FDNA 1T8EA 4Y00A 3JUWA 1HBUA 3PO4A 1S5KA 4N7TA 3DCAA 4BDPA 2J7UA 2UU9F 3KG1A 4DV2F 1BC6A 2CUYA 3BI0A 1T94A 1SL2A 3PEJA 4UTGA 3QAYA 3KK2A 2B8PA 3LACA 3DN9A 4MMOA 5BYRA 2JBJA 2KCWA 4KO0B 3PDNA 4MT1A 1XTZA 4ED3A 1B64A 4I6YA 4KKOB 1VQ8S 5HATA 2Q44A 1KD1T 4FD6A 4XPEA 1HWUA 3IXQA 3PBBA 2QTWA 3O8WA 2KYZA 4ERDA 3R3TA 2X7IA 7AT1B 3DOKA 1H2TZ 5G20A 5RUBA 1RT3A 1KQSR 3MUMP 4LFAF 2G2OA 3KJVB 2HVIA 1VIOA 3VWEA 1G6BA 1JX4A 2LXIA 1BPMA 4P9SA 3D28A 1RTDA 2ZOGA 4RR5A 5IFMA 3E51A 2UVUA 4MIAA 4HT5A 2NXUA 1AB8A 4CRJA 1I94J 1P4NA 2PFFB 3MM9A 1E6VA 4DSIA 2O4HA 4KT0C 3IWEA 3QGPA 3QO9B 2HHVA 1BY9A 4Z7YA 1IQTA 1S7KA 2YWGA 2E5HA 4GVBB 3MAAB 2AT1B 2VBWA 1VLYA 1WOPA 2BL1A 4AXJA 1T9YA 1XEBA 1X31C 3BGFA 3L7UA 2WSEC 1UVIA 4B9VA 2HWTA 1HR0F 2BM1A 3PYGA 4Y49B 1NHKL 2KYXA 1IBMJ 4G1QB 4C3LA 4OP4A 1V0CA 3CE8A 4XPKA 4X4UA 2Y1RI 3EXYA 3HD2A 1OIAA 2C2RA 2R8KA 1AXQA 4MH8A 5DDOC 3RYOA 4EU0A 4DR5J 2Z58B 4ECXA 2VG5A 3AOCA 1ZTWA 2R8GA 4OZ0A 1Y5IB 5LXRA 3BGLA 3ZXWA 1VHSA 2KO1A 4E8OA 3DLKA 1U8SA 3MFIA 1S12A 2BABA 3T90A 4PSXA 3SYZA 1P1TA 4ZYQA 4MFPA 5E0OA 3UNYA 3D5MA 4ILLA 5EWFA 2DXEA 1WSVA 4V19J 3PP9A 2DR9A 4DQSA 1TKXA 5H86A 2R2TA 1RACB 5AGEA 4FBUA 4M5MA 1TKZA 2BANB 3FNNA 3OWCA 4MFBB 3F5BA 1QD1A 2IA6A 4A38A 4ZVHA 1QUPA 1NMEB 5DETA 3OHAA 4O0IA 3TJAA 1NB2A 1S5ZA 1UA0A 2BV3A 4CDIA 2R7SA 4KGKA 2E1CA 3HZGA 2GQ2A 4GVBA 2M52A 3PKMA 1X4HA 2XHCA 1D9DA 2R3VA 4FF2A 1MU2B 3V6JA 5J8CA 1Q8LA 1ZO0A 4PYAA 1L5UA 4C0HA 1UMJA 3VTIA 1BUXA 5HROB 1PO6A 2GA7A 3RBZA 5ETLA 1S48A 2LA4A 2FTRA 5D4LA 2UP1A 2MGZA 3SDEB 3QATA 4ZN1A 4TN2A 1CBKA 4G6VB 4PR6A 2BW2A 1KVJA 2HFVA 2PVWA 3FBFA 2W1BA 4CRYB 3ZZIA 2HK2A 3JRUA 2E7VA 5D3GB 2W2PP 5E3PA 1RT7A 1JLQA 1Q2CA 2PD1A 2C1CA 1WACA 4OI2A 2COLA 2L9DA 2NXJA 3UD3P 1M1DA 1U6BA 2P6GA 4YS2A 5CA5A 4F4XA 2A10A 3P8BB 4ZY1A 3J81Y 4JV0A 2B4BA 4H4KA 4JV2A 3DNCA 2OPPA 1YW4A 1DBDA 5SZTA 1ZPVA 4DPXA 3MTJA 1EARA 1XFOA 4LMZA 3TFYA 3SXLA 2AZ1A 4X4NA 2HFNA 2LKZA 1SKUB 1W26A 1PIEA 1UA1A 2HVDA 3Q8QB 2EVZA 2OH2A 4LX9A 3V2UC 1REVB 2E7XA 5KAKA 5F9NA 2FGCA 3R96A 2Q04A 1CQMA 4LT6A 3MAQA 1LQ9A 3OVBA 2B4DA 2D3OR 4UFWA 4IDKB 1RYSA 5AG4A 2IAJA 4DL2A 2DGTA 2VB6A 1SH0A 2H4WB 4IO9Q 4OI3A 4DR2J 4X62J 1X5TA 2HGNA 1WG1A 4NJRA 5J1EA 5EMIA 4Y34A 1BWVA 3CEDA 5AG6A 3BPSP 4MCRA 1HW8A 3M2UA 4C7IA 1GXUA 2AJQA 4W4MA 3BZQA 2OKQA 3KHGA 2QIFA 4HLBA 1M0SA 7FDRA 2C2OB 3JQMA 1WTBA 4ZJQA 1NO8A 5G0RB 3HDSA 3I5AA 2VFUA 3KR4A 1B0VA 3KASA 4RWWA 2QRRA 2CNTA 3R27A 4CNYA 3ITHB 4NLSA 4RBTA 4NXMF 2X51A 1RWXB 4ZS6A 4C3MA 2GO9A 2UZAA 1C1CA 1SJFA 1LKZA 2MY8A 2CQ3A 3HVTB 1SPBP 3RBXA 2F9DA 4Q45A 4KFBA 4QIEA 