5I59A

Glutamate- and glycine-bound glun1/glun2a agonist binding domains with mpx 007
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
282
structure length
262
Chain Sequence
TRLKIVTIHQEPFVYVKPTMSDGTCVKKVICTGPHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Negative Allosteric Modulation of GluN2A-Containing NMDA Receptors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein, receptor
molecule keywords Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ion
total genus 83
structure length 262
sequence length 282
ec nomenclature
pdb deposition date 2016-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i59A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5i59A02
3IOTA 2G93A 2UYFA 4ND9A 2DE4A 1SDXA 5ITPA 1B46A 4H8JA 4LUBA 2QMXA 3T66A 1EZ9A 2XD2A 3LBSA 4MBPA 5CMMA 3N5LA 4JB7A 4N07A 3H3GA 3UK4A 1B51A 1O63A 3H6TA 2ZNTA 3PPPA 3N6TA 4I62A 2O51A 1SYIA 4H1XA 1MY2A 3HSTA 1LFIA 2I3VA 3U93A 5FHOA 1R9QA 3OD7A 1MXZA 3MUQA 2VD3A 1D9VA 2Y7RA 5IKBA 1I69A 1JETA 3EHSA 4YB5A 5ISUA 4R74A 2XD3A 4QFKA 2Q8JA 3O6GA 4H8IA 4H6DA 3VDFA 4EF2A 2F8DA 3K01A 3TCFA 3IOVA 1R6ZA 4X48A 4QSDA 3MVXA 3IJXB 1IXIA 3UGWA 1MPDA 4GD5A 4OERA 4UACA 4YAHX 4POWA 2HXWA 4YB6A 1S50A 2GFEA 1NFTA 5FTHA 3MBPA 5L9MA 1B3FA 1B32A 1J1NA 1AIVA 1YAEA 2PMSA 3T96B 2HAUA 3DELB 3G7WA 5TPAA 5I58A 4U1OA 2Y7IA 4GFRA 2QPQA 2OCUA 4NF5A 4NMYA 1GGGA 3Q27A 1PBPA 3TQWA 4G68C 3EHUA 1A99A 3RTFB 3WAFA 3JV9A 4F3BA 2DWIA 4U4SA 3H4ZA 1B7UA 4OFOA 3S9EA 1IXHA 2ZMBA 2GHAA 3FJ7A 1Y1MA 3QIMA 4NF8A 4EXLA 5B7DA 5JTYB 4ZE9A 1BIYA 1LLSA 1MY4A 1Y3NA 1US4A 3FJMA 4OWDA 3IX1A 3T93B 2I0CA 4IGTA 3I6VA 4QFLA 3E9XA 3DM0A 5CMCA 5I57B 3RT6B 1XS5A 4U2RA 3RY3A 4R6KA 3KEIA 1TT1A 1SQYA 3O2AA 3IJOB 1OQGA 1I6AA 1VFEA 4X1DA 4QHQA 4TOZA 3TZAA 4E0WA 4FAJA 2PVUA 4FEDA 5H8HA 5AA4B 2UVGA 1Y9UA 1IEJA 2KLFA 1URSA 2D3IA 1N7XA 3C32A 3IO4A 2VP1A 2PT1A 