5I4TG

Immature hexagonal lattice of hiv-1 gag
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
91
structure length
91
Chain Sequence
TSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVLAEAMSQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of an HIV assembly and maturation switch.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords CTD-SP1 fragment of HIV-1 Gag
total genus 30
structure length 91
sequence length 91
chains with identical sequence H, I, J, K, L
ec nomenclature
pdb deposition date 2016-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5i4tG00
1A43A 2M8NA 4U0FA 2XV6A 1A8OA 4PH1A 3DS1A 4QNBA 3DPHA 4PH0A 4M0IA 4U0CA 5I4TG 3G28A 1AUMA 3DS2A 3MGEA 3P05A 3G29A 4XROA 3G21A 1E6JP 1EOQA 2EIAA 3G0VA 4XFXA 3DS5A 2L6EA 2KODA 1QRJA 5HGOA 2XT1A 4U0BA 4WYMA 5DCKA 5HGMA 2JYGA 3NTEA 2ONTA 4U0AA 4XRQA 5HGLA 5HGNA 1D1DA 3G26A 2LF4A 2XXMA 4COCA 2M8LA 4XFYA 2BUOA 1EIAA 3DS3A 3H47A 3G1GA 4COPA 5JPAA 3DS0A 4U0EA 3VRLC 2M8PA 2JYLA 3G1IA 4IPYA 1BAJA 4U0DA 2JO0A 3LRYA 3H4EA 4XFZA 3DTJA 3DS4A
chains in the Genus database with same CATH superfamily
3EJEA 3RG2A 4PH0A 2GDXA 3CCJP 3CXCO 2MF4A 1VQ8P 2PEIA 4U0BA 1N8RQ 4COCA 2MY5A 2KGDA 1VQLP 2JU2A 4H2XC 2M5RA 1K73Q 2N6ZA 1DV5A 2MR8A 2EFJA 4CA3A 4BPGA 1X3OA 3OW2O 1VQPP 3GKLC 4U0DA 3G71P 4PH1A 5I4TG 2K0YA 1K8AQ 1VQ6P 1L0IA 2CQ8A 3H0DA 5DCKA 1L0HA 3H47A 2GYKA 2QEXP 4BPFA 2K5XA 3G1IA 4HKGA 2XZ1C 2FACA 2EHTA 2KR5A 2KWLA 2LIUA 4QNBA 1HQBA 3Q20A 3CC4P 5EW5E 5HGMA 3CCLP 2MR7A 2KGEA 1QVFO 2BUOA 4U0EA 4H2WC 1CEIA 1YHQP 1KD1Q 2Z46A 5KP8B 1M90Q 4U0CA 1JJ2O 2E1MA 3HYBA 2JQ4A 2AF8A 1VQ4P 1Q86Q 1K30A 3NTEA 5HV8A 3EJBA 2JO0A 4XFZA 2X2BA 2WPTA 4PXHB 1ZMBA 3DS1A 2FQ0A 3RG6C 3CPWO 3CCRP 2JU1A 3CE7A 4GR6A 2GZFA 1YJ9P 2LPKA 2AFEA 1QVGO 2JAZA 2ROQA 2KW2A 1HY8A 2K0DX 3I56P 3G26A 2MVVA 3VRLC 1M74A 3LMOA 4IPYA 1FR2A 2KOPA 2PEKA 2JGPA 2M8NA 3DPHA 2LIWA 2VSQA 2VLOA 4H2YC 1EMVA 1IMQA 2EIAA 3G0VA 5HGOA 2DGYA 1K9MQ 2JYGA 5F2KA 2AFDA 2KG6A 1F80D 3DS3A 2KGAA 2KG8A 3DTJA 2K93A 3CCMP 1IMPA 1A8OA 2N5HA 2LOLA 3P05A 4XROA 5EJDA 1E6JP 2PEOA 3GZLA 