2VZYA 3S9MA 4C2ZA 5CD4A 2IRXA 2MDAA 4XDDA 3NP5A 4DZDA 2PO4A 2CQPA 2M3DA 2J7WA 2ARHA 5CZXA 5AJ3J 1U6ZA 3PY8A 3P2FA 4R8FA 1FWPA 3BLNA 2B0GA 2BZ2A 1RABB 4QBJA 1MN7A 4LR7A 2AFUA 5F0UA 4BHQA 2ZKUA 2AE6A 3OUYB 4F4AA 1S77D 1HQEB 3BBBA 1O8BA 3BR8A 3G2XA 3Q8SB 3H2VE 1VQOS 2IM1A 4DV2J 1VJQA 4DU7A 2AWZA 3MECB 5KG5A 3MMBA 1FNOA 4X64J 4OC5A 2CQHA 2DGSA 4R0JA 4J9RA 3Q22A 3LMSA 5BYQA 4DR6F 4HACB 1UWYA 3B2YA 1BXNA 3ISND 3JSRA 4ID8A 5IX3A 5EX0A 3SSQA 4ZX8A 4USHA 2VG6B 2ACMA 1MJAA 4QWEA 4M5KA 3VHQA 1VHEA 2HKEA 3L95X 4W9YA 3W65A 4H89A 4ZKAA 3EYZA 3TANA 3NE8A 4BCAA 1I51B 3N7ZA 1RAIB 2FZCB 2BEFA 2IL4A 1HMVB 1HWIA 3B78A 2PC1A 3PB7X 4DPUA 3K8WA 2DBBA 3HLPA 4DUZF 3GUXA 4EMDA 1UVJA 2IY5B 2B4OA 3SQOP 2WW4A 2ZBPA 1UCNA 3OHBA 4A32A 2RE1A 4CO3A 5LSRA 1YWXA 3N5FA 4J91A 1TMMA 3BDPA 3IWNC 2KVIA 1NK9A 3FFIA 3W91A 2XMKA 4LQ3A 4DR2F 1K47A 1TUVA 3CT9A 1IBCB 1Z8WA 2OPRA 1CPSA 3MM7A 3PG9A 3NGDA 2G1DA 2AEFA 4WBFA 4P6QA 5B0GA 2O28A 4N56A 3KLGB 1OBRA 2VONA 2VA3A 2E5LF 3MOJB 2ZXVA 4G65A 4ECTA 2XZWA 3KLEA 4L73A 1VRUB 2DNOA 4DV6F 4AL6A 5E5NA 2RQ4A 3I55S 1YJTA 5CYMA 1FXDA 1XNRF 2E5JA 4NLVA 1I1DA 4LQGA 4O3NA 4IFVA 2JFKA 2CNLB 2N3LA 5F9LA 2AYGA 2F8MA 2VDHA 5C42A 1N36F 1PCAA 2I79A 4NI2A 1CJKB 2CQ0A 2V63A 4MFKA 2CNSA 2XS5A 4YB5A 1U1KA 2OPPB 3P2HA 3R5BA 3LO3A 3NGUA 2NZ4A 2EFOA 1MMNA 4NLGA 3CPWR 1A7GE 4F0XA 3B3VA 3PIOQ 4CS0B 1IBKF 1DLOA 1M1GA 3OLBA 2CFXA 2WONB 1IJEB 4FVMA 1CM0A 1GX5A 1GMUA 4IAVA 1F2OA 2K7KA 5F8MA 2XO6A 2FJBB 2HHWA 1GNKA 2FJDB 3M1VB 2LP4A 1Y9KA 4KUAA 3WZ0A 2YNEA 4C2YA 2GW8A 1GHEA 2LVWA 4DV1F 4NX9A 2VJUA 3D7GA 3R5CA 2B5GA 5DZ6A 2PJCA 4QU7A 2CTCA 4MRIA 3LP2B 1YJVA 2G2ZA 2JBKA 3CCUS 2ATLA 1WHYA 3BDEA 5IXUA 5L46A 1W2IA 1IYLA 3DLGA 3MEGB 4OX9F 4LBHA 2G0IA 3OFGA 4NCGB 1IICA 3IS9A 5B08A 4FKYA 2DGOA 1LOKA 4KQZA 1TL1B 4LQ9A 3EPGA 3UO0A 3DRPB 1FA0A 3G87A 1TUWA 1Q79A 2HB6A 1NSLA 2RQCA 1NRKA 4OC0A 1JLCA 4PG8A 5A8RB 4AQYF 3IRXA 2YKMB 4RZRA 2EFGA 4ED4A 2VBXA 2CQ1A 4K4SA 2B9XA 3UDVA 1IR0A 2OP5A 1TELA 1FHTA 3ONQA 1OMSA 1GXTA 4BWMA 1JJCB 1DY3A 3D3CJ 4NLUA 3NAIA 2DIUA 2ZNZA 3GYAA 5LMUJ 2F4VF 4C8NA 3KXDA 2CDRB 3THVA 1LW0B 3PB4X 3AQPA 3H2LA 4MY0A 5C42B 2MQMA 3KK3A 1FFGB 1N0VC 4RNNA 1QTNB 1NPKA 1WELA 1S1TB 1RI7A 1KZFA 3VGTA 4NA3A 2WOMB 2ASJA 2V6AA 3I0RB 4YR3A 2XY7A 1C0TB 1FCAA 4U8YA 5HQ8A 3E01B 1WC6A 1A6LA 1NK4A 3TP2A 4KUBA 2QYGA 4USUA 2RDDA 4JZ0A 4ZCLA 4DMZA 1RBLA 2V77A 2GC8A 5BXIA 2WVCA 4IRDA 1DAXA 1M5SA 1F5CA 2BKNA 2H48B 3ZZZA 4F0YA 3QZ8A 1KC8T 2ZH6A 5LSLA 3WR7A 1Q4RA 4A47A 2IHR1 5A8KA 2I8EA 2AZ3A 4PABA 4H4MB 1U1PA 1N36J 3RYLA 4Y0FA 1XC9A 4DS4A 2RT3A 2NYHA 1CVJA 