5I4NA

Crystal structure of the e596a v617f mutant jak2 pseudokinase domain bound to mg-atp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
284
structure length
275
Chain Sequence
FHKIRNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFAAASMMSKLSHKHLVLNYGVCFCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAAAMHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVPPECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKAAELANLINNCMDYEPDHRPSFRAIIRDLNSLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Uncoupling JAK2 V617F activation from cytokine-induced signalling by modulation of JH2 alpha C helix.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
total genus 87
structure length 275
sequence length 284
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i4nA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i4nA01
5AV0A 4DITA 5J5SA 4BTFA 2PVYA 5IMXA 3FSFA 4E4NA 2ZB1A 4BVUA 4YP8A 4RZVA 4EHGA 3DNEA 5E90A 3RZFA 3EQGA 4C8BA 3AOXA 1H28A 4QTBA 5GZ8A 3NUUA 4C58A 2ZM4A 3V5JA 4FICA 4XEYA 4Q2AA 4TY1A 4M7IA 3UQCA 1WBPA 2BALA 4WSQA 3C4EA 3I1AA 5CEPA 2UW4A 1YOLA 5IA2A 5IEVA 4DEGA 3ZRLA 3QFVA 3RZBA 3TNWA 5J5TA 3BHTA 4FOCA 1PXNA 5BYYA 5EQYA 5IH6A 1VJYA 4FNZA 2V62A 4JX3A 4CFFA 4FNWA 1VR2A 4R3RA 4CQGA 3IW4A 4LL0A 5D7AA 4W9XA 2ZYBA 5EDQA 3D2KA 1R0EA 5CY3A 5CZIA 3UIBA 3F2RA 4CG9A 4OTQA 2A0CX 3GU4A 3GFEA 3VO3A 2VTSA 3PVGA 4KIQA 4JVGA 5JQ5A 2Z7SA 3WZUA 2VTIA 5BVOA 2CCIA 5KMJA 1J7IA 5DVRA 4FTMA 2IZUA 4CVAA 3ZUVA 1YI6A 4IQ6A 4TPTA 3AC5A 1E9HA 3KXXA 4H39A 5CWZA 4ZXTA 1CMKE 5EI8A 5HCYA 3CE3A 2XIZA 2X7FA 4K8AA 2H6DA 5FGKA 3DS6A 4JDHA 4BDHA 4QMQA 2UW9A 1UKHA 3LQ5A 4O21A 3TACA 2ETKA 5J79A 2GNFA 2OFUA 4L53A 3ANQA 2CKOA 1PXPA 3DV3A 4NK9A 3WZEA 5BQ0A 4BYIA 3K3IA 2JEDA 4GL9A 3QAME 1PMNA 2PE0A 2XCHA 3DT1A 4BCIA 2PMOX 2XB7A 4AW5A 5CENA 3IOKA 3DQWA 3LFNA 3Q4UA 4JIAA 2QOFA 5LMKC 3MFTA 4LV5A 5L6PA 1SVEA 3FJQE 1SNUA 2GS6A 3N4VA 3W1FA 1JSUA 3UOLA 1YXSA 1H25A 1ZLTA 2WXVA 3IW7A 4YJRA 5L4QA 2WNTA 5A6NA 1DM2A 5H9BA 4RIYB 1OUKA 2Z2WA 4FK3A 3CY3A 3V01A 1CTPE 4IVAA 5KMMA 4WIHA 4O22A 4MQ2A 5AX3A 5F9EA 3UIXA 1E1XA 1TVOA 1PXJA 1QPDA 3IGGA 2ZDTA 4GFGA 3CGFA 3I60A 4DGOA 4F9BA 2ITQA 4O2ZA 2C0TA 4XRLA 4ANMA 3RINA 4EBVA 2WFYA 2WQBA 3BCEA 4YLJA 3SXRA 5ACKA 2ITVA 3TKUA 4D55A 3UP2A 3D5UA 3FMHA 3DBFA 5CEIA 3CQEA 3KCFA 4CTBA 4LUEA 4RJ5A 4ALVA 5J7HA 2YHVA 3QQGA 3VAPA 4BKYA 4FZ7A 4F6WA 5CAOA 3DZOA 1OMWA 1UNHA 4A9SA 3UP7A 2WMUA 4MNEB 3KRWA 4C3FA 3TV7A 5EHLA 1OPJA 1MRYA 3IS5A 2C5XA 5J1VA 5GIPE 3FUPA 4QMWA 4C2VA 3OCBA 4I6BA 3SXSA 3D94A 3ZTXA 3VULA 3EQHA 3VRYA 3QA8A 2YLFA 4CKRA 3I4BA 2WQNA 3VN9A 1H27A 3WZJA 4BCOA 4Z55A 3NAXA 2F57A 3E7VA 5HBHA 3UVQA 4EH3A 1LUFA 5BUJA 2HZNA 1OGUA 4K77A 1OIRA 1H0VA 4GFMA 4KKHA 2BDWA 5JK3A 3QRIA 4FZAB 1OPLA 5CI7A 3ALNA 3GQIA 1JWHA 4MF1A 4RG0A 2CNVA 4IE9A 3G6HA 4O6EA 5CASA 1Y57A 4ACCA 3OVVA 5EYDA 4O7YA 3GT8A 3HP5A 4WNPA 4ZK5A 4LQMA 4PY1A 5K5XA 2PZPA 2WU6A 1XWSA 2PYWA 1XBBA 4IANA 2PULA 3V8WA 4O7ZA 3FMDA 3AD5A 2UVYA 4WD5A 3NIZA 4IEBA 1ZYLA 4PMMA 3GU6A 1NY3A 2R3LA 2QOKA 5HLWA 1WBTA 3A4OX 5KUPA 4BZDA 1F3MC 4XBRA 5ANDA 5A4EA 4FEXA 3QHRA 1MRVA 4L68A 4XV2A 3TNIA 4LL5A 5DT4A 3UBDA 3PJ3A 2R3RA 2R3KA 4NWMA 4BC6A 4CLJA 1REJA 1WVYA 1UNGA 3EFJA 3QCSA 2UZWE 3MI9A 5HIBA 4Q9ZA 1YHVA 3QQHA 4TW9A 3UPXA 1ZRZA 4R3CA 2X81A 4NTSA 4BL1A 4FG8A 4FKQA 2XK9A 5AR2A 4O7NA 5IQGA 2C6OA 5AP5A 5IPJA 3FLSA 4ZTNA 2CLQA 4CTCA 2W5BA 2JKQA 2WMBA 4EJ7A 4WNOA 2DWBA 1UA2A 4XG4A 4FT9A 4TL0A 3S1HA 2J51A 2X7GA 3A62A 2XIKA 2HENA 3FI4A 3G0FA 3R8LA 4TWNA 3WILA 4E6AA 4DG2E 3U6JA 4FEWA 2W1IA 2WZJA 1M2PA 5I4NA 1IAJA 5AFVA 2R3GA 4QP2A 3VQHA 2F4JA 5E9EA 4CCUA 4F9AA 4N57A 3KK8A 5CANA 4A9YA 1XO2B 4JBVA 3FMJA 5EM6A 2EWAA 1K3AA 3AC8A 1W7HA 5AUXA 5TE0A 2FH9A 5CS6A 1OL1A 3MJ1A 3LLAA 3ZYAA 2J5FA 1BL7A 3ZDIA 5M4CA 2QCSA 4IX5A 2Y6MA 3AMYA 4C0TA 5EQEA 3BHYA 4DEEA 2OJFE 2HAKA 4V05A 2OXXA 2PVKA 5AP2A 3FXWA 1H0WA 3R28A 4BZOA 3FZSA 4EOQA 5AX9A 4DH7A 5FLFA 2WMTA 4ANOA 2W1DA 2H96A 3P1AA 4ACGA 2Q0NA 1CM8A 3GEQA 4FIFA 3COKA 1IASA 2VO0A 3NAYA 3D5XA 3RP9A 3VUDA 1K2PA 3B8QA 3VUKA 1WBSA 4O1PA 4Y8DA 4AX8A 3HV3A 2OGVA 3G0EA 3P9JA 4MD7E 3UZTA 4P4CA 3OXTA 5IA0A 1OIQA 1KWPA 1CKJA 4LG4A 5J9ZA 5B2LA 1OL6A 4I5PA 2YIWA 5DIAA 5I5ZA 4J71A 3MN3A 4DYMA 1BKXA 1T46A 2VU3A 3UNJA 2WIPA 2XYNA 4NW5A 4FKOA 2VTHA 4B9DA 4GU9A 3D2IA 5M06A 3HMPA 3HV5A 3OBJA 4YNEA 4ZP5A 2ZB0A 2B52A 2OW3A 3QWKA 4LYNA 2ITYA 4KIKB 3E88A 1MQBA 3EL7A 4CLIA 4EWHA 3NYOA 1FMOE 5AEPA 3D4QA 4EKLA 4O6LA 2A4LA 2GQSA 4I0TA 3AGLA 3CP9A 4XNEA 1XH8A 4EKKA 2X8EA 2IJMA 3BLRA 5L2QA 3QU0A 2YZAA 2OH0E 3DXNA 1TQMA 2YAKA 2Z7RA 2JGZA 2XRUA 2BR1A 2VX3A 3FHIA 5IEXA 2GDOA 3FPQA 4EONA 4RPVA 3TNPC 5L6WL 2H8HA 5EOBA 4MNEA 3Q96A 4BI1A 3BBTB 4ZSLA 4CYIA 3IO7A 2UZEA 4C61A 4FKSA 5HE2A 3VBVA 5JFWA 4U80A 4K9YA 3QTZA 3R71A 5J9YA 2C1BA 3PVBA 4GYGA 3IECA 5ANOA 2WOUA 2VWBA 2BZIB 3NYVA 5D12A 4AS0A 3CY2A 3VQUA 3EB0A 4IZ5A 2QR8A 3NRMA 1GIHA 5BMMA 1OBGA 4KBAA 5H2UA 2ETRA 3WZKA 5AAGA 4YZMA 4CKIA 4C57A 3PSCA 2UVXA 4IM3A 5HIDA 3PG3A 1APME 2BIYA 2PHKA 3V04A 4CT1A 5HTBA 4QD6A 3LFQA 4C36A 1GNGA 4F09A 4MAOA 4MD8E 3SD0A 4QTEA 4QMSA 3R7GA 3NUAA 4IFGA 