5I4OA

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate zinc-chelator water-soluble inhibitor (dc28).
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
b'VWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHQIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i4oA00
3MA2A 1FLSA 1OMJA 1UTZA 2I47A 2MLRA 3TS4A 4L63A 3GBOA 3WV1A 2OW9A 4FXYP 3ZXHA 1Z3JA 4IUWA 3LQBA 5L7FA 2KRJA 2SRTA 1QJIA 2JT6A 1IABA 3VTGA 3EDHA 4FVLA 2JNPA 2N8RA 2W15A 1HTDA 4H3XA 1AYKA 1CGEA 2WO8A 1GE6A 1ND1A 4XM7A 4L19A 1G05A 3O2XA 1XUCA 4I03A 1SLNA 4HX3A 5L79A 1HFSA 3LJZA 4G0DA 1GXDA 1OO9A 2V4BA 2OW2A 1R1IA 1BIWA 3LQ0A 3F16A 2E2DA 1C8TA 2Z2DA 2JT5A 1XFZA 2XS4A 3VI1A 3TVCA 3WV3A 1XFXA 3HYGA 1GKCA 3KHIA 3LGPA 1MMBA 3K7LA 2Y6DA 2RJPA 4AXQA 3Q2GA 5D2BA 3DWBA 4DV8A 2OVZA 2CKIA 3HDBA 1HOVA 3TT4A 3I7IA 3RTTA 2O36A 1QIAA 5LABA 2D1NA 1Q3AA 1SLMA 4QKZA 2X3CA 4FU4A 3LEAA 4PKSA 2ERPA 3DNGA 1OS9A 3BA0A 4IN9A 1J7NA 1QJJA 1XUDA 1CQRA 1D8FA 3F19A 3HY9A 1ZXVA 2OVXA 2PJTA 3P1VA 3F17A 1BQOA 3HBUP 1IAEA 4GR3A 1BSWA 1EB6A 2W12A 4GR0A 1QIBA 1MMRA 1KBCA 4GF1A 2W0DA 1G49A 4H1QA 2OW0A 1IAAA 3AYKA 1KUIA 3NX7A 4EFSA 3UVCA 1PWVA 1Y93A 3ZUKA 5B5PA 4PKTA 1R54A 1Y0VA 3EWJA 1L6JA 4PKQA 4XM6A 1SATA 1H71P 2OXZA 1B8YA 1G12A 1Y8JA 2EROA 3K7NA 1JANA 2DDYA 1PWUA 1EAKA 3F15A 1CGFA 2WOAA 4XM8A 4IJOA 3EDZA 3HB2P 3EHXA 1ASTA 1R1HA 3L0TA 3O64A 1EUBA 3KEKA 5H8XA 1BKCI 4JIJA 1JK3A 1BKCE 3LK8A 4DF9A 1R1JA 2RJQA 4DPEA 3P24A 5I43A 1JAOA 2DW2A 1RMZA 3USNA 2MZIA 1JKYA 1IACA 4J4MA 3LJGA 4G9LA 5I0LA 2YIGA 1YP1A 1HY7A 4WK7A 5I4OA 4PKUA 1D8MA 2MLSA 3LILA 4JQGA 1GO8P 1KAPP 2OY4A 1SRPA 1USNA 2USNA 3KMEA 1FBLA 1PWQA 1KUKA 3B8ZA 2AIGP 1GKDA 4A3WA 1JJ9A 1ZS0A 1HV5A 1O0QA 1YOUA 1BKCA 3LMCA 4AUOA 3N2VA 5BOTA 1OM7A 1AKLA 5CZMA 5CUHA 1XFYA 4R3VA 3DL1A 5CXAA 1JAPA 1GE7A 3EDIA 4H49A 1KUHA 1I73A 3HBVP 1ZTQA 3Q2HA 1ROSA 1PWWA 1IADA 3LUNA 1I76A 1QICA 1CK7A 5I12A 3EHYA 4A7BA 3G5CA 3ZVSA 1XURA 2Y6CA 1SMPA 3KRYA 2JSDA 4GR8A 456CA 1KUFA 1KUGA 2MZEA 2DDFA 1O0TA 4GWMA 3AIGA 2K9CA 1CIZA 4PKWA 3OHLA 5D1UA 4CTHA 5D7WA 830CA 2W14A 1BZSA 1XFWA 1G4KA 1ATLA 3LE9A 2DW0A 3HDAP 4WZVA 3CKIA 4HMAA 2OXUA 1XFUA 1B3DA 1QUAA 1YCMA 2YB9A 1AF0A 1CAQA 1JH1A 1C7KA 4XCTA 2HU6A 2POJA 1BM6A 4H82A 2FV5A 1D7XA 4I35A 1OS2A 1GO7P 3HY7A 1MMQA 3RTSA 4GWNA 4WF6A 1OM8A 5D3CA 3KEJA 2W13A 3B92A 1GE5A 1FM1A 2TCLA 4Q1LA 1UEAA 1BQQM 1G9KA 3AYUA 3U1RA 4H2EA 3I7GA 1JAQA 4WKEA 1JIWP 2OW1A 5B5OA 3EDGA 2XS3A 3WV2A 1SU3A 2E3XA 1YQYA 3LJTA 4ON1A 4H84A 1DTHA 1DMTA 1K7QA 2OZRA 3KECA 4L6TA 1R55A 2D1OA 2OI0A 2MZHA 4ZR5A 3KMCA 2OXWA 1K7GA 2X3AA 2K2GA 1I1IP 4XBHA 1BUVM 1CGLA 1ZXCA 3DSLA 1A86A 2AYKA 5D1SA 4PKVA 4JP4A 2L0RA 3F1AA 1ZVXA 4PKRA 3G42A 4GQLA 1OM6A 3OHOA 2X3BA 5D1TA 3DPEA 3F18A 4AIGA 4DD8A 2OY2A 5JMYA 1ZP5A 1UMTA 1UTTA 3N2UA 1IAGA 2J0TA 2FV9A 2O3EA 5BPAA 3E8RA 4JPAA 4JA1A 1RM8A 2WO9A 3V96B 3TSKA 1D5JA 2DW1A 5BOYA 1CXVA 2JIHA 2QPJA 5I3MA 2ERQA 4H76A 1UMSA 3ELMA 4H30A 2J83A 2A8HA 2CLTA 1S4BP 3KWVC 3B2ZA 3LKAA 3DPFA 1XFVA 1A85A 1WNIA 2X7MA 4GUYA 1JIZA 3LIKA 4WKIA 1MMPA 1HFCA 3SHIA 1BUDA 4AYKA 3LIRA 966CA 3LUMA 5I2ZA 1K7IA 4FXQA 1MNCA 4ILWD 1PWPA 1C3IA 3L0VA
