5I59A

Glutamate- and glycine-bound glun1/glun2a agonist binding domains with mpx 007
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
282
structure length
262
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCVKKVICTGPHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Negative Allosteric Modulation of GluN2A-Containing NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ion
total genus 83
structure length 262
sequence length 282
ec nomenclature
pdb deposition date 2016-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i59A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i59A02
1MQDA 2A5TB 2XXHA 2HFBA 2XXWA 2XD3A 2AL4A 2YLNA 4ELQA 1H45A 3G3GA 3OXNA 2THIA 3GBBA 1OLAA 2LAOA 4FIMA 4QFOA 1RYXA 4H5FA 3IB0A 3R6UA 4R9GA 2NXOA 4IO6A 4IY5A 4TLMB 4ECFA 2XX9A 1PEBA 3JV9A 1IXIA 3C31A 2WKYA 4F18A 3U94A 3SESA 5I56A 1YPNA 3EF7A 3IOVA 4NF4B 4OMBA 3K6UA 3LBSA 1BLFA 5I2KA 4X1DA 5KZTA 1Y9UA 2QS1A 3QXMA 5IAIA 4K3FA 3SKPA 3I6VA 3EPEA 1B2HA 4LUBA 4N07A 4C0RA 1B51A 1MXYA 1Y3QA 3T9UA 1NH8A 2QMXA 1KWHA 2Z22A 3FJ7A 3M8UA 4YZZA 3KN7A 1UIVA 3EN3A 4GWOA 4LVQA 4F39A 1VR5A 3DLNA 1B4HA 2NOOA 1FTKA 5I84A 1ZTYA 4FJPA 4GLIA 4UACA 5CBRA 3IO6A 3OO9A 3UP9A 5BUUA 2V84A 4DXBA 3SETA 3IAZA 3MPLA 4IO7A 3C9HA 4R74A 4KR5A 2R71A 2QS4A 4IY6A 3USDA 5B7DA 1LAFE 1LB9A 3B6TA 1VFEA 3IORA 1NNTA 1FW0A 1ZBMA 2F5XA 3E4RA 4FE8A 4M4GA 4YAHX 4GOTA 3UN6A 3VE1B 5CMBA 3CFXA 2DVCA 1B05A 3FIRA 2DE4A 1B58A 1CB6A 1FQCA 2GFEA 5DTBA 1XC1A 1TFAA 4QFLA 3I5OA 4F3BA 3QYTA 1XOCA 5TPAA 4I62A 1B3FA 1QJMA 3O6HA 5JK4A 1MPDA 2V3TA 3SEUA 3OMBA 4LATA 4GFRA 4ZS9A 5L9OA 1B7HA 1D9VA 4GL0A 3OSRA 3U72A 2DYXA 4JWYA 1RKMA 2HAVA 2B65A 3K1NA 3OO7A 5JEIA 1D4NA 3LC8A 1PBPA 1D3KA 5AA2A 3LSFB 2X7QA 4GXAA 3WAFA 5I2NB 3VXBA 1UTBA 2Y84A 3O66A 5I59A 2VD2A 2XXQA 1GGGA 1R1NA 2DOJA 1NH7A 1MY0A 1LFGA 1IUDA 2Y7IA 4N13A 4O3CA 4OFJA 2ZXTA 2O7IA 2PT2A 5K2YA 4POXA 5I58A 3MQ9A 3A3UA 4MF3A 4DXCA 4F3PA 1MXUA 1B6HA 2QS3A 3BBRA 3TUSA 2DE2A 3EHTA 1JVXA 1UIUA 3G7WA 4OEUA 1PBQA 2PT1A 3RTWB 3SEWA 5AA2D 3VXCA 3QAXA 4EQ9A 1PB9A 4HS7A 5AA3A 2FA7A 3QSLA 1DMBA 3PGFA 4MH5A 1BTJA 3IOTA 2I3WA 4KD5A 3U8QA 1OQGA 3ZKLA 1EZOA 1IEJA 4ZZEA 1B0LA 4F3SA 1YAEA 3DELB 3MJNA 1H76A 1B1HA 1SDXA 2YJPA 1HSEA 4EQ7A 4U2RA 4KHZE 1OLCA 4QFKA 2Z23A 4PFWA 3G3JA 1A7LA 3HPIA 5B70A 1R9QA 3TCGA 4NF6B 1PDAA 1URSA 5ICTA 3E9XA 5L9SA 2VOZA 4R75A 2ZNUA 1I6BA 1B40A 4AQ4A 1EZPA 1PC3A 1POY1 1JVYA 4FORA 4IGRA 4IO2A 4ZEIA 1LLSA 1DTGA 1SVXB 2XXUA 3FZVA 4R2BA 4F1VA 2NWJA 2GHAA 3L6GA 3C33A 1H43A 1QW0A 2IA4A 1IZ1A 3CG3A 5CRYA 1FTJA 5ITPA 2Q89A 4NF5A 1XHYA 4GD5A 3UA8A 4R6KA 3EQ1A 2DWIA 2ONRA 4OXVA 5AA2B 1SW2A 4DE8A 2DVZA 2D21A 5DEXA 3RT8A 2DS9A 2YPNA 2R9JA 2IEEA 5H8SA 1BIYA 4YKIA 3O28A 2G29A 3S9EA 1LSTA 3TQLA 3DM0A 5I58B 4QFNA 3T22A 4NF8A 4NF4A 3GZGA 2ANJA 3PPOA 4RK9A 2OBGA 3T66A 3C32A 3BFTA 4NTLA 3TTKA 1F9BA 2F7BA 5FTHA 4LA9A 1B46A 4IB2A 3Q25A 2RCBA 3RGYA 3QK6A 2XHDA 3BKIB 4RNSA 1I69A 3K6VA 3B6WA 4L17A 4LZ7A 3RUMA 1YTVA 3M3KA 1I6AA 5I2NA 3C35A 1Y1MA 3G3FA 5CM6A 4OENA 1MH4A 3R26A 4RYAA 4DZ1A 3MVYA 2M8CA 3OELA 4G8MA 1FTMA 3O97A 3TTNA 3PUXE 5CMKA 5TPAB 4BDQA 2XD2A 2O51A 1H44A 1UTHA 4NWCA 1B9JA 1MY2A 5KDTB 1SYIA 3TMGA 1JEUA 2O7UA 2B3FA 1OIBA 1MRPA 1Y4CA 2GHBA 3B6QA 3O2AA 4JSDA 5HBCA 4THIA 1UTHB 3C36A 4C1TA 3MW0A 4GIZA 1LCTA 5DT6A 2W7YA 1TFDA 3TFLA 4C1UA 4ZZAA 4H6DA 1YCJA 1SW5A 2QJEA 3IOWA 3PUVE 3VLUA 1HSLA 1N84A 3QUJA 1B0HA 1WDNA 2H9BA 1S9TA 2DXYA 3BFUA 3F11A 2F35A 3LR1A 3PUWE 4P11A 2G93A 5M2VA 4KYDA 3CFLA 3ILTB 5TP9A 4EUOA 3OO6A 2XX7A 4NEDA 1B4ZA 3Q26A 2ZNTA 3IX1A 3LSWA 4NWDA 3ODBA 1R6ZA 2V25A 3A3CA 3U92A 2VD3A 3TODA 1OMPA 4KI0E 4NMYA 1QKBA 3ZKKA 3RTFB 3V8XB 4GVOA 3T9VA 3T9XB 3TYHA 2E1SA 2PMSA 5DVFA 2HEUA 1TWYA 2I0BA 1MS7A 4YU0A 4POWA 5ITOA 4YB5A 4R9FA 1Y4TA 4LQ5A 2H5YA 1P1OA 4XKNA 3MP1A 1FQBA 5A5XA 3K01A 1PB7A 4QFPA 2XXXA 2F7AA 1JEVA 1UQWA 3KOTA 4ONYA 3TQWA 3OOAA 1A8FA 3K1PA 3MWBA 1ELJA 3O9PA 4ELPA 2D3IA 3MZ1A 2ZMBA 4OTEA 3PMVA 2ZYKA 3ECRA 4PFTA 3TCFA 5CC2A 1A99A 2Z8EA 4GL8A 1GR2A 1FQDA 3AXFA 3VFJA 3IL1B 1UTBB 1M5BA 4I1DA 3KG2A 4MFIA 2F6GA 4OFOA 1JW5A 3SEYA 4DIGA 3MP6A 3OEMA 2F7CA 3U1OA 3S9NC 3SDFA 2Y7WA 5ICQA 1FQEA 3FV2A 2OWSA 3FD3A 3I3VA 4WKMA 4NE4A 1LAHE 3LSLA 3OD7A 3U93A 4YB7A 3HCQA 4Z7EA 1SW4A 3W9VA 1IITA 1MPCA 2PYYA 2XX8A 3G3IA 4KCDA 3V83A 1Y1ZA 1Q1KA 3G3KA 4I9DA 1USYH 1IQ7A 1M5DA 3FJMA 3IB1A 3L6HA 3HN0A 3UIFA 2DWJA 3W9WA 4ISUA 4EF2A 4ELOA 1GV8A 4PE5B 1AOVA 4BLAA 1EZ9A 2PBWA 2F8DA 4Q5TA 1MY1A 1MDP1 4UA8A 1US4A 1NNFA 3MPKA 1B5JA 2RKMA 4GXSB 4OYVA 2HXWA 1JNFA 2P1SA 2V3UA 2XXIA 2XXPA 3C34A 3CSBA 3DP8A 4H1XA 3N94A 3PUZE 2Z8DA 4KYEA 3K1MA 3UK4A 1QUIA 5H8FA 4KFQA 5H8NB 5KCJA 3DP4A 4WEPA 2I6EA 3Q28A 4I8CA 1B3HA 4RA1A 3ZSFA 4DDDA 4F2OA 3MZ9A 4YKKA 1JW4A 4GQOA 4QF9A 5I59B 1ZJLA 3MVWA 1WVJA 3W15C 1NNKA 4Z0IA 4P0IA 3DP6A 1S50A 2Y7PA 2X26A 3H6UA 4O3BA 1NFTA 5H8QA 5L8DA 3CSGA 2O84X 3CR9A 4P0GA 3KBRA 1B3GA 3PD8A 5HM4B 3PU5A 4X9TA 1L5TA 1VSOA 4NF8B 2QMWA 2HAUA 3C4MA 3HHGA 3OEKA 5H8FB 3GBAA 4G8HA 1AIVA 2I4BA 3EHSA 3ILUB 5CMMA 3ZS6A 1WODA 1P1UA 2O6AA 1ZMGA 2OWTA 5FHNA 2AYSA 4IO4A 3G3HA 3H6VA 4AB6A 3A09A 1A55A 1EH3A 2UYEA 1XT8A 3CI8A 4Q0CA 4OEVA 4ELRA 1MPBA 5TU0A 4KQPA 3LUYA 1LFHA 3FGSA 2F34A 2DXRA 2XXVA 4G68C 4JDFA 1URGA 4LP2B 4NF6A 2DWHA 1DTZA 4OFLA 3TZAA 3VV5A 3VDFA 4N6PA 2ZYNA 4F29A 3VLVA 2CZLA 5A5XB 1US5A 4QHQA 1LGBC 3PD9A 4QRZA 1S7YA 4M1VA 1IIWA 2GRVA 3FXRA 3VLWA 2AL5A 5DVJA 1ATGA 1DSNA 3PMWA 4TLLB 3H6TA 5F7VA 1BP5A 2Y7KA 1QUJA 4YB6A 1AMFA 2RC7A 4HW8A 3MBPA 5AA4B 2H25A 4U4XA 1P99A 3PPRA 4GF8A 4U23A 4NF5B 4Q30B 2Q8JA 2Q88A 5FHOA 4RPOA 4G8NA 3K2DA 2XXYA 3O6GA 1MXXA 2UVJA 1MH3A 2OK2A 3CVGA 3UGWA 1MXWA 1SYHA 1FQFA 2QRYA 2QL3A 2ALUA 3MVZA 4F1UA 4DCYA 4X1BA 4IO3A 4XIGQ 2NVUB 4F3GA 4ZE9A 1N04A 3OSQA 4G2ZA 2R6GE 3IR1A 3VVDA 2OCUA 1SW1A 1MXZA 3IJOB 4G77A 1T0KA 4JWOA 4GRKA 4ND9A 5H8QB 3IJXB 5IKBA 1ZKBA 1MY4A 2NUVA 1B7UA 1GTKA 2E0SA 1B1XA 1Z7ME 3TAJA 1I6QA 4QSDA 5TP9B 2Q2CA 4G4PA 3IO4A 3CRBA 3K0VA 5EHMA 4JXIA 3PPNA 1O7TA 4MLVA 4KYSA 1AH5A 2I58A 1Z7NE 4X48A 3QIMA 1IXGA 1II5A 2Q9TA 2DE3A 5I57B 4DLDA 2F36A 2DP8A 4FATA 2DQVA 1MM6A 1TXFA 2OLBA 3FVKA 3HV1A 2P0SA 2P2AA 2X7PA 4R73A 5EHSA 4OERA 2B3BA 3JYRA 4E0WA 4ZECA 5BWJA 5CBSA 2OJTA 1VFDA 4XTCQ 1B5HA 4IO5A 2HCAA 3S9MC 3GLBA 4JBZA 3JZJA 3K6XA 1RYOA 2Z8FA 3KN3A 1M5EA 2XXRA 4EXKA 2Y7RA 3PUYE 2I49A 5EYFA 4OWDA 4YICA 2CMOA 3GXAA 4DCXA 3RPWA 2HQ0A 3KEIA 5LOMA 4ZE8A 5I56B 3KSXA 2RINA 4R2FA 4TOZA 3CG1A 3N26A 2O1LA 5DEXB 4YKPA 3MP8A 1Y3NA 2FYIA 4PETA 4U1ZA 5L9MA 3R7XA 1N7WA 4WXJA 4F31B 3D4CA 1CE2A 3O6IA 3RY3A 3TDJA 4EF1A 3FASA 4H8IA 1N0TA 3TELA 4QSEA 1P1NA 3FUZA 1MXVA 2RF1A 4OETA 3H6WA 3HHFA 3CIJA 3TTRA 2ZYOA 4PFYA 5H8NA 2V3QA 4LONB 2ESNA 3K02A 3ONMA 4JB7A 1B3EA 1NL5A 4F1YA 1SBPA 4U21A 1OVBA 5HPQA 3S9LC 3N6TA 1MQGA 2PVUA 4RXLA 1LFIA 4R6HA 1ZIUA 3RN8A 2H4IA 1OQHA 1FQAA 3SEXA 1PB8A 1M5CA 1LBBA 1N3WA 3VVEA 4BDOA 4DXUA 1DPPA 1XVYA 2KLFA 4BDMA 1A8EA 4OVJA 3TTLA 2O1MA 5CI5A 3RLFE 4ESWA 5AA4A 1MQHA 4HCYA 1VE4A 2I4CA 1ANFA 4FAJA 1ZU0A 1SQYA 4H65A 2I48A 1IXHA 3IOUA 4FEDA 2ONKE 5FHMA 5I57A 2XXTA 4MLQA 3TEPA 5J1DA 3Q27A 3TPAA 1MG1A 4XXUA 4AB5A 5F1QA 2UVGA 4BDRA 1N7XA 2VP1A 4HCWA 4ESXA 1SI0A 1OVTA 3H06B 4FECA 1D9YA 2F78A 3S4UA 3THIA 3OENA 1ZLQA 4F2QA 3RQTA 2ABHA 3KSJA 2QPQA 1M5FA 3SEVA 5I2KB 3N5LA 3O29A 3LSXA 4PP0A 3M3FA 4PFUA 4YMBA 2V93A 3UORA 1IXCA 3KJTA 4G68A 4JWXA 1LAGE 4RJZA 5ISUA 2BJJX 3V89B 3KN8A 1FTOA 3K4UA 1AL3A 2QS2A 3E13X 3P7IA 2GH9A 3MVXA 4RY1A 4WEDA 5H8HA 1JW1A 1SI1A 3MC2A 4EDPA 3PPPA 3KFMA 1N76A 1QULA 4TQUQ 3WAEA 1J1NA 1DOTA 3FXUA 1BKAA 4RK2A 2Q2AA 3FXQA 1HSJA 1B52A 4H8JA 2F97A 4U4SA 1N3XA 3H7MA 2HZLA 1URDA 1MM7A 1Y20A 3PPQA 1JQFA 3FATA 4QSCA 1Y3PA 4ZEDA 2VGQA 2ZNSA 2I3VA 2UYFA 1O64A 4IGTA 2I0CA 3FVNA 4EXLA 3KZGA 3IK6B 2H98A 1XS5A 3PMXA 2O68A 4JSOA 3QUFA 2OZZA 1EU8A 4H67A 2PX1A 1FTLA 4YKJA 4U1OA 2REJA 3HSTA 3MUQA 2QSXA 5KCJB 4OHNA 3T9HB 4R72A 5AE4A 2D5WA 2RC8A 1H3DA 3PV0E 3CFZA 4G68B 5ELVA 3FVOA 2FNCA 2UXAA 2DSFA 1JETA 1MY3A 5DYHA 3T93B 5JTYA 1P1WA 1LBCA 1MQIA 3H03A 4KPTA 3FVGA 4LQ2A 5AA1A 3H4ZA 5FTIA 2AIXA 4OQOA 1MDQA 4BDNA 2UVHA 4BDLA 4HTGA 4O3AA 1LAXA 1USYE 5JTYB 3E3KA 1LB8A 1B32A 2VHAA 3V5AA 4Q8RA 4OZ9A 1FCKA 5CMCA 4LZ5A 1XVXA 4XKQA 1POTA 4OESA 3MZBA 2ONSA 2O69A 3KGCA 2HZKA 1B7ZA 1GVCA 1NNPA 3B7DA 1B3LA 3KJ7A 1R9LA 4H0WA 1MQJA 3RNNA 4YMAA 3Q29A 2REGA 1NKXA 4ZEKA 4U22A 1B5IA 1QUKA 4ZEBA 4PQJA 2A5TA 3H3GA 4KCCA 4LZ8A 3S2VA 1LCFA 2UVIA 2A5SA 3VVFA 3N6UA 3M3LA 3OO8A 1A40A 2H99A 1Q35A 4RPNA 3IB2A 4ZEFA 1QVSA 3FJGA 1QKAA 3EHUA 2RCAA 3HO7A 3K00A 4XKRA 3MAMA 2ZYMA 4F19A 4F22A 4FEBA 1NMUA 5K2XA 2DWAA 1DPEA 2F6PA 4MBPA 3TKDA 4ZDMA 3TTMA 4EQBA 3T96B 3SERA 4E0XA 4H5GA 2RC9A 3K6WA 4R6YA 5H8HB 3FV1A 3RT6B 5KDTA 3D4GA 5DVIA 3TCHA 1O63A 3KOSA 4XKPA 1A54A 1SD3A 1TT1A 1P1QA