4GL0A 3RNNA 4U1ZA 1FQBA 3T22A 3PUWE 4F2QA 2I4BA 1OQHA 1QUJA 2O1LA 3DP6A 3FVOA 2F97A 3HCQA 3MWBA 4GRKA 3GBAA 4M1VA 4ZDMA 5TP9A 3PPNA 3SKPA 3VXCA 1EU8A 1DTGA 3K6XA 4DCYA 2I6EA 5BUUA 2ZYOA 4JBZA 2H99A 3QXMA 1L5TA 5CBRA 4GLIA 1AH5A 4HTGA 3BKIB 5KDTA 1B6HA 1A8FA 1P1WA 2CMOA 5K2XA 3OO7A 4ELOA 3IB2A 2UVJA 2XXYA 3K2DA 1ATGA 2ONKE 3D4CA 3HHFA 4FJPA 4JSDA 1A40A 1OLCA 1EH3A 3H06B 4F1VA 3T9XB 4ELQA 1B3EA 1B58A 4GF8A 2NUVA 4XXUA 5JEIA 2RCAA 4DCXA 2AL4A 2DYXA 4O3CA 2OLBA 3M3LA 1UIVA 3N26A 5K2YA 1FQFA 2O68A 3U92A 1RYXA 4OFLA 2R6GE 5I57A 3ZS6A 1B7HA 4DIGA 1EZPA 2A5TA 1N0TA 1MY3A 2ZYNA 5DVFA 4ELPA 3FIRA 2I58A 1N3XA 2VGQA 3MP8A 2AL5A 3FATA 1S9TA 1WDNA 2P1SA 1SYHA 1QVSA 1SW1A 2V25A 2REGA 3IO6A 3FVKA 1P1UA 3G3IA 4NF4B 1BLFA 3FJGA 2ZXTA 4R9GA 3V8XB 5BWJA 1B52A 3K1MA 4R6HA 2F36A 3L6GA 4EF1A 1JVXA 4WEPA 4M4GA 5CM6A 1TXFA 4I1DA 4RPNA 3QUFA 1QUKA 1Y20A 4OYVA 1IXGA 2I49A 5F7VA 1AL3A 5CMKA 2Y7WA 4I8CA 3SESA 1FQCA 4OHNA 4H5FA 3I3VA 1LAGE 3TQLA 2E1SA 1FQDA 3LSXA 1MXYA 1I6QA 3C33A 3OO6A 3E4RA 4LZ8A 2HZKA 4OMBA 3ZSFA 3VVDA 3CG1A 3MPKA 3GXAA 1H76A 4IGRA 4ZEIA 1FQAA 1A7LA 4YKIA 1IXCA 5DT6A 1FTJA 1NNKA 3FV2A 4EQ7A 4I9DA 2RC9A 3ONMA 5H8QB 1P1NA 3ZKLA 3L6HA 3MC2A 2VHAA 3SEXA 4RNSA 1SW4A 4ZZAA 4NE4A 5AA1A 1HSLA 1NNPA 2HCAA 4Q0CA 1P99A 4ELRA 2Q88A 2XHDA 3KSJA 3OELA 3O29A 1KWHA 3IOWA 1Q1KA 4YKKA 1MY0A 1OIBA 2O84X 4O3BA 3VVEA 4AB5A 1MDP1 2QS1A 1TFDA 2RKMA 3K6WA 4ZEKA 1YCJA 5M2VA 4ISUA 5HM4B 5ICQA 3RLFE 1ZMGA 2CZLA 2X7PA 1WODA 3SETA 3PPQA 1B1HA 2AYSA 3EF7A 4XKPA 4PFWA 1FQEA 4IO3A 3PD8A 1UTHB 4ZECA 3A09A 2V3UA 3Q29A 3GLBA 4IO5A 3ODBA 1N76A 2QS4A 3HHGA 4L17A 2QRYA 3JYRA 2WKYA 1MPCA 5I2NA 5KCJA 4ZZEA 2DOJA 2IA4A 3SEYA 3THIA 2XX8A 1SI0A 3OSRA 1LBBA 2ABHA 1ANFA 1FTLA 1FW0A 2F6PA 1XOCA 3CR9A 3FASA 3MZBA 2F5XA 4NF4A 4OETA 1B3GA 4MH5A 5HPQA 4PE5B 3S4UA 2YLNA 4RYAA 4YB7A 1IZ1A 1NL5A 4YZZA 3LC8A 1MQHA 2B65A 