chains in the Genus database with same CATH superfamily
3MA2A 1FLSA 1OMJA 1UTZA 2I47A 2MLRA 3TS4A 4L63A 3GBOA 3WV1A 2OW9A 4FXYP 3ZXHA 1Z3JA 4IUWA 3LQBA 5L7FA 2KRJA 2SRTA 1QJIA 2JT6A 1IABA 3VTGA 3EDHA 3DTEA 4FVLA 2JNPA 2N8RA 2W15A 3DTIA 1HTDA 4H3XA 1AYKA 1CGEA 2WO8A 1GE6A 1ND1A 4XM7A 4L19A 1G05A 3O2XA 1XUCA 4I03A 1SLNA 4HX3A 5L79A 1HFSA 3LJZA 4G0DA 1GXDA 1OO9A 2V4BA 2OW2A 1R1IA 1BIWA 3LQ0A 3F16A 2E2DA 1C8TA 2Z2DA 2JT5A 1XFZA 2XS4A 3VI1A 3TVCA 3WV3A 1XFXA 3HYGA 1GKCA 3KHIA 3LGPA 1MMBA 3K7LA 2Y6DA 2RJPA 4AXQA 3Q2GA 5D2BA 3DWBA 4DV8A 2OVZA 2CKIA 3HDBA 1HOVA 3TT4A 3I7IA 3RTTA 2O36A 1QIAA 5LABA 2D1NA 1Q3AA 1SLMA 4QKZA 2X3CA 4FU4A 3LEAA 4PKSA 2ERPA 3DNGA 1OS9A 3BA0A 4IN9A 1J7NA 1QJJA 1XUDA 1CQRA 1D8FA 3F19A 3HY9A 1ZXVA 2OVXA 2PJTA 3P1VA 3F17A 1BQOA 3HBUP 1IAEA 4GR3A 1BSWA 1EB6A 2W12A 4GR0A 1QIBA 1MMRA 1KBCA 4GF1A 2W0DA 1G49A 4H1QA 2OW0A 1IAAA 3AYKA 1KUIA 3NX7A 4EFSA 1TVIA 3UVCA 1PWVA 1Y93A 3ZUKA 5B5PA 4PKTA 1R54A 1Y0VA 3EWJA 1L6JA 4PKQA 4XM6A 1SATA 1H71P 2OXZA 1B8YA 1G12A 1Y8JA 2EROA 3K7NA 1JANA 2DDYA 1PWUA 1EAKA 3F15A 1CGFA 2WOAA 4XM8A 4IJOA 3EDZA 3HB2P 3EHXA 1ASTA 1R1HA 3L0TA 3O64A 1EUBA 3KEKA 5H8XA 1BKCI 4JIJA 1JK3A 1BKCE 3LK8A 4DF9A 1R1JA 2RJQA 4DPEA 3P24A 5I43A 1JAOA 2DW2A 1RMZA 3USNA 1OZ9A 2MZIA 1JKYA 1IACA 4J4MA 3LJGA 4G9LA 5I0LA 2YIGA 1YP1A 1HY7A 4WK7A 5I4OA 4PKUA 1D8MA 2MLSA 3LILA 4JQGA 1GO8P 1KAPP 2OY4A 1SRPA 1USNA 3KMEA 2USNA 1FBLA 2YUFA 1PWQA 1KUKA 3B8ZA 2AIGP 1GKDA 4A3WA 1JJ9A 1ZS0A 1HV5A 1XM5A 1O0QA 1YOUA 1BKCA 3LMCA 4AUOA 3N2VA 5BOTA 1OM7A 1AKLA 5CZMA 4L7AA 1XFYA 5CUHA 4R3VA 3DL1A 5CXAA 1JAPA 1GE7A 3EDIA 4H49A 1KUHA 1I73A 3HBVP 1ZTQA 3Q2HA 1ROSA 1PWWA 1IADA 3LUNA 1I76A 1QICA 1CK7A 5I12A 3EHYA 4A7BA 3G5CA 3ZVSA 1XURA 2Y6CA 1SMPA 3KRYA 2JSDA 4GR8A 456CA 1KUFA 1KUGA 2MZEA 2DDFA 1O0TA 4GWMA 3AIGA 2K9CA 1CIZA 4PKWA 3OHLA 5D1UA 4CTHA 5D7WA 830CA 2W14A 1BZSA 1XFWA 1G4KA 1ATLA 3LE9A 2DW0A 3HDAP 4WZVA 3CKIA 4HMAA 2OXUA 1XFUA 1B3DA 1QUAA 1YCMA 2YB9A 1AF0A 1CAQA 1JH1A 1C7KA 4XCTA 2HU6A 2POJA 1BM6A 4H82A 2FV5A 1D7XA 4I35A 1OS2A 1GO7P 3HY7A 1MMQA 3RTSA 4GWNA 4WF6A 1OM8A 5D3CA 3KEJA 2W13A 3B92A 1GE5A 1FM1A 2TCLA 4Q1LA 1UEAA 1BQQM 1G9KA 3AYUA 3U1RA 4H2EA 3I7GA 1XAXA 1JAQA 4WKEA 1JIWP 2OW1A 5B5OA 3EDGA 2XS3A 3WV2A 1SU3A 2E3XA 1YQYA 3LJTA 4ON1A 4H84A 1DTHA 1DMTA 1K7QA 2OZRA 3KECA 4L6TA 1R55A 2D1OA 2OI0A 2MZHA 4ZR5A 3KMCA 2OXWA 1K7GA 2X3AA 2K2GA 