5I4TG

Immature hexagonal lattice of hiv-1 gag
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an HIV assembly and maturation switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords CTD-SP1 fragment of HIV-1 Gag
total genus 30
structure length 91
sequence length 91
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2016-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5i4tG00
5HGLA 3H4EA 2M8LA 1EOQA 2KODA 5HGMA 2JO0A 3VRLC 4XFZA 4COCA 4XFYA 4U0AA 2XXMA 3DPHA 3DS3A 3H47A 4WYMA 4U0CA 2L6EA 4XFXA 4COPA 5HGNA 3G28A 4PH1A 3DS2A 2JYGA 2XT1A 1BAJA 2ONTA 4XRQA 4XROA 5JPAA 3G0VA 3DS0A 3G26A 4U0BA 4QNBA 4M0IA 3MGEA 2XV6A 1EIAA 1AUMA 3P05A 4IPYA 3DS1A 5I4TG 1D1DA 3DS5A 3NTEA 3G1IA 1QRJA 1A43A 4U0EA 2LF4A 4U0DA 2M8NA 1A8OA 3LRYA 5HGOA 1E6JP 3DTJA 2BUOA 2M8PA 3G1GA 3G29A 4U0FA 2EIAA 5DCKA 3G21A 4PH0A 2JYLA 3DS4A
chains in the Genus database with same CATH superfamily
2KORA 2L4BA 4U0CA 1VQ5P 1BAJA 2KWLA 1YHQP 2AVAA 2P9XA 4GR6A 3CCSP 2JQ4A 3CCEP 4U0DA 4R0MA 2QNWA 2GDWA 1AF8A 4U0FA 1K73Q 4IZ6A 2Z44A 1KD1Q 2KG9A 1BXIA 2CWOA 2FVAA 2GDXA 3G26A 3P05A 1GXGA 2PEKA 2FVFA 1M6EX 2L9FA 1ZMBA 2DNWA 2K2QA 2FQ1A 1HQBA 2PNGA 1GXHA 2M8LA 2OTLP 1L0IA 2KOOA 3DS3A 2L6EA 2NO8A 2JU2A 7CEIA 2VLQA 3LMOA 1NJIQ 3CPWO 2CNRA 3Q20A 1VQMP 3G29A 1N8RQ 2EG5A 2N5IA 2QEXP 3I56P 1VQ4P 2E1MA 2JAZA 5CZDB 2XZ0D 1K8AQ 1RO2A 2FAEA 2L0QA 4IPYA 2ROQA 4U0EA 3CCRP 2N98A 5KP7B 2BHVA 1A8OA 1VQ6P 2EIAA 2LKIA 2EHSA 4COCA 2LOLA 2K92A 4WYMA 2AFDA 2LPKA 1ZNVA 1UJZA 1VQ9P 2AFEA 3CMAP 2LL8A 2CGQA 4H2WC 1W2BO 1FR2A 1YITP 1EIAA 2PENA 4HKGA 1K9MQ 2KOQA 1F80D 2FVEA 2FHSC 2KOPA 3CXCO 2OARA 2KGAA 3VRLC 4PXHB 1HY8A 2VLOA 3OW2O 2KR5A 2PEJA 3I55P 1YJNP 1MZ8A 4M0IA 3RG2A 3GZMA 2CQ8A 2KW2A 2VLPA 2PEMA 1YJ9P 2GZIA 5HGMA 5KP8B 3CCLP 5EW5E 1NQ4A 2MVUA 2K0XA 2XZ1C 3DS5A 2JB0A 1VQNP 1OR5A 4H2YC 2JYLA 2XV6A 1D1DA 2GZFA 2JO0A 4U0AA 1VQKP 4BPFA 2JYGA 2ONTA 1S72P 2GDYA 2L22A 2PY8A 2CG5B 1KQSO 2LMLA 3G1IA 1VQPP 1M74A 2Z46A 1T8KA 1YI2P 2M8PA 1KLPA 1Q7YQ 3H4EA 2EFJA 4XFXA 1K30A 5HV8A 3E2DA 4U0BA 