2PEQA 2L9FA 2K2QA 3LRYA 7CEIA 2ERHA 2OARA 1GPJA 2EHSA 1T8KA 2JBGA 5KP7B 3G29A 2LKIA 3WBHA 3CD6P 1AYIA 2BHVA 4WYMA 4R0MA 5HGNA 2L0QA 1S72P 5F2OA 1E0HA 1BAJA 1UJZA 1YITP 2K94A 1KQSO 3CC7P 4IZ6A 2NO8A 2LMLA 2KORA 2GDYA 2KGCA 1YI2P 4XFXA 1RO0A 2L22A 3CCVP 2QNWA 2XZ0D 2ONTA 2P9XA 1VQ9P 4F37A 2JYLA 1VQNP 5KP6B 1IUQA 1A43A 4U0FA 2CNRA 2VLNA 2OTJP 4M0IA 3MGEA 1VQMP 2FQ1A 3G21A 1EOQA 2L6EA 2KODA 1RO2A 2KOOA 4XRQA 5HGLA 2FVFA 2KOSA 2Z45A 4BPHA 3H4EA 3GJNA 2XV6A 1GXGA 3G28A 1AUMA 2VLPA 3G4SP 2PEJA 2OTLP 3DS5A 2KG9A 4DG9A 2L4BA 3CMEP 1VQ5P 1EIAA 3G1GA 2N5IA 1M6EX 3E2DA 2CWOA 2PY8A 4NEOA 2MVUA 2GZGA 1Q7YQ 2GDWA 3B5IA 3U43A 3HZQA 1YIJP 2FVAA 2N6YA 5CZDB 2EG5A 2JB0A 3I55P 2CG5B 2XT1A 1D1DA 3GZMA 1M1KQ 3M1MA 4PWVB 4XFYA 1NQ4A 1YJNP 1VKUA 2VLQA 4MRTC 3DS0A 2GZIA 1DNYA 5BS2A 1ACPA 2CGQA 1W2BO 1KLPA 1NJIQ 1OR5A 1RNIA 1VHNA 1ZNVA 2FQ2A 3G6EP 2LL8A 2FADA 1BXIA 3B4QA 1QRJA 4U0AA 2LF4A 2M8LA 2PEMA 5JPAA 5F2NA 2LTEA 3CC2P 1YJWP 5BS1A 3DS4A 2K0XA 2PNGA 2K92A 4UHPB 2N50A 3CCUP 3CCEP 4GR2A 2FVEA 1AF8A 1MZ8A 2FHSC 2Z44A 1KC8Q 2GZEA 2XXMA 4COPA 3CCQP 5HVCA 3EJDA 2M8PA 1VQ7P 1Q81Q 4QKOA 1Z6MA 2DNWA 1UNKA 3NY7B 2N98A 3DS2A 3CMAP 2FAEA 2GZJA 3CCSP 1GXHA 2QA4P 2KOQA 1Q82Q 2AVAA 1M6NA 2MD9A 2PENA 1VQKP 1VQOP
chains in the Genus database with same CATH topology
2OARA 1KD1Q 2Z46A 3HZQA 4PH0A 4U0CA 1M90Q 1YIJP 1JJ2O 3G29A 2E1MA 3HYBA 3WBHA 3CCJP 3CXCO 2EG5A 1VQ4P 1Q86Q 1K30A 1VQ8P 3CD6P 2PEIA 3I55P 2BHVA 2XT1A 4U0BA 4WYMA 1N8RQ 3NTEA 5HGNA 1D1DA 1M1KQ 3M1MA 4COCA 4XFYA 1YJNP 1S72P 3DS0A 5F2OA 5BS2A 1VQLP 1BAJA 2JO0A 4XFZA 1YITP 1W2BO 1KQSO 3CC7P 1ZMBA 1NJIQ 1RNIA 3DS1A 1K73Q 3RG6C 3CPWO 3CCRP 3G6EP 4GR6A 1YI2P 2EFJA 1YJ9P 1QVGO 4XFXA 1RO0A 1QRJA 3CCVP 4U0AA 2ONTA 3I56P 3G26A 2LF4A 3OW2O 2M8LA 2PEMA 5JPAA 5F2NA 1VQPP 2P9XA 1VQ9P 3CC2P 3VRLC 1M74A 1YJWP 2JYLA 4IPYA 4U0DA 1VQNP 5BS1A 2PEKA 3DS4A 1A43A 1IUQA 2M8NA 4U0FA 3G71P 4PH1A 2OTJP 3DPHA 4M0IA 5I4TG 3CCUP 3CCEP 3MGEA 1VQMP 4GR2A 3G21A 1EOQA 2EIAA 2Z44A 3G0VA 1K8AQ 2L6EA 1VQ6P 2KODA 1RO2A 5HGOA 2DGYA 3H0DA 5DCKA 1K9MQ 2JYGA 5F2KA 4XRQA 5HGLA 1KC8Q 2XXMA 