5I4OA

Crystal structure of the catalytic domain of mmp-12 in complex with a selective sugar-conjugated triazole-linked carboxylate zinc-chelator water-soluble inhibitor (dc28).
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
156
structure length
156
Chain Sequence
VWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHQIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Sugar-Based Arylsulfonamide Carboxylates as Selective and Water-Soluble Matrix Metalloproteinase-12 Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 156
sequence length 156
chains with identical sequence B, C, D
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 5i4oA00
3HY7A 2OZRA 3ZUKA 1ZXVA 1XURA 3DNGA 5CXAA 1BSWA 1H71P 2J0TA 1XFWA 2D1NA 2JNPA 4H1QA 3EWJA 5I12A 1PWPA 2EROA 3B8ZA 3OHLA 1D7XA 1SATA 1ZTQA 2K2GA 3USNA 1BIWA 2OW2A 1KBCA 5BOTA 3TT4A 1FLSA 1Z3JA 1OO9A 5LABA 1BKCI 1CIZA 1D8MA 2YB9A 1A86A 3DPFA 2YIGA 2DW2A 1JIWP 1JJ9A 1R1HA 2OVZA 2W13A 1HTDA 4JQGA 1WNIA 2MLRA 1ASTA 1R1JA 4IUWA 1R55A 1ZXCA 3HBVP 2X3BA 4L19A 3UVCA 3F15A 4FXQA 1UEAA 1ROSA 966CA 1GXDA 1SLNA 1XUDA 1SMPA 1J7NA 3KWVC 1KUFA 3RTTA 4WF6A 2QPJA 2DW0A 2MZEA 5JMYA 1JAQA 1MMPA 1B3DA 5I2ZA 1YOUA 3LK8A 1GE5A 3KMEA 3TVCA 3LGPA 4A3WA 1IAAA 1SU3A 1XFVA 4L6TA 3I7IA 4PKRA 2MLSA 3EDHA 3KHIA 3AIGA 1MNCA 4WZVA 1KUIA 1HV5A 1Y0VA 4DV8A 1OS9A 4R3VA 2D1OA 5BOYA 4H49A 4XBHA 3AYUA 3V96B 4H30A 4DD8A 1DTHA 1C7KA 3DSLA 3LEAA 4GWMA 3E8RA 1AYKA 3LQ0A 1O0TA 1JANA 4WKIA 2CKIA 2W14A 1OMJA 5I4OA 1ND1A 1B8YA 3VTGA 3KEKA 4CTHA 1G4KA 1YP1A 1G12A 1UTTA 1R54A 4XM6A 1I1IP 2HU6A 2USNA 4PKWA 1BKCE 2Y6DA 1AF0A 5H8XA 1CGFA 1R1IA 2L0RA 4PKTA 4XM8A 4J4MA 3P1VA 1ZVXA 1KUKA 3LJZA 3B92A 1BZSA 3G42A 3EHXA 3O2XA 3K7LA 1PWVA 4IN9A 5D1TA 3NX7A 1FM1A 3LIKA 4H84A 4PKUA 3KMCA 2N8RA 4GWNA 1S4BP 1IABA 4A7BA 2SRTA 1JKYA 2CLTA 5D7WA 3L0TA 1EB6A 1BKCA 4H2EA 2FV5A 1JAOA 1IAEA 3HDBA 3LILA 1ATLA 2JT5A 1HFCA 4HX3A 1GKDA 3F17A 1CGLA 2AYKA 2OI0A 4GR8A 2FV9A 2X7MA 3G5CA 1CAQA 4G0DA 3GBOA 3LUMA 1A85A 4XCTA 5B5PA 3K7NA 3LQBA 1BQOA 3HB2P 4PKVA 1EUBA 4FXYP 1SLMA 2Y6CA 1XFUA 3EHYA 3Q2HA 3LJGA 3EDIA 1OM6A 4QKZA 1IACA 1JAPA 1G49A 3AYKA 1QJJA 1GKCA 2JT6A 2I47A 1C8TA 2DW1A 2OW0A 1USNA 2MZHA 2OY4A 2RJPA 4EFSA 1D8FA 5D1SA 5I0LA 1G05A 1XFYA 3EDZA 3LJTA 1L6JA 3HBUP 3VI1A 4JIJA 1EAKA 1DMTA 4AYKA 3L0VA 2TCLA 1JIZA 3SHIA 3F1AA 3KRYA 4GR3A 3ZVSA 1OS2A 4L63A 1JK3A 3ELMA 4GUYA 3LKAA 1JH1A 3HY9A 4ILWD 2V4BA 5D3CA 2PJTA 1K7IA 1UMTA 1CXVA 3U1RA 1ZP5A 2KRJA 3CKIA 1QUAA 1QIAA 3WV3A 1I76A 2W12A 1GO7P 2JSDA 4JPAA 2XS3A 2OXWA 1YCMA 2WO9A 3F16A 1RMZA 2A8HA 2JIHA 830CA 2W15A 2J83A 456CA 4FU4A 1Y8JA 2ERQA 2E3XA 2RJQA 1PWWA 2WO8A 3LMCA 2E2DA 1QICA 3HYGA 3KECA 1C3IA 3N2VA 5CZMA 4IJOA 4FVLA 1CK7A 2X3AA 2K9CA 1CQRA 5I43A 4JA1A 1XUCA 3F18A 1MMRA 1GE7A 5I3MA 1K7QA 3F19A 