chains in the Genus database with same CATH superfamily
2XXHA 2HFBA 1EYKA 2AL4A 1H45A 4I40A 3OXNA 2LAOA 4FIMA 4IO6A 4IY5A 4OVPA 3U94A 5I56A 3LBSA 1BLFA 3QXMA 4K3FA 1YXIA 4LUBA 4N07A 4MHFA 1Y3QA 1VR5A 1FTKA 4FJPA 5BUUA 4DXBA 3MPLA 2QS4A 4IY6A 4NN3A 3IORA 1NNTA 1FW0A 4M4GA 4GOTA 3UN6A 1B05A 1TFAA 4QFLA 1QJMA 3O6HA 3SEUA 3OMBA 1D9VA 3OSRA 3K1NA 1PBPA 3GYYA 2Y84A 5ESYA 5I59A 4N13A 1NH7A 2DOJA 1LFGA 2O7IA 5K2YA 1MXUA 3TUSA 3EHTA 1JVXA 3QAXA 5AA3A 2FA7A 4PF6A 1JP4A 4MH5A 2I3WA 4ZZEA 1B0LA 4F3SA 3MJNA 1G0HA 1LBXA 4U2RA 4KHZE 3G3JA 3HPIA 4MEVA 5L9SA 4R75A 1I6BA 4FORA 1IMCA 3CHGA 3FZVA 1SVXB 2XXUA 4R2BA 4F1VA 2NWJA 3L6GA 2IA4A 1IZ1A 5CRYA 5I3SA 2Q89A 1XHYA 3UA8A 1SW2A 2D21A 5DEXA 2YPNA 4O8MA 5H8SA 1BIYA 4NF4A 3PPOA 3TTKA 1F9BA 3RGYA 4LA9A 1B46A 3BKIB 1I69A 3RUMA 5CM6A 4OENA 2PCRA 5ET5A 3OELA 2M8CA 3TTNA 4NWCA 1B9JA 2B3FA 1OIBA 3O2AA 5I57A 4ZZAA 4H6DA 1YCJA 2QJEA 3PUVE 5F24A 1S9TA 1NV2A 2F35A 2R8TA 4EUOA 2XX7A 4NEDA 1B4ZA 2Q74A 3ODBA 3U92A 2VD3A 1QKBA 3T9XB 3TYHA 1Y4TA 1PB7A 1JEVA 4MNIA 4ONYA 3MWBA 3TCFA 1A99A 1GR2A 3AXFA 3VFJA 1M5BA 2Y7WA 4HE2A 1FQEA 4WKMA 3I3VA 4QXDA 4YB7A 1SW4A 3W9VA 1MPCA 2PYYA 3UIFA 2DWJA 4ELOA 1AOVA 2F8DA 4Q5TA 1NNFA 3MPKA 1B5JA 4H1XA 2XXIA 4KYEA 3PUZE 5H8NB 3UK4A 3DP4A 3MZ9A 5I59B 4Z0IA 3DP6A 5IZ1A 3CSGA 4P0GA 3KBRA 5HM4B 4PFIA 4NF8B 2ZZXA 3OEKA 2OWTA 1ZMGA 3G3HA 3H6VA 3A09A 2UYEA 5TU0A 1LFHA 2F34A 2DXRA 2XXVA 3TZAA 4F29A 4N6PA 1S7YA 1IIWA 1IMDA 2AL5A 5DVJA 1DSNA 3PMWA 2WX9A 3H6TA 5F7VA 1QUJA 4GWYA 5AA4B 4U4XA 2Q88A 5FHOA 3UGWA 2OK2A 2QL3A 4DCYA 3FBPA 4JWOA 4ND9A 3TAJA 1I6QA 5TP9B 4JXIA 2I58A 4X48A 2DE3A 1NV0A 2DQVA 2OLBA 2WEFA 3JYRA 2MKZA 4IO5A 2Q8MA 4G61A 3JZJA 5EYFA 5LOMA 4PFBA 4ZE8A 4R2FA 4TOZA 2FBPA 3TDJA 4H8IA 4NAPA 3TELA 4QSEA 3FUZA 2RF1A 3IFAA 3CIJA 4GX4A 2V3QA 2ESNA 4JB7A 1SBPA 4U21A 1LFIA 1ZIUA 1XVYA 2KLFA 4BDMA 3BIHA 5AA4A 2ZZVA 1ANFA 1ZU0A 3IOUA 3QMFA 4MLQA 1MG1A 2VP1A 1D9YA 2F78A 3OENA 1ZLQA 2CZHA 3RQTA 4OVTA 3O29A 3M3FA 4YMBA 4G68A 3KN8A 2QVUA 3K4UA 1AL3A 2QS2A 2GH9A 5H8HA 1JW1A 1N76A 4XF5A 2WBDA 3FXQA 4H8JA 3BIGA 3PPQA 4N4UA 4ZEDA 2VGQA 2ZNSA 4I3YA 1K9ZA 1FTLA 4U1OA 3HSTA 3MUQA 4P8BA 4OHNA 2RC8A 3PV0E 3CFZA 2OWZA 3FVOA 2UXAA 5DYHA 1MY3A 3H03A 4KPTA 5AA1A 4OQOA 1FTAA 2VHAA 4Q8RA 1FCKA 1XVXA 3MZBA 2O69A 1B7ZA 3KJ7A 1FBEA 1RDXA 4PGNA 5I5PA 3LUZA 4DI3D 3S2VA 2A5SA 3M3LA 3OO8A 3IB2A 1QKAA 3EHUA 1FBCA 2ZYMA 4MBPA 5H8HB 5KDTA 3RT6B 3TCHA 4XKPA 1A54A 1SD3A 1MQDA 4ELQA 3G3GA 3GBBA 1RYXA 4H5FA 1CNQA 2NXOA 3JV9A 4F18A 3EF7A 5I2KA 1Y9UA 4MNPA 3SKPA 4GWUA 4C0RA 1B51A 1NH8A 3M8UA 4YZZA 1IMFA 3KN7A 4GWOA 3DLNA 1B4HA 1ZTYA 3OO9A 2V84A 5J16A 3SETA 3IAZA 4IO7A 5IGAA 3USDA 1VFEA 3E4RA 2F5XA 4FE8A 3VE1B 5CMBA 2DE4A 1B58A 2GFEA 1XC1A 3I5OA 5EQ7A 5TPAA 3PTYA 1MPDA 2V3TA 4GFRA 4JWYA 2B65A 1D3KA 2X7QA 3WAFA 5I2NB 3ROJA 1UTBA 4O7IA 2VD2A 2XXQA 1GGGA 1AWBA 1MY0A 4O3CA 2ZXTA 2PT2A 4POXA 4MF3A 1YZ0A 4F3PA 3BBRA 4OEUA 3RTWB 1PBQA 2PT1A 3SEWA 4HS7A 3QSLA 1BTJA 2P3VA 3IOTA 1EZOA 1IEJA 1H76A 2YJPA 1OLCA 5B70A 3TCGA 4KXPA 2VOZA 4PGPA 4AQ4A 1POY1 4ZEIA 1DTGA 2GHAA 3C33A 1QW0A 3CG3A 4NF5A 1LBVA 4IR8A 3EQ1A 2ONRA 4DE8A 4AS5A 3O28A 3T22A 4NF8A 4RK9A 1VDWA 2OBGA 3T66A 3BFTA 2F7BA 4IB2A 3Q25A 4PAKA 4L17A 1YTVA 3G3FA 1Y1MA 1G0IA 3MVYA 4G8MA 5CMKA 5TPAB 1H44A 1Q9DA 1Y4CA 4P1EA 4JSDA 4GIZA 1LCTA 5DT6A 3IOWA 3VLUA 1N84A 2H9BA 3BFUA 3F11A 3LR1A 2G93A 3CFLA 3OO6A 3Q26A 5ET8A 2ZNTA 3LSWA 4NWDA 1R6ZA 3TODA 4GVOA 2PMSA 5DVFA 4YU0A 4R9FA 4LQ5A 2H5YA 3MP1A 1FQBA 4O94A 5A5XA 1NV1A 3KOTA 1A8FA 3K1PA 2D3IA 3MZ1A 1K9YA 2ZMBA 3PMVA 3RYDA 2Z8EA 3FXBA 5LDZA 4GL8A 4I1DA 4PAIA 3MYUA 1YYZA 3FV2A 3FD3A 3HCQA 4Z7EA 1IITA 3G3IA 4KCDA 3V83A 1IMBA 1Y1ZA 1Q1KA 3HN0A 4BLAA 4DCXA 4UA8A 1MDP1 2RKMA 3TTRA 2V3UA 1JNFA 2P1SA 3C34A 3DP8A 5KCJA 4KFQA 4WEPA 4I8CA 4RA1A 3ZSFA 2CZIA 4YKKA 4GQOA 1ZJLA 1NNKA 4O3BA 2X26A 4GWXA 1B3GA 1VSOA 2QMWA 2HAUA 4G8HA 5CMMA 3ZS6A 2O6AA 1P1UA 5FHNA 4AB6A 1XT8A 4OEVA 4KQPA 3LUYA 3FGSA 4OFLA 2DWHA 5A5XB 2CZLA 4QHQA 3VLWA 4QRZA 3FXRA 2Y7KA 4YB6A 2RC7A 2H25A 3PPRA 4U23A 4NF5B 4RPOA 4G8NA 2XXYA 2UVJA 4FBPA 3CVGA 4NQ8A 2QRYA 3MVZA 4X1BA 4ZE9A 3OSQA 2Y5KA 4G77A 4GRKA 1GTKA 4QSDA 3PPNA 4KYSA 5I57B 1NV7A 3B8BA 4DLDA 2F36A 2P2AA 4OERA 2GQ1A 4E0WA 4ZECA 2OJTA 1VFDA 4XTCQ 1B5HA 4JBZA 5IZ3A 2Z8FA 4XEQA 2XXRA 4OVRA 2Y7RA 3PUYE 2HQ0A 3KSXA 3N26A 4PETA 4U1ZA 5L9MA 5ET7A 5I7IA 1N0TA 4OETA 4PFYA 3K02A 1B3EA 1NL5A 3ISPA 1OVBA 3S9LC 2VPOA 3N6TA 1MQGA 2PVUA 4R6HA 1FQAA 4N6KA 1M5CA 4NG7A 1A8EA 3RLFE 2F3BA 4ESWA 1VE4A 2I4CA 4FAJA 4H65A 1NUYA 2I48A 4FEDA 2ONKE 3TEPA 5J1DA 1N7XA 4HCWA 1XI6A 3H06B 3S4UA 3THIA 4F2QA 3SEVA 1M5FA 4PP0A 1FSAA 1IXCA 4JWXA 5ISUA 1LAGE 3V89B 1FTOA 2VPNA 3P7IA 3MVXA 4WEDA 2WYKA 4TQUQ 2Q2AA 4P1LA 2HHMA 2F97A 1N3XA 3H7MA 1URDA 1MM7A 1Y20A 1JQFA 4QSCA 1Y3PA 2UYFA 1O64A 4IGTA 3IK6B 1XS5A 2OZZA 3NOHA 4PFRA 1NUZA 2QSXA 5IZZA 2FNCA 2DSFA 3T93B 1P1WA 1LBCA 2XXKA 4LQ2A 2XWIA 3H4ZA 5FTIA 4BDLA 2UVHA 1USYE 3V5AA 1BK4A 1GVCA 1R9LA 3RNNA 4ZEKA 1B5IA 4PQJA 3H3GA 4KCCA 3EKIA 1LCFA 1A40A 4PCDA 4F19A 2RCAA 3K00A 3U65A 2KQZA 2DWAA 1DPEA 3TTMA 4E0XA 3SERA 4H5GA 2RC9A 3K6WA 4PBHA 1O63A 2XXWA 2XD3A 2YLNA 1OLAA 4QFOA 3IB0A 4R9GA 4ECFA 4TLMB 1PEBA 3C31A 4JVIA 3SESA 1YPNA 3IOVA 4N81A 4NF4B 4OMBA 3K6UA 4X1DA 5IAIA 1FBPA 1B2HA 5I2NA 2QMXA 2Z22A 1KWHA 4F39A 1UIVA 4LVQA 5I84A 4GLIA 5CBRA 3C9HA 2QFLA 4R74A 3B6TA 1ZBMA 2DVCA 1NUXA 5T3JA 1CB6A 1FQCA 5DTBA 1XOCA 4I62A 1B3FA 5L9OA 1B7HA 4NX1A 2BJIA 2DYXA 4PTKA 3OO7A 5JEIA 1RDYA 1D4NA 2FHYA 5AA2A 1FBFA 3LSFB 5IM2A 3VXBA 3O66A 2XWVA 1R1NA 4OFJA 1IUDA 5I58A 3A3UA 4I3EA 2DE2A 3G7WA 3VXCA 4EQ9A 1PB9A 3E78A 3PGFA 4KD5A 1OQGA 2PFZA 4OVSA 1YAEA 4N15A 4MIJA 1B1HA 4EQ7A 4QFKA 2Z23A 4NF6B 1PDAA 3E9XA 1B40A 4IGRA 1JVYA 4IO2A 4N91A 1LLSA 3B50A 1LBWA 1H43A 1FTJA 2DWIA 2DVZA 4PDDA 2IEEA 4YKIA 1FBGA 2DDKA 3S9EA 1LSTA 3DM0A 5IZ3B 3GZGA 5FTHA 2RCBA 2XHDA 5EQAA 1I6AA 3R26A 4RYAA 4DZ1A 1FTMA 3O97A 4BDQA 2XD2A 1UTHA 1MY2A 5KDTB 1JEUA 1IMAA 3B6QA 3TMGA 4NF0A 4THIA 1UTHB 3C36A 3MW0A 2W7YA 3W15C 3QUJA 1B0HA 1WDNA 2DXYA 5M2VA 3ILTB 5TP9A 3KC0A 3IX1A 2V25A 4MNCA 1FPEA 1OMPA 4NMYA 2FIXA 2E1SA 2HEUA 1TWYA 2I0BA 4POWA 4YB5A 1LBZA 4XKNA 3K01A 2CEYA 4QFPA 2XXXA 2F7AA 3TQWA 2F3DA 1DBZA 4ELPA 4PFTA 3ECRA 5CC2A 1FQDA 3IL1B 3KG2A 2F6GA 4OFOA 1JW5A 3SEYA 3OEMA 4P3LA 3U1OA 1LEVA 4GBVA 1LAHE 2QVRA 4I9DA 1USYH 1M5DA 3FJMA 3IB1A 3W9WA 4EF2A 1GV8A 1EZ9A 2PBWA 1US4A 4GXSB 4R72A 3CSBA 2Z8DA 4HE0A 4DDDA 2I6EA 3Q28A 1JW4A 3MVWA 1WVJA 3H6UA 1NFTA 5H8QA 4MMPA 2O84X 3CR9A 3PD8A 2L5VA 3HHGA 5H8FB 4GWZA 3EHSA 1WODA 2AYSA 1A55A 1IMEA 1EH3A 4Q0CA 4ELRA 1FPDA 1MPBA 4JDFA 4NF6A 3VV5A 3VDFA 4GX3A 3PD9A 4M1VA 2GRVA 4QBAA 4LN5A 1AMFA 1P99A 3RPLA 4GF8A 4Q30B 2Q8JA 3O6GA 1MXXA 1MH3A 4PF8A 1SYHA 2ALUA 4IO3A 4XIGQ 1N04A 2CEXA 2R6GE 1T0KA 3IJXB 1MY4A 1B7UA 1Z7ME 2Q2CA 4G4PA 3IO4A 3CRBA 2P3NA 1Z7NE 1FJ6A 1II5A 2Q9TA 5EQ9A 2DP8A 3FVKA 5A5LA 2B4LA 3HV1A 5EHSA 4R73A 1FRPA 5BWJA 3S9MC 3K6XA 1D9QA 4OWDA 3GXAA 5I56B 2RINA 3CG1A 1Y3NA 5EQ8A 3R7XA 4F31B 3D4CA 1CE2A 3FASA 1P1NA 1MXVA 3H6WA 2ZYOA 5H8NA 4LONB 3SEXA 4RXLA 3RN8A 4FATA 1OQHA 2XA5A 3VVEA 1N3WA 1DPPA 1DK4A 1NV4A 3TTLA 5CI5A 1MQHA 4XFEA 1SQYA 5FHMA 3Q27A 5F1QA 2ZZWA 4ESXA 1SI0A 4FECA 5LTCA 4PE3A 2ABHA 2QPQA 5I2KB 3N5LA 4PFUA 3UORA 4RJZA 2BJJX 3E13X 1INPA 4DI4B 3MC2A 4EDPA 3PPPA 3KFMA 1QULA 3WAEA 1J1NA 1DOTA 3FXUA 1HSJA 4U4SA 4X8RA 5ET6A 3KZGA 4JSOA 3QUFA 1EU8A 1RDZA 4H67A 2PX1A 4YKJA 5KCJB 5AE4A 5JTYA 1MQIA 4GWSA 4BDNA 4O3AA 5JTYB 3E3KA 1LB8A 5CMCA 2ONSA 2HZKA 3B7DA 1B3LA 1KZ8A 4PAFA 4H0WA 1MQJA 3LV0A 4YMAA 4N8GA 2REGA 1NKXA 1QUKA 4ZEBA 1KA0A 3VVFA 3N6UA 1Q35A 3FJGA 4XKRA 1NMUA 5K2XA 4ZDMA 3T96B 5EYGA 3KOSA 1B52A 1P1QA 2A5TB 4N17A 2THIA 4UABA 4PBQA 3R6UA 2XX9A 1IXIA 2WKYA 4MJOA 5KZTA 2QS1A 2XWKA 2VT5A 2FVZA 3I6VA 3EPEA 1MXYA 3T9UA 3T9VA 3FJ7A 3EN3A 4AS4A 2NOOA 4UACA 3IO6A 3UP9A 4KR5A 2R71A 1FPGA 5B7DA 1LAFE 1LB9A 4YAHX 3E79A 3CFXA 3FIRA 2PFYA 4F3BA 3QYTA 