1YIJP 1QRJA 5KP6B 2KGDA 2GZEA 4CA3A 1IMPA 1E6JP 2LIWA 3M1MA 4GR2A 3DTJA 3CC4P 3G21A 3DS4A 1IMQA 3B5IA 3GJNA 2K93A 3H47A 2WPTA 3EJDA 3WBHA 3G0VA 1RO0A 1AUMA 3HYBA 5HGOA 3GKLC 3G6EP 1VQ8P 1QVFO 3G1GA 4PH0A 1Z6MA 3GZLA 5DCKA 5F2KA 2N6ZA 5HVCA 1GPJA 2K94A 1M90Q 3DPHA 4COPA 5BS1A 4PH1A 3NY7B 1Q81Q 2FQ0A 3RG6C 4DG9A 2MR7A 1YJWP 1M1KQ 1M6NA 4PWVB 3G4SP 4BPGA 2N5HA 5F2OA 5EJDA 3CCMP 2GZGA 3CCVP 2KODA 2OTJP 3U43A 5F2NA 5HGNA 2FQ2A 3CD6P 4XROA 2GYKA 3H0DA 5JPAA 2MY5A 4UHPB 2LIUA 2M5RA 5I4TG 2VSQA 1IUQA 2EHTA 1A43A 2LTEA 1VKUA 1VQOP 2VLNA 3CC7P 1L0HA 1UNKA 3CE7A 2BUOA 1RNIA 1Q82Q 3CCJP 2K0DX 1QVGO 3G28A 4XRQA 2GZJA 2Z45A 3DS0A 4MRTC 2N6YA 1ACPA 2ERHA 3CCUP 3LRYA 3EJEA 2JBGA 2PEQA 5BS2A 1KC8Q 2FADA 2MVVA 4XFYA 1E0HA 3CMEP 2XT1A 2MF4A 2AF8A 1VQLP 4H2XC 3HZQA 3NTEA 1Q86Q 2K0YA 1DNYA 3CCQP 2DGYA 2JU1A 1EOQA 4XFZA 2XXMA 2KG6A 2JGPA 3DS2A 2KG8A 1EMVA 1VHNA 2FACA 2X2BA 2KGEA 2PEIA 3DS1A 2MD9A 3EJBA 2LF4A 3CC2P 2KOSA 5HGLA 1JJ2O 4NEOA 2PEOA 2QA4P 1VQ7P 4F37A 1CEIA 1X3OA 4QNBA 3G71P 3MGEA 4QKOA 2MR8A 3B4QA 1DV5A 2M8NA 2N50A 1AYIA 2KGCA 4BPHA 2K5XA
chains in the Genus database with same CATH topology
3H4EA 1Q82Q 3CCJP 4COCA 2EFJA 4WYMA 4U0CA 4XFXA 1QVGO 3G28A 1VQ5P 1BAJA 4XRQA 1VQ9P 1K30A 3CMAP 1YHQP 2Z45A 1W2BO 3DS0A 3E2DA 4U0BA 1YITP 4GR6A 2P9XA 1EIAA 1YIJP 2PENA 1K9MQ 1QRJA 3CCSP 3CCEP 4U0DA 3CCUP 3LRYA 1E6JP 3M1MA 4GR2A 3DTJA 3CXCO 3CC4P 2OARA 4U0FA 3G21A 2PEQA 1K73Q 3DS4A 2Z44A 1KD1Q 5BS2A 3VRLC 1KC8Q 3B5IA 4XFYA 3H47A 3OW2O 3CMEP 2XT1A 2PEJA 2CWOA 3WBHA 3I55P 3G0VA 1YJNP 3G26A 4M0IA 1RO0A 1VQLP 3P05A 1AUMA 3HZQA 2PEKA 3NTEA 1Q86Q 3HYBA 1M6EX 1ZMBA 2PEMA 1YJ9P 5HGOA 3G6EP 1VQ8P 3CCQP 1QVFO 3G1GA 4PH0A 2DGYA 5DCKA 5F2KA 2M8LA 1EOQA 5HGMA 2OTLP 4XFZA 1M90Q 2XXMA 3DPHA 3DS3A 4COPA 2L6EA 5BS1A 4PH1A 3CCLP 3DS2A 1Q81Q 3RG6C 1NJIQ 2PEIA 3DS1A 3DS5A 1YJWP 1M1KQ 1M6NA 1VQNP 2LF4A 3CC2P 3CPWO 3G4SP 3Q20A 5F2OA 1VQMP 3G29A 1N8RQ 2EG5A 2XV6A 2JYLA 3CCMP 1D1DA 5HGLA 3CCVP 1JJ2O 2KODA 2QEXP 3I56P 2JO0A 2OTJP 2PEOA 4U0AA 2QA4P 1VQ4P 5F2NA 5HGNA 1VQ7P 2E1MA 