1I1IP 4XBHA 1BUVM 1CGLA 1ZXCA 3DSLA 1A86A 2AYKA 5D1SA 4PKVA 4JP4A 2L0RA 3F1AA 1ZVXA 4PKRA 3G42A 4GQLA 1OM6A 3OHOA 2X3BA 5D1TA 3DTKA 3DPEA 3F18A 4AIGA 4DD8A 2OY2A 5JMYA 1ZP5A 1UMTA 1UTTA 3N2UA 1IAGA 2J0TA 2FV9A 2O3EA 5BPAA 3E8RA 4JPAA 4JA1A 1RM8A 2WO9A 3V96B 3TSKA 1D5JA 2DW1A 5BOYA 1CXVA 2JIHA 2QPJA 5I3MA 2ERQA 4H76A 1UMSA 3ELMA 4H30A 2J83A 2A8HA 2CLTA 1S4BP 3KWVC 3B2ZA 3LKAA 3DPFA 1XFVA 1A85A 1WNIA 2X7MA 4GUYA 1JIZA 3LIKA 4WKIA 1MMPA 1HFCA 3SHIA 1BUDA 4AYKA 3LIRA 966CA 3LUMA 5I2ZA 1K7IA 4FXQA 1MNCA 4ILWD 1PWPA 1C3IA 3L0VA
chains in the Genus database with same CATH topology
3MA2A 1FLSA 1OMJA 1UTZA 2I47A 2MLRA 3TS4A 4L63A 3GBOA 3WV1A 2OW9A 4FXYP 3ZXHA 1Z3JA 4IUWA 3LQBA 5L7FA 2KRJA 2SRTA 1QJIA 2JT6A 1IABA 3VTGA 3EDHA 3DTEA 4FVLA 2JNPA 2N8RA 2W15A 3DTIA 1HTDA 4H3XA 1AYKA 1CGEA 2WO8A 1GE6A 1ND1A 4XM7A 4L19A 1G05A 3O2XA 1XUCA 4I03A 1SLNA 4HX3A 5L79A 1HFSA 3LJZA 4G0DA 1GXDA 1OO9A 2V4BA 2OW2A 1R1IA 1BIWA 3LQ0A 3F16A 2E2DA 1C8TA 2Z2DA 2JT5A 1XFZA 2XS4A 3VI1A 3TVCA 3WV3A 1XFXA 3HYGA 1GKCA 3KHIA 3LGPA 1MMBA 3K7LA 2Y6DA 2RJPA 4AXQA 3Q2GA 5D2BA 3DWBA 4DV8A 2OVZA 2CKIA 3HDBA 1HOVA 3TT4A 3I7IA 3RTTA 2O36A 1QIAA 5LABA 2D1NA 1Q3AA 1SLMA 4QKZA 2X3CA 4FU4A 3LEAA 4PKSA 2ERPA 3DNGA 1OS9A 3BA0A 4IN9A 1J7NA 1QJJA 1XUDA 1CQRA 1D8FA 3F19A 3HY9A 1ZXVA 2OVXA 2PJTA 3P1VA 3F17A 1BQOA 3HBUP 1IAEA 4GR3A 1BSWA 1EB6A 2W12A 4GR0A 1QIBA 1MMRA 1KBCA 4GF1A 2W0DA 1G49A 4H1QA 2OW0A 1IAAA 3AYKA 1KUIA 3NX7A 4EFSA 3UVCA 1PWVA 1Y93A 3ZUKA 5B5PA 4PKTA 1R54A 1Y0VA 3EWJA 1L6JA 4PKQA 4XM6A 1SATA 1H71P 2OXZA 1B8YA 1G12A 1Y8JA 2EROA 3K7NA 1JANA 2DDYA 1PWUA 1EAKA 3F15A 1CGFA 2WOAA 4XM8A 4IJOA 3EDZA 3HB2P 3EHXA 1ASTA 1R1HA 3L0TA 3O64A 1EUBA 3KEKA 5H8XA 1BKCI 4JIJA 1JK3A 1BKCE 3LK8A 4DF9A 1R1JA 2RJQA 4DPEA 3P24A 5I43A 1JAOA 2DW2A 1RMZA 3USNA 2MZIA 1JKYA 1IACA 4J4MA 3LJGA 4G9LA 5I0LA 2YIGA 1YP1A 1HY7A 4WK7A 5I4OA 4PKUA 1D8MA 2MLSA 3LILA 4JQGA 1GO8P 1KAPP 2OY4A 1SRPA 1USNA 3KMEA 2USNA 1FBLA 2YUFA 1PWQA 1KUKA 3B8ZA 2AIGP 1GKDA 4A3WA 1JJ9A 1ZS0A 1HV5A 1O0QA 1YOUA 1BKCA 3LMCA 4AUOA 3N2VA 5BOTA 1OM7A 1AKLA 5CZMA 4L7AA 1XFYA 5CUHA 4R3VA 3DL1A 5CXAA 1JAPA 1GE7A 3EDIA 4H49A 1KUHA 1I73A 3HBVP 1ZTQA 3Q2HA 1ROSA 1PWWA 1IADA 3LUNA 1I76A 1QICA 1CK7A 5I12A 3EHYA 4A7BA 3G5CA 3ZVSA 1XURA 2Y6CA 1SMPA 3KRYA 2JSDA 4GR8A 456CA 1KUFA 1KUGA 2MZEA 2DDFA 1O0TA 4GWMA 3AIGA 2K9CA 1CIZA 4PKWA 3OHLA 5D1UA 4CTHA 5D7WA 830CA 2W14A 1BZSA 1XFWA 1G4KA 1ATLA 3LE9A 2DW0A 3HDAP 4WZVA 3CKIA 4HMAA 2OXUA 1XFUA 1B3DA 1QUAA 1YCMA 2YB9A 1AF0A 1CAQA 1JH1A 1C7KA 4XCTA 2HU6A 2POJA 1BM6A 4H82A 2FV5A 1D7XA 4I35A 1OS2A 1GO7P 3HY7A 1MMQA 3RTSA 4GWNA 4WF6A 1OM8A 5D3CA 3KEJA 2W13A 3B92A 1GE5A 1FM1A 2TCLA 4Q1LA 1UEAA 1BQQM 1G9KA 3AYUA 3U1RA 4H2EA 3I7GA 1JAQA 4WKEA 1JIWP 2OW1A 5B5OA 