2BRHA 3CD3A 5C4KA 3DBQA 4F6SA 3DFAA 4AE6A 4G3EA 3UZPA 5DWRA 2UZDA 4DTKA 5KBQA 3MVHA 3MW1A 5HHWA 3F82A 3QALE 5HD7A 4QPSA 4O7SA 2P2IA 2Y9QA 3H4JA 2YIQA 3RHXA 4AP7A 4CMTA 3NR9A 5JEBA 4NCTA 5ACBC 2B55A 3W32A 3P23A 3K54A 4AZVA 3IK3A 3UG2A 2W17A 3BQCA 2GNJA 4B7TA 3OBGA 4CXAA 3R21A 3H3CA 4JDJA 3W18A 3WOWA 5IQEA 4LMNA 2YM8A 3GGFA 4TYGA 3NNUA 3LCDA 4L3LA 4XYFA 4RT7A 2ONLA 2QO2A 4D1SA 4ZY4A 3H0ZA 3L9MA 2XYUA 3H10A 4O2PA 4NIFB 4ZZMA 3BYMA 2RF9A 4PDSA 2EB2A 3R7OA 3DTWA 3CPBA 3MJ2A 3S2PA 4FI1A 2NNWB 3P7BA 5EQPA 5M4IA 3S0OA 3MVJA 3VS7A 3EH9A 4GK4A 3CKWA 4A9TA 4GJ2A 4M12A 4QMMA 2G2HA 2BRMA 3EQFA 2PU8A 2YABA 2XK7A 2VX0A 4KRCA 4DFZE 2LGCA 1ZWSA 2W5AA 2YA9A 5A4CA 2C68A 5C01A 5AUTA 3FI8A 3VUHA 5GIOE 4R8QA 3RM7A 4EC8A 2OF2A 3F9NA 2R2PA 4OBPA 5HCZA 2PMLX 4R78A 3ZCLA 1U46A 5FEEA 3CLYA 4OBOA 3E8NA 4D2TA 1YXXA 3HV4A 4RIYA 4ZTQA 4GCJA 4YGAA 4FK6A 5FP5A 2WD1A 3OCGA 3PRIA 2VWUA 2X7OA 3Q52A 4GRBA 4QMVA 3W55A 2ZM3A 4OBQA 5IH5A 3RAHA 3DKGA 3EFLA 3CKXA 4BRXA 4LV8A 5I9YA 4HCUA 2J90A 4Q5EA 4RFYA 3EN6A 3F66A 3LCTA 5BVKA 4FEUA 3TG1A 3UGCA 3V3VA 4B6LA 5M09A 2ZMDA 3DK6A 4RA5A 5L3AA 3JVRA 4LRJA 4AT4A 3D83A 4OTGA 2JDSA 3FQEA 1ZAOA 2X2MA 5EDPA 5HE1A 3PYYA 1P2AA 4D28A 2IZRA 2XA4A 3VHKA 3EQPA 3GC7A 4HGSA 2GPHA 2F9GA 4IWOA 3WBLA 2PWLA 2GHGA 5LCKA 2YACA 2OIQA 2IW9A 3MPMA 1HCLA 1BX6A 4UB7A 4XJ0A 4BBMA 2Y6OA 2ZM1A 4N6YA 2BAQA 4O0XA 3UYSA 4APPA 3R73A 1Q3DA 2E9UA 3DAKA 3D15A 2XMYA 1OKYA 1GJOA 2C6TA 2PVRA 2QO7A 2WIHA 3MV5A 5FTOA 4ALWA 4R7BA 3FBVA 4HVIA 5E4HA 1EH4A 3REPA 4IBMA 1GOLA 2QHNA 2HY0A 4KRDA 4BIDA 3JXWA 2QOQA 3PRFA 3R2YA 2UVZA 3M11A 4IZAA 3L9LA 3UJGA 2CDZA 4D0WA 3G6GA 3HA8A 4HNIA 3DKCA 5FUTA 1YKRA 3BE2A 3HP2A 5LVLA 5AP0A 1FVVA 1M17A 2JFMA 4JNWA 4QTAA 5EHOA 3WZDA 2A1AB 1KOBA 3HMOA 4EQUA 3TDWA 4E20A 4E5WA 4BTKA 5L2SA 2PL0A 2V55A 1P5EA 3HEGA 4L46A 1SM2A 5EDRA 3MTLA 3PA3A 4FTJA 2ZOQA 1X8BA 4HPTE 3EYHA 4ZTHA 3OZ6A 2BIKB 4FL1A 1JAMA 3CD8A 3HECA 4TYEA 4U7ZA 4FC0A 3NMUF 2VO7A 2BFXA 5AM7A 3SRVB 4RIXB 2BVAA 3AT4A 3UTOA 4D2SA 1KV2A 2QG5A 4HVSA 5C1QB 3CGOA 3HX4A 4WO5A 3ZFYA 3BLHA 5KNJA 3QUDA 4G5PA 2J0IA 2IN6A 3FLZA 4D2RA 4RIWA 3F2NA 3ORTA 2C6KA 5L8KA 4K11A 4YC8A 3G9LX 3QGWA 1RE8A 2B54A 1J1CA 2EUFB 5EW9A 5I9VA 3D14A 2WQMA 4B8MA 4YC6A 4BYJA 3FZRA 3LFDA 2J2IB 5E8YA 4F0IA 5HO7A 3W2QA 4ITIA 4IW0A 1DI9A 3I0QA 3QZIA 3O8PA 4H1JA 4L42A 5IA5A 4C7TA 3H0YA 5F95A 4U9AA 4QP7A 2IW6A 1U4DA 2AUHA 4L8MA 3VHEA 4CFVA 2R3FA 3VBWA 3LJ1A 4FSWA 4PX6A 3KMMA 1YHWA 4WKQA 4O86A 4J99A 4UYNA 1RDQE 1H1PA 4ENXA 3NCZA 4F7NA 3FZOA 4L6QA 4MBJA 2R3PA 3LJ0A 4JQ8A 3M42A 4OAVB 2PZ5A 4KB8A 4PL4A 4AUAA 3FPMA 3OHTA 2WQOA 3KRLA 3OROA 4F63A 2HXLA 3MA6A 5TF9A 3GC0A 4AZFA 4BN1A 4LOOA 4HOKA 5KZ0A 3DKFA 4QPMA 3BX5A 4GK2A 1OI9A 2XK6A 3WIKA 4ENYA 2QOHA 1VYWA 3PXZA 1TKIA 1BYGA 4AN2A 5EYCA 4FIGA 3ODZX 2W1CA 2XS0A 4EBWA 1ZYDA 4G9RA 5KMNA 4YTFA 4ZTSA 3R8MA 2VTQA 4NL0A 3QGYA 3QYZA 4FV2A 5AV2A 3ZDUA 3KXZA 1R1WA 4EH4A 4EK8A 2GTMA 3ZRMA 2ITOA 3R00A 1RW8A 4MK0A 4EOJA 3RK9A 3V6RA 2OZAB 4PUZA 3PJ8A 4EK5A 2OU7A 2VX1A 3LJ2A 4UMTA 4XG2A 2YLEA 3RMFA 4CZYB 2CNQA 2R3OA 3LFEA 2F7ZE 3F5UA 3OXZA 5DMZA 5EK7A 4QMYA 2OF4A 2W5HA 3UE4A 1JSVA 3VS3A 5CF8A 4YNOA 2OJJA 3OOMA 4DEHA 4RWKA 2UUEA 5EM8A 4PTGA 3Q2MA 3CS9A 4FEVA 2VO3A 3KVWA 5JFVA 4AZEA 2IWIA 5FDXA 4ZY6A 3NUPA 4E1ZA 5CEMA 3ZBFA 4CNHA 3PXKA 3WYYA 2W4OA 2AC3A 4USEA 4IDVA 3BYSA 3WF7A 5L2TA 3OTVA 4BHZA 4CFWA 2REIA 5AP6A 4KABA 2W1ZA 4FIIA 5HLPA 3ROYA 1G3NA 3UYTA 4FVPA 3AC1A 3V5QA 3ZC6A 5DGZA 2IVTA 4I20A 1UU9A 3D5VA 4U97A 5GZAA 4CG8A 2GCDA 5CNNA 3HA6A 3MH2A 5A3XA 4L45A 1H24A 3HUCA 5KBRA 5LQFA 5IDPA 3R9HA 1GY3A 2VTNA 4M14A 4ACMA 3L1SA 1R39A 4CZUA 1KOAA 1LPUA 1Q8WA 4AA4A 4FV3A 3QC9A 4O0WA 3E8CA 4D4RA 2I0HA 1Q4LA 5JGDA 3SVVA 4QQJA 1L8TA 5AV3A 3SDJA 1H08A 5FBOA 5AWMA 4OTIA 4EUUA 3BBWA 2BPMA 4AQCA 3UZRA 2PUUA 5JMSA 1T45A 4XG8A 3UC4A 3LFBA 2BDFA 2OO8X 1Q8UA 3RPVA 2QD9A 3TJDA 4UMRA 1WAKA 3VBQA 1ZOGA 3F69A 3MY1A 4S2ZA 4RIOA 3ZO3A 3N4TA 3WF6A 3MFRA 2WO6A 3F3UA 4FSTA 4XH6A 5B7VA 4WOVA 1QL6A 2YCQA 2YITA 4JX7A 4XG3A 2EU9A 2GSFA 2QOIA 5I9ZA 2X0GA 2W99B 4KINA 4PMSA 4YJVA 2YN8A 4AF3A 1ZMUA 2UZTA 3PPJA 4K1BA 4ORKA 3DBDA 2QKWB 3A7HA 3UO4A 4IB0A 3M2WA 2BCJA 4XG9A 4ZJVA 3E92A 3PZEA 3RAWA 3CIKA 5HOAA 2CLXA 3HNGA 5DR6A 3VBXA 4UBAA 3PSDA 5BYZA 2Z8CA 3AT2A 3BGZA 4AZWA 3Q9YA 1YVJA 5AP1A 3U8WA 4C4EA 1QMZA 4L00A 3I81A 3BHUA 2XJ0A 1V0PA 3G51A 5AP3A 5CI6A 3ENHA 2Y7JA 4U42A 1I44A 3FQHA 3NWWA 4BKJA 1JOWB 4AOTA 1P14A 3CSVA 2O64A 3MWUA 3PA5A 4RJ8A 4UZHA 4DBNA 4HGLA 2YAAA 4QMPA 4CV8A 1M52A 3HV6A 4KIPA 2G9XA 4YSMA 1TQPA 4ZZNA 4CKJA 3SW7A 4GJ3A 5BNJA 4GYIA 2X8IA 4RVKA 2WMQA 4E3CA 2OJIA 3D7TB 3O23A 4NW6A 5A14A 3L9PA 2PZIA 3QRTA 4GV1A 4KBKA 5JH6A 2JDRA 2ZV2A 3AC3A 5ETAA 4D5HA 4RA4A 4ANSA 5BMSA 3HVCA 3E93A 1XH5A 3LVPA 2I7QA 4DEDA 3NSZA 4FNYA 4M69A 1XH7A 2GS2A 1Z9XA 1GZKA 1H8FA 5T3QA 4A9UA 2JBPA 3UOHA 2VWXA 2XK4A 4JL9A 4RQKA 4PMTA 3TWJA 4BDAA 3U6HA 1JPAA 3HKOA 5C9CA 4EORA 3DCVA 3DQXA 3PE1A 4JAIA 2PZYA 3W8QA 2YZLA 4KIKA 3KCKA 4OTHA 4PMPA 1FVTA 2GMXA 4NSTA 5AUWA 3ZXZA 3ZO1A 4YU2A 3ZLWA 4JLCA 2PY3A 3R6XA 4O84A 4DH3A 3SLSA 4J52A 4YO6A 3RM6A 3I6WA 2WGJA 5HVJA 5C03A 1OKZA 1QCFA 4D0XA 3JUHA 