5A8WA 4A8YA 3HHLA 2Z0GA 3OTOJ 3QMQA 2HFOA 3W7BA 2W4DA 1SJRA 3DI6A 2V68A 1X5SA 1O5JA 5F8LA 3NMRA 3W2WA 1U1OA 1NDKA 2XI3A 2PJ0A 1P6TA 1X8DA 2DNLA 1CEZA 1NHUA 1A0OB 3GYNA 1FERA 4DYOA 3D0HE 4A8MP 2W25A 2DGXA 4DSFA 2C42A 4WFZA 3MPVA 1RT5B 4P74A 2DO0A 2ZE2A 4OLLA 2MPUA 2DB1A 2XBPA 5CD4H 2AX1A 4ZVFA 2F8EX 1LK5A 4DBQA 2VF3A 1JLGA 5KTCA 1JK9B 3G6XA 3O6QA 3DOLB 1U1LA 4IO1A 4CO5A 3HHEA 4RNMA 2R7HA 3I4HX 1VCTA 1FNXH 4UUWA 4H4OB 1V3SA 3P3DA 3ZZUA 3CXSA 3CO0P 5E3RA 1NK7A 3DDDA 2EWHA 4GKKJ 4Q2LA 3IAS9 1UL3A 3ZJ0A 2YX1A 4CCHA 3S9LA 2HS0A 1YJ7A 3CULA 1PUAA 3FSXA 3HFVA 4UEEA 3CJKB 4K4UA 2RDJA 1I21A 2DF5A 2OB0A 1HWJA 3K8VA 2FLPA 3QIPB 1URRA 1HNIB 3NG8A 5F0WA 1S60A 3D0IE 3BGUA 5I4MA 4J9LA 3X1LB 1FT8A 4OYMA 2CPDA 1B0PA 4IR9A 5C88A 1KFSA 4JJXA 4B12A 3G8QA 2ZH4A 2QA4G 1RWPB 1TTHB 4C9DA 3H59A 1WWZA 4XPDB 2ZEGA 3TOBA 4DR4J 1GFWB 4TKTA 3SI8A 1F6TA 5CYQB 2G0CA 3NA6A 3EGNA 2HHHF 4ES3A 3M8ZA 1S9EA 4OHYA 5L1JA 2ZNYA 4GKJJ 2YKNB 1DQ8A 2XG8A 5CBMA 1WC4A 2M2BA 3DYAB 1RTIB 2B3TB 1VIXA 1U7LA 3CCLS 5J1PA 3MPDA 5EBVA 1RT1A 1QSRA 3K2KA 2QFIA 3B8HA 3S6FA 2VOOA 2QC3A 3TAQA 2ZD1A 2NSBA 3VQTA 3Q8PB 2HHQA 2MZ1A 2DNNA 4PG7A 1DTQB 3IAM9 2AGPA 1KLMA 1CJTA 4PZVA 3IN5A 1KFDA 2W9BA 2YNCA 1FJ7A 1N0UA 1N6QA 4HI2A 2VFSA 2J6UA 3VGSA 4P4EA 3LP0A 4CYPA 1AFIA 4OL8A 2RUGA 1GXLA 1X9WA 1YRXA 3CCRS 2Z3KA 2YPYA 4UOHA 4KY3A 1S1TA 2Z30B 4EO8A 3R8YA 5H9FK 1HQUB 1S1VA 1VC5A 4ID5A 1ZOTA 3NNHA 3G6VA 2VBYA 4C0BA 1QDUB 2HNDA 1VHOA 2ZW7A 3LWMA 2ZH8A 2Q79A 1XMTA 4ES1A 5J2QA 3KNAA 1YBUA 4DG1A 2CDQA 1BHNA 4LF6J 2HS3A 5FIIA 3TZWA 4JD6A 1Q7YT 4ZVRB 2GU2A 1RJJA 2DRDA 1KR4A 4YN3B 3AJ2A 2UV8G 2QIRA 3HM9A 4JI3J 4YHHJ 1T3NA 3PHTA 2H5MA 3OR1A 1H7XA 1VFJA 4RJVA 2VL1A 3IM9A 1JNRB 4IUSA 2QECA 3DFEA 2QE5A 3C26A 1URNA 4YHHF 1Z4EA 2VBZA 2PRQA 1IOIA 4ZMMA 2JEIA 2VEZA 4O3SA 2J9DE 1JLCB 1TL5A 2VG7A 2NCKL 2DHXA 4LSLB 4OMFG 2Z3LA 3FSYA 4MYUA 1PG5B 5IWAJ 1Q1KA 2OUGA 1IBMF 2ABYA 3JTOA 2PI5A 2CJ9A 1T9WA 2IM0A 3MEDB 4PK3A 3K17A 1QY7A 2B51A 2F8HA 1CP7A 5JPHA 1S6QA 4DWIA 1TL7B 4ED8A 2MB0B 3ZNUA 3JYTB 5DQIA 3DOMB 2GHWA 2B5JB 3RJMB 3C14A 3UVJB 2R8VA 2C3UA 3CD0A 4LIRA 5E3QA 3KK1A 1XQIA 3DMJA 2HAFA 2GHVC 3GIIA 1M5KC 5KFTA 5B09A 4WZQA 3ZTPA 3IRWP 2CJXB 2ZITA 5IB9A 2BQRA 1YR0A 2A2CA 2ALZA 2PJ4A 4HKFA 4CYUB 1Y3JA 1EB0A 3I4PA 5KT5A 1VQLS 5F48A 3DHXA 2IRYA 2CXAA 2EUIA 3W6XA 2LA6A 4UY8T 3B3CA 3MM8B 1VQYA 2ZH3A 2ZOFA 3UWTA 5B0FA 3QRPA 2NQPA 4H4OA 4AFFA 2RRBA 1OY9A 1FY7A 1D0EA 2GAHC 4KBIA 1F9FA 1RU1A 4OI0A 5KFHA 1AYEA 3FEYB 5FD1A 2FZKB 3GE9A 4ZVPB 2BYCA 2IA0A 4EYHB 3Q8RB 3X3UA 3PW4A 2JLGA 3Q23A 3A3NB 1ZETA 3MXHP 4OIXA 