4GXSB 2YJPA 1LB9A 2DE2A 3B6TA 3PD9A 4MLQA 3TDJA 1NH7A 4R6YA 2YPNA 3TKDA 3TTMA 3ECRA 2QMWA 1Z7ME 2F7BA 1JEUA 3K02A 2D5WA 1MH3A 3KGCA 1H44A 4BDRA 3K00A 4DLDA 4JSOA 1SW2A 3QAXA 3OENA 3KJTA 4HCYA 3TFLA 2Q89A 3R6UA 4LQ5A 3K1PA 1YTVA 4RK9A 4BDLA 3VLVA 3EPEA 1MXUA 4JWOA 2AIXA 3C36A 3A3CA 3TAJA 2B3FA 1S7YA 3W15C 1II5A 1I6BA 3RGYA 1IITA 3MJNA 4WKMA 4RK2A 3U1OA 1SD3A 1TWYA 2DQVA 1MRPA 2I48A 3KZGA 3OXNA 1QUIA 3IK6B 4X1BA 3VFJA 4GWOA 2I0BA 2M8CA 3MW0A 1JNFA 4P11A 2QSXA 3N6UA 4KI0E 1OLAA 1PDAA 1URDA 3MP1A 4RJZA 3UIFA 5I84A 4EQ9A 4MLVA 1BTJA 1O7TA 3FUZA 1QULA 4BLAA 2O7UA 3PUYE 4R73A 2XXHA 4U21A 2DP8A 3Q26A 1PB7A 3FVNA 5L9SA 4GIZA 3M3FA 3H6UA 4BDMA 3CRBA 3KSXA 3OO9A 2XXQA 5A5XB 3N94A 3O6IA 5DEXA 1VR5A 1QJMA 5FTIA 2UVIA 4FORA 3G3JA 1GV8A 4TLLB 1XC1A 2PX1A 3T9UA 4FATA 3S9LC 5CC2A 1B3LA 1MG1A 2QL3A 2Z8FA 3K0VA 2XXWA 3G3GA 1B40A 4NWDA 4OESA 2FA7A 2ONSA 4XKQA 3LSWA 2V93A 5CI5A 3RT8A 4GXAA 4G4PA 4C1TA 4RXLA 3MQ9A 2RC8A 1PB8A 3KN7A 1SI1A 3OOAA 2X7QA 5H8HB 3VXBA 5AA4A 4N13A 4BDNA 1JW5A 1PEBA 5DVIA 4Z0IA 4LZ5A 4R2FA 3PPOA 1SW5A 2H5YA 5CBSA 5TPAB 4F3PA 5I58B 1T0KA 4OXVA 1QW0A 3OEMA 3F11A 3GBBA 5DVJA 2F7AA 3U72A 4LONB 3H03A 2OWSA 2OZZA 1MQDA 3SEVA 1TFAA 2Q2CA 1M5BA 1XT8A 1M5EA 2HQ0A 2XX7A 4G2ZA 4UA8A 5CMBA 3UP9A 2XXUA 4C0RA 3QSLA 5F1QA 5CRYA 4DXBA 4PQJA 3RN8A 1ZKBA 2ANJA 1A8EA 3BBRA 2F35A 3T9HB 4HCWA 1N04A 1MQGA 3ILTB 4OQOA 4POXA 4DXCA 3CI8A 1D4NA 5FHMA 1MPBA 3VE1B 3TTKA 1POTA 4X9TA 3UORA 4NWCA 5LOMA 2A5SA 2Y7PA 3B6QA 4F1YA 4IY5A 3FZVA 2NOOA 3IORA 1B5HA 1QKBA 3K4UA 3KN8A 1MDQA 1M5FA 1B0HA 2IEEA 2ZNSA 4OEVA 4XTCQ 1B0LA 4OVJA 2O69A 3S9NC 5H8NB 1XHYA 3IR1A 3O66A 4IO6A 1MM6A 4QRZA 4Z7EA 4Q5TA 1BP5A 3K6VA 2Z8DA 1PC3A 5DEXB 1LGBC 4KYSA 2X26A 1H45A 4OEUA 4WEDA 5AA2B 3LSFB 1URGA 2GH9A 3G3HA 2O6AA 2O1MA 4FIMA 3RTWB 4C1UA 3U94A 4KYDA 1LB8A 1OVTA 1Y4CA 3EQ1A 3TYHA 4F3GA 4FEBA 4R72A 5J1DA 3S9MC 1XVXA 