5JK4A 4LATA 4GL0A 3U72A 1RKMA 2HAVA 2HPGA 3LC8A 4GXAA 2Y7IA 4HE1A 1FPKA 3MQ9A 4DXCA 1B6HA 2QS3A 5AA2D 1UIUA 1DMBA 3U8QA 3ZKLA 2HXRA 3DELB 4GX6A 1SDXA 1HSEA 4H45A 4PFWA 1A7LA 1R9QA 4GWWA 1URSA 5ICTA 2OX3A 2ZNUA 1EYIA 1EZPA 1PC3A 4H46A 5ITPA 4GD5A 4R6KA 1NUWA 4OXVA 5AA2B 3RT8A 2DS9A 2R9JA 4MAGA 2G29A 3TQLA 5I58B 4QFNA 3SZPA 2JJKA 2ANJA 3C32A 4NTLA 2WBBA 3QK6A 4RNSA 3K6VA 3B6WA 4LZ7A 2WYPA 3M3KA 3C35A 1MH4A 1FBDA 3PUXE 2O51A 4N6DA 1SYIA 2O7UA 4OANA 2GHBA 1MRPA 5HBCA 4F1UA 4C1TA 4C1UA 1TFDA 3TFLA 5FBPA 1SW5A 1HSLA 1NV6A 3PUWE 1SPIA 4P11A 4HXVA 1FPLA 4KYDA 1FPFA 3A3CA 4KI0E 2CZKA 3ZKKA 3RTFB 3V8XB 5EYHA 2B4MA 1MS7A 5ITOA 4MCOA 1P1OA 4OVQA 1UQWA 4X04A 3OOAA 3O9PA 1ELJA 4OTEA 2ZYKA 1UTBB 4MFIA 4DIGA 3MP6A 2F7CA 3S9NC 3SDFA 5ICQA 2OWSA 4NE4A 3LSLA 3OD7A 3U93A 4NGUA 2XX8A 3G3KA 3L6HA 1IQ7A 4MX6A 4ISUA 4PE5B 1MY1A 4OYVA 2HXWA 2XXPA 3N94A 3K1MA 1QUIA 5H8FA 4F2OA 1B3HA 4QF9A 4P0IA 1S50A 2Y7PA 4PC9A 3IFCA 5L8DA 3PU5A 4X9TA 1L5TA 3C4MA 3GBAA 1AIVA 2I4BA 3ILUB 5DW8A 4IO4A 3RPLB 3CI8A 4LP2B 4G68C 1URGA 1DTZA 2ZYNA 3VLVA 4P56A 1US5A 3A29A 1LGBC 1ATGA 4TLLB 1BP5A 4HW8A 3MBPA 2FIEA 3K2DA 1MXWA 1FQFA 2NVUB 4F3GA 4G2ZA 3IR1A 3VVDA 2OCUA 1SW1A 1MXZA 3D1RA 3IJOB 5H8QB 5IKBA 1ZKBA 2NUVA 2E0SA 1B1XA 5EHMA 3K0VA 1O7TA 4MLVA 1AH5A 1FPJA 1NV5A 3QIMA 1IXGA 4P47A 1MM6A 4NHBA 1TXFA 2P0SA 2X7PA 2B3BA 1QGXA 5CBSA 2Y5LA 2HCAA 3GLBA 2XWOA 1RYOA 3KN3A 1M5EA 4EXKA 2I49A 4YICA 2CMOA 1KA1A 3RPWA 3KEIA 2O1LA 5DEXB 4YKPA 3MP8A 2FYIA 1N7WA 4WXJA 3O6IA 3RY3A 4EF1A 3HHFA 3ONMA 4F1YA 4N8YA 5HPQA 2H4IA 1PB8A 4BDOA 1LBBA 4DXUA 1LBYA 4OVJA 2O1MA 4HCYA 1IXHA 3KBZA 2XXTA 3TPAA 4AB5A 4XXUA 1FJ9A 4BDRA 2UVGA 1OVTA 3HFUA 3T1BA 3KSJA 3LSXA 2V93A 3KJTA 1EYJA 4RY1A 4GBWA 1SI1A 1DCUA 1BKAA 4RK2A 1NV3A 2KR0A 2HZLA 3FATA 3MSTA 2I3VA 4O7MA 2I0CA 3FVNA 4EXLA 2H98A 1FPBA 3PMXA 2O68A 1FPIA 2REJA 4JVCA 3KC1A 3T9HB 2D5WA 1H3DA 3T0JA 4G68B 5ELVA 2QVVA 1JETA 3FVGA 1FBHA 2AIXA 1MDQA 4HTGA 1LAXA 1B32A 4OZ9A 4JVDA 4LZ5A 4XKQA 1POTA 4OESA 3KGCA 1NNPA 2V4CA 4OA4A 3Q29A 4U22A 2A5TA 4LZ8A 2UVIA 4ZEFA 2H99A 4RPNA 1QVSA 4PDHA 3HO7A 4P9KA 3MAMA 4F22A 4FEBA 3TKDA 4EQBA 2F6PA 4R6YA 3FV1A 3D4GA 5DVIA 1NI9A 4ZS9A 1TT1A
chains in the Genus database with same CATH topology
1MQDA 2A5TB 2XXHA 2HFBA 2XXWA 2XD3A 2AL4A 2YLNA 4ELQA 1H45A 3G3GA 3OXNA 2THIA 3GBBA 1OLAA 2LAOA 4FIMA 4QFOA 1RYXA 4H5FA 3IB0A 3R6UA 4R9GA 2NXOA 4IO6A 4IY5A 4TLMB 4ECFA 2XX9A 1PEBA 3JV9A 1IXIA 3C31A 2WKYA 4F18A 3U94A 3SESA 5I56A 1YPNA 3EF7A 3IOVA 4NF4B 4OMBA 3K6UA 3LBSA 1BLFA 5I2KA 4X1DA 5KZTA 1Y9UA 2QS1A 3QXMA 5IAIA 4K3FA 3SKPA 3I6VA 3EPEA 1B2HA 4LUBA 4N07A 4C0RA 1B51A 1MXYA 1Y3QA 3T9UA 1NH8A 2QMXA 1KWHA 2Z22A 3FJ7A 3M8UA 4YZZA 3KN7A 1UIVA 3EN3A 4GWOA 4LVQA 4F39A 1VR5A 3DLNA 1B4HA 2NOOA 1FTKA 5I84A 1ZTYA 4FJPA 4GLIA 4UACA 5CBRA 3IO6A 3OO9A 3UP9A 5BUUA 2V84A 4DXBA 3SETA 3IAZA 3MPLA 4IO7A 3C9HA 4R74A 4KR5A 2R71A 2QS4A 4IY6A 3USDA 5B7DA 1LAFE 1LB9A 3B6TA 1VFEA 3IORA 1NNTA 1FW0A 1ZBMA 2F5XA 3E4RA 4FE8A 4M4GA 4YAHX 4GOTA 3UN6A 3VE1B 5CMBA 3CFXA 2DVCA 1B05A 3FIRA 2DE4A 1B58A 1CB6A 1FQCA 2GFEA 5DTBA 1XC1A 1TFAA 4QFLA 3I5OA 4F3BA 3QYTA 1XOCA 5TPAA 4I62A 1B3FA 1QJMA 3O6HA 5JK4A 1MPDA 2V3TA 3SEUA 3OMBA 4LATA 4GFRA 4ZS9A 5L9OA 1B7HA 1D9VA 4GL0A 3OSRA 3U72A 2DYXA 4JWYA 1RKMA 2HAVA 2B65A 3K1NA 3OO7A 5JEIA 1D4NA 3LC8A 1PBPA 1D3KA 5AA2A 3LSFB 2X7QA 4GXAA 3WAFA 5I2NB 3VXBA 1UTBA 2Y84A 3O66A 5I59A 2VD2A 2XXQA 1GGGA 1R1NA 2DOJA 1NH7A 1MY0A 1LFGA 1IUDA 2Y7IA 4N13A 4O3CA 4OFJA 2ZXTA 2O7IA 2PT2A 5K2YA 4POXA 5I58A 3MQ9A 3A3UA 4MF3A 4DXCA 4F3PA 1MXUA 1B6HA 2QS3A 3BBRA 3TUSA 2DE2A 3EHTA 1JVXA 1UIUA 3G7WA 4OEUA 1PBQA 2PT1A 3RTWB 3SEWA 5AA2D 3VXCA 3QAXA 4EQ9A 1PB9A 4HS7A 5AA3A 2FA7A 3QSLA 1DMBA 3PGFA 4MH5A 1BTJA 3IOTA 2I3WA 4KD5A 3U8QA 1OQGA 3ZKLA 1EZOA 1IEJA 4ZZEA 1B0LA 4F3SA 1YAEA 3DELB 3MJNA 1H76A 1B1HA 1SDXA 2YJPA 1HSEA 4EQ7A 4U2RA 4KHZE 1OLCA 4QFKA 2Z23A 4PFWA 3G3JA 1A7LA 3HPIA 5B70A 1R9QA 3TCGA 4NF6B 1PDAA 1URSA 5ICTA 3E9XA 5L9SA 2VOZA 4R75A 2ZNUA 1I6BA 1B40A 4AQ4A 1EZPA 1PC3A 1POY1 1JVYA 4FORA 4IGRA 4IO2A 4ZEIA 1LLSA 1DTGA 1SVXB 2XXUA 3FZVA 4R2BA 4F1VA 2NWJA 2GHAA 3L6GA 3C33A 1H43A 1QW0A 2IA4A 1IZ1A 3CG3A 5CRYA 1FTJA 5ITPA 2Q89A 4NF5A 1XHYA 4GD5A 3UA8A 4R6KA 3EQ1A 2DWIA 2ONRA 4OXVA 5AA2B 1SW2A 4DE8A 2DVZA 2D21A 5DEXA 3RT8A 2DS9A 2YPNA 2R9JA 2IEEA 5H8SA 1BIYA 4YKIA 3O28A 2G29A 3S9EA 1LSTA 3TQLA 3DM0A 5I58B 4QFNA 3T22A 4NF8A 4NF4A 3GZGA 2ANJA 3PPOA 4RK9A 2OBGA 3T66A 3C32A 3BFTA 4NTLA 3TTKA 1F9BA 2F7BA 5FTHA 4LA9A 1B46A 4IB2A 3Q25A 2RCBA 3RGYA 3QK6A 2XHDA 3BKIB 4RNSA 1I69A 3K6VA 3B6WA 4L17A 4LZ7A 3RUMA 1YTVA 3M3KA 1I6AA 5I2NA 3C35A 1Y1MA 3G3FA 5CM6A 4OENA 1MH4A 3R26A 4RYAA 4DZ1A 3MVYA 2M8CA 3OELA 4G8MA 1FTMA 3O97A 3TTNA 3PUXE 5CMKA 5TPAB 4BDQA 2XD2A 2O51A 1H44A 1UTHA 4NWCA 1B9JA 1MY2A 5KDTB 1SYIA 3TMGA 1JEUA 2O7UA 2B3FA 1OIBA 1MRPA 1Y4CA 2GHBA 3B6QA 3O2AA 4JSDA 5HBCA 4THIA 1UTHB 3C36A 4C1TA 3MW0A 4GIZA 1LCTA 5DT6A 2W7YA 1TFDA 3TFLA 4C1UA 4ZZAA 4H6DA 1YCJA 1SW5A 2QJEA 3IOWA 3PUVE 3VLUA 1HSLA 1N84A 3QUJA 1B0HA 1WDNA 2H9BA 1S9TA 2DXYA 3BFUA 3F11A 2F35A 3LR1A 3PUWE 4P11A 2G93A 5M2VA 4KYDA 3CFLA 3ILTB 5TP9A 4EUOA 3OO6A 2XX7A 4NEDA 1B4ZA 3Q26A 2ZNTA 3IX1A 3LSWA 4NWDA 3ODBA 1R6ZA 2V25A 3A3CA 3U92A 2VD3A 3TODA 1OMPA 4KI0E 4NMYA 1QKBA 3ZKKA 3RTFB 3V8XB 4GVOA 3T9VA 3T9XB 3TYHA 2E1SA 2PMSA 5DVFA 2HEUA 1TWYA 2I0BA 1MS7A 4YU0A 4POWA 5ITOA 4YB5A 4R9FA 1Y4TA 4LQ5A 2H5YA 1P1OA 4XKNA 3MP1A 1FQBA 5A5XA 3K01A 1PB7A 4QFPA 2XXXA 2F7AA 1JEVA 1UQWA 3KOTA 4ONYA 3TQWA 3OOAA 1A8FA 3K1PA 3MWBA 1ELJA 3O9PA 4ELPA 2D3IA 3MZ1A 2ZMBA 4OTEA 3PMVA 2ZYKA 3ECRA 4PFTA 3TCFA 5CC2A 1A99A 2Z8EA 4GL8A 1GR2A 1FQDA 3AXFA 3VFJA 3IL1B 1UTBB 1M5BA 4I1DA 3KG2A 4MFIA 2F6GA 4OFOA 1JW5A 3SEYA 4DIGA 3MP6A 3OEMA 2F7CA 3U1OA 3S9NC 3SDFA 2Y7WA 5ICQA 1FQEA 3FV2A 2OWSA 3FD3A 3I3VA 4WKMA 4NE4A 1LAHE 3LSLA 3OD7A 3U93A 4YB7A 3HCQA 4Z7EA 1SW4A 3W9VA 1IITA 1MPCA 2PYYA 2XX8A 3G3IA 4KCDA 3V83A 1Y1ZA 1Q1KA 3G3KA 4I9DA 1USYH 1IQ7A 1M5DA 3FJMA 3IB1A 3L6HA 3HN0A 3UIFA 2DWJA 3W9WA 4ISUA 4EF2A 4ELOA 1GV8A 4PE5B 1AOVA 4BLAA 1EZ9A 2PBWA 2F8DA 4Q5TA 1MY1A 1MDP1 4UA8A 1US4A 1NNFA 3MPKA 1B5JA 2RKMA 4GXSB 4OYVA 2HXWA 1JNFA 2P1SA 2V3UA 2XXIA 2XXPA 3C34A 3CSBA 3DP8A 4H1XA 3N94A 3PUZE 2Z8DA 4KYEA 3K1MA 3UK4A 1QUIA 5H8FA 4KFQA 5H8NB 5KCJA 3DP4A 4WEPA 2I6EA 3Q28A 4I8CA 1B3HA 4RA1A 3ZSFA 4DDDA 4F2OA 3MZ9A 4YKKA 1JW4A 4GQOA 4QF9A 5I59B 1ZJLA 3MVWA 1WVJA 3W15C 1NNKA 4Z0IA 4P0IA 3DP6A 1S50A 2Y7PA 2X26A 3H6UA 4O3BA 1NFTA 5H8QA 5L8DA 3CSGA 2O84X 3CR9A 4P0GA 3KBRA 1B3GA 3PD8A 5HM4B 3PU5A 4X9TA 1L5TA 1VSOA 4NF8B 2QMWA 2HAUA 3C4MA 3HHGA 3OEKA 5H8FB 3GBAA 4G8HA 1AIVA 2I4BA 3EHSA 3ILUB 5CMMA 3ZS6A 1WODA 1P1UA 2O6AA 1ZMGA 2OWTA 5FHNA 2AYSA 4IO4A 3G3HA 3H6VA 4AB6A 3A09A 1A55A 1EH3A 2UYEA 1XT8A 3CI8A 4Q0CA 4OEVA 4ELRA 1MPBA 5TU0A 4KQPA 3LUYA 1LFHA 3FGSA 2F34A 2DXRA 2XXVA 4G68C 4JDFA 1URGA 4LP2B 4NF6A 2DWHA 1DTZA 4OFLA 3TZAA 3VV5A 3VDFA 4N6PA 2ZYNA 4F29A 3VLVA 2CZLA 5A5XB 1US5A 4QHQA 1LGBC 3PD9A 4QRZA 1S7YA 4M1VA 1IIWA 2GRVA 3FXRA 3VLWA 2AL5A 5DVJA 1ATGA 1DSNA 3PMWA 4TLLB 3H6TA 5F7VA 1BP5A 2Y7KA 1QUJA 4YB6A 1AMFA 2RC7A 4HW8A 3MBPA 5AA4B 2H25A 4U4XA 1P99A 3PPRA 4GF8A 4U23A 4NF5B 4Q30B 2Q8JA 2Q88A 5FHOA 4RPOA 4G8NA 3K2DA 2XXYA 3O6GA 1MXXA 2UVJA 1MH3A 2OK2A 3CVGA 3UGWA 1MXWA 1SYHA 1FQFA 2QRYA 2QL3A 2ALUA 3MVZA 4F1UA 4DCYA 4X1BA 4IO3A 4XIGQ 2NVUB 4F3GA 4ZE9A 1N04A 3OSQA 4G2ZA 2R6GE 3IR1A 3VVDA 2OCUA 1SW1A 1MXZA 3IJOB 4G77A 1T0KA 4JWOA 4GRKA 4ND9A 5H8QB 3IJXB 5IKBA 1ZKBA 1MY4A 2NUVA 1B7UA 1GTKA 2E0SA 1B1XA 1Z7ME 3TAJA 1I6QA 4QSDA 5TP9B 2Q2CA 4G4PA 3IO4A 3CRBA 3K0VA 5EHMA 4JXIA 3PPNA 1O7TA 4MLVA 4KYSA 1AH5A 2I58A 1Z7NE 4X48A 3QIMA 1IXGA 1II5A 2Q9TA 2DE3A 5I57B 4DLDA 2F36A 2DP8A 4FATA 2DQVA 1MM6A 1TXFA 2OLBA 3FVKA 3HV1A 2P0SA 2P2AA 2X7PA 4R73A 5EHSA 4OERA 2B3BA 3JYRA 4E0WA 4ZECA 5BWJA 5CBSA 2OJTA 1VFDA 4XTCQ 1B5HA 4IO5A 2HCAA 3S9MC 3GLBA 4JBZA 3JZJA 3K6XA 1RYOA 2Z8FA 3KN3A 1M5EA 2XXRA 4EXKA 2Y7RA 3PUYE 2I49A 5EYFA 4OWDA 4YICA 2CMOA 3GXAA 4DCXA 3RPWA 2HQ0A 3KEIA 5LOMA 4ZE8A 5I56B 3KSXA 2RINA 4R2FA 4TOZA 3CG1A 3N26A 2O1LA 5DEXB 4YKPA 3MP8A 1Y3NA 2FYIA 4PETA 4U1ZA 5L9MA 3R7XA 1N7WA 4WXJA 4F31B 3D4CA 1CE2A 3O6IA 3RY3A 3TDJA 4EF1A 3FASA 4H8IA 1N0TA 3TELA 4QSEA 1P1NA 3FUZA 1MXVA 2RF1A 4OETA 3H6WA 3HHFA 3CIJA 3TTRA 2ZYOA 4PFYA 5H8NA 2V3QA 4LONB 2ESNA 3K02A 3ONMA 4JB7A 1B3EA 1NL5A 4F1YA 