2V8GA 2FZGB 3UCGA 2ZPAA 4UUXA 2EC0A 5E3AA 1D8ZA 3OL9A 2BDPA 4KOTA 3M8QA 2FT0A 3EDQB 3BJ8A 2HHPA 5HLFB 2F1FA 2A18A 3CB4A 4P71A 1VQ5S 2YH0A 1LCPA 1X4EA 2LQ8A 1JKHB 2G2YA 1SV5A 3M6XA 1WHWA 2XHWA 1UFLA 4P10A 1OPIA 2NR0A 2IYGA 1WI6A 4DLEA 2NUHA 2R7XA 1HBOA 1X10A 3LP1B 3EY5A 4ONUA 1DJ0A 2WRMA 1RTJB 5KFPA 2OZUA 1UEUA 3GMGA 3PV8A 1HQ2A 4ELUA 2UUWA 2APOA 2E66A 4YR0A 3DOLA 3Q8UA 3CD7A 3EPIA 4B3TF 4X64F 2XGQA 2JDCA 1LWEB 3G6ES 3LAKA 3NNAA 4Y2CA 4NCAA 1NK6A 3CZXA 1PJ7A 2IAJB 1F60B 1YREA 4ETZA 3MM5A 2B4DB 2RDIA 4IH7A 4K2JA 1F5AA 2DITA 1IKXB 3H5SA 4RLEA 1FD2A 2V5HG 2W2NP 1ZZNA 5J1QA 4Y3CA 3B4MA 3OR2B 1Q7LB 2ADCA 4YDXA 1FXLA 4R76A 4KH0B 2ATCB 1WKLA 4C8LA 2HMIA 5KOXA 2M5YA 1B7YB 3TUPA 3WX4A 1LNQA 4O4GB 1GTEA 4U5YA 4ER8A 1H73A 2GREA 4YUDA 4U7UK 3UR3C 4RL1A 2VDIA 2PSZA 5F8HA 4OC3A 4RN7A 4JI5J 4USIA 3CC2S 4EEYA 2V4JA 2VD3A 4I69A 1S0VA 5KG7A 3AB4B 1AUDA 5H1SV 1WJ9A 4B02A 2DNHA 4RUAA 4CLZA 3LANA 1UJ4A 4WFXA 2QMXA 3V81A 3V8IA 4BMHA 4URGA 4R8UA 5LL6d 3U1MA 2AEMA 3G96A 1S7IA 3KR5A 1VBXA 3A9LA 2Q4YA 2FLLA 3RAMA 1RHQB 3G82A 4UZBA 2HBZB 2OJ3A 4H6UA 2KRRA 3VCDA 2PDOA 2FVRA 4DFPA 3FBCA 3BSNA 1HPZB 4YFUA 3UDCA 3N5BA 4WE1A 2RKIB 3MTKA 1FDNA 1N4LA 3ILOA 2MEWA 3H25A 1Z8XA 3UCZP 1QSOA 1XWLA 3A1YG 4KYZA 3O1LA 3W66A 3JB9k 1V6HA 1OO0B 3B3SA 2XMJA 1WC1A 2L41A 4HNXB 2GMJA 1RBOB 1S72S 2WPXA 3IBWA 2JVOA 2YWEA 2ZUAA 2R7VA 2W9CA 4O0NA 2AYMA 2AFOA 1FK9A 2E1PA 3A8IA 3DGPA 1AMPA 4U67Q 3HSGA 1LRZA 4IFVB 5KT4A 3BO2A 4J9QA 4FNIA 3A8JA 2WSAA 2YX7A 5IM0B 1R43A 1TKXB 3FEEA 2ZW6A 2EG1A 5D0GA 5C25B 3CDBA 5DM7Q 2J9AA 4A95A 5HP1A 1VC6A 1FJEB 3CJ0A 1WD6A 3FZ2A 5ELYA 4ZCMA 3OFEA 4UCMA 1Q82T 4ZPCA 1S7NA 4DX7A 5AXMA 2LQ5A 4AB7A 3EMTA 4PKDB 2GIQA 4BBHA 3H98A 4TQSA 1PGZA 1APSA 3IG1B 3UN2A 2E1AA 4X5KA 4LBPA 4I2PA 1HI0P 2JZ5A 3NNCA 4FS1A 3M9NB 3HVRA 3B35A 3P5TL 1RTZA 3CJTA 2EKNA 4EZ6A 3TR5A 1YQHA 4B3RJ 4CRZB 2VG5B 4MAKA 2XYHB 1TAQA 1LK7A 3LQVA 2J76E 4DCPB 3KJQB 3NXZA 3QWUA 3G4SS 2O66A 5LXYA 3KWMA 1YRTA 1QSYA 1MWZA 4DR3J 2XCAA 2YQ1A 4KGVB 3ISNC 2V34A 4GO7X 2J7KA 4ZI6A 5CYMB 5CAAA 1CJTB 4J9KA 1UFKA 1H8LA 3SJXA 3UD5A 2UXCJ 3T1YJ 2W01A 1TV6B 3MR3A 4MK7A 4YQWA 2YGWA 2RHSB 5LJ3Y 3PX0A 3EDRB 1I3OB 2HIYA 1SL1A 2OLWA 3H8EA 2IVMA 2HBQB 2ILYA 1RTJA 3D2MA 4TWEA 3MM9B 3LPEA 4CGPA 1OSDA 3RO0A 4L6V3 4NSQA 4YY3F 2HHUA 3GIMA 1VKCA 2CNOB 2XLIA 4MFBA 4OYXA 2B4PA 3H5YA 1GQEA 4FP9A 2FIAA 1N8RT 1FT7A 2DPJA 3OQ2A 4Q7AA 3M1VA 3Q86A 3M2RA 3T6JA 1QE1B 2KHCA 4I67A 4ZPDA 5IS2A 4FF1A 1UFHA 1X60A 1U02A 2A2DA 2KXHA 1UJ5A 4O3QA 5GADI 3O5TB 1ZM2A 4YB1P 2RMLA 3W8PA 2DPIA 4UW2A 1HWKA 4ECZA 3RB3A 2Q4VA 