1JQFA 4GVOA 1MQJA 3HV1A 1P1OA 3ZKKA 4Q30B 4ZEBA 3QK6A 3B7DA 3MVWA 4NF8B 2Z22A 3TMGA 1LSTA 4F18A 3V89B 1USYH 2E0SA 3VVFA 4F29A 5L8DA 4OFJA 1LFGA 2DXRA 3DP8A 4FECA 1UIUA 3CIJA 1ZLQA 1JEVA 4TLMB 3PUVE 4KCCA 4N6PA 4FE8A 4BDQA 1UTBB 2DXYA 4PP0A 4G8HA 4PFTA 2DVZA 3SEUA 2LAOA 4ONYA 3M3KA 4IO7A 4NTLA 3TPAA 4KD5A 3UN6A 4F2OA 5AA2A 5FHNA 5IAIA 4H5GA 3FXRA 1DPEA 4KQPA 4YU0A 4R9FA 4ESXA 2DWJA 3MZ9A 2OWTA 2XXIA 1CB6A 4IB2A 3DLNA 2NWJA 2PT2A 1M5DA 4F3SA 1WVJA 5I59A 2REJA 3CG3A 4U22A 2VOZA 4LP2B 4LQ2A 3MVZA 4EUOA 1LAFE 3V83A 3HN0A 1VE4A 1XVYA 2R71A 3VV5A 3WAEA 2HEUA 2Z8EA 3CFLA 3VLWA 4DE8A 4G68B 4IO4A 5EYFA 4NF6A 2BJJX 1UTBA 4YKPA 1DTZA 2XXVA 3C31A 3CSGA 3KOSA 3PGFA 4YICA 2H25A 1H43A 1FTKA 1B9JA 4LVQA 1ZBMA 3IB0A 4KR5A 5JTYA 1ZIUA 3PMWA 1A55A 3QUJA 3KFMA 1DMBA 3K6UA 4QSEA 3IOUA 1MH4A 2ZNUA 5TU0A 3MAMA 1Q35A 3CSBA 3LSLA 4AB6A 4F31B 4XKNA 1FTOA 3FXQA 4KCDA 2ALUA 2ONRA 4YMAA 5AA2D 2UYEA 3GZGA 3KJ7A 2V3QA 2W7YA 2HZLA 2NVUB 3KOTA 3LR1A 4EDPA 3H6VA 3MPLA 1R1NA 1SVXB 1Y3QA 2XXXA 5KCJB 3TODA 1QKAA 1R9LA 1VSOA 2Q2AA 3BFTA 3FGSA 2V3TA 4G77A 4PFYA 2XXPA 1ZU0A 1B05A 2PYYA 4IY6A 4OTEA 2Q9TA 1IIWA 3RQTA 4KPTA 3VLUA 3W9WA 5ITOA 3G3KA 2XXTA 2DSFA 3ILUB 4OZ9A 2RF1A 3RPWA 4WXJA 4DZ1A 1SBPA 3TCGA 2GHBA 2VD2A 4F1UA 1IUDA 1M5CA 2P0SA 3KBRA 2H98A 2F78A 3E13X 2V84A 3O9PA 2H4IA 3Q28A 4JWYA 4NEDA 3OO8A 3HO7A 1B3HA 2THIA 3KG2A 1MXXA 3M8UA 4YMBA 1Y3PA 4PFUA 3EHTA 2QS3A 3FXUA 4K3FA 3H7MA 4QFOA 3TCHA 5AE4A 3TTRA 5H8FB 1PB9A 1F9BA 1MY1A 1P1QA 1LFHA 3AXFA 1OVBA 2HFBA 2HAVA 1GTKA 1H3DA 2O7IA 3PUXE 4G68A 1NMUA 1OMPA 1B1XA 4QSCA 1BKAA 2B3BA 3C35A 5I2KB 4H0WA 1JW4A 2GRVA 4AQ4A 2PBWA 2F34A 4U4XA 1FCKA 4BDOA 2I4CA 2I3WA 3PMXA 3FD3A 1IQ7A 4XKRA 4JWXA 2RC7A 5DTBA 1NH8A 1DOTA 1NKXA 4R75A 1RYOA 3CFXA 5TP9B 4Q8RA 4ZEDA 3K1NA 1ZTYA 5I59B 4PETA 1LCTA 4RPOA 4JDFA 1FTMA 4F22A 1LBCA 3T9VA 3MZ1A 3PPRA 4ZE8A 1N7WA 4HS7A 