2Z45A 4COPA 3DS3A 3H47A 3CCQP 2QEXP 2M8PA 1VQ7P 1Q81Q 3G1IA 3H4EA 3DTJA 3CCMP 2XV6A 1A8OA 4QNBA 3G28A 3Q20A 1AUMA 3DS2A 3P05A 4XROA 2PEJA 3G4SP 3CC4P 3CMAP 2OTLP 1E6JP 2PEOA 3CCSP 3DS5A 5HGMA 2QA4P 3CCLP 2PEQA 1Q82Q 3CMEP 1VQ5P 1QVFO 2BUOA 1EIAA 3G1GA 1M6NA 1M6EX 4U0EA 3E2DA 2CWOA 2PY8A 2PENA 1YHQP 1VQKP 3LRYA 1VQOP 1Q7YQ 3B5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A43 A;  2M8N A;  4U0F A;  2XV6 A;  1A8O A;  4PH1 A;  3DS1 A;  4QNB A;  3DPH A;  4PH0 A;  4M0I A;  4U0C A;  5I4T G;  3G28 A;  1AUM A;  3DS2 A;  3MGE A;  3P05 A;  3G29 A;  4XRO A;  3G21 A;  1E6J P;  1EOQ A;  2EIA A;  3G0V A;  4XFX A;  3DS5 A;  2L6E A;  2KOD A;  1QRJ A;  5HGO A;  2XT1 A;  4U0B A;  4WYM A;  5DCK A;  5HGM A;  2JYG A;  3NTE A;  2ONT A;  4U0A A;  4XRQ A;  5HGL A;  5HGN A;  1D1D A;  3G26 A;  2LF4 A;  2XXM A;  4COC A;  2M8L A;  4XFY A;  2BUO A;  1EIA A;  3DS3 A;  3H47 A;  3G1G A;  4COP A;  5JPA A;  3DS0 A;  4U0E A;  3VRL C;  2M8P A;  2JYL A;  3G1I A;  4IPY A;  1BAJ A;  4U0D A;  2JO0 A;  3LRY A;  3H4E A;  4XFZ A;  3DTJ A;  3DS4 A; 
#chains in the Genus database with same CATH topology
 3EJE A;  3RG2 A;  4PH0 A;  2GDX A;  3CCJ P;  3CXC O;  2MF4 A;  1VQ8 P;  2PEI A;  4U0B A;  1N8R Q;  4COC A;  2MY5 A;  2KGD A;  1VQL P;  2JU2 A;  4H2X C;  2M5R A;  1K73 Q;  2N6Z A;  1DV5 A;  2MR8 A;  2EFJ A;  4CA3 A;  4BPG A;  1X3O A;  3OW2 O;  1VQP P;  3GKL C;  4U0D A;  3G71 P;  4PH1 A;  5I4T G;  2K0Y A;  1K8A Q;  1VQ6 P;  1L0I A;  2CQ8 A;  3H0D A;  5DCK A;  1L0H A;  3H47 A;  2GYK A;  2QEX P;  4BPF A;  2K5X A;  3G1I A;  4HKG A;  2XZ1 C;  2FAC A;  2EHT A;  2KR5 A;  2KWL A;  2LIU A;  4QNB A;  1HQB A;  3Q20 A;  3CC4 P;  5EW5 E;  5HGM A;  3CCL P;  2MR7 A;  2KGE A;  1QVF O;  2BUO A;  4U0E A;  4H2W C;  1CEI A;  1YHQ P;  1KD1 Q;  2Z46 A;  5KP8 B;  1M90 Q;  4U0C A;  1JJ2 O;  2E1M A;  3HYB A;  2JQ4 A;  2AF8 A;  1VQ4 P;  1Q86 Q;  1K30 A;  3NTE A;  5HV8 A;  3EJB A;  2JO0 A;  4XFZ A;  2X2B A;  2WPT A;  4PXH B;  1ZMB A;  3DS1 A;  2FQ0 A;  3RG6 C;  3CPW O;  3CCR P;  2JU1 A;  3CE7 A;  4GR6 A;  2GZF A;  1YJ9 P;  2LPK