1O0QA 1MMBA 3MA2A 3ZXHA 1OM7A 1GE6A 4AIGA 5D2BA 2POJA 2X3CA 4AUOA 2Z2DA 1MMQA 4PKQA 1BQQM 4DPEA 1FBLA 3WV2A 3TS4A 1PWQA 2OVXA 3LUNA 1HOVA 4AXQA 4I03A 4H3XA 1YQYA 1BUDA 4H76A 5D1UA 1RM8A 1KUHA 2O36A 5CUHA 4GF1A 4JP4A 5BPAA 1Y93A 5L79A 2W0DA 1SRPA 1OM8A 4GQLA 1BM6A 1XFXA 3Q2GA 1KAPP 3DPEA 1G9KA 1AKLA 1IADA 3N2UA 1QIBA 2AIGP 1BUVM 1XFZA 1CGEA 1HFSA 3P24A 3KEJA 3BA0A 1KUGA 4DF9A 4XM7A 1Q3AA 1I73A 2WOAA 1UMSA 2OY2A 2ERPA 2DDYA 1IAGA 4WKEA 1GO8P 3TSKA 3DWBA 2MZIA 3WV1A 2XS4A 2DDFA 3LIRA 4HMAA 2OXUA 4WK7A 3OHOA 4ON1A 3LE9A 4I35A 4PKSA 3O64A 3DL1A 1K7GA 1PWUA 3I7GA 1D5JA 4G9LA 1ZS0A 4H82A 2OW1A 5B5OA 1UTZA 4Q1LA 4ZR5A 3RTSA 2OXZA 2O3EA 3HDAP 3B2ZA 5L7FA 2OW9A 4GR0A 1HY7A 1QJIA 3EDGA
chains in the Genus database with same CATH superfamily
3HY7A 2OZRA 3ZUKA 1ZXVA 1XURA 3DNGA 5CXAA 1BSWA 1H71P 2J0TA 1XFWA 2D1NA 2JNPA 4H1QA 3EWJA 5I12A 1PWPA 2EROA 3B8ZA 3OHLA 1D7XA 1SATA 1ZTQA 2K2GA 3USNA 1BIWA 2OW2A 1KBCA 5BOTA 3TT4A 1FLSA 1Z3JA 1OO9A 5LABA 1BKCI 1CIZA 1D8MA 2YB9A 1A86A 3DPFA 2YIGA 2DW2A 1JIWP 1JJ9A 1R1HA 2OVZA 2W13A 1HTDA 4JQGA 1WNIA 2MLRA 1ASTA 1R1JA 4IUWA 1R55A 1ZXCA 3HBVP 2X3BA 4L19A 3UVCA 3F15A 4FXQA 1UEAA 1ROSA 966CA 1GXDA 1SLNA 1XUDA 1SMPA 1J7NA 3KWVC 1KUFA 3RTTA 4WF6A 2QPJA 2DW0A 2MZEA 5JMYA 1JAQA 1MMPA 1XAXA 1B3DA 5I2ZA 1YOUA 3LK8A 1GE5A 3KMEA 3TVCA 3LGPA 4A3WA 1IAAA 1SU3A 1XFVA 4L6TA 3I7IA 4PKRA 2MLSA 3EDHA 3KHIA 3AIGA 1MNCA 4WZVA 1KUIA 1HV5A 1Y0VA 4DV8A 1OS9A 4R3VA 2D1OA 5BOYA 4H49A 4XBHA 3AYUA 3V96B 4H30A 4DD8A 1DTHA 1C7KA 3DSLA 3LEAA 4GWMA 3E8RA 1AYKA 3LQ0A 1O0TA 1JANA 4WKIA 2CKIA 2W14A 1OMJA 5I4OA 1ND1A 1B8YA 3VTGA 3KEKA 4CTHA 1G4KA 1YP1A 1G12A 1UTTA 1R54A 4L7AA 4XM6A 1I1IP 2HU6A 2USNA 4PKWA 1BKCE 2Y6DA 1AF0A 5H8XA 1CGFA 2YUFA 1R1IA 2L0RA 4PKTA 4XM8A 4J4MA 3P1VA 1ZVXA 1KUKA 3LJZA 3B92A 1BZSA 3G42A 3EHXA 3O2XA 3K7LA 1PWVA 4IN9A 5D1TA 3NX7A 1FM1A 3LIKA 4H84A 4PKUA 3KMCA 2N8RA 4GWNA 1S4BP 1IABA 4A7BA 2SRTA 1JKYA 2CLTA 5D7WA 3L0TA 1EB6A 1BKCA 4H2EA 2FV5A 1JAOA 1IAEA 3HDBA 3LILA 1ATLA 2JT5A 1HFCA 4HX3A 1GKDA 3F17A 1CGLA 2AYKA 2OI0A 4GR8A 2FV9A 2X7MA 3DTEA 3G5CA 1CAQA 4G0DA 3GBOA 3LUMA 1A85A 4XCTA 5B5PA 3K7NA 3LQBA 1BQOA 3HB2P 4PKVA 1EUBA 4FXYP 1SLMA 2Y6CA 1XFUA 3EHYA 3Q2HA 3LJGA 1TVIA 3EDIA 1OM6A 4QKZA 1IACA 1JAPA 1G49A 3AYKA 1QJJA 1GKCA 2JT6A 2I47A 1C8TA 2DW1A 2OW0A 1USNA 2MZHA 2OY4A 2RJPA 4EFSA 1D8FA 5D1SA 5I0LA 1G05A 1XFYA 3EDZA 3LJTA 1L6JA 3HBUP 3VI1A 4JIJA 1EAKA 1DMTA 4AYKA 3L0VA 2TCLA 1JIZA 3SHIA 1XM5A 3F1AA 3KRYA 4GR3A 3ZVSA 1OS2A 4L63A 1JK3A 3ELMA 4GUYA 3LKAA 1JH1A 3HY9A 4ILWD 2V4BA 5D3CA 2PJTA 1K7IA 1UMTA 1CXVA 3U1RA 1ZP5A 2KRJA 3CKIA 1QUAA 1QIAA 3WV3A 1I76A 2W12A 1GO7P 2JSDA 4JPAA 2XS3A 2OXWA 1YCMA 2WO9A 3F16A 1RMZA 2A8HA 2JIHA 830CA 2W15A 2J83A 3DTKA 456CA 4FU4A 1Y8JA 2ERQA 2E3XA 2RJQA 1PWWA 2WO8A 3LMCA 2E2DA 1QICA 3HYGA 