3EDGA 2XS3A 3WV2A 1SU3A 2E3XA 1YQYA 3LJTA 4ON1A 4H84A 1DTHA 1DMTA 1K7QA 2OZRA 3KECA 4L6TA 1R55A 2D1OA 2OI0A 2MZHA 4ZR5A 3KMCA 2OXWA 1K7GA 2X3AA 2K2GA 1I1IP 4XBHA 1BUVM 1CGLA 1ZXCA 3DSLA 1A86A 2AYKA 5D1SA 4PKVA 4JP4A 2L0RA 3F1AA 1ZVXA 4PKRA 3G42A 4GQLA 1OM6A 3OHOA 2X3BA 5D1TA 3DTKA 3DPEA 3F18A 4AIGA 4DD8A 2OY2A 5JMYA 1ZP5A 1UMTA 1UTTA 3N2UA 1IAGA 2J0TA 2FV9A 2O3EA 5BPAA 3E8RA 4JPAA 4JA1A 1RM8A 2WO9A 3V96B 3TSKA 1D5JA 2DW1A 5BOYA 1CXVA 2JIHA 2QPJA 5I3MA 2ERQA 4H76A 1UMSA 3ELMA 4H30A 2J83A 2A8HA 2CLTA 1S4BP 3KWVC 3B2ZA 3LKAA 3DPFA 1XFVA 1A85A 1WNIA 2X7MA 4GUYA 1JIZA 3LIKA 4WKIA 1MMPA 1HFCA 3SHIA 1BUDA 4AYKA 3LIRA 966CA 3LUMA 5I2ZA 1K7IA 4FXQA 1MNCA 4ILWD 1PWPA 1C3IA 3L0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MA2 A;  1FLS A;  1OMJ A;  1UTZ A;  2I47 A;  2MLR A;  3TS4 A;  4L63 A;  3GBO A;  3WV1 A;  2OW9 A;  4FXY P;  3ZXH A;  1Z3J A;  4IUW A;  3LQB A;  5L7F A;  2KRJ A;  2SRT A;  1QJI A;  2JT6 A;  1IAB A;  3VTG A;  3EDH A;  4FVL A;  2JNP A;  2N8R A;  2W15 A;  1HTD A;  4H3X A;  1AYK A;  1CGE A;  2WO8 A;  1GE6 A;  1ND1 A;  4XM7 A;  4L19 A;  1G05 A;  3O2X A;  1XUC A;  4I03 A;  1SLN A;  4HX3 A;  5L79 A;  1HFS A;  3LJZ A;  4G0D A;  1GXD A;  1OO9 A;  2V4B A;  2OW2 A;  1R1I A;  1BIW A;  3LQ0 A;  3F16 A;  2E2D A;  1C8T A;  2Z2D A;  2JT5 A;  1XFZ A;  2XS4 A;  3VI1 A;  3TVC A;  3WV3 A;  1XFX A;  3HYG A;  1GKC A;  3KHI A;  3LGP A;  1MMB A;  3K7L A;  2Y6D A;  2RJP A;  4AXQ A;  3Q2G A;  5D2B A;  3DWB A;  4DV8 A;  2OVZ A;  2CKI A;  3HDB A;  1HOV A;  3TT4 A;  3I7I A;  3RTT A;  2O36 A;  1QIA A;  5LAB A;  2D1N A;  1Q3A A;  1SLM A;  4QKZ A;  2X3C A;  4FU4 A;  3LEA A;  4PKS A;  2ERP A;  3DNG A;  1OS9 A;  3BA0 A;  4IN9 A;  1J7N A;  1QJJ A;  1XUD A;  1CQR A;  1D8F A;  3F19 A;  3HY9 A;  1ZXV A;  2OVX A;  2PJT A;  3P1V A;  3F17 A;  1BQO A;  3HBU P;  1IAE A;  4GR3 A;  1BSW A;  1EB6 A;  2W12 A;  4GR0 A;  1QIB A;  1MMR A;  1KBC A;  4GF1 A;  2W0D A;  1G49 A;  4H1Q A;  2OW0 A;  1IAA A;  3AYK A;  1KUI A;  3NX7 A;  4EFS A;  3UVC A;  1PWV A;  1Y93 A;  3ZUK A;  5B5P A;  4PKT A;  1R54 A;  1Y0V A;  3EWJ A;  1L6J A;  4PKQ A;  4XM6 A;  1SAT A;  1H71 P;  2OXZ A;  1B8Y A;  1G12 A;  1Y8J A;  2ERO A;  3K7N A;  1JAN A;  2DDY A;  1PWU A;  1EAK A;  3F15 A;  1CGF A;  2WOA A;  4XM8 A;  4IJO A;  3EDZ A;  3HB2 P;  3EHX A;  1AST A;  1R1H A;  3L0T A;  3O64 A;  1EUB A;  3KEK A;  5H8X A;  1BKC I;  4JIJ A;  1JK3 A;  1BKC E;  3LK8 A;  4DF9 A;  1R1J A;  2RJQ A;  4DPE A;  3P24 A;  5I43 A;  1JAO A;  2DW2 A;  1RMZ A;  3USN A;  2MZI A;  1JKY A;  1IAC A;  4J4M A;  3LJG A;  4G9L A;  5I0L A;  2YIG A;  1YP1 A;  1HY7 A;  4WK7 A;  5I4O A;  4PKU A;  1D8M A;  2MLS A;  3LIL A;  4JQG A;  1GO8 P;  1KAP P;  2OY4 A;  1SRP A;  1USN A;  2USN A;  