5I4TG

Immature hexagonal lattice of hiv-1 gag
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CTD-SP1 fragment of HIV-1 Gag
publication title Crystal structure of an HIV assembly and maturation switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 91
sequence length 91
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2016-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5i4tG00
3G1IA 4IPYA 3G29A 3MGEA 1A8OA 4COPA 2L6EA 3DTJA 1A43A 2BUOA 4U0DA 5HGLA 4U0EA 3H4EA 4U0AA 5JPAA 1AUMA 1QRJA 3P05A 5HGNA 5HGMA 4XFZA 5DCKA 4U0FA 3H47A 2EIAA 1BAJA 3G26A 3DS0A 3DS3A 4PH1A 2XV6A 2M8PA 4WYMA 4PH0A 3G28A 4U0BA 4U0CA 2JYGA 3DPHA 4M0IA 5HGOA 5I4TG 3G0VA 2M8LA 3DS1A 4XFXA 1E6JP 4QNBA 4XROA 4COCA 2JO0A 3G21A 1EOQA 3DS4A 1EIAA 3DS2A 3DS5A 4XRQA 2JYLA 2ONTA 3LRYA 3NTEA 2KODA 2LF4A 3VRLC 2XT1A 2M8NA 2XXMA 3G1GA 4XFYA 1D1DA
chains in the Genus database with same CATH superfamily
3CXCO 2JAZA 2PNGA 2KOOA 3G4SP 4XFZA 5DCKA 1IMPA 1L0HA 2VLOA 4UHPB 1QVFO 2JYGA 2CWOA 2M8LA 2M5RA 3LMOA 2K5XA 1D1DA 4IPYA 2FVEA 5BS1A 2LKIA 2Z46A 3CCRP 2JQ4A 3U43A 5EW5E 2AFEA 1VQ7P 1K30A 2OTJP 3M1MA 4NEOA 2MR8A 3HZQA 3EJBA 2KOPA 3DS2A 3LRYA 2LF4A 2LMLA 5JPAA 3CCLP 3GJNA 2K0YA 3DS3A 1VQ6P 2X2BA 1KLPA 2JU1A 2AFDA 1GPJA 2KODA 2K92A 2KGAA 1YIJP 1Q7YQ 1UJZA 2P9XA 3G28A 4U0BA 1VQ9P 3EJDA 1M6EX 2GZGA 2NO8A 2PEOA 1KC8Q 2KGEA 2K0DX 2PEKA 2LTEA 2K94A 3DTJA 1W2BO 1IUQA 1QVGO 2MY5A 2KG6A 2GZFA 4WYMA 1GXGA 1FR2A 1K8AQ 2KG8A 2KOSA 2XT1A 1AF8A 2M8NA 4PWVB 5BS2A 3OW2O 2LOLA 4COPA 1A43A 3CCMP 1JJ2O 3WBHA 2FVFA 5HGMA 2MVUA 2N6YA 4PH1A 1ACPA 4PH0A 2FADA 1BXIA 1F80D 4H2YC 2FQ2A 2JYLA 1VKUA 3CCQP 4H2WC 2KR5A 5HGLA 4U0AA 2L9FA 2EHTA 2JBGA 4HKGA 3G26A 5I4TG 2OTLP 2N5HA 3CCUP 2XZ0D 1IMQA 2DNWA 1VQ5P 3G21A 4XRQA 2BHVA 1Q81Q 1NJIQ 1S72P 2CQ8A 1OR5A 2KGDA 1M74A 3G1IA 2FVAA 2K2QA 2EFJA 1KD1Q 1M1KQ 1M6NA 1VQOP 5F2NA 2QNWA 2VLQA 1N8RQ 2KOQA 1RO2A 5HV8A 2M8PA 2EG5A 4H2XC 4XROA 3G71P 1EOQA 2FAEA 2GDWA 1YJNP 2PEJA 3EJEA 1Z6MA 1VQ4P 1A8OA 5F2OA 1DV5A 3B4QA 3HYBA 4QKOA 1AUMA 2OARA 5F2KA 2KGCA 