3KECA 1C3IA 3N2VA 5CZMA 4IJOA 4FVLA 1CK7A 2X3AA 2K9CA 1CQRA 5I43A 4JA1A 1XUCA 3F18A 1MMRA 1GE7A 5I3MA 1K7QA 3F19A 1O0QA 1MMBA 3MA2A 3ZXHA 1OM7A 1GE6A 4AIGA 5D2BA 2POJA 2X3CA 4AUOA 2Z2DA 1MMQA 4PKQA 1BQQM 4DPEA 1FBLA 3WV2A 3TS4A 1PWQA 2OVXA 3DTIA 3LUNA 1HOVA 4AXQA 4I03A 4H3XA 1YQYA 1BUDA 4H76A 5D1UA 1RM8A 1KUHA 2O36A 5CUHA 4GF1A 4JP4A 5BPAA 1Y93A 5L79A 2W0DA 1SRPA 1OM8A 4GQLA 1BM6A 1XFXA 3Q2GA 1KAPP 3DPEA 1G9KA 1AKLA 1IADA 3N2UA 1QIBA 2AIGP 1BUVM 1XFZA 1CGEA 1HFSA 3P24A 3KEJA 3BA0A 1KUGA 1OZ9A 4DF9A 4XM7A 1Q3AA 1I73A 2WOAA 1UMSA 2OY2A 2ERPA 2DDYA 1IAGA 4WKEA 1GO8P 3TSKA 3DWBA 2MZIA 3WV1A 2XS4A 2DDFA 3LIRA 4HMAA 2OXUA 4WK7A 3OHOA 4ON1A 3LE9A 4I35A 4PKSA 3O64A 3DL1A 1K7GA 1PWUA 3I7GA 1D5JA 4G9LA 1ZS0A 4H82A 2OW1A 5B5OA 1UTZA 4Q1LA 4ZR5A 3RTSA 2OXZA 2O3EA 3HDAP 3B2ZA 5L7FA 2OW9A 4GR0A 1HY7A 1QJIA 3EDGA
chains in the Genus database with same CATH topology
3HY7A 2OZRA 3ZUKA 1ZXVA 1XURA 3DNGA 5CXAA 1BSWA 1H71P 2J0TA 1XFWA 2D1NA 2JNPA 4H1QA 3EWJA 5I12A 1PWPA 2EROA 3B8ZA 3OHLA 1D7XA 1SATA 1ZTQA 2K2GA 3USNA 1BIWA 2OW2A 1KBCA 5BOTA 3TT4A 1FLSA 1Z3JA 1OO9A 5LABA 1BKCI 1CIZA 1D8MA 2YB9A 1A86A 3DPFA 2YIGA 2DW2A 1JIWP 1JJ9A 1R1HA 2OVZA 2W13A 1HTDA 4JQGA 1WNIA 2MLRA 1ASTA 1R1JA 4IUWA 1R55A 1ZXCA 3HBVP 2X3BA 4L19A 3UVCA 3F15A 4FXQA 1UEAA 1ROSA 966CA 1GXDA 1SLNA 1XUDA 1SMPA 1J7NA 3KWVC 1KUFA 3RTTA 4WF6A 2QPJA 2DW0A 2MZEA 5JMYA 1JAQA 1MMPA 1B3DA 5I2ZA 1YOUA 3LK8A 1GE5A 3KMEA 3TVCA 3LGPA 4A3WA 1IAAA 1SU3A 1XFVA 4L6TA 3I7IA 4PKRA 2MLSA 3EDHA 3KHIA 3AIGA 1MNCA 4WZVA 1KUIA 1HV5A 1Y0VA 4DV8A 1OS9A 4R3VA 2D1OA 5BOYA 4H49A 4XBHA 3AYUA 3V96B 4H30A 4DD8A 1DTHA 1C7KA 3DSLA 3LEAA 4GWMA 3E8RA 1AYKA 3LQ0A 1O0TA 1JANA 4WKIA 2CKIA 2W14A 1OMJA 5I4OA 1ND1A 1B8YA 3VTGA 3KEKA 4CTHA 1G4KA 1YP1A 1G12A 1UTTA 1R54A 4L7AA 4XM6A 1I1IP 2HU6A 2USNA 4PKWA 1BKCE 2Y6DA 1AF0A 5H8XA 1CGFA 2YUFA 1R1IA 2L0RA 4PKTA 4XM8A 4J4MA 3P1VA 1ZVXA 1KUKA 3LJZA 3B92A 1BZSA 3G42A 3EHXA 3O2XA 3K7LA 1PWVA 4IN9A 5D1TA 3NX7A 1FM1A 3LIKA 4H84A 4PKUA 3KMCA 2N8RA 4GWNA 1S4BP 1IABA 4A7BA 2SRTA 1JKYA 2CLTA 5D7WA 3L0TA 1EB6A 1BKCA 4H2EA 2FV5A 1JAOA 1IAEA 3HDBA 3LILA 1ATLA 2JT5A 1HFCA 4HX3A 1GKDA 3F17A 1CGLA 2AYKA 2OI0A 4GR8A 2FV9A 2X7MA 3DTEA 3G5CA 1CAQA 4G0DA 3GBOA 3LUMA 1A85A 4XCTA 5B5PA 3K7NA 3LQBA 1BQOA 3HB2P 4PKVA 1EUBA 4FXYP 1SLMA 2Y6CA 1XFUA 3EHYA 3Q2HA 3LJGA 3EDIA 1OM6A 4QKZA 1IACA 1JAPA 1G49A 3AYKA 1QJJA 1GKCA 2JT6A 2I47A 1C8TA 2DW1A 2OW0A 1USNA 2MZHA 2OY4A 2RJPA 4EFSA 1D8FA 5D1SA 5I0LA 1G05A 1XFYA 3EDZA 3LJTA 1L6JA 3HBUP 3VI1A 4JIJA 1EAKA 1DMTA 4AYKA 3L0VA 2TCLA 1JIZA 3SHIA 3F1AA 3KRYA 4GR3A 3ZVSA 1OS2A 4L63A 1JK3A 3ELMA 4GUYA 3LKAA 1JH1A 3HY9A 4ILWD 2V4BA 5D3CA 2PJTA 1K7IA 1UMTA 1CXVA 3U1RA 1ZP5A 2KRJA 3CKIA 1QUAA 1QIAA 3WV3A 1I76A 2W12A 1GO7P 2JSDA 4JPAA 2XS3A 2OXWA 1YCMA 2WO9A 3F16A 1RMZA 