1SBPA 4U21A 1OVBA 5HPQA 3S9LC 3N6TA 1MQGA 2PVUA 4RXLA 1LFIA 4R6HA 1ZIUA 3RN8A 2H4IA 1OQHA 1FQAA 3SEXA 1PB8A 1M5CA 1LBBA 1N3WA 3VVEA 4BDOA 4DXUA 1DPPA 1XVYA 2KLFA 4BDMA 1A8EA 4OVJA 3TTLA 2O1MA 5CI5A 3RLFE 4ESWA 5AA4A 1MQHA 4HCYA 1VE4A 2I4CA 1ANFA 4FAJA 1ZU0A 1SQYA 4H65A 2I48A 1IXHA 3IOUA 4FEDA 2ONKE 5FHMA 5I57A 2XXTA 4MLQA 3TEPA 5J1DA 3Q27A 3TPAA 1MG1A 4XXUA 4AB5A 5F1QA 2UVGA 4BDRA 1N7XA 2VP1A 4HCWA 4ESXA 1SI0A 1OVTA 3H06B 4FECA 1D9YA 2F78A 3S4UA 3THIA 3OENA 1ZLQA 4F2QA 3RQTA 2ABHA 3KSJA 2QPQA 1M5FA 3SEVA 5I2KB 3N5LA 3O29A 3LSXA 4PP0A 3M3FA 4PFUA 4YMBA 2V93A 3UORA 1IXCA 3KJTA 4G68A 4JWXA 1LAGE 4RJZA 5ISUA 2BJJX 3V89B 3KN8A 1FTOA 3K4UA 1AL3A 2QS2A 3E13X 3P7IA 2GH9A 3MVXA 4RY1A 4WEDA 5H8HA 1JW1A 1SI1A 3MC2A 4EDPA 3PPPA 3KFMA 1N76A 1QULA 4TQUQ 3WAEA 1J1NA 1DOTA 3FXUA 1BKAA 4RK2A 2Q2AA 3FXQA 1HSJA 1B52A 4H8JA 2F97A 4U4SA 1N3XA 3H7MA 2HZLA 1URDA 1MM7A 1Y20A 3PPQA 1JQFA 3FATA 4QSCA 1Y3PA 4ZEDA 2VGQA 2ZNSA 2I3VA 2UYFA 1O64A 4IGTA 2I0CA 3FVNA 4EXLA 3KZGA 3IK6B 2H98A 1XS5A 3PMXA 2O68A 4JSOA 3QUFA 2OZZA 1EU8A 4H67A 2PX1A 1FTLA 4YKJA 4U1OA 2REJA 3HSTA 3MUQA 2QSXA 5KCJB 4OHNA 3T9HB 4R72A 5AE4A 2D5WA 2RC8A 1H3DA 3PV0E 3CFZA 4G68B 5ELVA 3FVOA 2FNCA 2UXAA 2DSFA 1JETA 1MY3A 5DYHA 3T93B 5JTYA 1P1WA 1LBCA 1MQIA 3H03A 4KPTA 3FVGA 4LQ2A 5AA1A 3H4ZA 5FTIA 2AIXA 4OQOA 1MDQA 4BDNA 2UVHA 4BDLA 4HTGA 4O3AA 1LAXA 1USYE 5JTYB 3E3KA 1LB8A 1B32A 2VHAA 3V5AA 4Q8RA 4OZ9A 1FCKA 5CMCA 4LZ5A 1XVXA 4XKQA 1POTA 4OESA 3MZBA 2ONSA 2O69A 3KGCA 2HZKA 1B7ZA 1GVCA 1NNPA 3B7DA 1B3LA 3KJ7A 1R9LA 4H0WA 1MQJA 3RNNA 4YMAA 3Q29A 2REGA 1NKXA 4ZEKA 4U22A 1B5IA 1QUKA 4ZEBA 4PQJA 2A5TA 3H3GA 4KCCA 4LZ8A 3S2VA 1LCFA 2UVIA 2A5SA 3VVFA 3N6UA 3M3LA 3OO8A 1A40A 2H99A 1Q35A 4RPNA 3IB2A 4ZEFA 1QVSA 3FJGA 1QKAA 3EHUA 2RCAA 3HO7A 3K00A 4XKRA 3MAMA 2ZYMA 4F19A 4F22A 4FEBA 1NMUA 5K2XA 2DWAA 1DPEA 2F6PA 4MBPA 3TKDA 4ZDMA 3TTMA 4EQBA 3T96B 3SERA 4E0XA 4H5GA 2RC9A 3K6WA 4R6YA 5H8HB 3FV1A 3RT6B 5KDTA 3D4GA 5DVIA 3TCHA 1O63A 3KOSA 4XKPA 1A54A 1SD3A 1TT1A 1P1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQD A;  2A5T B;  2XXH A;  2HFB A;  2XXW A;  2XD3 A;  2AL4 A;  2YLN A;  4ELQ A;  1H45 A;  3G3G A;  3OXN A;  2THI A;  3GBB A;  1OLA A;  2LAO A;  4FIM A;  4QFO A;  1RYX A;  4H5F A;  3IB0 A;  3R6U A;  4R9G A;  2NXO A;  4IO6 A;  4IY5 A;  4TLM B;  4ECF A;  2XX9 A;  1PEB A;  3JV9 A;  1IXI A;  3C31 A;  2WKY A;  4F18 A;  3U94 A;  3SES A;  5I56 A;  1YPN A;  3EF7 A;  3IOV A;  4NF4 B;  4OMB A;  3K6U A;  3LBS A;  1BLF A;  5I2K A;  4X1D A;  5KZT A;  1Y9U A;  2QS1 A;  3QXM A;  5IAI A;  4K3F A;  3SKP A;  3I6V A;  3EPE A;  1B2H A;  4LUB A;  4N07 A;  4C0R A;  1B51 A;  1MXY A;  1Y3Q A;  3T9U A;  1NH8 A;  2QMX A;  1KWH A;  2Z22 A;  3FJ7 A;  3M8U A;  4YZZ A;  3KN7 A;  1UIV A;  3EN3 A;  4GWO A;  4LVQ A;  4F39 A;  1VR5 A;  3DLN A;  1B4H A;  2NOO A;  1FTK A;  5I84 A;  1ZTY A;  4FJP A;  4GLI A;  4UAC A;  5CBR A;  3IO6 A;  3OO9 A;  3UP9 A;  5BUU A;  2V84 A;  4DXB A;  3SET A;  3IAZ A;  3MPL A;  4IO7 A;  3C9H A;  4R74 A;  4KR5 A;  2R71 A;  2QS4 A;  4IY6 A;  3USD A;  5B7D A;  1LAF E;  1LB9 A;  3B6T A;  1VFE A;  3IOR A;  1NNT A;  1FW0 A;  1ZBM A;  2F5X A;  3E4R A;  4FE8 A;  4M4G A;  4YAH X;  4GOT A;  3UN6 A;  3VE1 B;  5CMB A;  3CFX A;  2DVC A;  1B05 A;  3FIR A;  2DE4 A;  1B58 A;  1CB6 A;  1FQC A;  2GFE A;  5DTB A;  1XC1 A;  1TFA A;  4QFL A;  3I5O A;  4F3B A;  3QYT A;  1XOC A;  5TPA A;  4I62 A;  1B3F A;  1QJM A;  3O6H A;  5JK4 A;  1MPD A;  2V3T A;  3SEU A;  3OMB A;  4LAT A;  4GFR A;  4ZS9 A;  5L9O A;  1B7H A;  1D9V A;  4GL0 A;  3OSR A;  3U72 A;  2DYX A;  4JWY A;  1RKM A;  2HAV A;  2B65 A;  3K1N A;  3OO7 A;  5JEI A;  1D4N A;  3LC8 A;  1PBP A;  1D3K A;  5AA2 A;  3LSF B;  2X7Q A;  4GXA A;  3WAF A;  5I2N B;  3VXB A;  1UTB A;  2Y84 A;  3O66 A;  5I59 A;  2VD2 A;  2XXQ A;  1GGG A;  1R1N A;  2DOJ A;  1NH7 A;  1MY0 A;  1LFG A;  1IUD A;  2Y7I A;  4N13 A;  4O3C A;  4OFJ A;  2ZXT A;  2O7I A;  2PT2 A;  5K2Y A;  4POX A;  5I58 A;  3MQ9 A;  3A3U A;  4MF3 A;  4DXC A;  4F3P A;  1MXU A;  1B6H A;  2QS3 A;  3BBR A;  3TUS A;  2DE2 A;  3EHT A;  1JVX A;  1UIU A;  3G7W A;  4OEU A;  1PBQ A;  2PT1 A;  3RTW B;  3SEW A;  5AA2 D;  3VXC A;  3QAX A;  4EQ9 A;  1PB9 A;  4HS7 A;  5AA3 A;  2FA7 A;  3QSL A;  1DMB A;  3PGF A;  4MH5 A;  1BTJ A;  3IOT A;  2I3W A;  4KD5 A;  3U8Q A;  1OQG A;  3ZKL A;  1EZO A;  1IEJ A;  4ZZE A;  1B0L A;  4F3S A;  1YAE A;  3DEL B;  3MJN A;  1H76 A;  1B1H A;  1SDX A;  2YJP A;  1HSE A;  4EQ7 A;  4U2R A;  4KHZ E;  1OLC A;  4QFK A;  2Z23 A;  4PFW A;  3G3J A;  1A7L A;  3HPI A;  5B70 A;  1R9Q A;  3TCG A;  4NF6 B;  1PDA A;  1URS A;  5ICT A;  3E9X A;  5L9S A;  2VOZ A;  4R75 A;  2ZNU A;  1I6B A;  1B40 A;  4AQ4 A;  1EZP A;  1PC3 A;  1POY 1;  1JVY A;  4FOR A;  4IGR A;  4IO2 A;  4ZEI A;  1LLS A;  1DTG A;  1SVX B;  2XXU A;  3FZV A;  4R2B A;  4F1V A;  2NWJ A;  2GHA A;  3L6G A;  3C33 A;  1H43 A;  1QW0 A;  2IA4 A;  1IZ1 A;  3CG3 A;  5CRY A;  1FTJ A;  5ITP A;  2Q89 A;  4NF5 A;  1XHY A;  4GD5 A;  3UA8 A;  4R6K A;  3EQ1 A;  2DWI A;  2ONR A;  4OXV A;  5AA2 B;  1SW2 A;  4DE8 A;  2DVZ A;  2D21 A;  5DEX A;  3RT8 A;  2DS9 A;  2YPN A;  2R9J A;  2IEE A;  5H8S A;  1BIY A;  4YKI A;  3O28 A;  2G29 A;  3S9E A;  1LST A;  3TQL A;  3DM0 A;  5I58 B;  4QFN A;  3T22 A;  4NF8 A;  4NF4 A;  3GZG A;  2ANJ A;  3PPO A;  4RK9 A;  2OBG A;  3T66 A;  3C32 A;  3BFT A;  4NTL A;  3TTK A;  1F9B A;  2F7B A;  5FTH A;  4LA9 A;  1B46 A;  4IB2 A;  3Q25 A;  2RCB A;  3RGY A;  3QK6 A;  2XHD A;  3BKI B;  4RNS A;  1I69 A;  3K6V A;  3B6W A;  4L17 A;  4LZ7 A;  3RUM A;  1YTV A;  3M3K A;  1I6A A;  5I2N A;  3C35 A;  1Y1M A;  3G3F A;  5CM6 A;  4OEN A;  1MH4 A;  3R26 A;  4RYA A;  4DZ1 A;  3MVY A;  2M8C A;  3OEL A;  4G8M A;  1FTM A;  3O97 A;  3TTN A;  3PUX E;  5CMK A;  5TPA B;  4BDQ A;  2XD2 A;  2O51 A;  1H44 A;  1UTH A;  4NWC A;  1B9J A;  1MY2 A;  5KDT B;  1SYI A;  3TMG A;  1JEU A;  2O7U A;  2B3F A;  1OIB A;  1MRP A;  1Y4C A;  2GHB A;  3B6Q A;  3O2A A;  4JSD A;  5HBC A;  4THI A;  1UTH B;  3C36 A;  4C1T A;  3MW0 A;  4GIZ A;  1LCT A;  5DT6 A;  2W7Y A;  1TFD A;  3TFL A;  4C1U A;  4ZZA A;  4H6D A;  1YCJ A;  1SW5 A;  2QJE A;  3IOW A;  3PUV E;  3VLU A;  1HSL A;  1N84 A;  3QUJ A;  1B0H A;  1WDN A;  2H9B A;  1S9T A;  2DXY A;  3BFU A;  3F11 A;  2F35 A;  3LR1 A;  3PUW E;  4P11 A;  2G93 A;  5M2V A;  4KYD A;  3CFL A;  3ILT B;  5TP9 A;  4EUO A;  3OO6 A;  2XX7 A;  4NED A;  1B4Z A;  3Q26 A;  2ZNT A;  3IX1 A;  3LSW A;  4NWD A;  3ODB A;  1R6Z A;  2V25 A;  3A3C A;  3U92 A;  2VD3 A;  3TOD A;  1OMP A;  4KI0 E;  4NMY A;  1QKB A;  3ZKK A;  3RTF B;  3V8X B;  4GVO A;  3T9V A;  3T9X B;  3TYH A;  2E1S A;  2PMS A;  5DVF A;  2HEU A;  1TWY A;  2I0B A;  1MS7 A;  4YU0 A;  4POW A;  5ITO A;  4YB5 A;  4R9F A;  1Y4T A;  4LQ5 A;  2H5Y A;  1P1O A;  4XKN A;  3MP1 A;  1FQB A;  5A5X A;  3K01 A;  1PB7 A;  4QFP A;  2XXX A;  2F7A A;  1JEV A;  1UQW A;  3KOT A;  4ONY A;  3TQW A;  3OOA A;  1A8F A;  3K1P A;  3MWB A;  1ELJ A;  3O9P A;  4ELP A;  2D3I A;  3MZ1 A;  2ZMB A;  4OTE A;  3PMV A;  2ZYK A;  3ECR A;  4PFT A;  3TCF A;  5CC2 A;  1A99 A;  2Z8E A;  4GL8 A;  1GR2 A;  1FQD A;  3AXF A;  3VFJ A;  3IL1 B;  1UTB B;  1M5B A;  4I1D A;  3KG2 A;  4MFI A;  2F6G A;  4OFO A;  1JW5 A;  3SEY A;  4DIG A;  3MP6 A;  3OEM A;  2F7C A;  3U1O A;  3S9N C;  3SDF A;  2Y7W A;  5ICQ A;  1FQE A;  3FV2 A;  2OWS A;  3FD3 A;  3I3V A;  4WKM A;  4NE4 A;  1LAH E;  3LSL A;  3OD7 A;  3U93 A;  4YB7 A;  3HCQ A;  4Z7E A;  1SW4 A;  3W9V A;  1IIT A;  1MPC A;  2PYY A;  2XX8 A;  3G3I A;  4KCD A;  3V83 A;  1Y1Z A;  1Q1K A;  3G3K A;  4I9D A;  1USY H;  1IQ7 A;  1M5D A;  3FJM A;  3IB1 A;  3L6H A;  3HN0 A;  3UIF A;  2DWJ A;  3W9W A;  4ISU A;  4EF2 A;  4ELO A;  1GV8 A;  4PE5 B;  1AOV A;  4BLA A;  1EZ9 A;  2PBW A;  2F8D A;  4Q5T A;  1MY1 A;  1MDP 1;  4UA8 A;  1US4 A;  1NNF A;  3MPK A;  1B5J A;  2RKM A;  4GXS B;  4OYV A;  2HXW A;  1JNF A;  2P1S A;  2V3U A;  2XXI A;  2XXP A;  3C34 A;  3CSB A;  3DP8 A;  4H1X A;  3N94 A;  3PUZ E;  2Z8D A;  4KYE A;  3K1M A;  3UK4 A;  1QUI A;  5H8F A;  4KFQ A;  5H8N B;  5KCJ A;  3DP4 A;  4WEP A;  2I6E A;  3Q28 A;  4I8C A;  1B3H A;  4RA1 A;  3ZSF A;  4DDD A;  4F2O A;  3MZ9 A;  4YKK A;  1JW4 A;  4GQO A;  4QF9 A;  5I59 B;  1ZJL A;  3MVW A;  1WVJ A;  3W15 C;  1NNK A;  4Z0I A;  4P0I A;  