1VQKP 3CD6P 2JYGA 2ONTA 4XROA 1S72P 3H0DA 5JPAA 4QNBA 3G71P 3MGEA 1K8AQ 1RO2A 5I4TG 4IPYA 2PY8A 1KQSO 3G1IA 1IUQA 1A43A 1VQPP 4U0EA 3CCRP 1VQOP 2M8NA 1M74A 3CC7P 2BHVA 1A8OA 2Z46A 1VQ6P 1YI2P 2BUOA 1RNIA 2M8PA 2EIAA 1Q7YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGL A;  3H4E A;  2M8L A;  1EOQ A;  2KOD A;  5HGM A;  2JO0 A;  3VRL C;  4XFZ A;  4COC A;  4XFY A;  4U0A A;  2XXM A;  3DPH A;  3DS3 A;  3H47 A;  4WYM A;  4U0C A;  2L6E A;  4XFX A;  4COP A;  5HGN A;  3G28 A;  4PH1 A;  3DS2 A;  2JYG A;  2XT1 A;  1BAJ A;  2ONT A;  4XRQ A;  4XRO A;  5JPA A;  3G0V A;  3DS0 A;  3G26 A;  4U0B A;  4QNB A;  4M0I A;  3MGE A;  2XV6 A;  1EIA A;  1AUM A;  3P05 A;  4IPY A;  3DS1 A;  5I4T G;  1D1D A;  3DS5 A;  3NTE A;  3G1I A;  1QRJ A;  1A43 A;  4U0E A;  2LF4 A;  4U0D A;  2M8N A;  1A8O A;  3LRY A;  5HGO A;  1E6J P;  3DTJ A;  2BUO A;  2M8P A;  3G1G A;  3G29 A;  4U0F A;  2EIA A;  5DCK A;  3G21 A;  4PH0 A;  2JYL A;  3DS4 A; 
#chains in the Genus database with same CATH topology
 2KOR A;  2L4B A;  4U0C A;  1VQ5 P;  1BAJ A;  2KWL A;  1YHQ P;  2AVA A;  2P9X A;  4GR6 A;  3CCS P;  2JQ4 A;  3CCE P;  4U0D A;  4R0M A;  2QNW A;  2GDW A;  1AF8 A;  4U0F A;  1K73 Q;  4IZ6 A;  2Z44 A;  1KD1 Q;  2KG9 A;  1BXI A;  2CWO A;  2FVA A;  2GDX A;  3G26 A;  3P05 A;  1GXG A;  2PEK A;  2FVF A;  1M6E X;  2L9F A;  1ZMB A;  2DNW A;  2K2Q A;  2FQ1 A;  1HQB A;  2PNG A;  1GXH A;  2M8L A;  2OTL P;  1L0I A;  2KOO A;  3DS3 A;  2L6E A;  2NO8 A;  2JU2 A;  7CEI A;  2VLQ A;  3LMO A;  1NJI Q;  3CPW O;  2CNR A;  3Q20 A;  1VQM P;  3G29 A;  1N8R Q;  2EG5 A;  2N5I A;  2QEX P;  3I56 P;  1VQ4 P;  2E1M A;  2JAZ A;  5CZD B;  2XZ0 D;  1K8A Q;  1RO2 A;  2FAE A;  2L0Q A;  4IPY A;  2ROQ A;  4U0E A;  3CCR P;  2N98 A;  5KP7 B;  2BHV A;  1A8O A;  1VQ6 P;  2EIA A;  2LKI A;  2EHS A;  4COC A;  2LOL A;  2K92 A;  4WYM A;  2AFD A;  2LPK A;  1ZNV A;  1UJZ A;  1VQ9 P;  2AFE A;  3CMA P;  2LL8 A;  2CGQ A;  4H2W C;  1W2B O;  1FR2 A;  1YIT P;  1EIA A;  2PEN A;  4HKG A;  1K9M Q;  2KOQ A;  1F80 D;  2FVE A;  2FHS C;  