3KME A;  1FBL A;  1PWQ A;  1KUK A;  3B8Z A;  2AIG P;  1GKD A;  4A3W A;  1JJ9 A;  1ZS0 A;  1HV5 A;  1O0Q A;  1YOU A;  1BKC A;  3LMC A;  4AUO A;  3N2V A;  5BOT A;  1OM7 A;  1AKL A;  5CZM A;  5CUH A;  1XFY A;  4R3V A;  3DL1 A;  5CXA A;  1JAP A;  1GE7 A;  3EDI A;  4H49 A;  1KUH A;  1I73 A;  3HBV P;  1ZTQ A;  3Q2H A;  1ROS A;  1PWW A;  1IAD A;  3LUN A;  1I76 A;  1QIC A;  1CK7 A;  5I12 A;  3EHY A;  4A7B A;  3G5C A;  3ZVS A;  1XUR A;  2Y6C A;  1SMP A;  3KRY A;  2JSD A;  4GR8 A;  456C A;  1KUF A;  1KUG A;  2MZE A;  2DDF A;  1O0T A;  4GWM A;  3AIG A;  2K9C A;  1CIZ A;  4PKW A;  3OHL A;  5D1U A;  4CTH A;  5D7W A;  830C A;  2W14 A;  1BZS A;  1XFW A;  1G4K A;  1ATL A;  3LE9 A;  2DW0 A;  3HDA P;  4WZV A;  3CKI A;  4HMA A;  2OXU A;  1XFU A;  1B3D A;  1QUA A;  1YCM A;  2YB9 A;  1AF0 A;  1CAQ A;  1JH1 A;  1C7K A;  4XCT A;  2HU6 A;  2POJ A;  1BM6 A;  4H82 A;  2FV5 A;  1D7X A;  4I35 A;  1OS2 A;  1GO7 P;  3HY7 A;  1MMQ A;  3RTS A;  4GWN A;  4WF6 A;  1OM8 A;  5D3C A;  3KEJ A;  2W13 A;  3B92 A;  1GE5 A;  1FM1 A;  2TCL A;  4Q1L A;  1UEA A;  1BQQ M;  1G9K A;  3AYU A;  3U1R A;  4H2E A;  3I7G A;  1JAQ A;  4WKE A;  1JIW P;  2OW1 A;  5B5O A;  3EDG A;  2XS3 A;  3WV2 A;  1SU3 A;  2E3X A;  1YQY A;  3LJT A;  4ON1 A;  4H84 A;  1DTH A;  1DMT A;  1K7Q A;  2OZR A;  3KEC A;  4L6T A;  1R55 A;  2D1O A;  2OI0 A;  2MZH A;  4ZR5 A;  3KMC A;  2OXW A;  1K7G A;  2X3A A;  2K2G A;  1I1I P;  4XBH A;  1BUV M;  1CGL A;  1ZXC A;  3DSL A;  1A86 A;  2AYK A;  5D1S A;  4PKV A;  4JP4 A;  2L0R A;  3F1A A;  1ZVX A;  4PKR A;  3G42 A;  4GQL A;  1OM6 A;  3OHO A;  2X3B A;  5D1T A;  3DPE A;  3F18 A;  4AIG A;  4DD8 A;  2OY2 A;  5JMY A;  1ZP5 A;  1UMT A;  1UTT A;  3N2U A;  1IAG A;  2J0T A;  2FV9 A;  2O3E A;  5BPA A;  3E8R A;  4JPA A;  4JA1 A;  1RM8 A;  2WO9 A;  3V96 B;  3TSK A;  1D5J A;  2DW1 A;  5BOY A;  1CXV A;  2JIH A;  2QPJ A;  5I3M A;  2ERQ A;  4H76 A;  1UMS A;  3ELM A;  4H30 A;  2J83 A;  2A8H A;  2CLT A;  1S4B P;  3KWV C;  3B2Z A;  3LKA A;  3DPF A;  1XFV A;  1A85 A;  1WNI A;  2X7M A;  4GUY A;  1JIZ A;  3LIK A;  4WKI A;  1MMP A;  1HFC A;  3SHI A;  1BUD A;  4AYK A;  3LIR A;  966C A;  3LUM A;  5I2Z A;  1K7I A;  4FXQ A;  1MNC A;  4ILW D;  1PWP A;  1C3I A;  3L0V A; 
#chains in the Genus database with same CATH topology
 3MA2 A;  1FLS A;  1OMJ A;  1UTZ A;  2I47 A;  2MLR A;  3TS4 A;  4L63 A;  3GBO A;  3WV1 A;  2OW9 A;  4FXY P;  3ZXH A;  1Z3J A;  4IUW A;  3LQB A;  5L7F A;  2KRJ A;  2SRT A;  1QJI A;  2JT6 A;  1IAB A;  3VTG A;  3EDH A;  3DTE A;  4FVL A;  2JNP A;  2N8R A;  2W15 A;  3DTI A;  1HTD A;  4H3X A;  1AYK A;  1CGE A;  2WO8 A;  1GE6 A;  1ND1 A;  4XM7 A;  4L19 A;  1G05 A;  3O2X A;  1XUC A;  4I03 A;  1SLN A;  4HX3 A;  5L79 A;  1HFS A;  3LJZ A;  