3CC2P 3CPWO 1DNYA 5HVCA 4IZ6A 4M0IA 3DPHA 1T8KA 1GXHA 3DS1A 1ZNVA 1Q86Q 2QA4P 2VLPA 3RG2A 3DS4A 1VQNP 1E0HA 1VQLP 2LPKA 3NY7B 3GKLC 1KQSO 3DS0A 2N6ZA 3CMAP 2L4BA 1MZ8A 2MD9A 2JGPA 1YITP 2KWLA 2JO0A 2FQ1A 1RNIA 4BPGA 2Z45A 4XFYA 2L6EA 4U0DA 3CCEP 2KG9A 1YI2P 1VHNA 4U0FA 3CMEP 1BAJA 2FQ0A 2MF4A 2ROQA 5EJDA 4U0CA 4MRTC 4QNBA 1L0IA 5KP7B 2PEQA 2CGQA 2PEIA 1YHQP 3CCJP 1VQ8P 3H4EA 1QRJA 2N5IA 2K0XA 4R0MA 4GR6A 3RG6C 1VQKP 3G0VA 2L22A 3B5IA 3Q20A 2EHSA 4XFXA 2GDYA 3I55P 4COCA 3GZLA 2LL8A 4BPFA 1EIAA 2DGYA 2Z44A 3CCVP 2WPTA 3CC4P 3VRLC 3G29A 1K9MQ 1RO0A 5HGNA 2LIWA 2VSQA 2EIAA 2MVVA 4F37A 5CZDB 3CC7P 4CA3A 2AF8A 4BPHA 3I56P 1YJWP 3CCSP 2JU2A 1HQBA 1NQ4A 2ERHA 3E2DA 3CD6P 2PY8A 1M90Q 2BUOA 4U0EA 3GZMA 2E1MA 2LIUA 2MR7A 2VLNA 1EMVA 2L0QA 1UNKA 2KORA 1AYIA 5KP6B 1K73Q 2FACA 3H0DA 2GDXA 2GZIA 2QEXP 3DS5A 3NTEA 3G6EP 2GYKA 2GZJA 2N98A 4DG9A 5KP8B 3MGEA 4PXHB 1CEIA 2FHSC 3CE7A 2CG5B 2GZEA 1Q82Q 2K93A 4GR2A 1HY8A 2ONTA 1VQMP 2JB0A 1VQPP 3G1GA 1YJ9P 2PEMA 3P05A 2N50A 3H47A 2XV6A 7CEIA 5HGOA 2KW2A 2CNRA 1X3OA 1E6JP 1ZMBA 2PENA 2XZ1C 2AVAA 2XXMA
chains in the Genus database with same CATH topology
3CXCO 3G29A 1K9MQ 2PEKA 1A8OA 5F2OA 3DTJA 1RO0A 3HYBA 1W2BO 1AUMA 1IUQA 2OARA 5HGNA 3G4SP 1QVGO 5F2KA 4XFZA 5DCKA 3CC2P 2EIAA 3CPWO 4WYMA 3CC7P 1QVFO 2JYGA 3DPHA 4M0IA 2CWOA 2M8LA 3DS1A 1Q86Q 2QA4P 3DS4A 1VQNP 3I56P 1YJWP 1K8AQ 3CCSP 1VQLP 2XT1A 2M8NA 5BS2A 3OW2O 3E2DA 1D1DA 4IPYA 3CD6P 4COPA 5BS1A 2PY8A 1M90Q 1A43A 2BUOA 3CCMP 4U0EA 1JJ2O 2Z46A 3WBHA 3CCRP 5HGMA 1KQSO 2E1MA 3DS0A 4PH1A 3CMAP 4PH0A 1VQ7P 1K30A 2OTJP 3M1MA 1YITP 1K73Q 3H0DA 2JO0A 3HZQA 2QEXP 3DS2A 3DS5A 2JYLA 3CCQP 3LRYA 3NTEA 1RNIA 2LF4A 3G6EP 2Z45A 4XFYA 3MGEA 2L6EA 4U0DA 5HGLA 4U0AA 5JPAA 3CCEP 1YI2P 4U0FA 3CCLP 3CMEP 1BAJA 3G26A 3DS3A 5I4TG 2OTLP 4U0CA 1VQ6P 3CCUP 4QNBA 1Q82Q 2PEQA 1VQ5P 3G21A 2PEIA 4XRQA 2BHVA 4GR2A 1Q81Q 1NJIQ 1S72P 1YHQP 2ONTA 3CCJP 1VQMP 2KODA 1VQPP 3G1GA 1M74A 3G1IA 1YIJP 1YJ9P 1Q7YQ 1VQ8P 2PEMA 3H4EA 2EFJA 1QRJA 3P05A 1KD1Q 1M1KQ 2P9XA 1M6NA 1VQOP 3H47A 5F2NA 