A;  2AFE A;  1QVG O;  2JAZ A;  2ROQ A;  2KW2 A;  1HY8 A;  2K0D X;  3I56 P;  3G26 A;  2MVV A;  3VRL C;  1M74 A;  3LMO A;  4IPY A;  1FR2 A;  2KOP A;  2PEK A;  2JGP A;  2M8N A;  3DPH A;  2LIW A;  2VSQ A;  2VLO A;  4H2Y C;  1EMV A;  1IMQ A;  2EIA A;  3G0V A;  5HGO A;  2DGY A;  1K9M Q;  2JYG A;  5F2K A;  2AFD A;  2KG6 A;  1F80 D;  3DS3 A;  2KGA A;  2KG8 A;  3DTJ A;  2K93 A;  3CCM P;  1IMP A;  1A8O A;  2N5H A;  2LOL A;  3P05 A;  4XRO A;  5EJD A;  1E6J P;  2PEO A;  3GZL A;  2PEQ A;  2L9F A;  2K2Q A;  3LRY A;  7CEI A;  2ERH A;  2OAR A;  1GPJ A;  2EHS A;  1T8K A;  2JBG A;  5KP7 B;  3G29 A;  2LKI A;  3WBH A;  3CD6 P;  1AYI A;  2BHV A;  4WYM A;  4R0M A;  5HGN A;  2L0Q A;  1S72 P;  5F2O A;  1E0H A;  1BAJ A;  1UJZ A;  1YIT P;  2K94 A;  1KQS O;  3CC7 P;  4IZ6 A;  2NO8 A;  2LML A;  2KOR A;  2GDY A;  2KGC A;  1YI2 P;  4XFX A;  1RO0 A;  2L22 A;  3CCV P;  2QNW A;  2XZ0 D;  2ONT A;  2P9X A;  1VQ9 P;  4F37 A;  2JYL A;  1VQN P;  5KP6 B;  1IUQ A;  1A43 A;  4U0F A;  2CNR A;  2VLN A;  2OTJ P;  4M0I A;  3MGE A;  1VQM P;  2FQ1 A;  3G21 A;  1EOQ A;  2L6E A;  2KOD A;  1RO2 A;  2KOO A;  4XRQ A;  5HGL A;  2FVF A;  2KOS A;  2Z45 A;  4BPH A;  3H4E A;  3GJN A;  2XV6 A;  1GXG A;  3G28 A;  1AUM A;  2VLP A;  3G4S P;  2PEJ A;  2OTL P;  3DS5 A;  2KG9 A;  4DG9 A;  2L4B A;  3CME P;  1VQ5 P;  1EIA A;  3G1G A;  2N5I A;  1M6E X;  3E2D A;  2CWO A;  2PY8 A;  4NEO A;  2MVU A;  2GZG A;  1Q7Y Q;  2GDW A;  3B5I A;  3U43 A;  3HZQ A;  1YIJ P;  2FVA A;  2N6Y A;  5CZD B;  2EG5 A;  2JB0 A;  3I55 P;  2CG5 B;  2XT1 A;  1D1D A;  3GZM A;  1M1K Q;  3M1M A;  4PWV B;  4XFY A;  1NQ4 A;  1YJN P;  1VKU A;  2VLQ A;  4MRT C;  3DS0 A;  2GZI A;  1DNY A;  5BS2 A;  1ACP A;  2CGQ A;  1W2B O;  1KLP A;  1NJI Q;  1OR5 A;  1RNI A;  1VHN A;  1ZNV A;  2FQ2 A;  3G6E P;  2LL8 A;  2FAD A;  1BXI A;  3B4Q A;  1QRJ A;  4U0A A;  2LF4 A;  2M8L A;  2PEM A;  5JPA A;  5F2N A;  2LTE A;  3CC2 P;  1YJW P;  5BS1 A;  3DS4 A;  2K0X A;  2PNG A;  2K92 A;  4UHP B;  2N50 A;  3CCU P;  3CCE P;  4GR2 A;  2FVE A;  1AF8 A;  1MZ8 A;  2FHS C;  2Z44 A;  1KC8 Q;  2GZE A;  2XXM A;  4COP A;  3CCQ P;  5HVC A;  3EJD A;  2M8P A;  1VQ7 P;  1Q81 Q;  4QKO A;  1Z6M A;  2DNW A;  1UNK A;  3NY7 B;  2N98 A;  3DS2 A;  3CMA P;  2FAE A;  2GZJ A;  3CCS P;  1GXH A;  2QA4 P;  2KOQ A;  1Q82 Q;  2AVA A;  1M6N A;  2MD9 A;  2PEN A;  1VQK P;  1VQO P; 