4G0D A;  1GXD A;  1OO9 A;  2V4B A;  2OW2 A;  1R1I A;  1BIW A;  3LQ0 A;  3F16 A;  2E2D A;  1C8T A;  2Z2D A;  2JT5 A;  1XFZ A;  2XS4 A;  3VI1 A;  3TVC A;  3WV3 A;  1XFX A;  3HYG A;  1GKC A;  3KHI A;  3LGP A;  1MMB A;  3K7L A;  2Y6D A;  2RJP A;  4AXQ A;  3Q2G A;  5D2B A;  3DWB A;  4DV8 A;  2OVZ A;  2CKI A;  3HDB A;  1HOV A;  3TT4 A;  3I7I A;  3RTT A;  2O36 A;  1QIA A;  5LAB A;  2D1N A;  1Q3A A;  1SLM A;  4QKZ A;  2X3C A;  4FU4 A;  3LEA A;  4PKS A;  2ERP A;  3DNG A;  1OS9 A;  3BA0 A;  4IN9 A;  1J7N A;  1QJJ A;  1XUD A;  1CQR A;  1D8F A;  3F19 A;  3HY9 A;  1ZXV A;  2OVX A;  2PJT A;  3P1V A;  3F17 A;  1BQO A;  3HBU P;  1IAE A;  4GR3 A;  1BSW A;  1EB6 A;  2W12 A;  4GR0 A;  1QIB A;  1MMR A;  1KBC A;  4GF1 A;  2W0D A;  1G49 A;  4H1Q A;  2OW0 A;  1IAA A;  3AYK A;  1KUI A;  3NX7 A;  4EFS A;  1TVI A;  3UVC A;  1PWV A;  1Y93 A;  3ZUK A;  5B5P A;  4PKT A;  1R54 A;  1Y0V A;  3EWJ A;  1L6J A;  4PKQ A;  4XM6 A;  1SAT A;  1H71 P;  2OXZ A;  1B8Y A;  1G12 A;  1Y8J A;  2ERO A;  3K7N A;  1JAN A;  2DDY A;  1PWU A;  1EAK A;  3F15 A;  1CGF A;  2WOA A;  4XM8 A;  4IJO A;  3EDZ A;  3HB2 P;  3EHX A;  1AST A;  1R1H A;  3L0T A;  3O64 A;  1EUB A;  3KEK A;  5H8X A;  1BKC I;  4JIJ A;  1JK3 A;  1BKC E;  3LK8 A;  4DF9 A;  1R1J A;  2RJQ A;  4DPE A;  3P24 A;  5I43 A;  1JAO A;  2DW2 A;  1RMZ A;  3USN A;  1OZ9 A;  2MZI A;  1JKY A;  1IAC A;  4J4M A;  3LJG A;  4G9L A;  5I0L A;  2YIG A;  1YP1 A;  1HY7 A;  4WK7 A;  5I4O A;  4PKU A;  1D8M A;  2MLS A;  3LIL A;  4JQG A;  1GO8 P;  1KAP P;  2OY4 A;  1SRP A;  1USN A;  3KME A;  2USN A;  1FBL A;  2YUF A;  1PWQ A;  1KUK A;  3B8Z A;  2AIG P;  1GKD A;  4A3W A;  1JJ9 A;  1ZS0 A;  1HV5 A;  1XM5 A;  1O0Q A;  1YOU A;  1BKC A;  3LMC A;  4AUO A;  3N2V A;  5BOT A;  1OM7 A;  1AKL A;  5CZM A;  4L7A A;  1XFY A;  5CUH A;  4R3V A;  3DL1 A;  5CXA A;  1JAP A;  1GE7 A;  3EDI A;  4H49 A;  1KUH A;  1I73 A;  3HBV P;  1ZTQ A;  3Q2H A;  1ROS A;  1PWW A;  1IAD A;  3LUN A;  1I76 A;  1QIC A;  1CK7 A;  5I12 A;  3EHY A;  4A7B A;  3G5C A;  3ZVS A;  1XUR A;  2Y6C A;  1SMP A;  3KRY A;  2JSD A;  4GR8 A;  456C A;  1KUF A;  1KUG A;  2MZE A;  2DDF A;  1O0T A;  4GWM A;  3AIG A;  2K9C A;  1CIZ A;  4PKW A;  3OHL A;  5D1U A;  4CTH A;  5D7W A;  830C A;  2W14 A;  1BZS A;  1XFW A;  1G4K A;  1ATL A;  3LE9 A;  2DW0 A;  3HDA P;  4WZV A;  3CKI A;  4HMA A;  2OXU A;  1XFU A;  1B3D A;  1QUA A;  1YCM A;  2YB9 A;  1AF0 A;  1CAQ A;  1JH1 A;  1C7K A;  4XCT A;  2HU6 A;  2POJ A;  1BM6 A;  4H82 A;  2FV5 A;  1D7X A;  4I35 A;  1OS2 A;  1GO7 P;  3HY7 A;  1MMQ A;  3RTS A;  4GWN A;  4WF6 A;  1OM8 A;  5D3C A;  3KEJ A;  2W13 A;  3B92 A;  1GE5 A;  1FM1 A;  2TCL A;  4Q1L A;  1UEA A;  1BQQ M;  1G9K A;  3AYU A;  3U1R A;  4H2E A;  3I7G A;  1XAX A;  