4GR6A 1N8RQ 1RO2A 2XV6A 2M8PA 3RG6C 3G28A 4U0BA 1VQ9P 5HGOA 1VQKP 2EG5A 3G0VA 3B5IA 3Q20A 4XFXA 1E6JP 3I55P 4XROA 4COCA 1M6EX 1ZMBA 2PENA 3G71P 1EOQA 1EIAA 2DGYA 2Z44A 3CCVP 2PEOA 3CC4P 1YJNP 1KC8Q 2PEJA 3VRLC 2XXMA 1VQ4P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1I A;  4IPY A;  3G29 A;  3MGE A;  1A8O A;  4COP A;  2L6E A;  3DTJ A;  1A43 A;  2BUO A;  4U0D A;  5HGL A;  4U0E A;  3H4E A;  4U0A A;  5JPA A;  1AUM A;  1QRJ A;  3P05 A;  5HGN A;  5HGM A;  4XFZ A;  5DCK A;  4U0F A;  3H47 A;  2EIA A;  1BAJ A;  3G26 A;  3DS0 A;  3DS3 A;  4PH1 A;  2XV6 A;  2M8P A;  4WYM A;  4PH0 A;  3G28 A;  4U0B A;  4U0C A;  2JYG A;  3DPH A;  4M0I A;  5HGO A;  5I4T G;  3G0V A;  2M8L A;  3DS1 A;  4XFX A;  1E6J P;  4QNB A;  4XRO A;  4COC A;  2JO0 A;  3G21 A;  1EOQ A;  3DS4 A;  1EIA A;  3DS2 A;  3DS5 A;  4XRQ A;  2JYL A;  2ONT A;  3LRY A;  3NTE A;  2KOD A;  2LF4 A;  3VRL C;  2XT1 A;  2M8N A;  2XXM A;  3G1G A;  4XFY A;  1D1D A; 
#chains in the Genus database with same CATH topology
 3CXC O;  2JAZ A;  2PNG A;  2KOO A;  3G4S P;  4XFZ A;  5DCK A;  1IMP A;  1L0H A;  2VLO A;  4UHP B;  1QVF O;  2JYG A;  2CWO A;  2M8L A;  2M5R A;  3LMO A;  2K5X A;  1D1D A;  4IPY A;  2FVE A;  5BS1 A;  2LKI A;  2Z46 A;  3CCR P;  2JQ4 A;  3U43 A;  5EW5 E;  2AFE A;  1VQ7 P;  1K30 A;  2OTJ P;  3M1M A;  4NEO A;  2MR8 A;  3HZQ A;  3EJB A;  2KOP A;  3DS2 A;  3LRY A;  2LF4 A;  2LML A;  5JPA A;  3CCL P;  3GJN A;  2K0Y A;  3DS3 A;  1VQ6 P;  2X2B A;  1KLP A;  2JU1 A;  2AFD A;  1GPJ A;  2KOD A;  2K92 A;  2KGA A;  1YIJ P;  1Q7Y Q;  1UJZ A;  2P9X A;  3G28 A;  4U0B A;  1VQ9 P;  3EJD A;  1M6E X;  2GZG A;  2NO8 A;  2PEO A;  1KC8 Q;  2KGE A;  2K0D X;  2PEK A;  2LTE A;  2K94 A;  3DTJ A;  1W2B O;  1IUQ A;  1QVG O;  2MY5 A;  2KG6 A;  2GZF A;  4WYM A;  1GXG A;  1FR2 A;  1K8A Q;  2KG8 A;  2KOS A;  2XT1 A;  1AF8 A;  2M8N A;  4PWV B;  5BS2 A;  3OW2 O;  2LOL A;  4COP A;  1A43 A;  3CCM P;  1JJ2 O;  3WBH A;  2FVF A;  5HGM A;  2MVU A;  2N6Y A;  4PH1 A;  1ACP A;  4PH0 A;  2FAD A;  1BXI A;  1F80 D;  4H2Y C;  