2A8HA 2JIHA 830CA 2W15A 2J83A 3DTKA 456CA 4FU4A 1Y8JA 2ERQA 2E3XA 2RJQA 1PWWA 2WO8A 3LMCA 2E2DA 1QICA 3HYGA 3KECA 1C3IA 3N2VA 5CZMA 4IJOA 4FVLA 1CK7A 2X3AA 2K9CA 1CQRA 5I43A 4JA1A 1XUCA 3F18A 1MMRA 1GE7A 5I3MA 1K7QA 3F19A 1O0QA 1MMBA 3MA2A 3ZXHA 1OM7A 1GE6A 4AIGA 5D2BA 2POJA 2X3CA 4AUOA 2Z2DA 1MMQA 4PKQA 1BQQM 4DPEA 1FBLA 3WV2A 3TS4A 1PWQA 2OVXA 3DTIA 3LUNA 1HOVA 4AXQA 4I03A 4H3XA 1YQYA 1BUDA 4H76A 5D1UA 1RM8A 1KUHA 2O36A 5CUHA 4GF1A 4JP4A 5BPAA 1Y93A 5L79A 2W0DA 1SRPA 1OM8A 4GQLA 1BM6A 1XFXA 3Q2GA 1KAPP 3DPEA 1G9KA 1AKLA 1IADA 3N2UA 1QIBA 2AIGP 1BUVM 1XFZA 1CGEA 1HFSA 3P24A 3KEJA 3BA0A 1KUGA 4DF9A 4XM7A 1Q3AA 1I73A 2WOAA 1UMSA 2OY2A 2ERPA 2DDYA 1IAGA 4WKEA 1GO8P 3TSKA 3DWBA 2MZIA 3WV1A 2XS4A 2DDFA 3LIRA 4HMAA 2OXUA 4WK7A 3OHOA 4ON1A 3LE9A 4I35A 4PKSA 3O64A 3DL1A 1K7GA 1PWUA 3I7GA 1D5JA 4G9LA 1ZS0A 4H82A 2OW1A 5B5OA 1UTZA 4Q1LA 4ZR5A 3RTSA 2OXZA 2O3EA 3HDAP 3B2ZA 5L7FA 2OW9A 4GR0A 1HY7A 1QJIA 3EDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HY7 A;  2OZR A;  3ZUK A;  1ZXV A;  1XUR A;  3DNG A;  5CXA A;  1BSW A;  1H71 P;  2J0T A;  1XFW A;  2D1N A;  2JNP A;  4H1Q A;  3EWJ A;  5I12 A;  1PWP A;  2ERO A;  3B8Z A;  3OHL A;  1D7X A;  1SAT A;  1ZTQ A;  2K2G A;  3USN A;  1BIW A;  2OW2 A;  1KBC A;  5BOT A;  3TT4 A;  1FLS A;  1Z3J A;  1OO9 A;  5LAB A;  1BKC I;  1CIZ A;  1D8M A;  2YB9 A;  1A86 A;  3DPF A;  2YIG A;  2DW2 A;  1JIW P;  1JJ9 A;  1R1H A;  2OVZ A;  2W13 A;  1HTD A;  4JQG A;  1WNI A;  2MLR A;  1AST A;  1R1J A;  4IUW A;  1R55 A;  1ZXC A;  3HBV P;  2X3B A;  4L19 A;  3UVC A;  3F15 A;  4FXQ A;  1UEA A;  1ROS A;  966C A;  1GXD A;  1SLN A;  1XUD A;  1SMP A;  1J7N A;  3KWV C;  1KUF A;  3RTT A;  4WF6 A;  2QPJ A;  2DW0 A;  2MZE A;  5JMY A;  1JAQ A;  1MMP A;  1B3D A;  5I2Z A;  1YOU A;  3LK8 A;  1GE5 A;  3KME A;  3TVC A;  3LGP A;  4A3W A;  1IAA A;  1SU3 A;  1XFV A;  4L6T A;  3I7I A;  4PKR A;  2MLS A;  3EDH A;  3KHI A;  3AIG A;  1MNC A;  4WZV A;  1KUI A;  1HV5 A;  1Y0V A;  4DV8 A;  1OS9 A;  4R3V A;  2D1O A;  5BOY A;  4H49 A;  4XBH A;  3AYU A;  3V96 B;  4H30 A;  4DD8 A;  1DTH A;  1C7K A;  3DSL A;  3LEA A;  4GWM A;  3E8R A;  1AYK A;  3LQ0 A;  1O0T A;  1JAN A;  4WKI A;  2CKI A;  2W14 A;  1OMJ A;  5I4O A;  1ND1 A;  1B8Y A;  3VTG A;  3KEK A;  4CTH A;  1G4K A;  1YP1 A;  1G12 A;  1UTT A;  1R54 A;  4XM6 A;  1I1I P;  2HU6 A;  2USN A;  4PKW A;  1BKC E;  2Y6D A;  1AF0 A;  5H8X A;  1CGF A;  1R1I A;  2L0R A;  4PKT A;  4XM8 A;  4J4M A;  3P1V A;  1ZVX A;  1KUK A;  3LJZ A;  3B92 A;  1BZS A;  3G42 A;  3EHX A;  3O2X A;  3K7L A;  1PWV A;  4IN9 A;  5D1T A;  3NX7 A;  1FM1 A;  3LIK A;  4H84 A;  4PKU A;  3KMC A;  2N8R A;  4GWN A;  1S4B P;  1IAB A;  4A7B A;  2SRT A;  1JKY A;  2CLT A;  5D7W A;  3L0T A;  1EB6 A;  1BKC A;  4H2E A;  2FV5 A;  1JAO A;  1IAE A;  