3DP6 A;  1S50 A;  2Y7P A;  2X26 A;  3H6U A;  4O3B A;  1NFT A;  5H8Q A;  5L8D A;  3CSG A;  2O84 X;  3CR9 A;  4P0G A;  3KBR A;  1B3G A;  3PD8 A;  5HM4 B;  3PU5 A;  4X9T A;  1L5T A;  1VSO A;  4NF8 B;  2QMW A;  2HAU A;  3C4M A;  3HHG A;  3OEK A;  5H8F B;  3GBA A;  4G8H A;  1AIV A;  2I4B A;  3EHS A;  3ILU B;  5CMM A;  3ZS6 A;  1WOD A;  1P1U A;  2O6A A;  1ZMG A;  2OWT A;  5FHN A;  2AYS A;  4IO4 A;  3G3H A;  3H6V A;  4AB6 A;  3A09 A;  1A55 A;  1EH3 A;  2UYE A;  1XT8 A;  3CI8 A;  4Q0C A;  4OEV A;  4ELR A;  1MPB A;  5TU0 A;  4KQP A;  3LUY A;  1LFH A;  3FGS A;  2F34 A;  2DXR A;  2XXV A;  4G68 C;  4JDF A;  1URG A;  4LP2 B;  4NF6 A;  2DWH A;  1DTZ A;  4OFL A;  3TZA A;  3VV5 A;  3VDF A;  4N6P A;  2ZYN A;  4F29 A;  3VLV A;  2CZL A;  5A5X B;  1US5 A;  4QHQ A;  1LGB C;  3PD9 A;  4QRZ A;  1S7Y A;  4M1V A;  1IIW A;  2GRV A;  3FXR A;  3VLW A;  2AL5 A;  5DVJ A;  1ATG A;  1DSN A;  3PMW A;  4TLL B;  3H6T A;  5F7V A;  1BP5 A;  2Y7K A;  1QUJ A;  4YB6 A;  1AMF A;  2RC7 A;  4HW8 A;  3MBP A;  5AA4 B;  2H25 A;  4U4X A;  1P99 A;  3PPR A;  4GF8 A;  4U23 A;  4NF5 B;  4Q30 B;  2Q8J A;  2Q88 A;  5FHO A;  4RPO A;  4G8N A;  3K2D A;  2XXY A;  3O6G A;  1MXX A;  2UVJ A;  1MH3 A;  2OK2 A;  3CVG A;  3UGW A;  1MXW A;  1SYH A;  1FQF A;  2QRY A;  2QL3 A;  2ALU A;  3MVZ A;  4F1U A;  4DCY A;  4X1B A;  4IO3 A;  4XIG Q;  2NVU B;  4F3G A;  4ZE9 A;  1N04 A;  3OSQ A;  4G2Z A;  2R6G E;  3IR1 A;  3VVD A;  2OCU A;  1SW1 A;  1MXZ A;  3IJO B;  4G77 A;  1T0K A;  4JWO A;  4GRK A;  4ND9 A;  5H8Q B;  3IJX B;  5IKB A;  1ZKB A;  1MY4 A;  2NUV A;  1B7U A;  1GTK A;  2E0S A;  1B1X A;  1Z7M E;  3TAJ A;  1I6Q A;  4QSD A;  5TP9 B;  2Q2C A;  4G4P A;  3IO4 A;  3CRB A;  3K0V A;  5EHM A;  4JXI A;  3PPN A;  1O7T A;  4MLV A;  4KYS A;  1AH5 A;  2I58 A;  1Z7N E;  4X48 A;  3QIM A;  1IXG A;  1II5 A;  2Q9T A;  2DE3 A;  5I57 B;  4DLD A;  2F36 A;  2DP8 A;  4FAT A;  2DQV A;  1MM6 A;  1TXF A;  2OLB A;  3FVK A;  3HV1 A;  2P0S A;  2P2A A;  2X7P A;  4R73 A;  5EHS A;  4OER A;  2B3B A;  3JYR A;  4E0W A;  4ZEC A;  5BWJ A;  5CBS A;  2OJT A;  1VFD A;  4XTC Q;  1B5H A;  4IO5 A;  2HCA A;  3S9M C;  3GLB A;  4JBZ A;  3JZJ A;  3K6X A;  1RYO A;  2Z8F A;  3KN3 A;  1M5E A;  2XXR A;  4EXK A;  2Y7R A;  3PUY E;  2I49 A;  5EYF A;  4OWD A;  4YIC A;  2CMO A;  3GXA A;  4DCX A;  3RPW A;  2HQ0 A;  3KEI A;  5LOM A;  4ZE8 A;  5I56 B;  3KSX A;  2RIN A;  4R2F A;  4TOZ A;  3CG1 A;  3N26 A;  2O1L A;  5DEX B;  4YKP A;  3MP8 A;  1Y3N A;  2FYI A;  4PET A;  4U1Z A;  5L9M A;  3R7X A;  1N7W A;  4WXJ A;  4F31 B;  3D4C A;  1CE2 A;  3O6I A;  3RY3 A;  3TDJ A;  4EF1 A;  3FAS A;  4H8I A;  1N0T A;  3TEL A;  4QSE A;  1P1N A;  3FUZ A;  1MXV A;  2RF1 A;  4OET A;  3H6W A;  3HHF A;  3CIJ A;  3TTR A;  2ZYO A;  4PFY A;  5H8N A;  2V3Q A;  4LON B;  2ESN A;  3K02 A;  3ONM A;  4JB7 A;  1B3E A;  1NL5 A;  4F1Y A;  1SBP A;  4U21 A;  1OVB A;  5HPQ A;  3S9L C;  3N6T A;  1MQG A;  2PVU A;  4RXL A;  1LFI A;  4R6H A;  1ZIU A;  3RN8 A;  2H4I A;  1OQH A;  1FQA A;  3SEX A;  1PB8 A;  1M5C A;  1LBB A;  1N3W A;  3VVE A;  4BDO A;  4DXU A;  1DPP A;  1XVY A;  2KLF A;  4BDM A;  1A8E A;  4OVJ A;  3TTL A;  2O1M A;  5CI5 A;  3RLF E;  4ESW A;  5AA4 A;  1MQH A;  4HCY A;  1VE4 A;  2I4C A;  1ANF A;  4FAJ A;  1ZU0 A;  1SQY A;  4H65 A;  2I48 A;  1IXH A;  3IOU A;  4FED A;  2ONK E;  5FHM A;  5I57 A;  2XXT A;  4MLQ A;  3TEP A;  5J1D A;  3Q27 A;  3TPA A;  1MG1 A;  4XXU A;  4AB5 A;  5F1Q A;  2UVG A;  4BDR A;  1N7X A;  2VP1 A;  4HCW A;  4ESX A;  1SI0 A;  1OVT A;  3H06 B;  4FEC A;  1D9Y A;  2F78 A;  3S4U A;  3THI A;  3OEN A;  1ZLQ A;  4F2Q A;  3RQT A;  2ABH A;  3KSJ A;  2QPQ A;  1M5F A;  3SEV A;  5I2K B;  3N5L A;  3O29 A;  3LSX A;  4PP0 A;  3M3F A;  4PFU A;  4YMB A;  2V93 A;  3UOR A;  1IXC A;  3KJT A;  4G68 A;  4JWX A;  1LAG E;  4RJZ A;  5ISU A;  2BJJ X;  3V89 B;  3KN8 A;  1FTO A;  3K4U A;  1AL3 A;  2QS2 A;  3E13 X;  3P7I A;  2GH9 A;  3MVX A;  4RY1 A;  4WED A;  5H8H A;  1JW1 A;  1SI1 A;  3MC2 A;  4EDP A;  3PPP A;  3KFM A;  1N76 A;  1QUL A;  4TQU Q;  3WAE A;  1J1N A;  1DOT A;  3FXU A;  1BKA A;  4RK2 A;  2Q2A A;  3FXQ A;  1HSJ A;  1B52 A;  4H8J A;  2F97 A;  4U4S A;  1N3X A;  3H7M A;  2HZL A;  1URD A;  1MM7 A;  1Y20 A;  3PPQ A;  1JQF A;  3FAT A;  4QSC A;  1Y3P A;  4ZED A;  2VGQ A;  2ZNS A;  2I3V A;  2UYF A;  1O64 A;  4IGT A;  2I0C A;  3FVN A;  4EXL A;  3KZG A;  3IK6 B;  2H98 A;  1XS5 A;  3PMX A;  2O68 A;  4JSO A;  3QUF A;  2OZZ A;  1EU8 A;  4H67 A;  2PX1 A;  1FTL A;  4YKJ A;  4U1O A;  2REJ A;  3HST A;  3MUQ A;  2QSX A;  5KCJ B;  4OHN A;  3T9H B;  4R72 A;  5AE4 A;  2D5W A;  2RC8 A;  1H3D A;  3PV0 E;  3CFZ A;  4G68 B;  5ELV A;  3FVO A;  2FNC A;  2UXA A;  2DSF A;  1JET A;  1MY3 A;  5DYH A;  3T93 B;  5JTY A;  1P1W A;  1LBC A;  1MQI A;  3H03 A;  4KPT A;  3FVG A;  4LQ2 A;  5AA1 A;  3H4Z A;  5FTI A;  2AIX A;  4OQO A;  1MDQ A;  4BDN A;  2UVH A;  4BDL A;  4HTG A;  4O3A A;  1LAX A;  1USY E;  5JTY B;  3E3K A;  1LB8 A;  1B32 A;  2VHA A;  3V5A A;  4Q8R A;  4OZ9 A;  1FCK A;  5CMC A;  4LZ5 A;  1XVX A;  4XKQ A;  1POT A;  4OES A;  3MZB A;  2ONS A;  2O69 A;  3KGC A;  2HZK A;  1B7Z A;  1GVC A;  1NNP A;  3B7D A;  1B3L A;  3KJ7 A;  1R9L A;  4H0W A;  1MQJ A;  3RNN A;  4YMA A;  3Q29 A;  2REG A;  1NKX A;  4ZEK A;  4U22 A;  1B5I A;  1QUK A;  4ZEB A;  4PQJ A;  2A5T A;  3H3G A;  4KCC A;  4LZ8 A;  3S2V A;  1LCF A;  2UVI A;  2A5S A;  3VVF A;  3N6U A;  3M3L A;  3OO8 A;  1A40 A;  2H99 A;  1Q35 A;  4RPN A;  3IB2 A;  4ZEF A;  1QVS A;  3FJG A;  1QKA A;  3EHU A;  2RCA A;  3HO7 A;  3K00 A;  4XKR A;  3MAM A;  2ZYM A;  4F19 A;  4F22 A;  4FEB A;  1NMU A;  5K2X A;  2DWA A;  1DPE A;  2F6P A;  4MBP A;  3TKD A;  4ZDM A;  3TTM A;  4EQB A;  3T96 B;  3SER A;  4E0X A;  4H5G A;  2RC9 A;  3K6W A;  4R6Y A;  5H8H B;  3FV1 A;  3RT6 B;  5KDT A;  3D4G A;  5DVI A;  3TCH A;  1O63 A;  3KOS A;  4XKP A;  1A54 A;  1SD3 A;  1TT1 A;  1P1Q A; 
#chains in the Genus database with same CATH topology
 2XXH A;  2HFB A;  1EYK A;  2AL4 A;  1H45 A;  4I40 A;  3OXN A;  2LAO A;  4FIM A;  4IO6 A;  4IY5 A;  4OVP A;  3U94 A;  5I56 A;  3LBS A;  1BLF A;  3QXM A;  4K3F A;  1YXI A;  4LUB A;  4N07 A;  4MHF A;  1Y3Q A;  1VR5 A;  1FTK A;  4FJP A;  5BUU A;  4DXB A;  3MPL A;  2QS4 A;  4IY6 A;  4NN3 A;  3IOR A;  1NNT A;  1FW0 A;  4M4G A;  4GOT A;  3UN6 A;  1B05 A;  1TFA A;  4QFL A;  1QJM A;  3O6H A;  3SEU A;  3OMB A;  1D9V A;  3OSR A;  3K1N A;  1PBP A;  3GYY A;  2Y84 A;  5ESY A;  5I59 A;  4N13 A;  1NH7 A;  2DOJ A;  1LFG A;  2O7I A;  5K2Y A;  1MXU A;  3TUS A;  3EHT A;  1JVX A;  3QAX A;  5AA3 A;  2FA7 A;  4PF6 A;  1JP4 A;  4MH5 A;  2I3W A;  4ZZE A;  1B0L A;  4F3S A;  3MJN A;  1G0H A;  1LBX A;  4U2R A;  4KHZ E;  3G3J A;  3HPI A;  4MEV A;  5L9S A;  4R75 A;  1I6B A;  4FOR A;  1IMC A;  3CHG A;  3FZV A;  1SVX B;  2XXU A;  4R2B A;  4F1V A;  2NWJ A;  3L6G A;  2IA4 A;  1IZ1 A;  5CRY A;  5I3S A;  2Q89 A;  1XHY A;  3UA8 A;  1SW2 A;  2D21 A;  5DEX A;  2YPN A;  4O8M A;  5H8S A;  1BIY A;  4NF4 A;  3PPO A;  3TTK A;  1F9B A;  3RGY A;  4LA9 A;  1B46 A;  3BKI B;  1I69 A;  3RUM A;  5CM6 A;  4OEN A;  2PCR A;  5ET5 A;  3OEL A;  2M8C A;  3TTN A;  4NWC A;  1B9J A;  2B3F A;  1OIB A;  3O2A A;  5I57 A;  4ZZA A;  4H6D A;  1YCJ A;  2QJE A;  3PUV E;  5F24 A;  1S9T A;  1NV2 A;  2F35 A;  2R8T A;  4EUO A;  2XX7 A;  4NED A;  1B4Z A;  2Q74 A;  3ODB A;  3U92 A;  2VD3 A;  1QKB A;  3T9X B;  3TYH A;  1Y4T A;  1PB7 A;  1JEV A;  4MNI A;  4ONY A;  3MWB A;  3TCF A;  1A99 A;  1GR2 A;  3AXF A;  3VFJ A;  1M5B A;  2Y7W A;  4HE2 A;  1FQE A;  4WKM A;  3I3V A;  4QXD A;  4YB7 A;  1SW4 A;  3W9V A;  1MPC A;  2PYY A;  3UIF A;  2DWJ A;  4ELO A;  1AOV A;  2F8D A;  4Q5T A;  1NNF A;  3MPK A;  1B5J A;  4H1X A;  2XXI A;  4KYE A;  3PUZ E;  5H8N B;  3UK4 A;  3DP4 A;  3MZ9 A;  5I59 B;  4Z0I A;  3DP6 A;  5IZ1 A;  3CSG A;  4P0G A;  3KBR A;  5HM4 B;  4PFI A;  4NF8 B;  2ZZX A;  3OEK A;  2OWT A;  1ZMG A;  3G3H A;  3H6V A;  3A09 A;  2UYE A;  5TU0 A;  1LFH A;  2F34 A;  2DXR A;  2XXV A;  3TZA A;  4F29 A;  4N6P A;  1S7Y A;  1IIW A;  1IMD A;  2AL5 A;  5DVJ A;  1DSN A;  3PMW A;  2WX9 A;  3H6T A;  5F7V A;  1QUJ A;  4GWY A;  5AA4 B;  4U4X A;  2Q88 A;  5FHO A;  3UGW A;  2OK2 A;  2QL3 A;  4DCY A;  3FBP A;  4JWO A;  4ND9 A;  3TAJ A;  1I6Q A;  5TP9 B;  4JXI A;  2I58 A;  4X48 A;  