2FQ2 A;  2JYL A;  1VKU A;  3CCQ P;  4H2W C;  2KR5 A;  5HGL A;  4U0A A;  2L9F A;  2EHT A;  2JBG A;  4HKG A;  3G26 A;  5I4T G;  2OTL P;  2N5H A;  3CCU P;  2XZ0 D;  1IMQ A;  2DNW A;  1VQ5 P;  3G21 A;  4XRQ A;  2BHV A;  1Q81 Q;  1NJI Q;  1S72 P;  2CQ8 A;  1OR5 A;  2KGD A;  1M74 A;  3G1I A;  2FVA A;  2K2Q A;  2EFJ A;  1KD1 Q;  1M1K Q;  1M6N A;  1VQO P;  5F2N A;  2QNW A;  2VLQ A;  1N8R Q;  2KOQ A;  1RO2 A;  5HV8 A;  2M8P A;  2EG5 A;  4H2X C;  4XRO A;  3G71 P;  1EOQ A;  2FAE A;  2GDW A;  1YJN P;  2PEJ A;  3EJE A;  1Z6M A;  1VQ4 P;  1A8O A;  5F2O A;  1DV5 A;  3B4Q A;  3HYB A;  4QKO A;  1AUM A;  2OAR A;  5F2K A;  2KGC A;  3CC2 P;  3CPW O;  1DNY A;  5HVC A;  4IZ6 A;  4M0I A;  3DPH A;  1T8K A;  1GXH A;  3DS1 A;  1ZNV A;  1Q86 Q;  2QA4 P;  2VLP A;  3RG2 A;  3DS4 A;  1VQN P;  1E0H A;  1VQL P;  2LPK A;  3NY7 B;  3GKL C;  1KQS O;  3DS0 A;  2N6Z A;  3CMA P;  2L4B A;  1MZ8 A;  2MD9 A;  2JGP A;  1YIT P;  2KWL A;  2JO0 A;  2FQ1 A;  1RNI A;  4BPG A;  2Z45 A;  4XFY A;  2L6E A;  4U0D A;  3CCE P;  2KG9 A;  1YI2 P;  1VHN A;  4U0F A;  3CME P;  1BAJ A;  2FQ0 A;  2MF4 A;  2ROQ A;  5EJD A;  4U0C A;  4MRT C;  4QNB A;  1L0I A;  5KP7 B;  2PEQ A;  2CGQ A;  2PEI A;  1YHQ P;  3CCJ P;  1VQ8 P;  3H4E A;  1QRJ A;  2N5I A;  2K0X A;  4R0M A;  4GR6 A;  3RG6 C;  1VQK P;  3G0V A;  2L22 A;  3B5I A;  3Q20 A;  2EHS A;  4XFX A;  2GDY A;  3I55 P;  4COC A;  3GZL A;  2LL8 A;  4BPF A;  1EIA A;  2DGY A;  2Z44 A;  3CCV P;  2WPT A;  3CC4 P;  3VRL C;  3G29 A;  1K9M Q;  1RO0 A;  5HGN A;  2LIW A;  2VSQ A;  2EIA A;  2MVV A;  4F37 A;  5CZD B;  3CC7 P;  4CA3 A;  2AF8 A;  4BPH A;  3I56 P;  1YJW P;  3CCS P;  2JU2 A;  1HQB A;  1NQ4 A;  2ERH A;  3E2D A;  3CD6 P;  2PY8 A;  1M90 Q;  2BUO A;  4U0E A;  3GZM A;  2E1M A;  2LIU A;  2MR7 A;  2VLN A;  1EMV A;  2L0Q A;  1UNK A;  2KOR A;  1AYI A;  5KP6 B;  1K73 Q;  2FAC A;  3H0D A;  2GDX A;  2GZI A;  2QEX P;  3DS5 A;  3NTE A;  3G6E P;  2GYK A;  2GZJ A;  2N98 A;  4DG9 A;  5KP8 B;  3MGE A;  4PXH B;  1CEI A;  2FHS C;  3CE7 A;  2CG5 B;  2GZE A;  1Q82 Q;  2K93 A;  4GR2 A;  1HY8 A;  2ONT A;  1VQM P;  2JB0 A;  1VQP P;  3G1G A;  1YJ9 P;  2PEM A;  3P05 A;  2N50 A;  3H47 A;  2XV6 A;  7CEI A;  5HGO A;  2KW2 A;  2CNR A;  1X3O A;  1E6J P;  1ZMB A;  2PEN A;  2XZ1 C;  2AVA A;  2XXM A; 