3BEAA 5LXMA 1PKDA 1G8AA 4EHVA 5J95A 3DXPA 2A19B 5HU9A 4GUBA 1G5SA 1M14A 2FSTX 5KHWA 3PG1A 5JKGA 4PP9A 4BFMA 4C37A 4BGHA 1M7QA 5DN3A 4EYJA 1PXKA 3KL8A 3RPOA 4MD9E 3RWPA 3VS4A 3UO6A 4YUQA 2UW7A 4YO4A 4BDEA 4YLKA 4U0IA 4U5JA 4FKTA 5JRSA 5J1WA 3B2WA 3R8VA 2R64A 3KF4A 4M8TA 4O0YA 2QODA 5EM7A 4WNMA 4CFXA 4A06A 4BI2A 4QMXA 3KXMA 4PL5A 3EN9A 5AA8A 3PIZA 2W4JA 5IQAA 3R7IA 3CXWA 4TWOA 4FA2A 3A99A 3VNTA 4BI0A 3FZPA 4MYGA 4JDIA 3QZGA 4E6DA 5K9IA 3QWJA 3ZSHA 2GQRA 4X6QC 4L3JA 2X6EA 4CMOA 5EW3A 4J8NA 3OW3A 3UNZA 4ACDA 4PNIA 5C8NA 2CNUA 2WMWA 4DG3E 3O0GA 4QMZA 1JNKA 2WTVA 1IEPA 1S9IA 1M2QA 5TR6A 2BFYA 3VW6A 2WKMA 3ZFXA 4YJOA 3R2BA 2WMVA 1OBDA 5M56A 5A9UA 4KA3A 5BVFA 3QTXA 3QCYA 2HOGA 1BI7A 4H3QA 4KSPA 2B9JA 3CTHA 4G2FA 4IX6A 1J91A 3BRBA 2E9PA 4IMYA 4EC9A 4IWDA 1GIJA 5HCXA 4DTBA 5BYLA 3TTJA 3ULIA 5HTCA 1ERKA 1OECA 5HG8A 1AQ1A 4TN6A 4AT5A 4QMUA 1YXVA 2B1PA 2R0IA 4RJ4A 3PJ2A 3R1YA 3QCQA 3D7ZA 3LXLA 4NUSA 5LVNA 3TZ7A 4HYUA 4PF4A 2QLQA 4FX3A 4DH8A 3C4FA 3QD0A 5CU2A 4DH1A 4FVRA 4W9WA 5DT0A 4RMZA 3II5A 4YHTA 1O9UA 4JBOA 3O8UA 3U54A 4AOJA 3DAEA 1J7UA 3QA0A 3U9CA 2IZSA 3F5XA 2UZOA 2WTWA 3AQVA 2RFEA 5CSXA 4UXQA 3HRBA 4FIHA 4BDKA 4DC2A 5IKWA 3VWAA 5HKMA 4J95A 5AV4A 3FMEA 4QO9A 3NVKI 4UMUA 3DB8A 1OIYA 3QKKA 3DTCA 4ASZA 2F2CB 4XG6A 3A7FA 1F5QA 4GG7A 4HVDA 2VTOA 4DG0E 1Q61A 3BU6A 1H00A 4IVDA 4FKWA 4EEVA 3QHWA 1Y91A 4TT7A 4L43A 2BKKA 4GIHA 5EYKA 3THBA 2ZV8A 4LM5A 2YJSA 4C3PA 1Q41A 5IDNA 1JBPE 3S3IA 4CD0A 3QXOA 4K18A 3KKVA 3AC4A 3Q6WA 4JBPA 4ZJJA 4EHEA 5AADA 2I0YA 3DXQA 3FL5A 5FD2A 2YDIA 5CEKA 3F5GA 1OL5A 1OKWA 4AA0A 4FTNA 4ERKA 4CSVA 5CF4A 5DEWA 3GNIB 3F3TA 3GCPA 2XNPA 4I0SA 4BBFA 4E6QA 5GINE 2ETMA 5KMOA 1JLUE 4UMQA 4EOPA 5AM6A 4ASEA 4U43A 5HVKA 3AD4A 3LFFA 5ANEA 5EFQA 2YJRA 3NZ0A 3F7ZA 4JIKA 4J96A 4Y95A 4E5AX 4D9TA 3EQBA 4G17A 1DI8A 2VAGA 5AAEA 4C4GA 1NVRA 3P78A 1PKGA 5CT7A 3BV2A 2NO3A 3KULA 5DA3A 5E1EA 3TTIA 4ZMEA 3AC2A 2R3JA 4RX5A 2UW5A 3W2PA 4ZTMA 2W7XA 2ZV7A 4FKUA 2ITTA 4WT6A 3MESA 2C5NA 2HW6A 3PXFA 4W4XA 1TQIA 2HELA 3PY0A 4V0GA 1URCA 3GFWA 3ANRA 5EOLA 3ZZEA 3IG7A 4HZSA 1WBVA 1ZYSA 3QKLA 2XKEA 2VWZA 5CF5A 5IA1A 3FKLA 1PMEA 1PXIA 4TZRA 5E92A 4EWQA 4FUXA 2FGIA 4XCUA 3O7LD 3SV0A 3MDYA 4WG4A 3BU5A 1UVRA 3COHA 4HYHA 4IWQA 4RC3A 4XUFA 5ETFA 3R83A 2QOOA 3VUMA 4YZBA 4F9CA 3FY2A 4FTQA 2XNNA 4F64A 1DS5A 4ARKA 3ORPA 1MQ4A 4R1YA 4E26A 5IUIA 2C6EA 3EOCA 5ANIA 1XJDA 1WBOA 3K5VA 4NEUA 5HU3A 3QRJA 2OSCA 3EL8A 3TZMA 4I23A 4RFZA 3UOKA 3C5UA 2NRUA 2CJMA 2YISA 4MHAA 2WTIA 2R3MA 3KRXA 4QQ5A 3EMGA 3SGCA 3KN5A 4XLVA 1J1BA 2X9FA 5AMNA 5M51A 4A4LA 2QOLA 2XVDA 4ZS4A 3ORZA 3ORMA 5E91A 5H3QA 2OI4X 4HNFA 4HVGA 2J9MA 2P0CA 2IVVA 5CU0A 2DUVA 3C1XA 4USDA 3OCSA 3HDMA 5GJFA 4KKEA 4QTDA 5IQIA 4A07A 2FSLX 2VNWA 2W9FB 3PSBA 3E62A 4LOQA 4P2KA 4EJNA 5HE0A 2P33A 3JVSA 3GBZA 4NZWB 4FV6A 1XBAA 4J7BA 3L9NA 5D1JA 3P08A 5A4TA 5LJJA 5DPVA 1WMKA 4YR8A 2RGPA 3F2AA 4QYGA 4MBLA 2RFSA 1Q97A 2RFNA 5FWKK 3RHKA 2JKMA 1SZMA 1FGIA 4KAOA 2E2BA 3QQJA 5FQDC 5FXRA 5M55A 1YI4A 2WTDA 3ACJA 4DFXE 2XCKA 3PJCA 3LXKA 2WHBA 4FGRA 2XP2A 2B0QA 4FYOA 4C2WA 3JY0A 3LAUA 4RQVA 3QRKA 4W4YA 3OCTA 2XBAA 5CSHA 4HZRA 4IC8A 4AN9A 5IEYA 3IDPA 2YIRA 1FBNA 5E8VA 3PXYA 3LW0A 2WEVA 3NLBA 4FSYA 4R7HA 4ZSEA 4CZTA 4M69B 4BDDA 5LOHA 4EK6A 3DPKA 3UQGA 4QPAA 4I41A 5EW8A 5IH4A 1BLXA 4MX9A 4AA5A 5LMKA 3PZHA 4I4FA 1YDRE 5IQHA 3RNYA 2QQ7A 5M07A 4ZLOA 4X3FB 4RBLA 4FKJA 3F3VA 5C4LA 3MS9A 4J1RA 4EH5A 4DA5A 4BWXA 2H9VA 2XF0A 2V7OA 3OFMA 3UMWA 3RNIA 4I21A 2CGWA 4IHPA 5IZFA 4BCNA 2VTJA 4X21A 4O7TA 3KC3A 3RJCA 2JBOA 2O2UA 2WPAA 4UXLA 4GH2A 4FKIA 5D41A 4A7CA 4FT7A 2VO6A 4ZSAA 3O2MA 2DYLA 2X9EA 3RPSA 4ZIMA 3A61A 5KCVA 4CMUA 4U81A 4HGEA 3O7LB 2R3QA 3KVXA 4BGQA 4W4VA 1A48A 1ND4A 4WRGA 1PYEA 4D2PA 4XG7A 4DGLC 3R1QA 5HI2A 3A4PA 3FL4A 3RK5A 2CCHA 4R3PA 3VF9A 4GIIA 2VTRA 4XOYA 5C26A 2QONA 1XR1A 5HNIX 4GW8A 4O0TA 3QYWA 2QKRA 4QQTA 4HYSA 2UW8A 3LM5A 3QD4A 3ROCA 4R7IA 4S34A 4DFNA 4I93A 3EKNA 2OXDA 5CXHA 4F6UA 3QTQA 2JAVA 3MVLA 2JDTA 1AGWA 2WMAA 1Z5MA 5E8ZA 3HL7A 3BEGA 3NEWA 5HG7A 4Q5HA 1XHAA 4F9WA 4IVBA 4I6HA 3MH3A 3ORLA 1UV5A 1GZNA 5K0XA 1ZY4A 3EIDA 4EH2A 4NKAA 1BL6A 3RALA 1YDSE 3W2OA 4XP2A 3ZSGA 4GK3A 3M1SA 3MY0A 4MXYA 4D5KA 4U3ZA 2VTLA 5A4LA 3KA0A 5E8SA 3TXOA 3ZRKA 3QTSA 2C3KA 2P55A 2VGPA 5A46A 4KD1A 4QP1A 1FQ1B 4WNKA 2EXEA 2WTKB 3O51A 3EQIA 4C38A 3G15A 3Q4TA 5DHJA 4Y83A 3DA6A 1PY5A 4WG5A 5I9UA 4DFUA 2Z7LA 4G9CA 4JOAA 2W1EA 5CAPA 4TYIA 3FXZA 4AZTA 5D11A 5L8LA 3WE8A 4M0ZA 2QI8A 4CRLA 1YW2A 3ELJA 2VNYA 4YBJA 3AD6A 5DR9A 3PY3A 1JKTA 1U54A 2I0EA 2PSQA 4QOXA 4WUAA 4BICA 4KNBA 4JJRA 3ZLSA 4NM7A 5L2IA 2QNJA 3W2RA 4I3ZA 3TNHA 3NVMB 3U51A 1PXOA 4I4EA 2WEIA 2HWPA 4HYIA 4S32A 1BUHA 2E9OA 2PZRA 3CEKA 3GU5A 3JYAA 4TYHA 2GHLA 4FV4A 1NW1A 3TDVA 4E4LA 4IJPA 3ZLXA 4MNFA 4RC2A 4TTHB 4YJNA 4I5HA 2ESMA 3UO5A 4ASXA 4C62A 1YXUA 4U40A 5I3RA 2WQEA 2BTSA 2YCRA 1PXMA 5BVDA 4JQEA 5IMEA 4IVCA 5B2KA 1ZZLA 4IH8A 3VBYA 3VRZA 3DB6A 3UG1A 2OICA 3TI1A 5IG1A 4H1MA 3UVRA 4PDYA 3S95A 4BDGA 4Y46A 2RFDA 3TKHA 1XBCA 5J9LA 3SAYA 3EN7A 4BTJA 3SQQA 5DRDA 3R9DA 5C27A 3DFCB 4IADA 4N4SA 4YJQA 5C8KA 4FTCA 1OPKA 4C33A 2WU7A 4I1ZA 3GCQA 3MH0A 3OG7A 4Z7GA 