3HDB A;  3LIL A;  1ATL A;  2JT5 A;  1HFC A;  4HX3 A;  1GKD A;  3F17 A;  1CGL A;  2AYK A;  2OI0 A;  4GR8 A;  2FV9 A;  2X7M A;  3G5C A;  1CAQ A;  4G0D A;  3GBO A;  3LUM A;  1A85 A;  4XCT A;  5B5P A;  3K7N A;  3LQB A;  1BQO A;  3HB2 P;  4PKV A;  1EUB A;  4FXY P;  1SLM A;  2Y6C A;  1XFU A;  3EHY A;  3Q2H A;  3LJG A;  3EDI A;  1OM6 A;  4QKZ A;  1IAC A;  1JAP A;  1G49 A;  3AYK A;  1QJJ A;  1GKC A;  2JT6 A;  2I47 A;  1C8T A;  2DW1 A;  2OW0 A;  1USN A;  2MZH A;  2OY4 A;  2RJP A;  4EFS A;  1D8F A;  5D1S A;  5I0L A;  1G05 A;  1XFY A;  3EDZ A;  3LJT A;  1L6J A;  3HBU P;  3VI1 A;  4JIJ A;  1EAK A;  1DMT A;  4AYK A;  3L0V A;  2TCL A;  1JIZ A;  3SHI A;  3F1A A;  3KRY A;  4GR3 A;  3ZVS A;  1OS2 A;  4L63 A;  1JK3 A;  3ELM A;  4GUY A;  3LKA A;  1JH1 A;  3HY9 A;  4ILW D;  2V4B A;  5D3C A;  2PJT A;  1K7I A;  1UMT A;  1CXV A;  3U1R A;  1ZP5 A;  2KRJ A;  3CKI A;  1QUA A;  1QIA A;  3WV3 A;  1I76 A;  2W12 A;  1GO7 P;  2JSD A;  4JPA A;  2XS3 A;  2OXW A;  1YCM A;  2WO9 A;  3F16 A;  1RMZ A;  2A8H A;  2JIH A;  830C A;  2W15 A;  2J83 A;  456C A;  4FU4 A;  1Y8J A;  2ERQ A;  2E3X A;  2RJQ A;  1PWW A;  2WO8 A;  3LMC A;  2E2D A;  1QIC A;  3HYG A;  3KEC A;  1C3I A;  3N2V A;  5CZM A;  4IJO A;  4FVL A;  1CK7 A;  2X3A A;  2K9C A;  1CQR A;  5I43 A;  4JA1 A;  1XUC A;  3F18 A;  1MMR A;  1GE7 A;  5I3M A;  1K7Q A;  3F19 A;  1O0Q A;  1MMB A;  3MA2 A;  3ZXH A;  1OM7 A;  1GE6 A;  4AIG A;  5D2B A;  2POJ A;  2X3C A;  4AUO A;  2Z2D A;  1MMQ A;  4PKQ A;  1BQQ M;  4DPE A;  1FBL A;  3WV2 A;  3TS4 A;  1PWQ A;  2OVX A;  3LUN A;  1HOV A;  4AXQ A;  4I03 A;  4H3X A;  1YQY A;  1BUD A;  4H76 A;  5D1U A;  1RM8 A;  1KUH A;  2O36 A;  5CUH A;  4GF1 A;  4JP4 A;  5BPA A;  1Y93 A;  5L79 A;  2W0D A;  1SRP A;  1OM8 A;  4GQL A;  1BM6 A;  1XFX A;  3Q2G A;  1KAP P;  3DPE A;  1G9K A;  1AKL A;  1IAD A;  3N2U A;  1QIB A;  2AIG P;  1BUV M;  1XFZ A;  1CGE A;  1HFS A;  3P24 A;  3KEJ A;  3BA0 A;  1KUG A;  4DF9 A;  4XM7 A;  1Q3A A;  1I73 A;  2WOA A;  1UMS A;  2OY2 A;  2ERP A;  2DDY A;  1IAG A;  4WKE A;  1GO8 P;  3TSK A;  3DWB A;  2MZI A;  3WV1 A;  2XS4 A;  2DDF A;  3LIR A;  4HMA A;  2OXU A;  4WK7 A;  3OHO A;  4ON1 A;  3LE9 A;  4I35 A;  4PKS A;  3O64 A;  3DL1 A;  1K7G A;  1PWU A;  3I7G A;  1D5J A;  4G9L A;  1ZS0 A;  4H82 A;  2OW1 A;  5B5O A;  1UTZ A;  4Q1L A;  4ZR5 A;  3RTS A;  2OXZ A;  2O3E A;  3HDA P;  3B2Z A;  5L7F A;  2OW9 A;  4GR0 A;  1HY7 A;  1QJI A;  3EDG A; 
#chains in the Genus database with same CATH topology