2OPRB 3SI0A 2C2ZB 2ZZMA 3MR6A 2GVZB 3PHEA 5IOLA 5HXDA 3C66A 2HNZB 1K9MT 2B4UA 4IG3B 2B3VA 3MMAA 4FN5A 4M94A 1TKDA 2FC8A 3NAHA 4MCPA 3M2UB 3VAJA 4DF4A 4DI6A 1VQNS 1CX8A 4B13A 3DRRA 3IGVA 3UPFA 4NRUA 1KOOA 3PB6X 3RTVA 3HX9A 4FUUA 1AFJA 4C8ZA 5L9NA 2QL9B 4HTIA 3DLKB 3UQSA 3ZZ0A 5D3GA 3W2VA 2QN6B 2FJVA 1UW9A 2KVQE 1X9SA 4DR7J 4LF5F 3N0VA 3R7SB 3R9FA 2H5JB 3S6KA 4OHWA 3QZ7A 2ZJQQ 3TEHB 2Y9HA 3QGHA 2XB2D 4B9TA 5B0DA 5JJBA 4DL5A 4DUZJ 5LOQA 2Y3YA 4ED7A 1IBLJ 3CJ8A 2LLZA 2NXNA 3GONA 4C68A 2QMUB 3G82B 1KHVA 4QR0A 5HMYA 3CJ2A 2GJIA 1S0NA 4DR5F 1KQFB 3W5XA 2CVEA 2BM0A 3TZZA 2XCPA 1VQ4S 3BJ7A 4DPTA 2PJ9A 1RHUB 1RWWB 4AG7A 3M2RB 3JTPA 3QNVA 3M30A 1VHFA 3N6LA 2ZEMA 3OJUA 3HXMA 2Z3PA 4NXNF 1XJWB 2O53A 3SHPA 5KFEA 4DL3A 4HHJA 4M5HA 3VGVA 2RQMA 3BHXA 3KJFB 2CPYA 2YY3A 3FK4A 1U09A 3Q2TC 2J9DA 1HLWA 3WQPA 4L74A 4OLPA 2FVGA 2OU2A 2XSJA 5M2PA 2HAIA 3V4IA 5DWMA 2MHNA 3QQCD 2MLZA 1Y9WA 1ZG9A 5LM7E 5L39A 3BQ1A 2DISA 2ASDA 2HQYA 3W2WB 3EGZA 4NRTA 1SC3B 3QSYB 2XYPB 5HK4A 2QMWA 1PYSB 3KHZA 2P8IA 3R6LB 4CLYA 3C2PA 1FDDA 4A8FA 5K9FA 1WF1A 3CJ3A 5K8OA 3K89A 2K3KA 1F1BB 3RU0A 4F0HA 2LQBA 4Z7CA 1S6PA 1K44A 2PJ5A 3SSRA 3I0RA 3M8RA 3K59A 1IUJA 2RJZA 1U6MA 4C11A 3FCVA 1RK8A 4A33A 4CGLA 4C6AA 4UT4A 2XS2A 4DN9A 2F7VA 3HD1A 5F3ZA 4QUSA 2D4PA 2AGQA 3T1HJ 1YRUA 4NGPA 4H2KA 4CAVA 1LXNA 1TL3A 3OFFA 5HI7A 3EVOA 2WCXA 1DTDA 5LT5A 2OFGX 4K4VA 3TAPA 4E8UA 4O23A 1RA6A 5K20B 3L3CA 1K8AT 3NWRA 2HUZA 3D1OA 5AXKA 1N5YB 2HC9A 2BJ1A 4HPSA 1YHQS 4DV5J 4H54A 3D8PA 1AUGA 4NF1A 4MBUA 2V4QA 2Z3OA 1FVSA 1UZHA 3DXSX 3OTOF 1WK4A 2HQIA 3IC1A 3HHLB 2HZAA 4XK8C 3KYLA 3FRMA 1GT8A 5CHCB 3RR7A 4UOGA 1HL6A 2ZC4A 2ZH7A 2VPXB 5AXLA 2ZEDA 4IF5A 3VVUA 1R6VA 2KZZA 1R8BA 1PJ6A 1FO1A 2GVDB 2CWXA 2YVSA 2G3TA 3R6GB 5HBMA 2ZEOA 1F5BA 3OXLA 1X4CA 3E3XA 4KOXA 4UIAA 2IJFA 4WZMA 2KI2A 1N54B 4X66J 4CQ1A 5D0EA 5FDLA 2OFHX 3GPAA 2OI2A 5T7LA 3PKYA 1QQ9A 1H0HB 3DR8A 4U7CA 3FQLA 3OXGA 2XEJA 3CJSA 2KHDA 3EZUA 3OL8A 2W2MP 1HD1A 4MCSA 3OUYA 4NGNA 3LF0A 3PO5A 3KLIB 2QLFB 2EI5A 3US5A 3P4UB 4DR1F 4AUKA 2WVEA 3ZZYA 1S4EA 1FWLA 5DLFA 3D6HB 1IU8A 4MK9A 3R5DA 2B5JA 2PMHA 5J1NA 4ANCA 1NH8A 5HMWA 1KN6A 3EVMA 1ZBTA 3LALA 2MXYA 3DDKA 4DOZA 5HVHA 1C2PA 1AZSB 3JXOA 1Z4UA 2WAQD 2E5GA 1RWNB 4NI2B 4B6ZA 1HA1A 3G3SA 3WABA 4P2MA 4FPRA 1D9FA 4OI1A 2HVZA 2R8IA 1OWXA 4NGRA 2PI4A 1MLAA 2CQ2A 3SI2A 2VKZG 4V19X 5C2CA 2V69A 4IH6A 3SV4A 3FJUA 3R1LA 3NFZA 5GMDA 5SUHA 3W8GA 1GMVA 4DG1B 4MY3A 2PRBA 2ZBCA 4OI4A 4DV1J 3ZNJ1 1N5QA 3D7HA 3UD4P 3JAMU 5CCLA 4OJ1A 2Y8WA 1I5OB 5BR8J 4LIWA 4IKAA 2KZMA 5D0RA 3DRSB 3VF0B 1RXOB 3HSZA 2FHMA 