1JAQ A;  4WKE A;  1JIW P;  2OW1 A;  5B5O A;  3EDG A;  2XS3 A;  3WV2 A;  1SU3 A;  2E3X A;  1YQY A;  3LJT A;  4ON1 A;  4H84 A;  1DTH A;  1DMT A;  1K7Q A;  2OZR A;  3KEC A;  4L6T A;  1R55 A;  2D1O A;  2OI0 A;  2MZH A;  4ZR5 A;  3KMC A;  2OXW A;  1K7G A;  2X3A A;  2K2G A;  1I1I P;  4XBH A;  1BUV M;  1CGL A;  1ZXC A;  3DSL A;  1A86 A;  2AYK A;  5D1S A;  4PKV A;  4JP4 A;  2L0R A;  3F1A A;  1ZVX A;  4PKR A;  3G42 A;  4GQL A;  1OM6 A;  3OHO A;  2X3B A;  5D1T A;  3DTK A;  3DPE A;  3F18 A;  4AIG A;  4DD8 A;  2OY2 A;  5JMY A;  1ZP5 A;  1UMT A;  1UTT A;  3N2U A;  1IAG A;  2J0T A;  2FV9 A;  2O3E A;  5BPA A;  3E8R A;  4JPA A;  4JA1 A;  1RM8 A;  2WO9 A;  3V96 B;  3TSK A;  1D5J A;  2DW1 A;  5BOY A;  1CXV A;  2JIH A;  2QPJ A;  5I3M A;  2ERQ A;  4H76 A;  1UMS A;  3ELM A;  4H30 A;  2J83 A;  2A8H A;  2CLT A;  1S4B P;  3KWV C;  3B2Z A;  3LKA A;  3DPF A;  1XFV A;  1A85 A;  1WNI A;  2X7M A;  4GUY A;  1JIZ A;  3LIK A;  4WKI A;  1MMP A;  1HFC A;  3SHI A;  1BUD A;  4AYK A;  3LIR A;  966C A;  3LUM A;  5I2Z A;  1K7I A;  4FXQ A;  1MNC A;  4ILW D;  1PWP A;  1C3I A;  3L0V A; 
#chains in the Genus database with same CATH homology
 3MA2 A;  1FLS A;  1OMJ A;  1UTZ A;  2I47 A;  2MLR A;  3TS4 A;  4L63 A;  3GBO A;  3WV1 A;  2OW9 A;  4FXY P;  3ZXH A;  1Z3J A;  4IUW A;  3LQB A;  5L7F A;  2KRJ A;  2SRT A;  1QJI A;  2JT6 A;  1IAB A;  3VTG A;  3EDH A;  3DTE A;  4FVL A;  2JNP A;  2N8R A;  2W15 A;  3DTI A;  1HTD A;  4H3X A;  1AYK A;  1CGE A;  2WO8 A;  1GE6 A;  1ND1 A;  4XM7 A;  4L19 A;  1G05 A;  3O2X A;  1XUC A;  4I03 A;  1SLN A;  4HX3 A;  5L79 A;  1HFS A;  3LJZ A;  4G0D A;  1GXD A;  1OO9 A;  2V4B A;  2OW2 A;  1R1I A;  1BIW A;  3LQ0 A;  3F16 A;  2E2D A;  1C8T A;  2Z2D A;  2JT5 A;  1XFZ A;  2XS4 A;  3VI1 A;  3TVC A;  3WV3 A;  1XFX A;  3HYG A;  1GKC A;  3KHI A;  3LGP A;  1MMB A;  3K7L A;  2Y6D A;  2RJP A;  4AXQ A;  3Q2G A;  5D2B A;  3DWB A;  4DV8 A;  2OVZ A;  2CKI A;  3HDB A;  1HOV A;  3TT4 A;  3I7I A;  3RTT A;  2O36 A;  1QIA A;  5LAB A;  2D1N A;  1Q3A A;  1SLM A;  4QKZ A;  2X3C A;  4FU4 A;  3LEA A;  4PKS A;  2ERP A;  3DNG A;  1OS9 A;  3BA0 A;  4IN9 A;  1J7N A;  1QJJ A;  1XUD A;  1CQR A;  1D8F A;  3F19 A;  3HY9 A;  1ZXV A;  2OVX A;  2PJT A;  3P1V A;  3F17 A;  1BQO A;  3HBU P;  1IAE A;  4GR3 A;  1BSW A;  1EB6 A;  2W12 A;  4GR0 A;  1QIB A;  1MMR A;  1KBC A;  4GF1 A;  2W0D A;  1G49 A;  4H1Q A;  2OW0 A;  1IAA A;  3AYK A;  1KUI A;  3NX7 A;  4EFS A;  3UVC A;  1PWV A;  1Y93 A;  3ZUK A;  5B5P A;  4PKT A;  1R54 A;  1Y0V A;  3EWJ A;  1L6J A;  4PKQ A;  4XM6 A;  1SAT A;  1H71 P;  2OXZ A;  1B8Y A;  1G12 A;  1Y8J A;  2ERO A;  3K7N A;  1JAN A;  2DDY A;  1PWU A;  1EAK A;  3F15 A;  1CGF A;  2WOA A;  4XM8 A;  4IJO A;  3EDZ A;  3HB2 P;  3EHX