 3HY7 A;  2OZR A;  3ZUK A;  1ZXV A;  1XUR A;  3DNG A;  5CXA A;  1BSW A;  1H71 P;  2J0T A;  1XFW A;  2D1N A;  2JNP A;  4H1Q A;  3EWJ A;  5I12 A;  1PWP A;  2ERO A;  3B8Z A;  3OHL A;  1D7X A;  1SAT A;  1ZTQ A;  2K2G A;  3USN A;  1BIW A;  2OW2 A;  1KBC A;  5BOT A;  3TT4 A;  1FLS A;  1Z3J A;  1OO9 A;  5LAB A;  1BKC I;  1CIZ A;  1D8M A;  2YB9 A;  1A86 A;  3DPF A;  2YIG A;  2DW2 A;  1JIW P;  1JJ9 A;  1R1H A;  2OVZ A;  2W13 A;  1HTD A;  4JQG A;  1WNI A;  2MLR A;  1AST A;  1R1J A;  4IUW A;  1R55 A;  1ZXC A;  3HBV P;  2X3B A;  4L19 A;  3UVC A;  3F15 A;  4FXQ A;  1UEA A;  1ROS A;  966C A;  1GXD A;  1SLN A;  1XUD A;  1SMP A;  1J7N A;  3KWV C;  1KUF A;  3RTT A;  4WF6 A;  2QPJ A;  2DW0 A;  2MZE A;  5JMY A;  1JAQ A;  1MMP A;  1XAX A;  1B3D A;  5I2Z A;  1YOU A;  3LK8 A;  1GE5 A;  3KME A;  3TVC A;  3LGP A;  4A3W A;  1IAA A;  1SU3 A;  1XFV A;  4L6T A;  3I7I A;  4PKR A;  2MLS A;  3EDH A;  3KHI A;  3AIG A;  1MNC A;  4WZV A;  1KUI A;  1HV5 A;  1Y0V A;  4DV8 A;  1OS9 A;  4R3V A;  2D1O A;  5BOY A;  4H49 A;  4XBH A;  3AYU A;  3V96 B;  4H30 A;  4DD8 A;  1DTH A;  1C7K A;  3DSL A;  3LEA A;  4GWM A;  3E8R A;  1AYK A;  3LQ0 A;  1O0T A;  1JAN A;  4WKI A;  2CKI A;  2W14 A;  1OMJ A;  5I4O A;  1ND1 A;  1B8Y A;  3VTG A;  3KEK A;  4CTH A;  1G4K A;  1YP1 A;  1G12 A;  1UTT A;  1R54 A;  4L7A A;  4XM6 A;  1I1I P;  2HU6 A;  2USN A;  4PKW A;  1BKC E;  2Y6D A;  1AF0 A;  5H8X A;  1CGF A;  2YUF A;  1R1I A;  2L0R A;  4PKT A;  4XM8 A;  4J4M A;  3P1V A;  1ZVX A;  1KUK A;  3LJZ A;  3B92 A;  1BZS A;  3G42 A;  3EHX A;  3O2X A;  3K7L A;  1PWV A;  4IN9 A;  5D1T A;  3NX7 A;  1FM1 A;  3LIK A;  4H84 A;  4PKU A;  3KMC A;  2N8R A;  4GWN A;  1S4B P;  1IAB A;  4A7B A;  2SRT A;  1JKY A;  2CLT A;  5D7W A;  3L0T A;  1EB6 A;  1BKC A;  4H2E A;  2FV5 A;  1JAO A;  1IAE A;  3HDB A;  3LIL A;  1ATL A;  2JT5 A;  1HFC A;  4HX3 A;  1GKD A;  3F17 A;  1CGL A;  2AYK A;  2OI0 A;  4GR8 A;  2FV9 A;  2X7M A;  3DTE A;  3G5C A;  1CAQ A;  4G0D A;  3GBO A;  3LUM A;  1A85 A;  4XCT A;  5B5P A;  3K7N A;  3LQB A;  1BQO A;  3HB2 P;  4PKV A;  1EUB A;  4FXY P;  1SLM A;  2Y6C A;  1XFU A;  3EHY A;  3Q2H A;  3LJG A;  1TVI A;  3EDI A;  1OM6 A;  4QKZ A;  1IAC A;  1JAP A;  1G49 A;  3AYK A;  1QJJ A;  1GKC A;  2JT6 A;  2I47 A;  1C8T A;  2DW1 A;  2OW0 A;  1USN A;  2MZH A;  2OY4 A;  2RJP A;  4EFS A;  1D8F A;  5D1S A;  5I0L A;  1G05 A;  1XFY A;  3EDZ A;  3LJT A;  1L6J A;  3HBU P;  3VI1 A;  4JIJ A;  1EAK A;  1DMT A;  4AYK A;  3L0V A;  2TCL A;  1JIZ A;  3SHI A;  1XM5 A;  3F1A A;  3KRY A;  4GR3 A;  3ZVS A;  1OS2 A;  4L63 A;  1JK3 A;  3ELM A;  4GUY A;  3LKA A;  1JH1 A;  3HY9 A;  4ILW D;  2V4B A;  5D3C A;  2PJT A;  1K7I A;  1UMT A;  1CXV A;  3U1R A;  1ZP5 A;  2KRJ A;  3CKI A;  1QUA A;  1QIA A;  3WV3 A;  1I76 A;  2W12 A;  1GO7 P;  2JSD A;  4JPA A;  2XS3 A;  2OXW A;  1YCM A;  2WO9 A;  3F16 A;  1RMZ A;  2A8H A;  2JIH A;  830C A;  2W15 A;  2J83 A;  3DTK A;  456C A;  4FU4 A;  1Y8J A;  2ERQ A;  2E3X A;  2RJQ A;  1PWW A;  2WO8 A;  3LMC A;  2E2D A;  1QIC A;  3HYG A;  3KEC A;  1C3I A;  3N2V A;  5CZM A;  4IJO A;  4FVL A;  1CK7 