4KFQA 2F6GA 3IAZA 5I56B 1AMFA 3A3UA 3R7XA 1MXVA 2Y7KA 4OENA 3SEWA 2DWAA 4THIA 1D3KA 1D9YA 1HSJA 4GQOA 3OEKA 3B6WA 2Z23A 1B5IA 4EQBA 4MFIA 1DSNA 3G3FA 4H65A 3USDA 4HW8A 5I2KA 5AA3A 2A5TB 5A5XA 3TEPA 2ESNA 3CFZA 1RKMA 4QF9A 3TUSA 1ZJLA 2XXRA 1B2HA 4GOTA 1US5A 4RA1A 1GR2A 4LATA 4XIGQ 4ECFA 1LAHE 1N3WA 3QYTA 1JVYA 4P0GA 4ZEFA 2NXOA 3TELA 1O64A 4IO2A 3PUZE 5DYHA 2DE3A 4F39A 3PU5A 3P7IA 3FVGA 1A54A 1DPPA 2G29A 3DP4A 3MP6A 1MXWA 4DDDA 5KZTA 2OBGA 4H67A 3C9HA 4NF5B 2DS9A 2H9BA 2R9JA 3R26A 1JW1A 4DXUA 5JK4A 1B4ZA 1NNFA 2RCBA 5KDTB 3BFUA 1UQWA 5EHMA 4QFPA 3V5AA 1B4HA 4JXIA 3IB1A 3HPIA 3JZJA 3O28A 2UVHA 5H8NA 3SDFA 4P0IA 5I2NB 5H8FA 3CVGA 1B7ZA 2DVCA 1YPNA 2XX9A 1N84A 1POY1 1VFDA 4LZ7A 1Y4TA 2FNCA 3PMVA 4QFNA 1MQIA 4G8NA 5B70A 1AOVA 1B5JA 2OK2A 1USYE 3KN3A 3Q25A 4YKJA 1MM7A 2DWHA 1HSEA 5H8QA 3MVYA 3RUMA 3UA8A 2QJEA 3SERA 4NF6B 4EXKA 2ZYKA 3O97A 4R2BA 3TTNA 4O3AA 5H8SA 2UXAA 3C4MA 3D4GA 4MF3A 2ZYMA 4KYEA 3U8QA 3W9VA 1GVCA 1Z7NE 5L9OA 5HBCA 1MS7A 4G8MA 2FYIA 4U23A 1CE2A 3LUYA 4ZS9A 2QS2A 3O6HA 2RINA 1LCFA 3H6WA 3PV0E 4KHZE 4TQUQ 1ELJA 2P2AA 3I5OA 1Y1ZA 5I56A 1EZOA 4F19A 4ESWA 4GL8A 1NNTA 3IL1B 5ICTA 3EN3A 2F7CA 2OJTA 2Y84A 3FV1A 3OSQA 3TTLA 1PBQA 3E3KA 1LAXA 2D21A 4LA9A 3OMBA 3S2VA 5EHSA 4E0XA 3C34A 1UTHA 5ELVA 4RY1A
chains in the Genus database with same CATH superfamily
4N17A 3IOTA 2UYFA 2DE4A 5ITPA 2CZHA 3T66A 5CMMA 4N4UA 3UK4A 1B51A 4I62A 2O51A 4N91A 5FHOA 1MXZA 3MUQA 1I69A 1JETA 4YB5A 5ISUA 4H8IA 1Q9DA 4YAHX 1IMDA 4POWA 1S50A 5FTHA 1B3FA 1YAEA 2HAUA 5TPAA 3EHUA 1A99A 3WAFA 4P9KA 3H4ZA 4NAPA 4OFOA 2GHAA 1Y1MA 4P8BA 3T93B 3FXBA 4H45A 4R6KA 1LBVA 3O2AA 1OQGA 3TZAA 4TOZA 4FEDA 5AA4B 2UVGA 2PFYA 2D3IA 3IO4A 2VP1A 3PUWE 3HCQA 3SKPA 1EU8A 1DTGA 4PBHA 2ZYOA 1L5TA 4GLIA 3BKIB 3K2DA 1ATGA 2ONKE 3D4CA 2P3VA 4FJPA 1IMFA 1OLCA 1B3EA 4GF8A 2RCAA 2DYXA 4P47A 1B7HA 1MY3A 2ZYNA 5DVFA 