4QNAA 4E73A 4MF0A 2XKFA 3JS2A 3LMIA 2B4SB 1A9UA 2C6DA 4W4WA 1MUOA 5FXQA 2UZLA 1I09A 3KFAA 4M68A 3T9IA 4DT9A 3TCPA 2YWVA 3VW8A 3VUIA 2BRBA 2R9SA 4TKSA 3E7OA 2VTTA 3FLQA 3RBWA 2YM4A 5AIKA 4H3BA 4ZS0A 4F70A 2PUPA 2VD5A 3C13A 5JN2A 3DOGA 3H9FA 3EKKA 5CSVA 2BUJA 4QP3A 3EN4A 2JD5A 2NPQA 4EH7A 3KRRA 2GNIA 3UMXA 3OY1A 3EWHA 1Q24A 3GXLA 4HGTA 4L7FA 1YWVA 4RWIA 3A7GA 3E63A 4KKGA 1UWJA 4O27B 2WAJA 5IF1A 2CN8A 3G90X 3GOKA 2OKRA 4QRCA 5IA3A 1Q3WA 2B9HA 3C51A 3OWKA 1OUYA 2RL5A 4AW2A 4YJTA 2P2HA 2UV2A 3EQDA 3VJNA 4ERWA 3NUNA 2R0UA 3ACKA 2DS1A 1YWRA 4UEUA 4I22A 5HICA 4DLIA 4XS2A 4C34A 4D1XA 3JY9A 4XV9A 1WVXA 4GEOA 4YURA 5E8WA 5HVYA 4WUNA 4KIOA 2PTKA 3T3UA 4FTIA 4GVJA 4UWYA 3R0TA 1LR4A 3R7YA 4ZTLA 1E1VA 3Q6UA 4AN3A 4YTCA 4XP0A 3A7IA 3NCGA 2W1HA 3Q9ZA 2WOTA 3MFUA 5AV1A 2FB8A 1H1WA 2KTYA 4AW1A 3FYJX 3PWYA 1Y6BA 1B38A 5GZ9A 4EHZA 5IISA 5B0XA 4BCQA 2PMIA 3C50A 3DNDA 3EHAA 3CCNA 4FSRA 1P4FA 4UV0A 5CZHA 4QMNA 3ZUUA 5IQFA 4X2GA 4OTFA 1Z57A 5AP4A 4ASDA 2B7AA 4YPSA 2C5OA 3QX2A 4RRVA 4F1MA 4P5ZA 3ORXA 3N9XA 1SNXA 2EXMA 1FGKA 4I5MA 5BVNA 5KKRC 4H58A 5H8BA 3V8SA 1Q5KA 4R5YA 3ZLYA 4S30A 3BPRA 4YSJA 4NYEA 4FSMA 2IW8A 3E64A 5DEYA 3TV6A 2XUUA 4AAAA 5CSPA 4U3YA 4JBQA 2VWWA 4ANNA 3MTFA 3O8TA 5KZIA 4EYMA 3ZEPA 1B39A 3L8SA 4FSUA 3LXNA 3L8PA 1UNLA 3Q04A 4IZYA 4BCMA 4EUTA 2BHEA 4QNYA 4XRJA 4GG5A 1GAGA 4QYFA 2BROA 2CKQA 2BZKB 2ZJWA 3NIEA 3IKAA 3QBNA 4G34A 4U8ZA 3O96A 3UC3A 2G01A 1OM1A 3OC1A 5DNRA 3KXGA 4BB4A 4WG3A 5CAQA 4I0RA 4BCPA 5ANGA 3DU8A 3I7BA 4D58A 2PE1A 4ZSJA 3TZ8A 1H26A 3VBTA 3GCUA 5B2MA 3CQWA 3TUCA 4H05A 5TKDA 1B6CB 3K2LA 5E8XA 4G1WA 4ID7A 3LCKA 4RJ6A 3W16A 3QCXA 3KU2A 2HW7A 2RKUA 3AG9A 3H9OA 3KGAA 3W10A 4AFJA 4BCGA 5CF6A 2GFSA 3QQLA 2R7IA 3BU3A 2XM8A 3HGKA 5JGAA 1PMUA 5M57A 5AUZA 3BYVA 4LMUA 4MVFA 2VTPA 2BZJA 4RFMA 4U6RA 3OW4A 4AOIA 2OLCA 2Y8OA 3CPCA 5JQ8A 2XM9A 4RZWA 4NFMA 3V5TA 1H01A 2V7AA 5HX6A 1ZMWA 4IIRA 3BI6A 4Y73A 4IAZA 4IACA 2PPQA 5FEDA 4D4SA 3Q9XA 2GU8A 4O1OA 4CYJA 2VTMA 4DFYA 3KULB 4BDBA 4DGMA 3N51A 2X39A 1L3RE 4CCBA 4EH6A 1OL7A 3C4CA 5FDPA 1ZYJA 3G2FA 4MH7A 5CVHA 4F99A 3UODA 2BKZA 2QU6A 3E3BX 4ACHA 3GCVA 4IAIA 2RSVA 3FMNA 4QYEA 3CJFA 3AGMA 4F1OA 3KXNA 4AGWA 5DLSA 4L52A 2HCKA 5CYIA 3AXWA 4FG7A 1J3HA 2B9FA 2J0MB 3KF7A 4NM3A 4V04A 2BMCA 3FV8A 3NNVA 4ZY5A 2VZ6A 3F3WA 3OP5A 2X2KA 3IQ7A 3P79A 3R22A 4G3GA 3TN8A 2XIRA 1NXKA 1Q8ZA 3BYUA 4MWHA 5CSWA 5JRQA 2FSMX 2XEZA 4AG8A 5KKRB 4MXZA 4O91A 5FBNC 4QYHA 1W98A 5D10A 2X1NA 4QP4A 4X2FA 1V0OA 4IB5A 2BRGA 4RSSA 4EK4A 5FTGA 3WF5A 3MY5A 4FSNA 3Q53A 1PF8A 2YM3A 3FYKX 2W0JA 1V1KA 3CQUA 3Q32A 2UZNA 4BR3A 1QPJA 3QTRA 3LMHA 3PUPA 3MPAA 3U55A 2XJ2A 1YDTE 3R63A 1HCKA 3R8PA 2W4KA 3MB6A 5EI2A 5M4FA 1HOWA 4KS8A 3W2CA 2R3HA 5IU2A 2V22A 4AFEA 4IAKA 3NYXA 5AR4A 5H8EA 4FTTA 4EH9A 3BQRA 4H3PA 2OJGA 2Y4PA 4AZSA 3G9NA 4ZAUA 2PK9A 2FO0A 3MYGA 1Y8YA 2O3PA 3ID6C 4BTMA 5EH0A 3ZOSA 5D9HA 1LEWA 2O0UA 4I6FA 3OT8A 4ZEGA 4GKIA 1JKLA 3PIYA 4I6QA 4D2VA 3PPZA 2FUMA 4EOSA 4B8LA 1MP8A 2XK3A 2JDVA 3ZU7A 4GT5A 4DEIA 4ZZOA 1ZARA 4DLJA 3ZEWA 3QUPA 4D2WA 5HQ0A 4RWLA 5CQUA 4O7RA 3BYOA 2A2AA 3E3PA 2J0LA 4G6NA 1Q8TA 2G2FA 1STCE 3TIYA 4BDCA 4BDFA 2R7BA 4DFLA 5AUUA 3C0GA 3QD2B 3CBLA 3OXIA 2ERZE 5HE3A 5I9WA 4NKSA 1ZOEA 4O0RA 1KE5A 3FLYA 4JAJA 2OH4A 3ORKA 5TT7A 4A4XA 4Z16A 2GHMA 2J6MA 1VEBA 1PHKA 2YCSA 2W06A 2PVHA 2B9IA 3QLGA 3LFCA 2FYSA 3HMNA 4JRVA 3ZZWA 5I9XA 1U54B 3ZO2A 2IO6A 3ATSA 2GS7A 3R8UA 4GMYA 3WE4A 2ZDUA 3QQFA 1PW2A 4NU1A 1GZOA 5AR3A 1UU3A 2YDJA 4DFBA 2O5KA 2OWBA 3HZTA 3F3ZA 3CR0A 4G6LA 3GQLA 2XIYA 4M84A 5JT2A 2C6MA 3KQ7A 4IZ7A 5AUYA 5LVPA 3GU8A 4FT3A 4IX4A 2Z60A 4KUJA 3IPHA 3V51A 2ITXA 3QXPA 5K3YA 4XV3A 1REKA 4MBIA 4OT5A 4AWIA 2YDKA 1OITA 4J97A 2B53A 3C4XA 5F1ZA 3T9TA 2PMNX 4DBXA 3KRJA 4I92A 3DJ7A 4FODA 5IUGA 4W8DA 2V0DA 3DZQA 3FLNC 4ONAA 4F7JA 5L6OA 5K4JA 2C6LA 1KE7A 2E9NA 4QMLA 4FTKA 5F4NA 3PJ1A 1SMHA 4XBUA 4F7SA 3Q5IA 4B4LA 2OIBA 3FMMA 1OB3A 3QF9A 5ANKA 1SVHA 3EFKA 5FRIA 4UMPA 3GC9A 4UX9A 2JITA 3GU7A 3EQRA 1KE9A 3PA4A 4U79A 5AR8A 2VWVA 1NVQA 4MEDA 4R6VA 2X6DA 5M4UA 5HEZA 4F4PA 4ITJA 5CU4A 1URWA 4WBBB 4PPCA 4TRLA 2DQ7X 4Y85A 4YC3A 5AP7A 1WCCA 3BGQA 4CQEA 4F08A 5M53A 2NRYA 4PTCA 3EJ1A 5DG5A 2O8YA 4LOPA 4RVLA 3GVUA 3EZVA 3Q60A 4AGCA 4Z7HA 3TEIA 1ZMVA 3NW7A 3C9WA 4AACA 4ZLYA 5CAUA 1H07A 2X4ZA 4HPUE 4BCJA 3BHVA 4FYNA 3QTUA 4L44A 1NT2A 2J0KA 3FKNA 4II5A 1YOJA 4O0SA 4X2NA 4E5BA 4G6OA 3LXPA 3NUYA 3OOGA 5JSMA 2W9ZB 3TNQB 5G6VA 3VS1A 4S31A 4BCFA 4QP8A 4O82A 1ZYCA 2YERA 3R04A 1UU8A 2OJ9A 2PVJA 3NNXA 4ZTRA 4WRSA 5FTQA 1DAYA 3OEZA 3P86A 2CGUA 2JKKA 4HCVA 4N70A 4C4HA 2HY81 3LZBA 4EZ5A 5KMKA 4PRJA 4FKLA 4U41A 2BILB 2QC6A 2J7TA 4ANBA 2VWIA 4MXAA 3O71A 3V5LA 4HVHA 4EOMA 4G5JA 2J50A 4RX9A 3OTUA 3R7EA 4E93A 4V0GB 2RG6A 3ALOA 2PVMA 4FTOA 2C4GA 4AT3A 1Q8YA 5AA9A 3V6SA 4JS8A 1QPEA 2UZVA 2XNBA 2E9VA 3PVUA 1ZOHA 3MA3A 3QD3A 3T8OA 3HMMA 4QP9A 4GVAA 4EH8A 3R9RA 3PIXA 1OIUA 1YQJA 2ERKA 4RIXA 2CGVA 3DY7A 4U45A 4F1TA 5KMLA 4JQ7A 3SG9A 3MIAA 4JI9A 4EQCA 1IA8A 3LM0A 3OMVA 5JFSA 2ITUA 4BF2A 3N4UA 3EN5A 4D9UA 1MRUA 3A7JA 1KE8A 2ITWA 5AR7A 3FI2A 3RCJA 3R02A 4HW7A 4FTLA 5GJGA 1CDKA 4K0YA 4IAAA 4DTAA 3KMWA 3A8WA 3PPKA 3B2TA 