2DE3 A;  1NV0 A;  2DQV A;  2OLB A;  2WEF A;  3JYR A;  2MKZ A;  4IO5 A;  2Q8M A;  4G61 A;  3JZJ A;  5EYF A;  5LOM A;  4PFB A;  4ZE8 A;  4R2F A;  4TOZ A;  2FBP A;  3TDJ A;  4H8I A;  4NAP A;  3TEL A;  4QSE A;  3FUZ A;  2RF1 A;  3IFA A;  3CIJ A;  4GX4 A;  2V3Q A;  2ESN A;  4JB7 A;  1SBP A;  4U21 A;  1LFI A;  1ZIU A;  1XVY A;  2KLF A;  4BDM A;  3BIH A;  5AA4 A;  2ZZV A;  1ANF A;  1ZU0 A;  3IOU A;  3QMF A;  4MLQ A;  1MG1 A;  2VP1 A;  1D9Y A;  2F78 A;  3OEN A;  1ZLQ A;  2CZH A;  3RQT A;  4OVT A;  3O29 A;  3M3F A;  4YMB A;  4G68 A;  3KN8 A;  2QVU A;  3K4U A;  1AL3 A;  2QS2 A;  2GH9 A;  5H8H A;  1JW1 A;  1N76 A;  4XF5 A;  2WBD A;  3FXQ A;  4H8J A;  3BIG A;  3PPQ A;  4N4U A;  4ZED A;  2VGQ A;  2ZNS A;  4I3Y A;  1K9Z A;  1FTL A;  4U1O A;  3HST A;  3MUQ A;  4P8B A;  4OHN A;  2RC8 A;  3PV0 E;  3CFZ A;  2OWZ A;  3FVO A;  2UXA A;  5DYH A;  1MY3 A;  3H03 A;  4KPT A;  5AA1 A;  4OQO A;  1FTA A;  2VHA A;  4Q8R A;  1FCK A;  1XVX A;  3MZB A;  2O69 A;  1B7Z A;  3KJ7 A;  1FBE A;  1RDX A;  4PGN A;  5I5P A;  3LUZ A;  4DI3 D;  3S2V A;  2A5S A;  3M3L A;  3OO8 A;  3IB2 A;  1QKA A;  3EHU A;  1FBC A;  2ZYM A;  4MBP A;  5H8H B;  5KDT A;  3RT6 B;  3TCH A;  4XKP A;  1A54 A;  1SD3 A;  1MQD A;  4ELQ A;  3G3G A;  3GBB A;  1RYX A;  4H5F A;  1CNQ A;  2NXO A;  3JV9 A;  4F18 A;  3EF7 A;  5I2K A;  1Y9U A;  4MNP A;  3SKP A;  4GWU A;  4C0R A;  1B51 A;  1NH8 A;  3M8U A;  4YZZ A;  1IMF A;  3KN7 A;  4GWO A;  3DLN A;  1B4H A;  1ZTY A;  3OO9 A;  2V84 A;  5J16 A;  3SET A;  3IAZ A;  4IO7 A;  5IGA A;  3USD A;  1VFE A;  3E4R A;  2F5X A;  4FE8 A;  3VE1 B;  5CMB A;  2DE4 A;  1B58 A;  2GFE A;  1XC1 A;  3I5O A;  5EQ7 A;  5TPA A;  3PTY A;  1MPD A;  2V3T A;  4GFR A;  4JWY A;  2B65 A;  1D3K A;  2X7Q A;  3WAF A;  5I2N B;  3ROJ A;  1UTB A;  4O7I A;  2VD2 A;  2XXQ A;  1GGG A;  1AWB A;  1MY0 A;  4O3C A;  2ZXT A;  2PT2 A;  4POX A;  4MF3 A;  1YZ0 A;  4F3P A;  3BBR A;  4OEU A;  3RTW B;  1PBQ A;  2PT1 A;  3SEW A;  4HS7 A;  3QSL A;  1BTJ A;  2P3V A;  3IOT A;  1EZO A;  1IEJ A;  1H76 A;  2YJP A;  1OLC A;  5B70 A;  3TCG A;  4KXP A;  2VOZ A;  4PGP A;  4AQ4 A;  1POY 1;  4ZEI A;  1DTG A;  2GHA A;  3C33 A;  1QW0 A;  3CG3 A;  4NF5 A;  1LBV A;  4IR8 A;  3EQ1 A;  2ONR A;  4DE8 A;  4AS5 A;  3O28 A;  3T22 A;  4NF8 A;  4RK9 A;  1VDW A;  2OBG A;  3T66 A;  3BFT A;  2F7B A;  4IB2 A;  3Q25 A;  4PAK A;  4L17 A;  1YTV A;  3G3F A;  1Y1M A;  1G0I A;  3MVY A;  4G8M A;  5CMK A;  5TPA B;  1H44 A;  1Q9D A;  1Y4C A;  4P1E A;  4JSD A;  4GIZ A;  1LCT A;  5DT6 A;  3IOW A;  3VLU A;  1N84 A;  2H9B A;  3BFU A;  3F11 A;  3LR1 A;  2G93 A;  3CFL A;  3OO6 A;  3Q26 A;  5ET8 A;  2ZNT A;  3LSW A;  4NWD A;  1R6Z A;  3TOD A;  4GVO A;  2PMS A;  5DVF A;  4YU0 A;  4R9F A;  4LQ5 A;  2H5Y A;  3MP1 A;  1FQB A;  4O94 A;  5A5X A;  1NV1 A;  3KOT A;  1A8F A;  3K1P A;  2D3I A;  3MZ1 A;  1K9Y A;  2ZMB A;  3PMV A;  3RYD A;  2Z8E A;  3FXB A;  5LDZ A;  4GL8 A;  4I1D A;  4PAI A;  3MYU A;  1YYZ A;  3FV2 A;  3FD3 A;  3HCQ A;  4Z7E A;  1IIT A;  3G3I A;  4KCD A;  3V83 A;  1IMB A;  1Y1Z A;  1Q1K A;  3HN0 A;  4BLA A;  4DCX A;  4UA8 A;  1MDP 1;  2RKM A;  3TTR A;  2V3U A;  1JNF A;  2P1S A;  3C34 A;  3DP8 A;  5KCJ A;  4KFQ A;  4WEP A;  4I8C A;  4RA1 A;  3ZSF A;  2CZI A;  4YKK A;  4GQO A;  1ZJL A;  1NNK A;  4O3B A;  2X26 A;  4GWX A;  1B3G A;  1VSO A;  2QMW A;  2HAU A;  4G8H A;  5CMM A;  3ZS6 A;  2O6A A;  1P1U A;  5FHN A;  4AB6 A;  1XT8 A;  4OEV A;  4KQP A;  3LUY A;  3FGS A;  4OFL A;  2DWH A;  5A5X B;  2CZL A;  4QHQ A;  3VLW A;  4QRZ A;  3FXR A;  2Y7K A;  4YB6 A;  2RC7 A;  2H25 A;  3PPR A;  4U23 A;  4NF5 B;  4RPO A;  4G8N A;  2XXY A;  2UVJ A;  4FBP A;  3CVG A;  4NQ8 A;  2QRY A;  3MVZ A;  4X1B A;  4ZE9 A;  3OSQ A;  2Y5K A;  4G77 A;  4GRK A;  1GTK A;  4QSD A;  3PPN A;  4KYS A;  5I57 B;  1NV7 A;  3B8B A;  4DLD A;  2F36 A;  2P2A A;  4OER A;  2GQ1 A;  4E0W A;  4ZEC A;  2OJT A;  1VFD A;  4XTC Q;  1B5H A;  4JBZ A;  5IZ3 A;  2Z8F A;  4XEQ A;  2XXR A;  4OVR A;  2Y7R A;  3PUY E;  2HQ0 A;  3KSX A;  3N26 A;  4PET A;  4U1Z A;  5L9M A;  5ET7 A;  5I7I A;  1N0T A;  4OET A;  4PFY A;  3K02 A;  1B3E A;  1NL5 A;  3ISP A;  1OVB A;  3S9L C;  2VPO A;  3N6T A;  1MQG A;  2PVU A;  4R6H A;  1FQA A;  4N6K A;  1M5C A;  4NG7 A;  1A8E A;  3RLF E;  2F3B A;  4ESW A;  1VE4 A;  2I4C A;  4FAJ A;  4H65 A;  1NUY A;  2I48 A;  4FED A;  2ONK E;  3TEP A;  5J1D A;  1N7X A;  4HCW A;  1XI6 A;  3H06 B;  3S4U A;  3THI A;  4F2Q A;  3SEV A;  1M5F A;  4PP0 A;  1FSA A;  1IXC A;  4JWX A;  5ISU A;  1LAG E;  3V89 B;  1FTO A;  2VPN A;  3P7I A;  3MVX A;  4WED A;  2WYK A;  4TQU Q;  2Q2A A;  4P1L A;  2HHM A;  2F97 A;  1N3X A;  3H7M A;  1URD A;  1MM7 A;  1Y20 A;  1JQF A;  4QSC A;  1Y3P A;  2UYF A;  1O64 A;  4IGT A;  3IK6 B;  1XS5 A;  2OZZ A;  3NOH A;  4PFR A;  1NUZ A;  2QSX A;  5IZZ A;  2FNC A;  2DSF A;  3T93 B;  1P1W A;  1LBC A;  2XXK A;  4LQ2 A;  2XWI A;  3H4Z A;  5FTI A;  4BDL A;  2UVH A;  1USY E;  3V5A A;  1BK4 A;  1GVC A;  1R9L A;  3RNN A;  4ZEK A;  1B5I A;  4PQJ A;  3H3G A;  4KCC A;  3EKI A;  1LCF A;  1A40 A;  4PCD A;  4F19 A;  2RCA A;  3K00 A;  3U65 A;  2KQZ A;  2DWA A;  1DPE A;  3TTM A;  4E0X A;  3SER A;  4H5G A;  2RC9 A;  3K6W A;  4PBH A;  1O63 A;  2XXW A;  2XD3 A;  2YLN A;  1OLA A;  4QFO A;  3IB0 A;  4R9G A;  4ECF A;  4TLM B;  1PEB A;  3C31 A;  4JVI A;  3SES A;  1YPN A;  3IOV A;  4N81 A;  4NF4 B;  4OMB A;  3K6U A;  4X1D A;  5IAI A;  1FBP A;  1B2H A;  5I2N A;  2QMX A;  2Z22 A;  1KWH A;  4F39 A;  1UIV A;  4LVQ A;  5I84 A;  4GLI A;  5CBR A;  3C9H A;  2QFL A;  4R74 A;  3B6T A;  1ZBM A;  2DVC A;  1NUX A;  5T3J A;  1CB6 A;  1FQC A;  5DTB A;  1XOC A;  4I62 A;  1B3F A;  5L9O A;  1B7H A;  4NX1 A;  2BJI A;  2DYX A;  4PTK A;  3OO7 A;  5JEI A;  1RDY A;  1D4N A;  2FHY A;  5AA2 A;  1FBF A;  3LSF B;  5IM2 A;  3VXB A;  3O66 A;  2XWV A;  1R1N A;  4OFJ A;  1IUD A;  5I58 A;  3A3U A;  4I3E A;  2DE2 A;  3G7W A;  3VXC A;  4EQ9 A;  1PB9 A;  3E78 A;  3PGF A;  4KD5 A;  1OQG A;  2PFZ A;  4OVS A;  1YAE A;  4N15 A;  4MIJ A;  1B1H A;  4EQ7 A;  4QFK A;  2Z23 A;  4NF6 B;  1PDA A;  3E9X A;  1B40 A;  4IGR A;  1JVY A;  4IO2 A;  4N91 A;  1LLS A;  3B50 A;  1LBW A;  1H43 A;  1FTJ A;  2DWI A;  2DVZ A;  4PDD A;  2IEE A;  4YKI A;  1FBG A;  2DDK A;  3S9E A;  1LST A;  3DM0 A;  5IZ3 B;  3GZG A;  5FTH A;  2RCB A;  2XHD A;  5EQA A;  1I6A A;  3R26 A;  4RYA A;  4DZ1 A;  1FTM A;  3O97 A;  4BDQ A;  2XD2 A;  1UTH A;  1MY2 A;  5KDT B;  1JEU A;  1IMA A;  3B6Q A;  3TMG A;  4NF0 A;  4THI A;  1UTH B;  3C36 A;  3MW0 A;  2W7Y A;  3W15 C;  3QUJ A;  1B0H A;  1WDN A;  2DXY A;  5M2V A;  3ILT B;  5TP9 A;  3KC0 A;  3IX1 A;  2V25 A;  4MNC A;  1FPE A;  1OMP A;  4NMY A;  2FIX A;  2E1S A;  2HEU A;  1TWY A;  2I0B A;  4POW A;  4YB5 A;  1LBZ A;  4XKN A;  3K01 A;  2CEY A;  4QFP A;  2XXX A;  2F7A A;  3TQW A;  2F3D A;  1DBZ A;  4ELP A;  4PFT A;  3ECR A;  5CC2 A;  1FQD A;  3IL1 B;  3KG2 A;  2F6G A;  4OFO A;  1JW5 A;  3SEY A;  3OEM A;  4P3L A;  3U1O A;  1LEV A;  4GBV A;  1LAH E;  2QVR A;  4I9D A;  1USY H;  1M5D A;  3FJM A;  3IB1 A;  3W9W A;  4EF2 A;  1GV8 A;  1EZ9 A;  2PBW A;  1US4 A;  4GXS B;  4R72 A;  3CSB A;  2Z8D A;  4HE0 A;  4DDD A;  2I6E A;  3Q28 A;  1JW4 A;  3MVW A;  1WVJ A;  3H6U A;  1NFT A;  5H8Q A;  4MMP A;  2O84 X;  3CR9 A;  3PD8 A;  2L5V A;  3HHG A;  5H8F B;  4GWZ A;  3EHS A;  1WOD A;  2AYS A;  1A55 A;  1IME A;  1EH3 A;  4Q0C A;  4ELR A;  1FPD A;  1MPB A;  4JDF A;  4NF6 A;  3VV5 A;  3VDF A;  4GX3 A;  3PD9 A;  4M1V A;  2GRV A;  4QBA A;  4LN5 A;  1AMF A;  1P99 A;  3RPL A;  4GF8 A;  4Q30 B;  2Q8J A;  3O6G A;  1MXX A;  1MH3 A;  4PF8 A;  1SYH A;  2ALU A;  4IO3 A;  4XIG Q;  1N04 A;  2CEX A;  2R6G E;  1T0K A;  3IJX B;  1MY4 A;  1B7U A;  1Z7M E;  2Q2C A;  4G4P A;  3IO4 A;  3CRB A;  2P3N A;  1Z7N E;  1FJ6 A;  1II5 A;  2Q9T A;  5EQ9 A;  2DP8 A;  3FVK A;  5A5L A;  2B4L A;  3HV1 A;  5EHS A;  4R73 A;  1FRP A;  5BWJ A;  3S9M C;  3K6X A;  1D9Q A;  4OWD A;  3GXA A;  5I56 B;  2RIN A;  3CG1 A;  1Y3N A;  5EQ8 A;  3R7X A;  4F31 B;  3D4C A;  1CE2 A;  3FAS A;  1P1N A;  1MXV A;  3H6W A;  2ZYO A;  5H8N A;  4LON B;  3SEX A;  4RXL A;  3RN8 A;  4FAT A;  1OQH A;  2XA5 A;  3VVE A;  1N3W A;  1DPP A;  1DK4 A;  1NV4 A;  3TTL A;  5CI5 A;  1MQH A;  4XFE A;  1SQY A;  5FHM A;  3Q27 A;  5F1Q A;  2ZZW A;  4ESX A;  1SI0 A;  