A;  2X3A A;  2K9C A;  1CQR A;  5I43 A;  4JA1 A;  1XUC A;  3F18 A;  1MMR A;  1GE7 A;  5I3M A;  1K7Q A;  3F19 A;  1O0Q A;  1MMB A;  3MA2 A;  3ZXH A;  1OM7 A;  1GE6 A;  4AIG A;  5D2B A;  2POJ A;  2X3C A;  4AUO A;  2Z2D A;  1MMQ A;  4PKQ A;  1BQQ M;  4DPE A;  1FBL A;  3WV2 A;  3TS4 A;  1PWQ A;  2OVX A;  3DTI A;  3LUN A;  1HOV A;  4AXQ A;  4I03 A;  4H3X A;  1YQY A;  1BUD A;  4H76 A;  5D1U A;  1RM8 A;  1KUH A;  2O36 A;  5CUH A;  4GF1 A;  4JP4 A;  5BPA A;  1Y93 A;  5L79 A;  2W0D A;  1SRP A;  1OM8 A;  4GQL A;  1BM6 A;  1XFX A;  3Q2G A;  1KAP P;  3DPE A;  1G9K A;  1AKL A;  1IAD A;  3N2U A;  1QIB A;  2AIG P;  1BUV M;  1XFZ A;  1CGE A;  1HFS A;  3P24 A;  3KEJ A;  3BA0 A;  1KUG A;  1OZ9 A;  4DF9 A;  4XM7 A;  1Q3A A;  1I73 A;  2WOA A;  1UMS A;  2OY2 A;  2ERP A;  2DDY A;  1IAG A;  4WKE A;  1GO8 P;  3TSK A;  3DWB A;  2MZI A;  3WV1 A;  2XS4 A;  2DDF A;  3LIR A;  4HMA A;  2OXU A;  4WK7 A;  3OHO A;  4ON1 A;  3LE9 A;  4I35 A;  4PKS A;  3O64 A;  3DL1 A;  1K7G A;  1PWU A;  3I7G A;  1D5J A;  4G9L A;  1ZS0 A;  4H82 A;  2OW1 A;  5B5O A;  1UTZ A;  4Q1L A;  4ZR5 A;  3RTS A;  2OXZ A;  2O3E A;  3HDA P;  3B2Z A;  5L7F A;  2OW9 A;  4GR0 A;  1HY7 A;  1QJI A;  3EDG A; 
#chains in the Genus database with same CATH homology
 3HY7 A;  2OZR A;  3ZUK A;  1ZXV A;  1XUR A;  3DNG A;  5CXA A;  1BSW A;  1H71 P;  2J0T A;  1XFW A;  2D1N A;  2JNP A;  4H1Q A;  3EWJ A;  5I12 A;  1PWP A;  2ERO A;  3B8Z A;  3OHL A;  1D7X A;  1SAT A;  1ZTQ A;  2K2G A;  3USN A;  1BIW A;  2OW2 A;  1KBC A;  5BOT A;  3TT4 A;  1FLS A;  1Z3J A;  1OO9 A;  5LAB A;  1BKC I;  1CIZ A;  1D8M A;  2YB9 A;  1A86 A;  3DPF A;  2YIG A;  2DW2 A;  1JIW P;  1JJ9 A;  1R1H A;  2OVZ A;  2W13 A;  1HTD A;  4JQG A;  1WNI A;  2MLR A;  1AST A;  1R1J A;  4IUW A;  1R55 A;  1ZXC A;  3HBV P;  2X3B A;  4L19 A;  3UVC A;  3F15 A;  4FXQ A;  1UEA A;  1ROS A;  966C A;  1GXD A;  1SLN A;  1XUD A;  1SMP A;  1J7N A;  3KWV C;  1KUF A;  3RTT A;  4WF6 A;  2QPJ A;  2DW0 A;  2MZE A;  5JMY A;  1JAQ A;  1MMP A;  1B3D A;  5I2Z A;  1YOU A;  3LK8 A;  1GE5 A;  3KME A;  3TVC A;  3LGP A;  4A3W A;  1IAA A;  1SU3 A;  1XFV A;  4L6T A;  3I7I A;  4PKR A;  2MLS A;  3EDH A;  3KHI A;  3AIG A;  1MNC A;  4WZV A;  1KUI A;  1HV5 A;  1Y0V A;  4DV8 A;  1OS9 A;  4R3V A;  2D1O A;  5BOY A;  4H49 A;  4XBH A;  3AYU A;  3V96 B;  4H30 A;  4DD8 A;  1DTH A;  1C7K A;  3DSL A;  3LEA A;  4GWM A;  3E8R A;  1AYK A;  3LQ0 A;  1O0T A;  1JAN A;  4WKI A;  2CKI A;  2W14 A;  1OMJ A;  5I4O A;  1ND1 A;  1B8Y A;  3VTG A;  3KEK A;  4CTH A;  1G4K A;  1YP1 A;  1G12 A;  1UTT A;  1R54 A;  4L7A A;  4XM6 A;  1I1I P;  2HU6 A;  2USN A;  4PKW A;  1BKC E;  2Y6D A;  1AF0 A;  5H8X A;  1CGF A;  2YUF A;  1R1I A;  2L0R A;  4PKT A;  4XM8 A;  4J4M A;  3P1V A;  1ZVX A;  1KUK A;  3LJZ A;  3B92 A;  1BZS