2WELA 4NH1A 4AE9A 3FMLA 1OZ1A 2HWOA 3KK9A 4I24A 4DH5A 4JG6A 4FG9A 5KO1A 2QHMA 2YM5A 2YIXA 4FT5A 3Q9WA 2C47A 4FZFB 4PWNA 4RVMA 1QPCA 3WI6A 4BCKA 4EZ7A 3TM0A 4J53A 3FDNA 2XKCA 2J5EA 2X4FA 4WSYA 5GJDA 3A2CA 4Z3VA 2QOBA 5KMIA 3P7AA 3ZO4A 3R30A 2LAVA 3R7VA 4CFUA 1Q62A 4FKGA 5AUVA 5JZJA 4RJ7A 3FHRA 3IW5A 1CSNA 3H30A 4OGRA 1YI3A 3ERKA 3F5PA 3OUNB 3QTWA 1Y6AA 3RPYA 4CT2A 2C5YA 4DGNA 3D7TA 3RTPA 5HZNA 4UALA 3BLQA 1JQHA 3QLFA 5C8MA 5IUHA 3PLAE 4GSBA 1XH4A 2YM6A 4W8EA 3V8TA 3UPZA 2C5VA 3SA0A 2BDJA 2C69A 4C59A 5DE2A 5EHYA 3ZUTA 2P4IA 2F7XE 1M7NA 2Z02A 4F0FA 3BKBA 3AT3A 5TO8A 5E1SA 3TJCA 4X0MA 4HJOA 4MKCA 4OW8A 4PL3A 1W84A 3BHHA 4IX3A 4JG7A 4M0YA 5M44A 4FSQA 4IM0A 3ITZA 2YCFA 3LCOA 2C6IA 2XEYA 5IQCA 1U59A 5EKOA 4KWPA 3OD6X 4RC4A 4ZJIA 2BAJA 3UDBA 5BX0A 2GNLA 2OIDA 4Y5HA 4WBOA 4MXOA 4C3RA 3MSSA 4XMOA 3GUBA 4M3QA 3UIMA 4F65A 2OXYA 3PXQA 4IB3A 3RAIA 3RGFA 4M67A 3F7WA 5EI6A 2CGXA 4BWKA 2Q0BA 5GNKA 3R01A 3I5NA 2OG8A 3BE9A 1WVWA 3D5WA 3PY1A 5DBXA 3SX9A 4C4FA 2JAMA 3W33A 4EQMA 1OKVA 3MH1A 4NM5A 4FGBA 2C0IA 4IDTA 4IC7A 3DLSA 2CN5A 1RQQA 2BZHB 3ORNA 3QUEA 1BI8A 4LFIA 3SOCA 2Z7QA 2J0JA 1IR3A 3LQ8A 3MB7A 4ALUA 5I0BA 5KX8A 5H8GA 4DAWA 1XKKA 4G3FA 5HO6A 5L8JA 5E7RA 4D4YA 2W96B 3LFAA 3MPTA 1O6LA 4M97A 5CU6A 3RKBA 3RWQA 2CKPA 4L9IA 2XJ1A 4OLIA 3FZ1A 4XP3A 1WFCA 4ZSGA 2Y4IC 2XH5A 2ZAZA 3PWDA 3ZM4A 3KREA 5J8IA 3WF9A 3KMUA 4QYYA 3DGKA 4CV9A 2GNGA 2FVDA 3OWJA 5CNOA 4FV0A 3GENA 3I7CA 1K9AA 3PFQA 3B8RA 4PDPA 5JFXA 1S9JA 1F0QA 4IAYA 4M66A 3NGAA 4YTHA 2PVLA 5FM3A 2O63A 5HG5A 2GFCA 3FE3A 4C4JA 5DYJA 4DEBA 1ZXEA 2JKOA 3P0MA 4YHJA 3TIZA 3BIZA 4UYAA 1UWHA 5ICPA 4A4OA 1UKIA 1OVEA 3BZ3A 3LLTA 3RAKA 2I40A 2R5TA 3TT0A 3R8ZA 5CEOA 4FF8A 3CTJA 3FMKA 3FZTA 1ZY5A 3HDNA 4OTRA 3VUTA 3GCSA 4G3CA 5DR2A 3DDPA 3ETAA 5AAFA 5LVOA 2ONLC 2HYYA 5BUIA 4NT4A 4J98A 2C3JA 3SOAA 3ZHPC 5J7BA 5BPYA 2CHLA 4MQ1A 5CT0A 2O65A 4EOKA 3K3JA 5A6OA 5HBJA 4CGAA 5DFPA 2I6LA 3H9RA 4Y5QA 4XX9A 4EZ3A 2UW0A 2X8DA 1KSWA 2WMXA 3R7UA 3U4WA 2NP8A 2CSNA 3ZONA 4XOZA 2ITNA 2F49A 4LGHA 2Y0AA 4U44A 4OAUC 4BY9E 2XK8A 1H1QA 2QURA 4DHFA 4AXAA 3KB7A 4GUEA 2I0VA 2XNEA 3LMGA 3QKMA 4DINA 4JDKA 5BVWA 3VC4A 4F0GA 2HZ0A 3COIA 4ZLZA 4WHZA 4C4IA 4NTTA 4CFNA 5DH3A 2WMSA 4PV0A 4MWIA 3G33A 3BELA 1ZZ2A 3A60A 5I3OA 5HX8A 4YJPA 4EL9A 2W05A 3NW5A 4FMQA 3DBCA 3PP1A 5IQBA 1IRKA 3MVMA 3PVWA 2F2UA 3QX4A 4FZ6A 3BV3A 2V5QA 2XBJA 3DDQA 4QTCA 1H1RA 1KUTA 1O6YA 4DT8A 3U4UA 5HD4A 3DLZA 4FZDB 1YRPA 4X7QA 2XKDA 4P90A 4GT3A 4UZDA 1Y8GA 4E4MA 4G16A 4E8AA 4YZ9A 3UOJA 4V01A 4RLLA 3DAJA 1R3CA 5F20A 3GOPA 3UNKA 3IW6A 4R5SA 4FIJA 4O7WA 4JG8A 3MIYA 3O17A 3TKIA 2UW6A 1IA9A 3VUGA 5CTPA 4OR5A 3LHJA 4QMTA 4F7LA 4CFMA 4L67A 4X3JA 4R1VA 4L3PA 3ZMMA 3BWJA 3VF8A 2ZMCA 4DCEA 3QTIA 2FSOX 5HIEA 3IGOA 4L7SA 5CVFA 2EVAA 4DGGA 3P5KA 4E4XA 4YHFA 4QMOA 4YTIA 1VZOA 2WB8A 3E8DA 3VVHA 4YPDA 4PNKA 2BAKA 1IG1A 4FEQA 4LRKA 2EB3A 4D4VA 4IM2A 2IZTA 2SRCA 3ZSIA 2QU5A 5F94A 5JZNA 4Y72A 4YLLA 4OTDA 2IVSA 4XV1A 4I94A 3ZS5A 4NJ3A 3FSKA 5ETIA 3HYHA 4BBEA 3IOPA 3LFSA 3NW6A 1LP4A 2PE2A 3DKOA 3UVPA 3JR1A 1P4OA 2Q83A 2JIUA 3FEGA 3NUXA 3PTGA 4YJUA 5DT3A 2R3NA 4BWPA 5ITAA 2CMWA 4MXCA 2VTAA 3OWPA 3VS0A 1DAWA 2WTJA 4PTEA 2KULA 3UIUA 2VRXA 3CJGA 3NS9A 5FXSA 3ZBXA 5LMBA 4BDIA 1Q99A 1SVGA 5HO8A 4FVQA 3Q3BA 5ANJA 1YHSA 4GU6A 3ATTA 4ITHA 5T6KA 2HZ4A 4YJSA 3PDTA 3E5AA 4RWJA 3F61A 2QR7A 3MBLA 3HRFA 3SRVA 3VIDA 3F6XA 4BZNA 3U6IA 2YEXA 4LGDA 5HBEA 4JT3A 1YXTA 4KSQA 1FOTA 5LWMA 3SG8A 3QL8A 3OEFX 3RCDA 3WIGA 4OT6A 3GC8A 5DRBA 2UZBA 4AW0A 4S33A 5AJQA 3RK7A 5BUEA 2QLUA 3JPVA 4LUDA 4RIWB 4UY9A 5HORA 3QZFA 3D9VA 3DK7A 4EOIA 3QQUA 3SC1A 5CX9A 4O83A 4FT0A 2CKEA 4FNXA 4PPBA 3QQKA 4USFA 2GTNA 3DJ5A 5TOZA 2G1TA 4JXFA 4M15A 4FBXA 5LWNA 2IG7A 3NPCA 5HG9A 3ZH8A 2ZV9A 3GP0A 3NX8A 3VS6A 3HAMA 2JC6A 2WTKC 4L01A 1GIIA 4JRNA 4FL3A 4FKVA 2J4ZA 3FQSA 3IONA 2XIXA 3MFSA 4AGUA 2VUWA 4NJDA 4O7LA 1R0PA 2PVFA 2R3IA 5CLPA 4KS7A 2OFVA 2PUNA 4J8MA 4B0GA 2UW3A 3FC1X 4MTAA 3GB2A 4FV1A 4TWCA 5CVGA 3I79A 3QRUA 3K5UA 1KV1A 2HK5A 3FXXA 4FIEA 3AMBA 2YM7A 4FTUA 4H36A 2XNGA 4QT1A 3W8LA 5LCJA 1GZ8A 1PMVA 5LVMA 3DBEA 3LOKA 3C4WA 3ODYX 2XNOA 1U5RA 4A9RA 5HTIA 3OY3A 4JR7A 4WA9A 1LEZA 3BWFA 2FA2A 4E7WA 5ETCA 3LE6A 5EYMA 3W2SA 4FV9A 5CU3A 4FE2A 3R1NA 2UZUE 3FI3A 1XQZA 5KE0A 3ZXTA 3L8VA 3ET7A 3V5WA 1YWNA 2C3IB 4FL2A 3C0HA 3FLWA 4X2KA 3OUKA 4F9YA 4FV7A 3FC2A 2PUIA 2I1MA 3TUDA 4YZDA 2HXQA 3SKCA 3NDMA 5FP6A 5K5NA 3IW8A 2RIOA 3BGPA 2ACXA 4X3FC 5FG8A 3Q2JA 3IDBA 3S4QA 4BDJA 2Y4IB 3T3VA 5JGBA 3DJ6A 4G3DA 4C35A 1WBWA 4YZNA 4O81A 1FVRA 4UN0C 1XH6A 2QO9A 2VWYA 4ZOGA 1OL2A 3RPRA 1NA7A 5EKNA 4Q9SA 2WTCA 4BIBA 3KN6A 4OTPA 3FWQA 4N6ZA 5EM5A 3VS2A 4PQNA 4PP7A 4O0VA 1W82A 2QVSE 4AGDA 4FR4A 1V0BA 4B99A 4RGJA 5CQWA 1CKPA 2G2IA 2OK1A 3KY2A 4XLIA 4IB1A 1R78A 4OTWA 4IJ9A 3G5DA 4BIEA 3VJOA 1BMKA 2RG5A 2JDOA 4IAFA 2W1GA 3TZ9A 4GFOA 2YWPA 3S00A 1KE6A 5E8UA 3U9NA 2C30A 3FAAA 4TNDA 2XRWA 5GHVA 1JVPP 2BTRA 1WZYA 3OF0A 3D0EA 5KHXA 3UQFA 1U5QA 4TWPA 5AR5A 4YBKA 2IVUA 5CEQA 3R9OA 1PXLA 5CAVA 5T68A 1AD5A 2X2LA 3SW4A 2VGOA 2A27A 4DN5A 3U87A 2QG7A 2P3GX 4RX8A 1SYKA 3E87A 4NM0A 3FKOA 1UU7A 3Q5ZA 4K33A 2JFLA 4IWPA 1JKKA 