#chains in the Genus database with same CATH homology
 2OAR A;  1KD1 Q;  2Z46 A;  3HZQ A;  4PH0 A;  4U0C A;  1M90 Q;  1YIJ P;  1JJ2 O;  3G29 A;  2E1M A;  3HYB A;  3WBH A;  3CCJ P;  3CXC O;  2EG5 A;  1VQ4 P;  1Q86 Q;  1K30 A;  1VQ8 P;  3CD6 P;  2PEI A;  3I55 P;  2BHV A;  2XT1 A;  4U0B A;  4WYM A;  1N8R Q;  3NTE A;  5HGN A;  1D1D A;  1M1K Q;  3M1M A;  4COC A;  4XFY A;  1YJN P;  1S72 P;  3DS0 A;  5F2O A;  5BS2 A;  1VQL P;  1BAJ A;  2JO0 A;  4XFZ A;  1YIT P;  1W2B O;  1KQS O;  3CC7 P;  1ZMB A;  1NJI Q;  1RNI A;  3DS1 A;  1K73 Q;  3RG6 C;  3CPW O;  3CCR P;  3G6E P;  4GR6 A;  1YI2 P;  2EFJ A;  1YJ9 P;  1QVG O;  4XFX A;  1RO0 A;  1QRJ A;  3CCV P;  4U0A A;  2ONT A;  3I56 P;  3G26 A;  2LF4 A;  3OW2 O;  2M8L A;  2PEM A;  5JPA A;  5F2N A;  1VQP P;  2P9X A;  1VQ9 P;  3CC2 P;  3VRL C;  1M74 A;  1YJW P;  2JYL A;  4IPY A;  4U0D A;  1VQN P;  5BS1 A;  2PEK A;  3DS4 A;  1A43 A;  1IUQ A;  2M8N A;  4U0F A;  3G71 P;  4PH1 A;  2OTJ P;  3DPH A;  4M0I A;  5I4T G;  3CCU P;  3CCE P;  3MGE A;  1VQM P;  4GR2 A;  3G21 A;  1EOQ A;  2EIA A;  2Z44 A;  3G0V A;  1K8A Q;  2L6E A;  1VQ6 P;  2KOD A;  1RO2 A;  5HGO A;  2DGY A;  3H0D A;  5DCK A;  1K9M Q;  2JYG A;  5F2K A;  4XRQ A;  5HGL A;  1KC8 Q;  2XXM A;  2Z45 A;  4COP A;  3DS3 A;  3H47 A;  3CCQ P;  2QEX P;  2M8P A;  1VQ7 P;  1Q81 Q;  3G1I A;  3H4E A;  3DTJ A;  3CCM P;  2XV6 A;  1A8O A;  4QNB A;  3G28 A;  3Q20 A;  1AUM A;  3DS2 A;  3P05 A;  4XRO A;  2PEJ A;  3G4S P;  3CC4 P;  3CMA P;  2OTL P;  1E6J P;  2PEO A;  3CCS P;  3DS5 A;  5HGM A;  2QA4 P;  3CCL P;  2PEQ A;  1Q82 Q;  3CME P;  1VQ5 P;  1QVF O;  2BUO A;  1EIA A;  3G1G A;  1M6N A;  1M6E X;  4U0E A;  3E2D A;  2CWO A;  2PY8 A;  2PEN A;  1YHQ P;  1VQK P;  3LRY A;  1VQO P;  1Q7Y Q;  3B5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...