4FEC A;  5LTC A;  4PE3 A;  2ABH A;  2QPQ A;  5I2K B;  3N5L A;  4PFU A;  3UOR A;  4RJZ A;  2BJJ X;  3E13 X;  1INP A;  4DI4 B;  3MC2 A;  4EDP A;  3PPP A;  3KFM A;  1QUL A;  3WAE A;  1J1N A;  1DOT A;  3FXU A;  1HSJ A;  4U4S A;  4X8R A;  5ET6 A;  3KZG A;  4JSO A;  3QUF A;  1EU8 A;  1RDZ A;  4H67 A;  2PX1 A;  4YKJ A;  5KCJ B;  5AE4 A;  5JTY A;  1MQI A;  4GWS A;  4BDN A;  4O3A A;  5JTY B;  3E3K A;  1LB8 A;  5CMC A;  2ONS A;  2HZK A;  3B7D A;  1B3L A;  1KZ8 A;  4PAF A;  4H0W A;  1MQJ A;  3LV0 A;  4YMA A;  4N8G A;  2REG A;  1NKX A;  1QUK A;  4ZEB A;  1KA0 A;  3VVF A;  3N6U A;  1Q35 A;  3FJG A;  4XKR A;  1NMU A;  5K2X A;  4ZDM A;  3T96 B;  5EYG A;  3KOS A;  1B52 A;  1P1Q A;  2A5T B;  4N17 A;  2THI A;  4UAB A;  4PBQ A;  3R6U A;  2XX9 A;  1IXI A;  2WKY A;  4MJO A;  5KZT A;  2QS1 A;  2XWK A;  2VT5 A;  2FVZ A;  3I6V A;  3EPE A;  1MXY A;  3T9U A;  3T9V A;  3FJ7 A;  3EN3 A;  4AS4 A;  2NOO A;  4UAC A;  3IO6 A;  3UP9 A;  4KR5 A;  2R71 A;  1FPG A;  5B7D A;  1LAF E;  1LB9 A;  4YAH X;  3E79 A;  3CFX A;  3FIR A;  2PFY A;  4F3B A;  3QYT A;  5JK4 A;  4LAT A;  4GL0 A;  3U72 A;  1RKM A;  2HAV A;  2HPG A;  3LC8 A;  4GXA A;  2Y7I A;  4HE1 A;  1FPK A;  3MQ9 A;  4DXC A;  1B6H A;  2QS3 A;  5AA2 D;  1UIU A;  1DMB A;  3U8Q A;  3ZKL A;  2HXR A;  3DEL B;  4GX6 A;  1SDX A;  1HSE A;  4H45 A;  4PFW A;  1A7L A;  1R9Q A;  4GWW A;  1URS A;  5ICT A;  2OX3 A;  2ZNU A;  1EYI A;  1EZP A;  1PC3 A;  4H46 A;  5ITP A;  4GD5 A;  4R6K A;  1NUW A;  4OXV A;  5AA2 B;  3RT8 A;  2DS9 A;  2R9J A;  4MAG A;  2G29 A;  3TQL A;  5I58 B;  4QFN A;  3SZP A;  2JJK A;  2ANJ A;  3C32 A;  4NTL A;  2WBB A;  3QK6 A;  4RNS A;  3K6V A;  3B6W A;  4LZ7 A;  2WYP A;  3M3K A;  3C35 A;  1MH4 A;  1FBD A;  3PUX E;  2O51 A;  4N6D A;  1SYI A;  2O7U A;  4OAN A;  2GHB A;  1MRP A;  5HBC A;  4F1U A;  4C1T A;  4C1U A;  1TFD A;  3TFL A;  5FBP A;  1SW5 A;  1HSL A;  1NV6 A;  3PUW E;  1SPI A;  4P11 A;  4HXV A;  1FPL A;  4KYD A;  1FPF A;  3A3C A;  4KI0 E;  2CZK A;  3ZKK A;  3RTF B;  3V8X B;  5EYH A;  2B4M A;  1MS7 A;  5ITO A;  4MCO A;  1P1O A;  4OVQ A;  1UQW A;  4X04 A;  3OOA A;  3O9P A;  1ELJ A;  4OTE A;  2ZYK A;  1UTB B;  4MFI A;  4DIG A;  3MP6 A;  2F7C A;  3S9N C;  3SDF A;  5ICQ A;  2OWS A;  4NE4 A;  3LSL A;  3OD7 A;  3U93 A;  4NGU A;  2XX8 A;  3G3K A;  3L6H A;  1IQ7 A;  4MX6 A;  4ISU A;  4PE5 B;  1MY1 A;  4OYV A;  2HXW A;  2XXP A;  3N94 A;  3K1M A;  1QUI A;  5H8F A;  4F2O A;  1B3H A;  4QF9 A;  4P0I A;  1S50 A;  2Y7P A;  4PC9 A;  3IFC A;  5L8D A;  3PU5 A;  4X9T A;  1L5T A;  3C4M A;  3GBA A;  1AIV A;  2I4B A;  3ILU B;  5DW8 A;  4IO4 A;  3RPL B;  3CI8 A;  4LP2 B;  4G68 C;  1URG A;  1DTZ A;  2ZYN A;  3VLV A;  4P56 A;  1US5 A;  3A29 A;  1LGB C;  1ATG A;  4TLL B;  1BP5 A;  4HW8 A;  3MBP A;  2FIE A;  3K2D A;  1MXW A;  1FQF A;  2NVU B;  4F3G A;  4G2Z A;  3IR1 A;  3VVD A;  2OCU A;  1SW1 A;  1MXZ A;  3D1R A;  3IJO B;  5H8Q B;  5IKB A;  1ZKB A;  2NUV A;  2E0S A;  1B1X A;  5EHM A;  3K0V A;  1O7T A;  4MLV A;  1AH5 A;  1FPJ A;  1NV5 A;  3QIM A;  1IXG A;  4P47 A;  1MM6 A;  4NHB A;  1TXF A;  2P0S A;  2X7P A;  2B3B A;  1QGX A;  5CBS A;  2Y5L A;  2HCA A;  3GLB A;  2XWO A;  1RYO A;  3KN3 A;  1M5E A;  4EXK A;  2I49 A;  4YIC A;  2CMO A;  1KA1 A;  3RPW A;  3KEI A;  2O1L A;  5DEX B;  4YKP A;  3MP8 A;  2FYI A;  1N7W A;  4WXJ A;  3O6I A;  3RY3 A;  4EF1 A;  3HHF A;  3ONM A;  4F1Y A;  4N8Y A;  5HPQ A;  2H4I A;  1PB8 A;  4BDO A;  1LBB A;  4DXU A;  1LBY A;  4OVJ A;  2O1M A;  4HCY A;  1IXH A;  3KBZ A;  2XXT A;  3TPA A;  4AB5 A;  4XXU A;  1FJ9 A;  4BDR A;  2UVG A;  1OVT A;  3HFU A;  3T1B A;  3KSJ A;  3LSX A;  2V93 A;  3KJT A;  1EYJ A;  4RY1 A;  4GBW A;  1SI1 A;  1DCU A;  1BKA A;  4RK2 A;  1NV3 A;  2KR0 A;  2HZL A;  3FAT A;  3MST A;  2I3V A;  4O7M A;  2I0C A;  3FVN A;  4EXL A;  2H98 A;  1FPB A;  3PMX A;  2O68 A;  1FPI A;  2REJ A;  4JVC A;  3KC1 A;  3T9H B;  2D5W A;  1H3D A;  3T0J A;  4G68 B;  5ELV A;  2QVV A;  1JET A;  3FVG A;  1FBH A;  2AIX A;  1MDQ A;  4HTG A;  1LAX A;  1B32 A;  4OZ9 A;  4JVD A;  4LZ5 A;  4XKQ A;  1POT A;  4OES A;  3KGC A;  1NNP A;  2V4C A;  4OA4 A;  3Q29 A;  4U22 A;  2A5T A;  4LZ8 A;  2UVI A;  4ZEF A;  2H99 A;  4RPN A;  1QVS A;  4PDH A;  3HO7 A;  4P9K A;  3MAM A;  4F22 A;  4FEB A;  3TKD A;  4EQB A;  2F6P A;  4R6Y A;  3FV1 A;  3D4G A;  5DVI A;  1NI9 A;  4ZS9 A;  1TT1 A; 
#chains in the Genus database with same CATH homology
 1MQD A;  2A5T B;  2XXH A;  2HFB A;  2XXW A;  2XD3 A;  2AL4 A;  2YLN A;  4ELQ A;  1H45 A;  3G3G A;  3OXN A;  2THI A;  3GBB A;  1OLA A;  2LAO A;  4FIM A;  4QFO A;  1RYX A;  4H5F A;  3IB0 A;  3R6U A;  4R9G A;  2NXO A;  4IO6 A;  4IY5 A;  4TLM B;  4ECF A;  2XX9 A;  1PEB A;  3JV9 A;  1IXI A;  3C31 A;  2WKY A;  4F18 A;  3U94 A;  3SES A;  5I56 A;  1YPN A;  3EF7 A;  3IOV A;  4NF4 B;  4OMB A;  3K6U A;  3LBS A;  1BLF A;  5I2K A;  4X1D A;  5KZT A;  1Y9U A;  2QS1 A;  3QXM A;  5IAI A;  4K3F A;  3SKP A;  3I6V A;  3EPE A;  1B2H A;  4LUB A;  4N07 A;  4C0R A;  1B51 A;  1MXY A;  1Y3Q A;  3T9U A;  1NH8 A;  2QMX A;  1KWH A;  2Z22 A;  3FJ7 A;  3M8U A;  4YZZ A;  3KN7 A;  1UIV A;  3EN3 A;  4GWO A;  4LVQ A;  4F39 A;  1VR5 A;  3DLN A;  1B4H A;  2NOO A;  1FTK A;  5I84 A;  1ZTY A;  4FJP A;  4GLI A;  4UAC A;  5CBR A;  3IO6 A;  3OO9 A;  3UP9 A;  5BUU A;  2V84 A;  4DXB A;  3SET A;  3IAZ A;  3MPL A;  4IO7 A;  3C9H A;  4R74 A;  4KR5 A;  2R71 A;  2QS4 A;  4IY6 A;  3USD A;  5B7D A;  1LAF E;  1LB9 A;  3B6T A;  1VFE A;  3IOR A;  1NNT A;  1FW0 A;  1ZBM A;  2F5X A;  3E4R A;  4FE8 A;  4M4G A;  4YAH X;  4GOT A;  3UN6 A;  3VE1 B;  5CMB A;  3CFX A;  2DVC A;  1B05 A;  3FIR A;  2DE4 A;  1B58 A;  1CB6 A;  1FQC A;  2GFE A;  5DTB A;  1XC1 A;  1TFA A;  4QFL A;  3I5O A;  4F3B A;  3QYT A;  1XOC A;  5TPA A;  4I62 A;  1B3F A;  1QJM A;  3O6H A;  5JK4 A;  1MPD A;  2V3T A;  3SEU A;  3OMB A;  4LAT A;  4GFR A;  4ZS9 A;  5L9O A;  1B7H A;  1D9V A;  4GL0 A;  3OSR A;  3U72 A;  2DYX A;  4JWY A;  1RKM A;  2HAV A;  2B65 A;  3K1N A;  3OO7 A;  5JEI A;  1D4N A;  3LC8 A;  1PBP A;  1D3K A;  5AA2 A;  3LSF B;  2X7Q A;  4GXA A;  3WAF A;  5I2N B;  3VXB A;  1UTB A;  2Y84 A;  3O66 A;  5I59 A;  2VD2 A;  2XXQ A;  1GGG A;  1R1N A;  2DOJ A;  1NH7 A;  1MY0 A;  1LFG A;  1IUD A;  2Y7I A;  4N13 A;  4O3C A;  4OFJ A;  2ZXT A;  2O7I A;  2PT2 A;  5K2Y A;  4POX A;  5I58 A;  3MQ9 A;  3A3U A;  4MF3 A;  4DXC A;  4F3P A;  1MXU A;  1B6H A;  2QS3 A;  3BBR A;  3TUS A;  2DE2 A;  3EHT A;  1JVX A;  1UIU A;  3G7W A;  4OEU A;  1PBQ A;  2PT1 A;  3RTW B;  3SEW A;  5AA2 D;  3VXC A;  3QAX A;  4EQ9 A;  1PB9 A;  4HS7 A;  5AA3 A;  2FA7 A;  3QSL A;  1DMB A;  3PGF A;  4MH5 A;  1BTJ A;  3IOT A;  2I3W A;  4KD5 A;  3U8Q A;  1OQG A;  3ZKL A;  1EZO A;  1IEJ A;  4ZZE A;  1B0L A;  4F3S A;  1YAE A;  3DEL B;  3MJN A;  1H76 A;  1B1H A;  1SDX A;  2YJP A;  1HSE A;  4EQ7 A;  4U2R A;  4KHZ E;  1OLC A;  4QFK A;  2Z23 A;  4PFW A;  3G3J A;  1A7L A;  3HPI A;  5B70 A;  1R9Q A;  3TCG A;  4NF6 B;  1PDA A;  1URS A;  5ICT A;  3E9X A;  5L9S A;  2VOZ A;  4R75 A;  2ZNU A;  1I6B A;  1B40 A;  4AQ4 A;  1EZP A;  1PC3 A;  1POY 1;  1JVY A;  4FOR A;  4IGR A;  4IO2 A;  4ZEI A;  1LLS A;  1DTG A;  1SVX B;  2XXU A;  3FZV A;  4R2B A;  4F1V A;  2NWJ A;  2GHA A;  3L6G A;  3C33 A;  1H43 A;  1QW0 A;  2IA4 A;  1IZ1 A;  3CG3 A;  5CRY A;  1FTJ A;  5ITP A;  2Q89 A;  4NF5 A;  1XHY A;  4GD5 A;  3UA8 A;  4R6K A;  3EQ1 A;  2DWI A;  2ONR A;  4OXV A;  5AA2 B;  1SW2 A;  4DE8 A;  2DVZ A;  2D21 A;  5DEX A;  3RT8 A;  2DS9 A;  2YPN A;  2R9J A;  2IEE A;  5H8S A;  1BIY A;  4YKI A;  3O28 A;  2G29 A;  3S9E A;  1LST A;  3TQL A;  3DM0 A;  5I58 B;  4QFN A;  3T22 A;  4NF8 A;  4NF4 A;  3GZG A;  2ANJ A;  3PPO A;  4RK9 A;  2OBG A;  3T66 A;  3C32 A;  3BFT A;  4NTL A;  3TTK A;  1F9B A;  2F7B A;  5FTH A;  4LA9 A;  1B46 A;  4IB2 A;  3Q25 A;  2RCB A;  3RGY A;  3QK6 A;  2XHD A;  3BKI B;  4RNS A;  1I69 A;  3K6V A;  3B6W A;  4L17 A;  4LZ7 A;  3RUM A;  1YTV A;  3M3K A;  1I6A A;  5I2N A;  3C35 A;  1Y1M A;  3G3F A;  5CM6 A;  4OEN A;  1MH4 A;  3R26 A;  4RYA A;  4DZ1 A;  3MVY A;  2M8C A;  3OEL A;  4G8M A;  1FTM A;  3O97 A;  3TTN A;  3PUX E;  5CMK A;  5TPA B;  4BDQ A;  2XD2 A;  2O51 A;  1H44 A;  1UTH A;  4NWC A;  1B9J A;  1MY2 A;  5KDT B;  1SYI A;  3TMG A;  1JEU A;  2O7U A;  2B3F A;  1OIB A;  1MRP A;  1Y4C A;  2GHB