1H1SA 3LCSA 3ORIA 5D7VA 1PYXA 4ANQA 2ZVAA 3I6UA 4DEAA 2XNMA 3NUSA 3EYGA 3FY0A 2C3LA 1JSTA 4FSZA 4FV5A 1XH9A 4FV8A 4LI5A 3TV4A 3NNWA 3ULZA 3ZFMA 4EOOA 4PPAA 4DCAA 4IXPA 4YZCA 2GQGA 5E8TA 4D1ZA 5DOSA 2PVNA 2QOCA 4TNBA 2CPKE 4X6RA 4KBCA 3HAVA 4O38A 5FEQA 4PDOA 5HNBA 4LRMA 5HESA 3L8XA 4GS6A 4FUYA 3ENMA 4CRSA 2AC5A 4FTAA 4OUCA 4G31A 2W1FA 3TUBA 1ATPE 3GI3A 4K6ZA 1M2RA 1PRYA 3EQCA 4TYJA 1A06A 2H34A 3RI1A 3KXHA 1VYZA 4R77A 1NVSA 2AYPA 3HLLA 5IA4A 1H4LA 3OS3A 3CC6A 2ITZA 3C0IA 4NIFA 5M08A 2BHHA 3COMA 3HRCA 1PJKA 3RVGA 1FINA 5K4IA 3LIJA 4C02A 3LKMA 3O50A 2F7EE 4RLKA 4BGGA 4I5CA 4FTRA 4QP6A 2BRNA 4DE4A 5HLNA 4QQCA 4MXXA 2JLDA 3POOA 3PXRA 4FOBA 4YMJA 1YOMA 2C0OA 4NFNA 5J87A 2WMRA 3EZRA 5IQDA 4X2JA 3OWLA 2G15A 3Q4CA 4BCHA 4EK3A 3LQ3A 2ITPA 3CTQA 1W8CA 3I0OA 3P7CA 5DI1A 2IPXA 4TYHB 2JIVA 3IDCA 2GNHA 2OZAA 3AMAA 4N0SA 3P4KA 4M13A 3ZM9A 3A8XA 2YFXA 3QC4A 4LGGA 5FM2A 4JR3A 3F88A 5HNGA 3Q4ZA 3LPBA 4Z9LA 4UWBA 3E8EA 2VV9A 4K2RA 3HV7A 4O0UA 2C1AA 5G1XA 3PP0A 4GKHA 1W83A 5CXZA 1RJBA 4TXCA 3WF8A 4IFCA 3V5PA 3QZHA 2JIIA 3MGYA 3HUBA 3VS5A 2YIYA 1G8SA 4BKZA 3PLSA 3HMIA 3NYNA 3SXFA 4GT4A 3C5IA 2EXCX 4FKPA 4RJ3A 2HIWA 5LMAA 4RVTA 3I5ZA 3C7QA 1WBNA 4P7EA 1IAHA 3R9NA 2XZSA 2HZIA 4EOLA 1O6KA 4CEGA 3WARA 5L2WA 3TL8A 1W0XC 4FKRA 4P5QA 4UWCA 5BVEA 4AU8A 4ZMFA 3SHEA 3R1SA 1JKSA 2VN9A 4DF3A 3KEXA 4MCVA 3PE2A 2R4BA 3DK3A 3OT3A 4RX7A 5HGIA 4APCA 3POZA 5LARA 3ZC5A 3C4ZA 4O96A 2OZOA 4XHKB 4E6CA 3WYXA 1CKIA 5CALA 4BHNA 3EFWA 1J7LA 4X3FA 5AIRA 2OBJA 1FPUA 4HCTA 5A4QA 4ANLA 4NCTC 5K0KA 4EI4A 4O7VA 1FMKA 5A54A 5EG3A
chains in the Genus database with same CATH superfamily
5AV0A 4DITA 5J5SA 4BTFA 2PVYA 5IMXA 3FSFA 4E4NA 2ZB1A 4BVUA 4YP8A 4RZVA 4EHGA 3DNEA 5E90A 3RZFA 3EQGA 4C8BA 3AOXA 1H28A 4QTBA 5GZ8A 3NUUA 4C58A 2ZM4A 3V5JA 4FICA 4XEYA 4Q2AA 4TY1A 4M7IA 3UQCA 1WBPA 2BALA 4WSQA 3C4EA 3I1AA 5CEPA 2UW4A 1YOLA 5IA2A 5IEVA 4DEGA 2AQXA 3ZRLA 3QFVA 3RZBA 3TNWA 5J5TA 3BHTA 4FOCA 1PXNA 5BYYA 5EQYA 5IH6A 1VJYA 4FNZA 2V62A 4JX3A 4CFFA 4FNWA 1VR2A 4R3RA 4CQGA 3IW4A 4LL0A 5D7AA 4W9XA 2ZYBA 5EDQA 3D2KA 1R0EA 5CY3A 5CZIA 2XARA 3UIBA 3F2RA 4CG9A 4OTQA 2A0CX 3GU4A 3GFEA 3VO3A 2VTSA 3PVGA 4KIQA 4JVGA 5JQ5A 2Z7SA 3WZUA 2VTIA 5BVOA 2CCIA 5KMJA 1J7IA 5DVRA 4FTMA 2IZUA 4CVAA 3ZUVA 1YI6A 4IQ6A 4TPTA 3AC5A 1E9HA 3KXXA 4H39A 5CWZA 4ZXTA 1CMKE 5EI8A 5HCYA 3CE3A 2XIZA 2X7FA 4K8AA 2H6DA 5FGKA 3DS6A 4JDHA 4BDHA 4QMQA 2UW9A 1UKHA 3LQ5A 4O21A 3TACA 2ETKA 5J79A 2GNFA 2OFUA 4L53A 3ANQA 2CKOA 1PXPA 3DV3A 4NK9A 3WZEA 3NFGB 5BQ0A 4BYIA 3K3IA 2JEDA 4GL9A 3QAME 1PMNA 2PE0A 2XCHA 3DT1A 4BCIA 2PMOX 2XB7A 4AW5A 5CENA 3IOKA 3DQWA 3LFNA 3Q4UA 4JIAA 2QOFA 5LMKC 3MFTA 4LV5A 5L6PA 1SVEA 3FJQE 1SNUA 2GS6A 3N4VA 3W1FA 1JSUA 3UOLA 1YXSA 1H25A 1ZLTA 2WXVA 3IW7A 4YJRA 5L4QA 2WNTA 5A6NA 4O4CA 1DM2A 5H9BA 4RIYB 1OUKA 2Z2WA 4FK3A 3CY3A 3V01A 1CTPE 4IVAA 5KMMA 4WIHA 4O22A 3ML1A 4MQ2A 5AX3A 5F9EA 3UIXA 1E1XA 1TVOA 1PXJA 1QPDA 3IGGA 2ZDTA 4GFGA 3CGFA 3I60A 4DGOA 4F9BA 2ITQA 4O2ZA 2C0TA 4XRLA 4ANMA 3RINA 4EBVA 2WFYA 2WQBA 3BCEA 4YLJA 3SXRA 5ACKA 2ITVA 3TKUA 4D55A 3UP2A 3D5UA 3FMHA 3DBFA 5CEIA 1W2FA 3CQEA 3KCFA 4LUEA 4CTBA 4RJ5A 4ALVA 5J7HA 2YHVA 3QQGA 3VAPA 4BKYA 4FZ7A 4F6WA 5CAOA 3DZOA 1OMWA 1UNHA 4A9SA 3UP7A 2WMUA 4MNEB 3KRWA 4C3FA 3TV7A 5EHLA 1OPJA 1MRYA 3IS5A 2C5XA 5J1VA 5GIPE 3FUPA 4QMWA 4C2VA 3OCBA 4I6BA 3SXSA 3D94A 3ZTXA 3VULA 3EQHA 3VRYA 3QA8A 2YLFA 4CKRA 3I4BA 2WQNA 3VN9A 1H27A 3WZJA 4BCOA 4Z55A 3NAXA 2F57A 3E7VA 5HBHA 3UVQA 4EH3A 1LUFA 5BUJA 2HZNA 1OGUA 4K77A 1OIRA 1H0VA 4GFMA 4KKHA 2BDWA 5JK3A 3QRIA 4FZAB 1OPLA 5CI7A 3ALNA 3GQIA 1JWHA 4MF1A 4RG0A 2CNVA 4IE9A 3G6HA 4O6EA 5CASA 1Y57A 4ACCA 3OVVA 5EYDA 4O7YA 3GT8A 3HP5A 4WNPA 4ZK5A 4LQMA 4PY1A 5K5XA 2PZPA 2WU6A 1XWSA 2PYWA 1XBBA 4IANA 2PULA 3V8WA 4O7ZA 3FMDA 3AD5A 2UVYA 4WD5A 3NIZA 4IEBA 1ZYLA 4PMMA 3GU6A 1NY3A 2R3LA 2QOKA 5HLWA 1WBTA 3A4OX 5KUPA 4BZDA 1F3MC 4XBRA 5ANDA 5A4EA 4FEXA 3QHRA 1MRVA 4L68A 4XV2A 3TNIA 4LL5A 5DT4A 3UBDA 3PJ3A 2R3RA 2R3KA 4NWMA 4BC6A 4CLJA 1REJA 1WVYA 1UNGA 3EFJA 3QCSA 2UZWE 3MI9A 5HIBA 4Q9ZA 1YHVA 3QQHA 4TW9A 3UPXA 1ZRZA 4R3CA 2X81A 4NTSA 4BL1A 4FG8A 4FKQA 2XK9A 5AR2A 4O7NA 5IQGA 2C6OA 5AP5A 5IPJA 3FLSA 4ZTNA 2CLQA 4CTCA 2W5BA 2JKQA 2WMBA 4EJ7A 4WNOA 2DWBA 1UA2A 4XG4A 4FT9A 4TL0A 3S1HA 2J51A 2X7GA 3A62A 2XIKA 2HENA 3FI4A 3G0FA 3R8LA 4TWNA 3WILA 4E6AA 4DG2E 3U6JA 4FEWA 2W1IA 2WZJA 1M2PA 5I4NA 1IAJA 5AFVA 2R3GA 4QP2A 3VQHA 2F4JA 5E9EA 4CCUA 4F9AA 4N57A 3KK8A 5CANA 4A9YA 1XO2B 4JBVA 3FMJA 5EM6A 2EWAA 1K3AA 3AC8A 1W7HA 5AUXA 5TE0A 2FH9A 5CS6A 1OL1A 3MJ1A 3LLAA 3ZYAA 2J5FA 1BL7A 3ZDIA 5M4CA 2QCSA 4IX5A 2Y6MA 3AMYA 4C0TA 5EQEA 3BHYA 4DEEA 2OJFE 2HAKA 4V05A 2OXXA 2PVKA 5AP2A 3FXWA 1H0WA 3R28A 4BZOA 3FZSA 4EOQA 5AX9A 4DH7A 5FLFA 2WMTA 4ANOA 2W1DA 2H96A 3P1AA 4ACGA 2Q0NA 1CM8A 3GEQA 4FIFA 3COKA 1IASA 2VO0A 3NAYA 3D5XA 3RP9A 3VUDA 1K2PA 3B8QA 2XALA 3VUKA 1WBSA 4O1PA 4Y8DA 4AX8A 3HV3A 2OGVA 3G0EA 3P9JA 4MD7E 3UZTA 4P4CA 3OXTA 5IA0A 1OIQA 1KWPA 1CKJA 4LG4A 5J9ZA 5B2LA 1OL6A 4I5PA 2YIWA 5DIAA 5I5ZA 4J71A 3MN3A 4DYMA 1BKXA 1T46A 2VU3A 3UNJA 2WIPA 2XYNA 4NW5A 4FKOA 2VTHA 4B9DA 4GU9A 3D2IA 5M06A 3HMPA 3HV5A 