3KKWA 2LDIA 2XWXA 4Q43A 1Q53A 3IBFB 3MM7B 5KFBA 3QFWA 2MMYA 4OYWA 5KTAA 3ZZRA 1VRQC 4NOHA 4R6TA 1SKSA 2UXDJ 2F9JA 3PX4A 4OX7A 1R0CB 2IIHA 2DPTA 3FRYA 1TP7A 2HEKA 4CLKA 4DPOA 5KFWA 2V8PA 2Z3NA 5DG8A 1YVKA 4PG4A 4RNFA 5IZHA 2CJBA 4L3NA 3JYTA 3OTDA 4NLRA 4M85A 2DHAA 4JB8B 2OEJA 2GMHA 2HSEB 3T9YA 3D3SA 1WDDA 2CPFA 2XQCA 2V8HA 4B08A 2GLJA 5L1KA 3MURP 3K5NA 4PUOA 1NAQA 2J6SA 5I3UA 1EQ0A 3T5LA 1HNZJ 5KOWA 2FQQB 4K3NA 3TEGA 4OX6A 1M4LA 4KOSA 3HJVA 1OY8A 3CC4S 1Y0RA 4F4WA 2FGOA 1NDPA 2V8VA 4FDFA 3SMZA 5FVJA 4ATNA 4Y65A 3V4MA 2Y1JA 2K1RA 3TC8A 2WZ1A 2YKAA 1VR6A 3VAIA 1HNVA 2W24A 4LSZB 1R8HA 3PFOA 4ECQA 2FB0A 5KFZA 3GG0A 4OHVA 2RQKA 2IFXA 2VQFF 3A12A 1TL1A 4JV1A 2J0WA 3GR0A 3PRVA 4OHZA 4AXIA 3CUNA 2BMBA 3FF3A 4FD7A 2V8DA 3CD5A 2RB7A 3UN3A 2YNCC 4OC4A 2IMOA 4AXVA 1TAUA 1ZA2B 3NOCA 4I4BA 2XLJA 3DOKB 4DDFA 1PYTA 3ET6B 1NJXA 3ZTOA 2MQLA 3RRHA 2BACA 4RBVA 1XJOA 3I5CA 1TU0B 4GXHA 3O2IA 3WC6A 4KIAA 1RP5A 2MQ8A 3OLAA 4RX6A 2ZVIA 3TZYA 3GFZA 2E29A 1RHKB 3ITHA 1Y7EA 3H0PA 2W4PA 1G4CA 3ZC4A 4A8QA 2V0NA 4LF9F 4M3SA 4WK1A 3DLEB 5DQHA 1U26A 3QB8A 1P8GA 5HBMB 2EVNA 3E2EA 5THWA 1KTVA 1WHXA 2BOPA 4FYDA 1VQSA 4PXCA 2EEYA 3AJ1A 1CP6A 1YGHA 4X3RA 2ZE2B 1J4JA 4ZGYB 4NLWA 2MQPA 2LYVA 1HBOB 1QSTA 2VQFJ 4OZJA 3TA0A 4A37A 2PSWA 2AJ6A 5F8JA 5HANA 4EI2A 1HD0A 2CNKB 3AD7C 3TO9A 4CT9A 3PM9A 4MFQA 4N8OA 4I7FA 2EBJA 1HNVB 2BXJA 4MHZA 1YJUA 4DN0A 4H6ZA 4JI6F 2SXLA 2FD2A 4LRFA 4ZJOA 2E7WA 2VPWB 3J80U 3KUHA 1SI9A 3SCIE 5JXSA 1PKUA 2UUBF 3F0AA 3K9UA 4XPDC 5IV0A 1FKOA 5A27A 3KUGA 1Y0HA 4LSNB 4NYPA 2YNIB 1VQPS 3KLVA 4G1PA 2FJEB 4A46A 3KLFB 2DKOB 1LWFB 2CZVC 3PACA 2BA9A 1HDQA 1LAMA 3CMES 4NL5A 2MKKA 3CDUA 4DV4J 3EWGA 4JI8J 3MCMA 1R31A 2VXKA 2ZZNA 1LXJA 5HMXA 3DRSA 4X65F 2CPHA 1VBZA 1PAUB 5E3CA 1VRTA 4WU3A 4M6HA 2P6FA 1KUVA 2CJAA 1NHVA 4DL0C 2KXNB 4JI2F 1XRYA 1LOUA 1F9HA 1MK4A 5E96A 1F9EB 4M1KA 2HRYA 4RW8A 1R3NA 3TO8A 2Z2ZA 2BQUA 2XSFA 1NU4A 2C3MA 3HZEA 4P7TA 3B8GA 2OTJS 2RKIA 3S7RA 4IDKA 3SCJE 3FVYA 3CWJA 2R2UA 5EX3A 1S1WB 2LU2A 4CTAB 1Z2ZA 1B0TA 1CJVA 3RRGA 4JI4F 2JEJA 4PWDB 4LFBF 3TWZA 1ZH5A 2D3ZA 4E2AA 3NH5A 2EO8A 1FWKA 3B4DA 4NZ6A 2IBOA 4A2ZA 4K5SA 4LUBA 3GJTB 1YJWS 4UF4A 4U95A 1J5OB 3QRRA 3DLLQ 3J81j 3Q89A 2DD8S 4KVME 2MKSA 3LP0B 3AOAA 2CY2A 3A13A 5HMZA 1KONA 2A0FB 2KRBA 1LFWA 3D68A 3FIXA 2ALYB 1HQUA 3H5UA 4C8YA 3MHYA 1FE0A 4LREA 2IVFB 1S7LA 3H42A 5DQGA 3NKYA 5H84A 2QGFB 4PPZA 3MD1A 5LMUF 2F4VJ 4LFCF 2WUUA 4F36A 4NJQA 2OZHA 2UXCF 1VLOA 1SQHA 1SJ4P 3IG1A 4HDGA 1RT2A 2K2PA 3T6BA 4LF4J 5HVGA 5IC6B 2KT3A 5LRGA 1M90T 4DFJA 1X4AA 3KQXA 3BQ0A 2B5GB 5GMKa 2KFNA 