A;  3B6Q A;  3O2A A;  4JSD A;  5HBC A;  4THI A;  1UTH B;  3C36 A;  4C1T A;  3MW0 A;  4GIZ A;  1LCT A;  5DT6 A;  2W7Y A;  1TFD A;  3TFL A;  4C1U A;  4ZZA A;  4H6D A;  1YCJ A;  1SW5 A;  2QJE A;  3IOW A;  3PUV E;  3VLU A;  1HSL A;  1N84 A;  3QUJ A;  1B0H A;  1WDN A;  2H9B A;  1S9T A;  2DXY A;  3BFU A;  3F11 A;  2F35 A;  3LR1 A;  3PUW E;  4P11 A;  2G93 A;  5M2V A;  4KYD A;  3CFL A;  3ILT B;  5TP9 A;  4EUO A;  3OO6 A;  2XX7 A;  4NED A;  1B4Z A;  3Q26 A;  2ZNT A;  3IX1 A;  3LSW A;  4NWD A;  3ODB A;  1R6Z A;  2V25 A;  3A3C A;  3U92 A;  2VD3 A;  3TOD A;  1OMP A;  4KI0 E;  4NMY A;  1QKB A;  3ZKK A;  3RTF B;  3V8X B;  4GVO A;  3T9V A;  3T9X B;  3TYH A;  2E1S A;  2PMS A;  5DVF A;  2HEU A;  1TWY A;  2I0B A;  1MS7 A;  4YU0 A;  4POW A;  5ITO A;  4YB5 A;  4R9F A;  1Y4T A;  4LQ5 A;  2H5Y A;  1P1O A;  4XKN A;  3MP1 A;  1FQB A;  5A5X A;  3K01 A;  1PB7 A;  4QFP A;  2XXX A;  2F7A A;  1JEV A;  1UQW A;  3KOT A;  4ONY A;  3TQW A;  3OOA A;  1A8F A;  3K1P A;  3MWB A;  1ELJ A;  3O9P A;  4ELP A;  2D3I A;  3MZ1 A;  2ZMB A;  4OTE A;  3PMV A;  2ZYK A;  3ECR A;  4PFT A;  3TCF A;  5CC2 A;  1A99 A;  2Z8E A;  4GL8 A;  1GR2 A;  1FQD A;  3AXF A;  3VFJ A;  3IL1 B;  1UTB B;  1M5B A;  4I1D A;  3KG2 A;  4MFI A;  2F6G A;  4OFO A;  1JW5 A;  3SEY A;  4DIG A;  3MP6 A;  3OEM A;  2F7C A;  3U1O A;  3S9N C;  3SDF A;  2Y7W A;  5ICQ A;  1FQE A;  3FV2 A;  2OWS A;  3FD3 A;  3I3V A;  4WKM A;  4NE4 A;  1LAH E;  3LSL A;  3OD7 A;  3U93 A;  4YB7 A;  3HCQ A;  4Z7E A;  1SW4 A;  3W9V A;  1IIT A;  1MPC A;  2PYY A;  2XX8 A;  3G3I A;  4KCD A;  3V83 A;  1Y1Z A;  1Q1K A;  3G3K A;  4I9D A;  1USY H;  1IQ7 A;  1M5D A;  3FJM A;  3IB1 A;  3L6H A;  3HN0 A;  3UIF A;  2DWJ A;  3W9W A;  4ISU A;  4EF2 A;  4ELO A;  1GV8 A;  4PE5 B;  1AOV A;  4BLA A;  1EZ9 A;  2PBW A;  2F8D A;  4Q5T A;  1MY1 A;  1MDP 1;  4UA8 A;  1US4 A;  1NNF A;  3MPK A;  1B5J A;  2RKM A;  4GXS B;  4OYV A;  2HXW A;  1JNF A;  2P1S A;  2V3U A;  2XXI A;  2XXP A;  3C34 A;  3CSB A;  3DP8 A;  4H1X A;  3N94 A;  3PUZ E;  2Z8D A;  4KYE A;  3K1M A;  3UK4 A;  1QUI A;  5H8F A;  4KFQ A;  5H8N B;  5KCJ A;  3DP4 A;  4WEP A;  2I6E A;  3Q28 A;  4I8C A;  1B3H A;  4RA1 A;  3ZSF A;  4DDD A;  4F2O A;  3MZ9 A;  4YKK A;  1JW4 A;  4GQO A;  4QF9 A;  5I59 B;  1ZJL A;  3MVW A;  1WVJ A;  3W15 C;  1NNK A;  4Z0I A;  4P0I A;  3DP6 A;  1S50 A;  2Y7P A;  2X26 A;  3H6U A;  4O3B A;  1NFT A;  5H8Q A;  5L8D A;  3CSG A;  2O84 X;  3CR9 A;  4P0G A;  3KBR A;  1B3G A;  3PD8 A;  5HM4 B;  3PU5 A;  4X9T A;  1L5T A;  1VSO A;  4NF8 B;  2QMW A;  2HAU A;  3C4M A;  3HHG A;  3OEK A;  5H8F B;  3GBA A;  4G8H A;  1AIV A;  2I4B A;  3EHS A;  3ILU B;  5CMM A;  3ZS6 A;  1WOD A;  1P1U A;  2O6A A;  1ZMG A;  2OWT A;  5FHN A;  2AYS A;  4IO4 A;  3G3H A;  3H6V A;  4AB6 A;  3A09 A;  1A55 A;  1EH3 A;  2UYE A;  1XT8 A;  3CI8 A;  4Q0C A;  4OEV A;  4ELR A;  1MPB A;  5TU0 A;  4KQP A;  3LUY A;  1LFH A;  3FGS A;  2F34 A;  2DXR A;  2XXV A;  4G68 C;  4JDF A;  1URG A;  4LP2 B;  4NF6 A;  2DWH A;  1DTZ A;  4OFL A;  3TZA A;  3VV5 A;  3VDF A;  4N6P A;  2ZYN A;  4F29 A;  3VLV A;  2CZL A;  5A5X B;  1US5 A;  4QHQ A;  1LGB C;  3PD9 A;  4QRZ A;  1S7Y A;  4M1V A;  1IIW A;  2GRV A;  3FXR A;  3VLW A;  2AL5 A;  5DVJ A;  1ATG A;  1DSN A;  3PMW A;  4TLL B;  3H6T A;  5F7V A;  1BP5 A;  2Y7K A;  1QUJ A;  4YB6 A;  1AMF A;  2RC7 A;  4HW8 A;  3MBP A;  5AA4 B;  2H25 A;  4U4X A;  1P99 A;  3PPR A;  4GF8 A;  4U23 A;  4NF5 B;  4Q30 B;  2Q8J A;  2Q88 A;  5FHO A;  4RPO A;  4G8N A;  3K2D A;  2XXY A;  3O6G A;  1MXX A;  2UVJ A;  1MH3 A;  2OK2 A;  3CVG A;  3UGW A;  1MXW A;  1SYH A;  1FQF A;  2QRY A;  2QL3 A;  2ALU A;  3MVZ A;  4F1U A;  4DCY A;  4X1B A;  4IO3 A;  4XIG Q;  2NVU B;  4F3G A;  4ZE9 A;  1N04 A;  3OSQ A;  4G2Z A;  2R6G E;  3IR1 A;  3VVD A;  2OCU A;  1SW1 A;  1MXZ A;  3IJO B;  4G77 A;  1T0K A;  4JWO A;  4GRK A;  4ND9 A;  5H8Q B;  3IJX B;  5IKB A;  1ZKB A;  1MY4 A;  2NUV A;  1B7U A;  1GTK A;  2E0S A;  1B1X A;  1Z7M E;  3TAJ A;  1I6Q A;  4QSD A;  5TP9 B;  2Q2C A;  4G4P A;  3IO4 A;  3CRB A;  3K0V A;  5EHM A;  4JXI A;  3PPN A;  1O7T A;  4MLV A;  4KYS A;  1AH5 A;  2I58 A;  1Z7N E;  4X48 A;  3QIM A;  1IXG A;  1II5 A;  2Q9T A;  2DE3 A;  5I57 B;  4DLD A;  2F36 A;  2DP8 A;  4FAT A;  2DQV A;  1MM6 A;  1TXF A;  2OLB A;  3FVK A;  3HV1 A;  2P0S A;  2P2A A;  2X7P A;  4R73 A;  5EHS A;  4OER A;  2B3B A;  3JYR A;  4E0W A;  4ZEC A;  5BWJ A;  5CBS A;  2OJT A;  1VFD A;  4XTC Q;  1B5H A;  4IO5 A;  2HCA A;  3S9M C;  3GLB A;  4JBZ A;  3JZJ A;  3K6X A;  1RYO A;  2Z8F A;  3KN3 A;  1M5E A;  2XXR A;  4EXK A;  2Y7R A;  3PUY E;  2I49 A;  5EYF A;  4OWD A;  4YIC A;  2CMO A;  3GXA A;  4DCX A;  3RPW A;  2HQ0 A;  3KEI A;  5LOM A;  4ZE8 A;  5I56 B;  3KSX A;  2RIN A;  4R2F A;  4TOZ A;  3CG1 A;  3N26 A;  2O1L A;  5DEX B;  4YKP A;  3MP8 A;  1Y3N A;  2FYI A;  4PET A;  4U1Z A;  5L9M A;  3R7X A;  1N7W A;  4WXJ A;  4F31 B;  3D4C A;  1CE2 A;  3O6I A;  3RY3 A;  3TDJ A;  4EF1 A;  3FAS A;  4H8I A;  1N0T A;  3TEL A;  4QSE A;  1P1N A;  3FUZ A;  1MXV A;  2RF1 A;  4OET A;  3H6W A;  3HHF A;  3CIJ A;  3TTR A;  2ZYO A;  4PFY A;  5H8N A;  2V3Q A;  4LON B;  2ESN A;  3K02 A;  3ONM A;  4JB7 A;  1B3E A;  1NL5 A;  4F1Y A;  1SBP A;  4U21 A;  1OVB A;  5HPQ A;  3S9L C;  3N6T A;  1MQG A;  2PVU A;  4RXL A;  1LFI A;  4R6H A;  1ZIU A;  3RN8 A;  2H4I A;  1OQH A;  1FQA A;  3SEX A;  1PB8 A;  1M5C A;  1LBB A;  1N3W A;  3VVE A;  4BDO A;  4DXU A;  1DPP A;  1XVY A;  2KLF A;  4BDM A;  1A8E A;  4OVJ A;  3TTL A;  2O1M A;  5CI5 A;  3RLF E;  4ESW A;  5AA4 A;  1MQH A;  4HCY A;  1VE4 A;  2I4C A;  1ANF A;  4FAJ A;  1ZU0 A;  1SQY A;  4H65 A;  2I48 A;  1IXH A;  3IOU A;  4FED A;  2ONK E;  5FHM A;  5I57 A;  2XXT A;  4MLQ A;  3TEP A;  5J1D A;  3Q27 A;  3TPA A;  1MG1 A;  4XXU A;  4AB5 A;  5F1Q A;  2UVG A;  4BDR A;  1N7X A;  2VP1 A;  4HCW A;  4ESX A;  1SI0 A;  1OVT A;  3H06 B;  4FEC A;  1D9Y A;  2F78 A;  3S4U A;  3THI A;  3OEN A;  1ZLQ A;  4F2Q A;  3RQT A;  2ABH A;  3KSJ A;  2QPQ A;  1M5F A;  3SEV A;  5I2K B;  3N5L A;  3O29 A;  3LSX A;  4PP0 A;  3M3F A;  4PFU A;  4YMB A;  2V93 A;  3UOR A;  1IXC A;  3KJT A;  4G68 A;  4JWX A;  1LAG E;  4RJZ A;  5ISU A;  2BJJ X;  3V89 B;  3KN8 A;  1FTO A;  3K4U A;  1AL3 A;  2QS2 A;  3E13 X;  3P7I A;  2GH9 A;  3MVX A;  4RY1 A;  4WED A;  5H8H A;  1JW1 A;  1SI1 A;  3MC2 A;  4EDP A;  3PPP A;  3KFM A;  1N76 A;  1QUL A;  4TQU Q;  3WAE A;  1J1N A;  1DOT A;  3FXU A;  1BKA A;  4RK2 A;  2Q2A A;  3FXQ A;  1HSJ A;  1B52 A;  4H8J A;  2F97 A;  4U4S A;  1N3X A;  3H7M A;  2HZL A;  1URD A;  1MM7 A;  1Y20 A;  3PPQ A;  1JQF A;  3FAT A;  4QSC A;  1Y3P A;  4ZED A;  2VGQ A;  2ZNS A;  2I3V A;  2UYF A;  1O64 A;  4IGT A;  2I0C A;  3FVN A;  4EXL A;  3KZG A;  3IK6 B;  2H98 A;  1XS5 A;  3PMX A;  2O68 A;  4JSO A;  3QUF A;  2OZZ A;  1EU8 A;  4H67 A;  2PX1 A;  1FTL A;  4YKJ A;  4U1O A;  2REJ A;  3HST A;  3MUQ A;  2QSX A;  5KCJ B;  4OHN A;  3T9H B;  4R72 A;  5AE4 A;  2D5W A;  2RC8 A;  1H3D A;  3PV0 E;  3CFZ A;  4G68 B;  5ELV A;  3FVO A;  2FNC A;  2UXA A;  2DSF A;  1JET A;  1MY3 A;  5DYH A;  3T93 B;  5JTY A;  1P1W A;  1LBC A;  1MQI A;  3H03 A;  4KPT A;  3FVG A;  4LQ2 A;  5AA1 A;  3H4Z A;  5FTI A;  2AIX A;  4OQO A;  1MDQ A;  4BDN A;  2UVH A;  4BDL A;  4HTG A;  4O3A A;  1LAX A;  1USY E;  5JTY B;  3E3K A;  1LB8 A;  1B32 A;  2VHA A;  3V5A A;  4Q8R A;  4OZ9 A;  1FCK A;  5CMC A;  4LZ5 A;  1XVX A;  4XKQ A;  1POT A;  4OES A;  3MZB A;  2ONS A;  2O69 A;  3KGC A;  2HZK A;  1B7Z A;  1GVC A;  1NNP A;  3B7D A;  1B3L A;  3KJ7 A;  1R9L A;  4H0W A;  1MQJ A;  3RNN A;  4YMA A;  3Q29 A;  2REG A;  1NKX A;  4ZEK A;  4U22 A;  1B5I A;  1QUK A;  4ZEB A;  4PQJ A;  2A5T A;  3H3G A;  4KCC A;  4LZ8 A;  3S2V A;  1LCF A;  2UVI A;  2A5S A;  3VVF A;  3N6U A;  3M3L A;  3OO8 A;  1A40 A;  2H99 A;  1Q35 A;  4RPN A;  3IB2 A;  4ZEF A;  1QVS A;  3FJG A;  1QKA A;  3EHU A;  2RCA A;  3HO7 A;  3K00 A;  4XKR A;  3MAM A;  2ZYM A;  4F19 A;  4F22 A;  4FEB A;  1NMU A;  5K2X A;  2DWA A;  1DPE A;  2F6P A;  4MBP A;  3TKD A;  4ZDM A;  3TTM A;  4EQB A;  3T96 B;  3SER A;  4E0X A;  4H5G A;  2RC9 A;  3K6W A;  4R6Y A;  5H8H B;  3FV1 A;  3RT6 B;  5KDT A;  3D4G A;  5DVI A;  3TCH A;  1O63 A;  3KOS A;  4XKP A;  1A54 A;  1SD3 A;  1TT1 A;  1P1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...