2KOP A;  3CXC O;  2OAR A;  2KGA A;  3VRL C;  4PXH B;  1HY8 A;  2VLO A;  3OW2 O;  2KR5 A;  2PEJ A;  3I55 P;  1YJN P;  1MZ8 A;  4M0I A;  3RG2 A;  3GZM A;  2CQ8 A;  2KW2 A;  2VLP A;  2PEM A;  1YJ9 P;  2GZI A;  5HGM A;  5KP8 B;  3CCL P;  5EW5 E;  1NQ4 A;  2MVU A;  2K0X A;  2XZ1 C;  3DS5 A;  2JB0 A;  1VQN P;  1OR5 A;  4H2Y C;  2JYL A;  2XV6 A;  1D1D A;  2GZF A;  2JO0 A;  4U0A A;  1VQK P;  4BPF A;  2JYG A;  2ONT A;  1S72 P;  2GDY A;  2L22 A;  2PY8 A;  2CG5 B;  1KQS O;  2LML A;  3G1I A;  1VQP P;  1M74 A;  2Z46 A;  1T8K A;  1YI2 P;  2M8P A;  1KLP A;  1Q7Y Q;  3H4E A;  2EFJ A;  4XFX A;  1K30 A;  5HV8 A;  3E2D A;  4U0B A;  1YIJ P;  1QRJ A;  5KP6 B;  2KGD A;  2GZE A;  4CA3 A;  1IMP A;  1E6J P;  2LIW A;  3M1M A;  4GR2 A;  3DTJ A;  3CC4 P;  3G21 A;  3DS4 A;  1IMQ A;  3B5I A;  3GJN A;  2K93 A;  3H47 A;  2WPT A;  3EJD A;  3WBH A;  3G0V A;  1RO0 A;  1AUM A;  3HYB A;  5HGO A;  3GKL C;  3G6E P;  1VQ8 P;  1QVF O;  3G1G A;  4PH0 A;  1Z6M A;  3GZL A;  5DCK A;  5F2K A;  2N6Z A;  5HVC A;  1GPJ A;  2K94 A;  1M90 Q;  3DPH A;  4COP A;  5BS1 A;  4PH1 A;  3NY7 B;  1Q81 Q;  2FQ0 A;  3RG6 C;  4DG9 A;  2MR7 A;  1YJW P;  1M1K Q;  1M6N A;  4PWV B;  3G4S P;  4BPG A;  2N5H A;  5F2O A;  5EJD A;  3CCM P;  2GZG A;  3CCV P;  2KOD A;  2OTJ P;  3U43 A;  5F2N A;  5HGN A;  2FQ2 A;  3CD6 P;  4XRO A;  2GYK A;  3H0D A;  5JPA A;  2MY5 A;  4UHP B;  2LIU A;  2M5R A;  5I4T G;  2VSQ A;  1IUQ A;  2EHT A;  1A43 A;  2LTE A;  1VKU A;  1VQO P;  2VLN A;  3CC7 P;  1L0H A;  1UNK A;  3CE7 A;  2BUO A;  1RNI A;  1Q82 Q;  3CCJ P;  2K0D X;  1QVG O;  3G28 A;  4XRQ A;  2GZJ A;  2Z45 A;  3DS0 A;  4MRT C;  2N6Y A;  1ACP A;  2ERH A;  3CCU P;  3LRY A;  3EJE A;  2JBG A;  2PEQ A;  5BS2 A;  1KC8 Q;  2FAD A;  2MVV A;  4XFY A;  1E0H A;  3CME P;  2XT1 A;  2MF4 A;  2AF8 A;  1VQL P;  4H2X C;  3HZQ A;  3NTE A;  1Q86 Q;  2K0Y A;  1DNY A;  3CCQ P;  2DGY A;  2JU1 A;  1EOQ A;  4XFZ A;  2XXM A;  2KG6 A;  2JGP A;  3DS2 A;  2KG8 A;  1EMV A;  1VHN A;  2FAC A;  2X2B A;  2KGE A;  2PEI A;  3DS1 A;  2MD9 A;  3EJB A;  2LF4 A;  3CC2 P;  2KOS A;  5HGL A;  1JJ2 O;  4NEO A;  2PEO A;  2QA4 P;  1VQ7 P;  4F37 A;  1CEI A;  1X3O A;  4QNB A;  3G71 P;  3MGE A;  4QKO A;  2MR8 A;  3B4Q A;  1DV5 A;  2M8N A;  2N50 A;  1AYI A;  2KGC A;  4BPH A;  2K5X A; 