1JIHA 1R8CA 2P9EA 3DRYA 4JYAJ 4HH1A 2OGUA 3KLIA 2UVRA 1GMWA 5IC4B 3W1YC 3M9MB 1KVIA 5KFSA 4KPCA 4B5PA 1ZLHA 2W9AA 2ZFHA 1KEKA 4MFJA 2XNQA 2VODA 2VPYB 3KHHA 3WHIA 3T1HF 5C82A 1TZ0A 5JQ4A 4ZOSA 1L3KA 3KLEB 5DS7A 2GAGC 3HHLD 1N6QB 4ZX9A 1I12A 4RUBA 1SJ1A 2DR7A 3KMSA 1XR5A 2AJ1A 2MZJA 3FEZA 4UOCA 1HBMA 1UPMB 1L3VA 4MKBA 3CCQS 4PCQA 2GE3A 3WT4A 1R89A 2AKWB 1ZZFA 2VG6A 1NSAA 2LXUA 3QIPA 2BE2A 3S9NA 1ON0A 2GANA 3JSYA 3D0GE 1VQ7S 1B99A 2E9RX 2MYFA 1D8YA 4CLTA 1HI8A 4QC6A 2PIIA 3HHDA 2Y0SD 3FVLA 3JTNA 4JP8A 2XYGB 2BVZA 3CCVS 1HNWJ 4J90A 3SFGA 1AROP 1SXLA 4DV5F 3OVAA 4WP3A 2Q1LA 3I0SB 2AP6A 2ZBRA 4QB9A 2CRLA 5D8NA 4KC5A 2J8AA 1S1XB 3WIVA 1RA7A 1DRZA 2YKQA 1HIYA 1ACMB 1S97A 1P27B 2HNYA 2DGVA 1G7CB 4FXDA 4PXEA 4GVLA 2WK4A 3GFYA 4C4WA 4DX6A 2J6TA 4NA1A 2YKNA 2K06A 1WTFA 3MF5A 5KG0A 1FD8A 5H9EJ 3KTQA 5J2MB 1FVQA 2IRUA 3HFKA 3M8PA 2MKIA 4JI5F 8CPAA 4QIFA 2RVJA 4NGTA 3KOAA 5EGYA 2EWBA 3AAWB 2DNGA 4NYOA 3S6GA 2I9SA 3TQEA 2KKHA 1XF8A 3M6UA 4KVOE 2O67A 4MHYA 1Q7LA 2PJBA 1YIJS 5KT3A 5DLGA 3J7A1 4MHNA 4ICLA 1IKVA 3OTCA 1RHJB 3DRRB 4EGLA 2R7TA 4KSIA 3H5ZA 4DCJB 3M2VA 4RW6B 5GCNA 2L08A 2VFTA 1U0HB 3HULA 3LAMA 1FX4A 1UETA 4K4YA 3NGSA 4B17A 2MJNA 1XK8A 2DY9A 4ECSA 2V50A 1LFPA 4HACA 3PEIA 3VH9A 2DNRA 2E1MC 3FUYA 4CM0A 3CCJS 2DGWA 4RNOA 2XNRA 1VGYA 3ULHA 3PYFA 1JLQB 3HLUA 1YZ7A 3F0NA 3THTA 4OC2A 3JAMY 3F8KA 4PUOB 2V94A 1RT4B 3S6EA 1XIXA 1FF2A 4EVYA 3FBUA 4HH0A 4C8MA 2VV5A 2GIFA 4NCZA 5H9FJ 3T5KA 4QIVA 2VBQA 3NE7A 4FXVA 1TIQA 2EC2A 4ZVOB 2B7CB 5KG4A 1YLEA 3B3TA 4QR1A 2C2MB 1U24A 3L09A 1Q81T 3GIKA 2HNYB 5ETMA 2DT9A 3G6YA 2RC4A 2NSCA 4DUYF 5A6WA 1ZA1B 1REGX 3TJ9A 3MM8A 2IC3B 3TO7A 2KDOA 1DHMA 4H4MA 2YBVA 3V6DB 1H98A 1PBUA 3QT5A 3PZPA 1IBLF 4P52A 2Q66A 2PIYA 3MUTP 3AA9A 1X4DA 4XAKA 3CPXA 1FTCA 5B0BA 3GB0A 3RW6A 4B3OA 2B6AB 5A8KB 2I6WA 2KT5A 2FE7A 3AODA 3FKBA 2OMOA 5I3QA 4ILMA 2XTJP 3I82A 1AT1B 1KOHA 5DWNA 2EKYA 4OV1A 2Z4PA 3NBPA 1SVDA 4UEZA 2X7BA 4R87A 1HBUB 2AV5A 3M8QB 4L3KA 1UVKA 5J2NA 1XNQF 4C11B 4WIIA 3THPA 4I6WA 3V5RA 3S8SA 4FNHA 2DNYA 1BQXA 4F8RA 3SV3A 3E01A 3T1YF 3BEGB 3GV5B 2XZDB 4G3IA 4X4VA 3F41A 5DRKA 4CT8A 1S3ZA 3G86A 3EX7B 1KP6A 2N4CA 1NSQA 2L3MA 4LRAA 4CIOA 1Z8LA 2W8KA 2H65B 1RQ0A 3ZTQA 2DH8A 2NYQA 4WJBA 4M6IA 3MM6A 3W5ZA 4JI0J 3TT2A 2QL7B 3CXCR 2BCOA 5K5MA 1RB0A 4EFDA 2C3YA 3HI9A 5KT2A 2LU1A 1H2UX 3W62A 3T1AA 2UXBF 2F4FA 4WK3A 3IR6B 4ZPVR 3H7HB 3J7AN 2VFVA 1MU2A 2P2CB 3EXCX 1EP4A 2YQ0A 4Q0BB 1UJ6A 3PRDA 4IHMA 3DRPA 1CS4A 1BMQB 3HJFA 2P0WA 1H38A 1Q95G 1H2VZ 3MPYA 4F8ZA 1RT6B 4CYNA 3PR5B 1MMDA 2YWFA 2EFNA 3C15A 4F04B 2V4JB 2DYAA 