A;  1AST A;  1R1H A;  3L0T A;  3O64 A;  1EUB A;  3KEK A;  5H8X A;  1BKC I;  4JIJ A;  1JK3 A;  1BKC E;  3LK8 A;  4DF9 A;  1R1J A;  2RJQ A;  4DPE A;  3P24 A;  5I43 A;  1JAO A;  2DW2 A;  1RMZ A;  3USN A;  2MZI A;  1JKY A;  1IAC A;  4J4M A;  3LJG A;  4G9L A;  5I0L A;  2YIG A;  1YP1 A;  1HY7 A;  4WK7 A;  5I4O A;  4PKU A;  1D8M A;  2MLS A;  3LIL A;  4JQG A;  1GO8 P;  1KAP P;  2OY4 A;  1SRP A;  1USN A;  3KME A;  2USN A;  1FBL A;  2YUF A;  1PWQ A;  1KUK A;  3B8Z A;  2AIG P;  1GKD A;  4A3W A;  1JJ9 A;  1ZS0 A;  1HV5 A;  1O0Q A;  1YOU A;  1BKC A;  3LMC A;  4AUO A;  3N2V A;  5BOT A;  1OM7 A;  1AKL A;  5CZM A;  4L7A A;  1XFY A;  5CUH A;  4R3V A;  3DL1 A;  5CXA A;  1JAP A;  1GE7 A;  3EDI A;  4H49 A;  1KUH A;  1I73 A;  3HBV P;  1ZTQ A;  3Q2H A;  1ROS A;  1PWW A;  1IAD A;  3LUN A;  1I76 A;  1QIC A;  1CK7 A;  5I12 A;  3EHY A;  4A7B A;  3G5C A;  3ZVS A;  1XUR A;  2Y6C A;  1SMP A;  3KRY A;  2JSD A;  4GR8 A;  456C A;  1KUF A;  1KUG A;  2MZE A;  2DDF A;  1O0T A;  4GWM A;  3AIG A;  2K9C A;  1CIZ A;  4PKW A;  3OHL A;  5D1U A;  4CTH A;  5D7W A;  830C A;  2W14 A;  1BZS A;  1XFW A;  1G4K A;  1ATL A;  3LE9 A;  2DW0 A;  3HDA P;  4WZV A;  3CKI A;  4HMA A;  2OXU A;  1XFU A;  1B3D A;  1QUA A;  1YCM A;  2YB9 A;  1AF0 A;  1CAQ A;  1JH1 A;  1C7K A;  4XCT A;  2HU6 A;  2POJ A;  1BM6 A;  4H82 A;  2FV5 A;  1D7X A;  4I35 A;  1OS2 A;  1GO7 P;  3HY7 A;  1MMQ A;  3RTS A;  4GWN A;  4WF6 A;  1OM8 A;  5D3C A;  3KEJ A;  2W13 A;  3B92 A;  1GE5 A;  1FM1 A;  2TCL A;  4Q1L A;  1UEA A;  1BQQ M;  1G9K A;  3AYU A;  3U1R A;  4H2E A;  3I7G A;  1JAQ A;  4WKE A;  1JIW P;  2OW1 A;  5B5O A;  3EDG A;  2XS3 A;  3WV2 A;  1SU3 A;  2E3X A;  1YQY A;  3LJT A;  4ON1 A;  4H84 A;  1DTH A;  1DMT A;  1K7Q A;  2OZR A;  3KEC A;  4L6T A;  1R55 A;  2D1O A;  2OI0 A;  2MZH A;  4ZR5 A;  3KMC A;  2OXW A;  1K7G A;  2X3A A;  2K2G A;  1I1I P;  4XBH A;  1BUV M;  1CGL A;  1ZXC A;  3DSL A;  1A86 A;  2AYK A;  5D1S A;  4PKV A;  4JP4 A;  2L0R A;  3F1A A;  1ZVX A;  4PKR A;  3G42 A;  4GQL A;  1OM6 A;  3OHO A;  2X3B A;  5D1T A;  3DTK A;  3DPE A;  3F18 A;  4AIG A;  4DD8 A;  2OY2 A;  5JMY A;  1ZP5 A;  1UMT A;  1UTT A;  3N2U A;  1IAG A;  2J0T A;  2FV9 A;  2O3E A;  5BPA A;  3E8R A;  4JPA A;  4JA1 A;  1RM8 A;  2WO9 A;  3V96 B;  3TSK A;  1D5J A;  2DW1 A;  5BOY A;  1CXV A;  2JIH A;  2QPJ A;  5I3M A;  2ERQ A;  4H76 A;  1UMS A;  3ELM A;  4H30 A;  2J83 A;  2A8H A;  2CLT A;  1S4B P;  3KWV C;  3B2Z A;  3LKA A;  3DPF A;  1XFV A;  1A85 A;  1WNI A;  2X7M A;  4GUY A;  1JIZ A;  3LIK A;  4WKI A;  1MMP A;  1HFC A;  3SHI A;  1BUD A;  4AYK A;  3LIR A;  966C A;  3LUM A;  5I2Z A;  1K7I A;  4FXQ A;  1MNC A;  4ILW D;  1PWP A;  1C3I A;  3L0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...