#chains in the Genus database with same CATH homology
 3H4E A;  1Q82 Q;  3CCJ P;  4COC A;  2EFJ A;  4WYM A;  4U0C A;  4XFX A;  1QVG O;  3G28 A;  1VQ5 P;  1BAJ A;  4XRQ A;  1VQ9 P;  1K30 A;  3CMA P;  1YHQ P;  2Z45 A;  1W2B O;  3DS0 A;  3E2D A;  4U0B A;  1YIT P;  4GR6 A;  2P9X A;  1EIA A;  1YIJ P;  2PEN A;  1K9M Q;  1QRJ A;  3CCS P;  3CCE P;  4U0D A;  3CCU P;  3LRY A;  1E6J P;  3M1M A;  4GR2 A;  3DTJ A;  3CXC O;  3CC4 P;  2OAR A;  4U0F A;  3G21 A;  2PEQ A;  1K73 Q;  3DS4 A;  2Z44 A;  1KD1 Q;  5BS2 A;  3VRL C;  1KC8 Q;  3B5I A;  4XFY A;  3H47 A;  3OW2 O;  3CME P;  2XT1 A;  2PEJ A;  2CWO A;  3WBH A;  3I55 P;  3G0V A;  1YJN P;  3G26 A;  4M0I A;  1RO0 A;  1VQL P;  3P05 A;  1AUM A;  3HZQ A;  2PEK A;  3NTE A;  1Q86 Q;  3HYB A;  1M6E X;  1ZMB A;  2PEM A;  1YJ9 P;  5HGO A;  3G6E P;  1VQ8 P;  3CCQ P;  1QVF O;  3G1G A;  4PH0 A;  2DGY A;  5DCK A;  5F2K A;  2M8L A;  1EOQ A;  5HGM A;  2OTL P;  4XFZ A;  1M90 Q;  2XXM A;  3DPH A;  3DS3 A;  4COP A;  2L6E A;  5BS1 A;  4PH1 A;  3CCL P;  3DS2 A;  1Q81 Q;  3RG6 C;  1NJI Q;  2PEI A;  3DS1 A;  3DS5 A;  1YJW P;  1M1K Q;  1M6N A;  1VQN P;  2LF4 A;  3CC2 P;  3CPW O;  3G4S P;  3Q20 A;  5F2O A;  1VQM P;  3G29 A;  1N8R Q;  2EG5 A;  2XV6 A;  2JYL A;  3CCM P;  1D1D A;  5HGL A;  3CCV P;  1JJ2 O;  2KOD A;  2QEX P;  3I56 P;  2JO0 A;  2OTJ P;  2PEO A;  4U0A A;  2QA4 P;  1VQ4 P;  5F2N A;  5HGN A;  1VQ7 P;  2E1M A;  1VQK P;  3CD6 P;  2JYG A;  2ONT A;  4XRO A;  1S72 P;  3H0D A;  5JPA A;  4QNB A;  3G71 P;  3MGE A;  1K8A Q;  1RO2 A;  5I4T G;  4IPY A;  2PY8 A;  1KQS O;  3G1I A;  1IUQ A;  1A43 A;  1VQP P;  4U0E A;  3CCR P;  1VQO P;  2M8N A;  1M74 A;  3CC7 P;  2BHV A;  1A8O A;  2Z46 A;  1VQ6 P;  1YI2 P;  2BUO A;  1RNI A;  2M8P A;  2EIA A;  1Q7Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...