2I3CA 4Y2KA 3W60A 4U9ZA 5G0RA 2A4NA 3V38A 3C19A 2GV1A 1TQLA 1BGXT 4FKXA 2BE7D 5DDPC 3MAAA 5DGAA 4OIDA 3GR1A 2JLEA 3I9V9 3RBEA 1BLUA 5GAEI 2F3JA 3RZAA 3M8YA 4DSKA 3BREA 4K5RA 5IT9Y 5JMNA 1OSCA 4PQUA 1KVKA 1GK8A 2WHOA 5J2PB 2ZDOA 1WOOA 2QT7A 2FVCA 1X12A 1SJQA 2EK8A 2Q4ZA 1ZAXA 3PIPQ 4ZHRA 3BGRA 1HWLA 3V81B 2CNMA 3M32B 1EAYC 2NYIA 4F7VA 4LVNP 5KFOA 3N4WA 4WF9Q 3R97A 3CF5Q 2HHXA 3PB9X 1NDCA 1PILA 4I2PB 1NJIT 3W64A 3OD2A 5KG1A 4K0KF 1C1BB 2YNDA 4OYZA 3ELHA 1X0PA 5GAHI 5HQMA 4RU2A 4K4XA 5KT7A 4PXBA 1L3UA 3IFEA 3M6WA 1RAAB 3GWCA 2VZZA 1NKBA 4J9SA 1U2RA 1N5YA 1QLNA 2W9BB 2ODFA 2NMTA 3ISXA 2RS2A 4C2MA 3MOZA 1ZM9A 2EW9A 3KL9A 1JXEA 3J7ZT 4OYOA 3NEKA 5CYJA 4A8WA 2IYIA 5BWAB 3OTEA 1AZSA 5LRJA 4IK2A 4AG9A 2W9CB 2JJ4D 4YB6A 4F26A 3T8WA 1JLBA 5BYSA 4LFCJ 4CNZA 4Q38A 1T9TA 3MAHA 1K0VA 1O51A 4WPAA 4PQAA 3UDLA 2EPIA 1R6YA 2GGPB 2Z11A 4HI1A 4NGQA 1NLKL 2YKPA 5C25A 2MZQA 1VC0A 1SQEA 3BYRA 4ZBGA 4NGMA 1ZM3A 5G21A 2LDYA 2C6GA 1OY6A 3D1QA 2Z10A 1S49A 2YNFA 3N28A 1AUSL 2J5AA 3SQGB 3RR8A 2B7BB 3OPKA 3K7RA 2WTFA 1Y7RA 3CJ4A 3UCUP 3W9HA 2PN6A 3U7JA 5AE1A 4WYWA 2A3JA 4MKAA 1FEHA 4ZHRB 3J7YI 4N8NA 4ZVEA 2LMIA 3U27A 3FBBA 4UZCA 3AD8C 4P75A 1RADB 2CJYB 1IB1E 3VWSA 1KHWA 3BN4A 4N76A 3BO3A 2PJ3A 4MTPA 1XNRJ 1TK8A 1FRHA 3FH4A 5KFGA 4R3LA 5KFDA 3I96A 2REFA 4LSNA 1WC5A 5JUMA 3LWUA 2FYXA 3RAQA 3L7OA 1SQFA 3DKDA 2UUCF 3K2YA 4NA2A 4KS9A 4XIUA 1N88A 1MW7A 2Q6BA 4LR9A 1RBAA 2ZD1B 2FHKA 2JEGA 2DRAA 1SQGA 3IU1A 1LWCB 3AQOA 1FDBA 3QJJA 4IG0B 3ZO7A 4KRWA 3LH2S 2CTBA 4DPWA 4IRCA 3JQJA 3ENVA 2LQ9A 4FYVB 2N4DA 1QAJA 1BWEA 5KG3A 4TLQA 3MUVP 4KH1B 3DOMA 1X0FA 1TR0A 3GSDA 2HFZA 2X3GA 1EIYB 3TVZA 4ZITA 4OYBA 1XBWA 4M5DA 5A2QU 2HLUA 2HHSA 3NS6A 1DTTB 2N7CA 1HYSB 2XY5A 3QT7A 3AFGA 3C6TB 4JXRA 4KTQA 1OQ6A 4L72B 4NZ7A 2OSRA 5KFAA 3OT9A 2PA3A 1WG4A 2XGPA 2DHHA 1FI4A 3KZWA 4NEXA 1S9GB 4EO6A 4CPAA 2YNFB 3BB5A 3TAMB 1YQEA 1ELOA 3K9TA 1Y00A 3T41A 4NYZA 5AT1B 1LWEA 2WSFC 2IC3A 2DEIA 1B3TA 1CBXA 3GYXB 3M30B 1IYKA 3HUVA 3RW7A 2O3DA 1RTIA 3CCMS 3PGPA 5IT0A 5D29A 4BINA 8RUCA 1NSKL 2AHOB 4C97A 2XMVA 4URSA 1G1XA 4IFYB 2OPSB 1BD6A 3L9ZA 3UI3A 1CPZA 3MMAB 5I3PA 3OXFA 4I6AA 1Z5RA 3H4BA 3W63A 3PYDA 5AE2A 4MJKA 4J9UE 3L4BC 4B3SF 4IQXA 2ZH5A 4O44A 1YKWA 5KFCA 3V4IB 1TL7A 3BBFA 4CLLA 4QYZJ 2E9TA 4ZVUB 1ZTTA 1N32F 3VV2B 1VJWA 4NASA 3R95A 1NPPA 2XC9A 1NK0A 4J3GA 5KFNA 1L0CA 3CJQA 3H40A 2RFHA 3JSBA 2FL4A 4KFBB 1WOSA 3SI1A 5T14A 3PX6A 5EWGA 1U49A 4C7HA 3GIRA 1C4CA 2BW7A 3P45B 4I64A 2RRAA 5AJ3F 3VAGA 1VQ9S 3BQ2A 4ZLJA 4M95A 2FJAB 3PJXA 2RS8A 2CQ4A 3BGRB 3FYNA 1SUQA 2IBKA 3WX8A 3QT6A 5J2Q