3OBJA 4YNEA 4ZP5A 2ZB0A 2B52A 2OW3A 3QWKA 4LYNA 2ITYA 4KIKB 3E88A 1MQBA 3EL7A 4CLIA 4FJVA 4EWHA 3NYOA 1FMOE 5AEPA 3D4QA 4EKLA 4O6LA 2A4LA 2GQSA 4I0TA 3AGLA 3CP9A 4XNEA 1XH8A 4EKKA 2X8EA 2IJMA 3BLRA 5L2QA 3QU0A 2YZAA 2OH0E 3DXNA 1TQMA 2YAKA 2Z7RA 2JGZA 2XRUA 2BR1A 2VX3A 3FHIA 5IEXA 2GDOA 3FPQA 4EONA 4RPVA 3TNPC 5L6WL 2H8HA 5EOBA 4MNEA 3Q96A 4BI1A 3BBTB 4ZSLA 4CYIA 3IO7A 2UZEA 4C61A 4FKSA 5HE2A 3VBVA 5JFWA 4U80A 4K9YA 3QTZA 3R71A 5J9YA 2C1BA 3PVBA 4GYGA 3IECA 5ANOA 2WOUA 2VWBA 2BZIB 3NYVA 5D12A 4AS0A 3CY2A 3VQUA 3AKKA 3EB0A 4IZ5A 2QR8A 3NRMA 1GIHA 5BMMA 1OBGA 4JMQA 4KBAA 5H2UA 2ETRA 3WZKA 5AAGA 4YZMA 4CKIA 4C57A 3PSCA 2UVXA 4IM3A 5HIDA 3PG3A 1APME 2BIYA 2PHKA 3V04A 4CT1A 5HTBA 4QD6A 3LFQA 4C36A 1GNGA 4F09A 4MAOA 4MD8E 3SD0A 4QTEA 4QMSA 3R7GA 3NUAA 4IFGA 2BRHA 3CD3A 5C4KA 3DBQA 4F6SA 3DFAA 4AE6A 4G3EA 3UZPA 1XMLA 5DWRA 2UZDA 4DTKA 5KBQA 3MVHA 3MW1A 5HHWA 3F82A 3QALE 5HD7A 4QPSA 4O7SA 2P2IA 2Y9QA 3H4JA 2YIQA 3RHXA 4AP7A 4CMTA 3KIOC 3NR9A 5JEBA 4NCTA 5ACBC 2B55A 3W32A 3P23A 3K54A 4AZVA 3IK3A 3UG2A 2W17A 3BQCA 2GNJA 4B7TA 3OBGA 4CXAA 3R21A 3H3CA 4JDJA 3W18A 3WOWA 5IQEA 4LMNA 2YM8A 3GGFA 4TYGA 3NNUA 3LCDA 4L3LA 4XYFA 4RT7A 2ONLA 2QO2A 4D1SA 4ZY4A 3H0ZA 3L9MA 2XYUA 3H10A 4O2PA 4NIFB 4ZZMA 1ST0A 3BYMA 2RF9A 4PDSA 2EB2A 3R7OA 3DTWA 3CPBA 3MJ2A 3S2PA 4FI1A 2NNWB 3P7BA 5EQPA 5M4IA 3S0OA 3MVJA 3VS7A 3EH9A 4GK4A 3CKWA 4A9TA 2XAMA 4GJ2A 4M12A 4QMMA 2G2HA 2BRMA 3EQFA 2PU8A 2YABA 2XK7A 2VX0A 4KRCA 4DFZE 2LGCA 1ZWSA 2W5AA 2YA9A 5A4CA 2C68A 5C01A 5AUTA 3FI8A 3VUHA 5GIOE 4R8QA 3RM7A 4EC8A 2OF2A 3F9NA 2R2PA 4OBPA 5HCZA 2PMLX 4R78A 3ZCLA 1U46A 5FEEA 3CLYA 4OBOA 3E8NA 4D2TA 1YXXA 3HV4A 4RIYA 4ZTQA 4GCJA 4YGAA 4FK6A 5FP5A 2WD1A 3OCGA 3PRIA 2VWUA 2X7OA 3Q52A 4GRBA 4QMVA 3W55A 2ZM3A 4OBQA 5IH5A 3RAHA 3DKGA 3EFLA 3CKXA 4BRXA 4LV8A 5I9YA 4HCUA 2J90A 4Q5EA 4RFYA 3EN6A 3F66A 3LCTA 5BVKA 4FEUA 3TG1A 3UGCA 3V3VA 4B6LA 5M09A 2ZMDA 3DK6A 4RA5A 5L3AA 3JVRA 4LRJA 4AT4A 3D83A 4DHJA 4OTGA 2JDSA 3FQEA 1ZAOA 2X2MA 5EDPA 5HE1A 3PYYA 1P2AA 4D28A 2IZRA 2XA4A 3VHKA 3EQPA 3GC7A 4HGSA 2GPHA 2F9GA 4IWOA 3WBLA 2PWLA 2GHGA 5LCKA 2YACA 2OIQA 2IW9A 3MPMA 1HCLA 1BX6A 4UB7A 4XJ0A 4BBMA 2Y6OA 2ZM1A 4N6YA 2BAQA 4O0XA 3UYSA 4APPA 3R73A 1Q3DA 2E9UA 3DAKA 3NFFB 3D15A 2XMYA 1OKYA 1GJOA 2C6TA 2PVRA 2QO7A 2WIHA 3MV5A 5FTOA 4ALWA 4R7BA 3FBVA 4HVIA 5E4HA 1EH4A 3REPA 4IBMA 1GOLA 2QHNA 2HY0A 4KRDA 4BIDA 3JXWA 2QOQA 3PRFA 3R2YA 2UVZA 3M11A 4IZAA 3L9LA 3UJGA 2CDZA 4D0WA 3G6GA 3HA8A 4HNIA 3DKCA 5FUTA 1YKRA 3BE2A 3HP2A 5LVLA 5AP0A 1FVVA 1M17A 2JFMA 4JNWA 4QTAA 5EHOA 3WZDA 2A1AB 1KOBA 3HMOA 4EQUA 3TDWA 4E20A 4E5WA 4BTKA 5L2SA 2PL0A 2V55A 1P5EA 3HEGA 4L46A 1SM2A 5EDRA 3MTLA 3PA3A 4FTJA 2ZOQA 1X8BA 4HPTE 3EYHA 4ZTHA 3OZ6A 2BIKB 4FL1A 1JAMA 3CD8A 3HECA 4TYEA 4U7ZA 4FC0A 3NMUF 2VO7A 2BFXA 5AM7A 3SRVB 4RIXB 2BVAA 3AT4A 3VONA 3UTOA 4D2SA 1KV2A 2QG5A 4HVSA 5C1QB 3CGOA 3HX4A 4WO5A 3ZFYA 3BLHA 5KNJA 3QUDA 4G5PA 2J0IA 2IN6A 3FLZA 4D2RA 4RIWA 3F2NA 3ORTA 2C6KA 5L8KA 4K11A 4YC8A 3G9LX 3QGWA 1RE8A 2B54A 1J1CA 2EUFB 5EW9A 5I9VA 3D14A 2WQMA 4B8MA 4YC6A 4BYJA 3FZRA 3LFDA 2J2IB 5E8YA 4F0IA 5HO7A 3W2QA 4ITIA 4IW0A 1DI9A 3I0QA 3QZIA 3O8PA 4H1JA 4L42A 5IA5A 4C7TA 3H0YA 5F95A 1W2CA 4U9AA 4QP7A 2IW6A 1U4DA 2AUHA 4L8MA 3VHEA 4CFVA 2R3FA 3VBWA 3LJ1A 4FSWA 4PX6A 3KMMA 1YHWA 4WKQA 4O86A 4J99A 4UYNA 1RDQE 1H1PA 4ENXA 3NCZA 4F7NA 3FZOA 4L6QA 4MBJA 2R3PA 3LJ0A 4JQ8A 3M42A 4OAVB 2PZ5A 4KB8A 4PL4A 4AUAA 3FPMA 3OHTA 3W0NA 2WQOA 3KRLA 3OROA 4F63A 2HXLA 3MA6A 5TF9A 3GC0A 4AZFA 4BN1A 4LOOA 4HOKA 5KZ0A 3DKFA 4QPMA 3W0PA 3BX5A 4GK2A 1OI9A 2XK6A 3WIKA 4ENYA 2QOHA 1VYWA 3PXZA 1TKIA 1BYGA 4AN2A 5EYCA 4FIGA 3ODZX 2W1CA 2XS0A 4EBWA 1ZYDA 4G9RA 5KMNA 4YTFA 4ZTSA 3R8MA 2VTQA 4NL0A 3QGYA 3QYZA 4FV2A 5AV2A 3ZDUA 3KXZA 1R1WA 4EH4A 4EK8A 2GTMA 3ZRMA 2ITOA 3R00A 1RW8A 4MK0A 4EOJA 3W0RA 3RK9A 3V6RA 2OZAB 4PUZA 3PJ8A 4EK5A 2OU7A 2VX1A 3LJ2A 4UMTA 4XG2A 2YLEA 3RMFA 4CZYB 2CNQA 2R3OA 3LFEA 2F7ZE 3F5UA 3OXZA 5DMZA 5EK7A 4QMYA 2OF4A 2W5HA 3UE4A 1JSVA 3VS3A 5CF8A 4YNOA 2OJJA 3OOMA 4DEHA 4RWKA 2UUEA 5EM8A 4PTGA 3Q2MA 3CS9A 4FEVA 2VO3A 3KVWA 5JFVA 4AZEA 2IWIA 5FDXA 4ZY6A 3NUPA 4E1ZA 5CEMA 3ZBFA 4CNHA 3PXKA 3WYYA 2W4OA 2AC3A 4USEA 4IDVA 3BYSA 3WF7A 5L2TA 3OTVA 4BHZA 4CFWA 2REIA 5AP6A 4KABA 2W1ZA 4FIIA 5HLPA 3ROYA 1G3NA 3UYTA 4FVPA 3AC1A 3V5QA 3ZC6A 5DGZA 2IVTA 4I20A 1UU9A 3D5VA 4U97A 5GZAA 4CG8A 2GCDA 5CNNA 3HA6A 3MH2A 5A3XA 4L45A 1H24A 3HUCA 5KBRA 5LQFA 5IDPA 3R9HA 1GY3A 2VTNA 4M14A 4ACMA 3L1SA 1R39A 4CZUA 1KOAA 1LPUA 1Q8WA 4AA4A 4FV3A 3QC9A 4O0WA 3E8CA 4D4RA 2I0HA 1Q4LA 5JGDA 3SVVA 4QQJA 1L8TA 5AV3A 3SDJA 1H08A 5FBOA 5AWMA 4OTIA 4EUUA 3BBWA 2BPMA 4AQCA 3UZRA 2PUUA 5JMSA 1T45A 4XG8A 3UC4A 3LFBA 1OGYA 2BDFA 2OO8X 1Q8UA 3RPVA 2QD9A 3TJDA 4UMRA 1WAKA 3VBQA 1ZOGA 3F69A 3MY1A 4S2ZA 4RIOA 3ZO3A 3N4TA 3WF6A 3MFRA 2WO6A 3F3UA 1G8KA 4FSTA 4XH6A 5B7VA 4WOVA 1QL6A 2YCQA 2YITA 4JX7A 4XG3A 2EU9A 2GSFA 2QOIA 5I9ZA 2X0GA 4DHZA 2W99B 4KINA 4PMSA 4YJVA 2YN8A 4AF3A 1ZMUA 2UZTA 3PPJA 4K1BA 4ORKA 3DBDA 2QKWB 3A7HA 3UO4A 4IB0A 3M2WA 2BCJA 4XG9A 4ZJVA 3E92A 3PZEA 3RAWA 3CIKA 5HOAA 2CLXA 3HNGA 5DR6A 3VBXA 4UBAA 3PSDA 