#chains in the Genus database with same CATH homology
 3CXC O;  3G29 A;  1K9M Q;  2PEK A;  1A8O A;  5F2O A;  3DTJ A;  1RO0 A;  3HYB A;  1W2B O;  1AUM A;  1IUQ A;  2OAR A;  5HGN A;  3G4S P;  1QVG O;  5F2K A;  4XFZ A;  5DCK A;  3CC2 P;  2EIA A;  3CPW O;  4WYM A;  3CC7 P;  1QVF O;  2JYG A;  3DPH A;  4M0I A;  2CWO A;  2M8L A;  3DS1 A;  1Q86 Q;  2QA4 P;  3DS4 A;  1VQN P;  3I56 P;  1YJW P;  1K8A Q;  3CCS P;  1VQL P;  2XT1 A;  2M8N A;  5BS2 A;  3OW2 O;  3E2D A;  1D1D A;  4IPY A;  3CD6 P;  4COP A;  5BS1 A;  2PY8 A;  1M90 Q;  1A43 A;  2BUO A;  3CCM P;  4U0E A;  1JJ2 O;  2Z46 A;  3WBH A;  3CCR P;  5HGM A;  1KQS O;  2E1M A;  3DS0 A;  4PH1 A;  3CMA P;  4PH0 A;  1VQ7 P;  1K30 A;  2OTJ P;  3M1M A;  1YIT P;  1K73 Q;  3H0D A;  2JO0 A;  3HZQ A;  2QEX P;  3DS2 A;  3DS5 A;  2JYL A;  3CCQ P;  3LRY A;  3NTE A;  1RNI A;  2LF4 A;  3G6E P;  2Z45 A;  4XFY A;  3MGE A;  2L6E A;  4U0D A;  5HGL A;  4U0A A;  5JPA A;  3CCE P;  1YI2 P;  4U0F A;  3CCL P;  3CME P;  1BAJ A;  3G26 A;  3DS3 A;  5I4T G;  2OTL P;  4U0C A;  1VQ6 P;  3CCU P;  4QNB A;  1Q82 Q;  2PEQ A;  1VQ5 P;  3G21 A;  2PEI A;  4XRQ A;  2BHV A;  4GR2 A;  1Q81 Q;  1NJI Q;  1S72 P;  1YHQ P;  2ONT A;  3CCJ P;  1VQM P;  2KOD A;  1VQP P;  3G1G A;  1M74 A;  3G1I A;  1YIJ P;  1YJ9 P;  1Q7Y Q;  1VQ8 P;  2PEM A;  3H4E A;  2EFJ A;  1QRJ A;  3P05 A;  1KD1 Q;  1M1K Q;  2P9X A;  1M6N A;  1VQO P;  3H47 A;  5F2N A;  4GR6 A;  1N8R Q;  1RO2 A;  2XV6 A;  2M8P A;  3RG6 C;  3G28 A;  4U0B A;  1VQ9 P;  5HGO A;  1VQK P;  2EG5 A;  3G0V A;  3B5I A;  3Q20 A;  4XFX A;  1E6J P;  3I55 P;  4XRO A;  4COC A;  1M6E X;  1ZMB A;  2PEN A;  3G71 P;  1EOQ A;  1EIA A;  2DGY A;  2Z44 A;  3CCV P;  2PEO A;  3CC4 P;  1YJN P;  1KC8 Q;  2PEJ A;  3VRL C;  2XXM A;  1VQ4 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...