A;  3G42 A;  3EHX A;  3O2X A;  3K7L A;  1PWV A;  4IN9 A;  5D1T A;  3NX7 A;  1FM1 A;  3LIK A;  4H84 A;  4PKU A;  3KMC A;  2N8R A;  4GWN A;  1S4B P;  1IAB A;  4A7B A;  2SRT A;  1JKY A;  2CLT A;  5D7W A;  3L0T A;  1EB6 A;  1BKC A;  4H2E A;  2FV5 A;  1JAO A;  1IAE A;  3HDB A;  3LIL A;  1ATL A;  2JT5 A;  1HFC A;  4HX3 A;  1GKD A;  3F17 A;  1CGL A;  2AYK A;  2OI0 A;  4GR8 A;  2FV9 A;  2X7M A;  3DTE A;  3G5C A;  1CAQ A;  4G0D A;  3GBO A;  3LUM A;  1A85 A;  4XCT A;  5B5P A;  3K7N A;  3LQB A;  1BQO A;  3HB2 P;  4PKV A;  1EUB A;  4FXY P;  1SLM A;  2Y6C A;  1XFU A;  3EHY A;  3Q2H A;  3LJG A;  3EDI A;  1OM6 A;  4QKZ A;  1IAC A;  1JAP A;  1G49 A;  3AYK A;  1QJJ A;  1GKC A;  2JT6 A;  2I47 A;  1C8T A;  2DW1 A;  2OW0 A;  1USN A;  2MZH A;  2OY4 A;  2RJP A;  4EFS A;  1D8F A;  5D1S A;  5I0L A;  1G05 A;  1XFY A;  3EDZ A;  3LJT A;  1L6J A;  3HBU P;  3VI1 A;  4JIJ A;  1EAK A;  1DMT A;  4AYK A;  3L0V A;  2TCL A;  1JIZ A;  3SHI A;  3F1A A;  3KRY A;  4GR3 A;  3ZVS A;  1OS2 A;  4L63 A;  1JK3 A;  3ELM A;  4GUY A;  3LKA A;  1JH1 A;  3HY9 A;  4ILW D;  2V4B A;  5D3C A;  2PJT A;  1K7I A;  1UMT A;  1CXV A;  3U1R A;  1ZP5 A;  2KRJ A;  3CKI A;  1QUA A;  1QIA A;  3WV3 A;  1I76 A;  2W12 A;  1GO7 P;  2JSD A;  4JPA A;  2XS3 A;  2OXW A;  1YCM A;  2WO9 A;  3F16 A;  1RMZ A;  2A8H A;  2JIH A;  830C A;  2W15 A;  2J83 A;  3DTK A;  456C A;  4FU4 A;  1Y8J A;  2ERQ A;  2E3X A;  2RJQ A;  1PWW A;  2WO8 A;  3LMC A;  2E2D A;  1QIC A;  3HYG A;  3KEC A;  1C3I A;  3N2V A;  5CZM A;  4IJO A;  4FVL A;  1CK7 A;  2X3A A;  2K9C A;  1CQR A;  5I43 A;  4JA1 A;  1XUC A;  3F18 A;  1MMR A;  1GE7 A;  5I3M A;  1K7Q A;  3F19 A;  1O0Q A;  1MMB A;  3MA2 A;  3ZXH A;  1OM7 A;  1GE6 A;  4AIG A;  5D2B A;  2POJ A;  2X3C A;  4AUO A;  2Z2D A;  1MMQ A;  4PKQ A;  1BQQ M;  4DPE A;  1FBL A;  3WV2 A;  3TS4 A;  1PWQ A;  2OVX A;  3DTI A;  3LUN A;  1HOV A;  4AXQ A;  4I03 A;  4H3X A;  1YQY A;  1BUD A;  4H76 A;  5D1U A;  1RM8 A;  1KUH A;  2O36 A;  5CUH A;  4GF1 A;  4JP4 A;  5BPA A;  1Y93 A;  5L79 A;  2W0D A;  1SRP A;  1OM8 A;  4GQL A;  1BM6 A;  1XFX A;  3Q2G A;  1KAP P;  3DPE A;  1G9K A;  1AKL A;  1IAD A;  3N2U A;  1QIB A;  2AIG P;  1BUV M;  1XFZ A;  1CGE A;  1HFS A;  3P24 A;  3KEJ A;  3BA0 A;  1KUG A;  4DF9 A;  4XM7 A;  1Q3A A;  1I73 A;  2WOA A;  1UMS A;  2OY2 A;  2ERP A;  2DDY A;  1IAG A;  4WKE A;  1GO8 P;  3TSK A;  3DWB A;  2MZI A;  3WV1 A;  2XS4 A;  2DDF A;  3LIR A;  4HMA A;  2OXU A;  4WK7 A;  3OHO A;  4ON1 A;  3LE9 A;  4I35 A;  4PKS A;  3O64 A;  3DL1 A;  1K7G A;  1PWU A;  3I7G A;  1D5J A;  4G9L A;  1ZS0 A;  4H82 A;  2OW1 A;  5B5O A;  1UTZ A;  4Q1L A;  4ZR5 A;  3RTS A;  2OXZ A;  2O3E A;  3HDA P;  3B2Z A;  5L7F A;  2OW9 A;  4GR0 A;  1HY7 A;  1QJI A;  3EDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...