5BYZA 2Z8CA 3AT2A 3BGZA 4AZWA 3Q9YA 1YVJA 5AP1A 3U8WA 4C4EA 1QMZA 4L00A 3I81A 3BHUA 2XJ0A 4FRFA 1V0PA 3G51A 5AP3A 5CI6A 3ENHA 2Y7JA 4U42A 1I44A 3FQHA 3NWWA 4BKJA 1JOWB 4AOTA 1P14A 3CSVA 2O64A 3MWUA 3PA5A 4RJ8A 4UZHA 4DBNA 4HGLA 2YAAA 4QMPA 4CV8A 1M52A 3HV6A 4KIPA 2G9XA 4YSMA 1TQPA 4ZZNA 4CKJA 3SW7A 4GJ3A 4DDGA 5BNJA 4GYIA 2X8IA 4RVKA 2WMQA 4E3CA 2OJIA 3D7TB 3O23A 4NW6A 5A14A 3L9PA 2PZIA 3QRTA 4GV1A 4KBKA 5JH6A 2JDRA 2ZV2A 3AC3A 5ETAA 4D5HA 4RA4A 4ANSA 5BMSA 3HVCA 3E93A 1XH5A 3LVPA 2I7QA 4DEDA 3NSZA 4FNYA 2ZFYA 4M69A 1XH7A 2GS2A 1Z9XA 1GZKA 1H8FA 5T3QA 4A9UA 2JBPA 3UOHA 2VWXA 2XK4A 4JL9A 4RQKA 4PMTA 3TWJA 4BDAA 3U6HA 1JPAA 3HKOA 5C9CA 4EORA 3DCVA 3DQXA 3PE1A 4JAIA 2PZYA 3TMOA 3W8QA 2YZLA 4KIKA 3KCKA 4OTHA 4PMPA 1FVTA 2GMXA 4NSTA 5AUWA 3ZXZA 3ZO1A 4YU2A 3ZLWA 4JLCA 2PY3A 3R6XA 4O84A 4DH3A 3SLSA 4J52A 4YO6A 3RM6A 3I6WA 2WGJA 5HVJA 5C03A 1OKZA 1QCFA 4D0XA 3JUHA 3BEAA 5LXMA 1PKDA 1G8AA 4EHVA 5J95A 3DXPA 2A19B 5HU9A 4GUBA 1G5SA 1M14A 1W2DA 2FSTX 5KHWA 3PG1A 5JKGA 4PP9A 4BFMA 4C37A 4BGHA 1M7QA 2X0QA 5DN3A 4EYJA 1PXKA 3KL8A 3RPOA 4MD9E 3RWPA 3VS4A 3UO6A 4YUQA 2UW7A 4YO4A 4BDEA 4YLKA 4U0IA 4U5JA 4FKTA 5JRSA 5J1WA 3P5JC 3B2WA 3R8VA 2R64A 3KF4A 4M8TA 4O0YA 2QODA 5EM7A 4WNMA 4CFXA 4A06A 4BI2A 4QMXA 3KXMA 4PL5A 3EN9A 4O4FA 5AA8A 3PIZA 3O5AA 2W4JA 5IQAA 3R7IA 3CXWA 4TWOA 4FA2A 3A99A 3VNTA 4BI0A 3FZPA 4LDTA 4MYGA 4JDIA 3QZGA 4E6DA 5K9IA 3QWJA 3ZSHA 2GQRA 4X6QC 4L3JA 2X6EA 4CMOA 5EW3A 4J8NA 3OW3A 3UNZA 4ACDA 4PNIA 5C8NA 2CNUA 2WMWA 4DG3E 3O0GA 4QMZA 1JNKA 2WTVA 1IEPA 1S9IA 1M2QA 5TR6A 2BFYA 3VW6A 2WKMA 2XANA 4AXFA 3ZFXA 4BJJB 4YJOA 3R2BA 2WMVA 1OBDA 5M56A 5A9UA 4KA3A 5BVFA 3QTXA 3QCYA 2HOGA 1BI7A 4H3QA 4KSPA 2B9JA 1TFFA 3CTHA 4G2FA 4IX6A 1J91A 3BRBA 2E9PA 4IMYA 4EC9A 4IWDA 1GIJA 5HCXA 4DTBA 5BYLA 3TTJA 3ULIA 5HTCA 1ERKA 1OECA 5HG8A 1AQ1A 4TN6A 4AT5A 4QMUA 1YXVA 2B1PA 2R0IA 4RJ4A 3PJ2A 3R1YA 3QCQA 3D7ZA 3LXLA 4NUSA 5LVNA 3TZ7A 4HYUA 4PF4A 2QLQA 4FX3A 4DH8A 3C4FA 3QD0A 5CU2A 4DH1A 4FVRA 4W9WA 5DT0A 4RMZA 3II5A 4YHTA 1O9UA 4JBOA 3O8UA 3U54A 4AOJA 3DAEA 1J7UA 3QA0A 3U9CA 2IZSA 3F5XA 2UZOA 2WTWA 3AQVA 2RFEA 5CSXA 4UXQA 3HRBA 4FIHA 4BDKA 4DC2A 5IKWA 3VWAA 5HKMA 4J95A 5AV4A 3FMEA 4QO9A 3NVKI 4UMUA 3DB8A 1OIYA 3QKKA 3DTCA 4ASZA 2F2CB 4XG6A 3A7FA 1F5QA 4GG7A 4HVDA 2VTOA 4DG0E 1Q61A 3BU6A 1H00A 4IVDA 4FKWA 4EEVA 3QHWA 1Y91A 4TT7A 4L43A 2BKKA 4GIHA 5EYKA 3THBA 2ZV8A 4LM5A 2YJSA 4C3PA 1Q41A 5IDNA 1JBPE 3S3IA 4CD0A 3QXOA 4K18A 3KKVA 3AC4A 3Q6WA 4JBPA 4ZJJA 4EHEA 5AADA 2I0YA 3DXQA 3FL5A 5FD2A 2YDIA 5CEKA 3F5GA 1OL5A 1OKWA 4AA0A 4FTNA 4ERKA 4CSVA 5CF4A 5DEWA 3GNIB 3F3TA 3GCPA 2XNPA 4I0SA 4BBFA 4E6QA 5GINE 2ETMA 5KMOA 1JLUE 4UMQA 4EOPA 5AM6A 4ASEA 4U43A 5HVKA 3AD4A 3LFFA 5ANEA 5EFQA 2YJRA 3NZ0A 3F7ZA 4JIKA 4J96A 4Y95A 4E5AX 4D9TA 3EQBA 4G17A 1DI8A 2VAGA 5AAEA 4C4GA 1NVRA 3P78A 1PKGA 5CT7A 3BV2A 2NO3A 3KULA 5DA3A 5E1EA 3TTIA 4ZMEA 3AC2A 2R3JA 4RX5A 2UW5A 3W2PA 4ZTMA 2W7XA 3UDZA 2ZV7A 4FKUA 2ITTA 4WT6A 3MESA 2C5NA 2HW6A 3PXFA 4W4XA 1TQIA 2HELA 3PY0A 4V0GA 1URCA 3GFWA 3ANRA 5EOLA 3ZZEA 3IG7A 4HZSA 1WBVA 1ZYSA 3QKLA 2XKEA 2VWZA 5CF5A 5IA1A 3FKLA 1PMEA 1PXIA 4TZRA 5E92A 4EWQA 4FUXA 2FGIA 4XCUA 3O7LD 3SV0A 3MDYA 4WG4A 3BU5A 1UVRA 3COHA 4HYHA 4IWQA 4RC3A 4XUFA 5ETFA 3R83A 2QOOA 3VUMA 4YZBA 4F9CA 3FY2A 4FTQA 2XNNA 4F64A 1DS5A 4ARKA 3ORPA 1MQ4A 4R1YA 4E26A 5IUIA 3BL9A 2C6EA 3EOCA 5ANIA 1XJDA 1WBOA 3K5VA 4NEUA 5HU3A 3QRJA 2OSCA 3EL8A 3TZMA 4I23A 4RFZA 3UOKA 3C5UA 2NRUA 2CJMA 2YISA 4MHAA 2WTIA 2R3MA 3KRXA 4QQ5A 3EMGA 3SGCA 3KN5A 4XLVA 1J1BA 2X9FA 5AMNA 5M51A 4A4LA 2QOLA 2XVDA 4ZS4A 3ORZA 3ORMA 5E91A 5H3QA 2OI4X 4HNFA 4HVGA 2J9MA 2P0CA 2IVVA 5CU0A 2DUVA 3C1XA 4USDA 3OCSA 3HDMA 5GJFA 4KKEA 4QTDA 5IQIA 4A07A 2FSLX 2VNWA 2W9FB 3PSBA 3E62A 4LOQA 4P2KA 4EJNA 4BJJA 5HE0A 2P33A 3JVSA 3GBZA 4NZWB 4FV6A 1XBAA 4J7BA 3L9NA 5D1JA 3P08A 5A4TA 5LJJA 5DPVA 1WMKA 4YR8A 2RGPA 3F2AA 4QYGA 4MBLA 2RFSA 1Q97A 2RFNA 5FWKK 3RHKA 2JKMA 1SZMA 1FGIA 4KAOA 2E2BA 3QQJA 5FQDC 5FXRA 5M55A 1YI4A 2WTDA 3ACJA 4DFXE 2XCKA 3PJCA 3LXKA 2WHBA 4FGRA 2XP2A 2B0QA 4FYOA 4C2WA 3JY0A 3LAUA 4RQVA 3QRKA 4W4YA 3OCTA 2XBAA 5CSHA 4HZRA 4IC8A 4AN9A 5IEYA 3IDPA 4AXDA 2YIRA 1FBNA 5E8VA 3PXYA 3LW0A 2WEVA 3NLBA 4FSYA 4R7HA 4ZSEA 4CZTA 4M69B 4BDDA 5LOHA 4EK6A 3DPKA 3UQGA 4QPAA 4I41A 5EW8A 5IH4A 1BLXA 4MX9A 4AA5A 5LMKA 3PZHA 4I4FA 1YDRE 5IQHA 3RNYA 2QQ7A 5M07A 4ZLOA 4X3FB 4RBLA 4FKJA 3F3VA 5C4LA 3MS9A 4J1RA 4EH5A 4DA5A 4BWXA 2H9VA 2XF0A 2V7OA 3OFMA 3UMWA 3RNIA 4I21A 2CGWA 4IHPA 5IZFA 4BCNA 2VTJA 4X21A 4O7TA 3KC3A 3RJCA 2JBOA 2O2UA 2WPAA 4UXLA 4GH2A 4FKIA 5D41A 4A7CA 4FT7A 2VO6A 4ZSAA 3O2MA 2DYLA 2X9EA 3RPSA 4ZIMA 3A61A 5KCVA 4CMUA 4U81A 4HGEA 3O7LB 2R3QA 4AXEA 3KVXA 4BGQA 4W4VA 1A48A 1ND4A 4WRGA 1PYEA 4D2PA 4XG7A 4DGLC 3R1QA 5HI2A 3A4PA 3FL4A 3RK5A 2CCHA 4R3PA 3VF9A 4GIIA 2VTRA 4XOYA 5C26A 2QONA 1XR1A 5HNIX 4GW8A 4O0TA 4MUQA 3QYWA 2QKRA 4QQTA 4HYSA 2UW8A 3LM5A 3QD4A 3ROCA 4R7IA 4S34A 4DFNA 4I93A 3EKNA 2OXDA 5CXHA 4F6UA 3QTQA 2JAVA 3MVLA 2JDTA 1AGWA 2WMAA 1Z5MA 5E8ZA 3HL7A 3BEGA 3NEWA 5HG7A 4Q5HA 1XHAA 4F9WA 4IVBA 4I6HA 3MH3A 3ORLA 1UV5A 1GZNA 5K0XA 1ZY4A 3EIDA 4ANQA 4EH2A