2I58A 1N3XA 3FATA 1S9TA 2P1SA 1SYHA 1SW1A 4NF4B 3IO6A 3FVKA 4R9GA 1NV4A 4I1DA 3QUFA 1IXGA 2DDKA 5CMKA 1FQCA 2HZKA 1NUXA 4IGRA 4EQ7A 3ONMA 1P1NA 5AA1A 1HSLA 2HCAA 4Q0CA 4ELRA 3O29A 5I7IA 1MDP1 1TFDA 5ICQA 1BK4A 2X7PA 4XKPA 2Y5LA 2QS4A 1QGXA 5KCJA 2ABHA 3MZBA 1FTLA 1FW0A 1XOCA 2BJIA 2F5XA 4OETA 1B3GA 4MH5A 5HPQA 2YLNA 4RYAA 4GXSB 1MQHA 3TDJA 3B6TA 3PD9A 3TTMA 2YPNA 1H44A 1SW2A 2GQ1A 3K1PA 1DK4A 4OVQA 3VLVA 1RDXA 1MXUA 4JWOA 2AIXA 3TAJA 3W15C 3U1OA 1IITA 1SD3A 2DQVA 1MRPA 1QUIA 3FBPA 5LDZA 2M8CA 3N6UA 4KI0E 1URDA 2Q74A 5I84A 1BTJA 3FUZA 1QULA 4GX3A 4R73A 2XXHA 1PB7A 3H6UA 2XXQA 1NUWA 3O6IA 3G3JA 4FATA 2PX1A 2Z8FA 3G3GA 4NWDA 4XKQA 5CI5A 4P3LA 3LSWA 4G4PA 1SI1A 4PFRA 5CBSA 3KC1A 3A29A 1QW0A 5DVJA 3U72A 4LONB 1MQDA 2Q2CA 2HHMA 4XFEA 3QSLA 3KBZA 5CRYA 4DXBA 4PQJA 1ZKBA 3BBRA 3T9HB 3ILTB 1MQGA 4I3EA 1MPBA 3VE1B 3B6QA 4F1YA 4IY5A 5DVIA 4XTCQ 2IEEA 4O7IA 4OEVA 4OVJA 2O69A 4IO6A 4Z7EA 4HE2A 3K6VA 4KYSA 4MMPA 3LSFB 4C1UA 3U94A 4KYDA 3TYHA 3S9MC 4FEBA 1XVXA 2WEFA 4GVOA 1YZ0A 1P1OA 1FJ9A 3QK6A 3MVWA 4NF8B 1LSTA 2E0SA 1JEVA 4NGUA 4KCCA 4PFTA 3SEUA 4ONYA 2CEYA 4NTLA 5FHNA 2PT2A 1M5DA 4X8RA 3V83A 3MSTA 1VE4A 5IZ3B 3VV5A 2HEUA 2Z8EA 3CFLA 3VLWA 1UTBA 3PGFA 5TU0A 3IOUA 1MH4A 3FXQA 4KCDA 2ALUA 3GZGA 2NVUB 2L5VA 3MPLA 4MX6A 1Y3QA 5KCJB 4G77A 2XXKA 1ZU0A 2R8TA 3G3KA 1G0HA 1IUDA 2P0SA 3KBRA 2H98A 3Q28A 1MXXA 4YMBA 4PFUA 3FXUA 2HXRA 1KZ8A 1F9BA 1MY1A 1PB9A 1OVBA 1H3DA 2O7IA 5DW8A 2F3DA 1JW4A 2GRVA 2I4CA 5DTBA 1NKXA 3CFXA 4ZEDA 4HXVA 1ZTYA 5I59B 1FTMA 1LBCA 3MZ1A 1AMFA 3A3UA 2Y7KA 2Z23A 5EQ7A 1RKMA 5I5PA 1ZJLA 4ECFA 1LAHE 1N3WA 3QYTA 1JVYA 2NXOA 2FVZA 4MAGA 3P7IA 1DPPA 3DP4A 3MP6A 2OBGA 4NF5B 2R9JA 1JW1A 3SZPA 5EHMA 3IB1A 3HPIA 5I2NB 2FNCA 2FIEA 5I3SA 1USYE 3Q25A 2DWHA 1JP4A 3MVYA 5H8SA 2ZYMA 5EQAA 3W9VA 3B8BA 5L9OA 4G8MA 2FYIA 4TQUQ 1LCFA 4MIJA 5I56A 2P2AA 1Y1ZA 1NNTA 5ICTA 3EN3A 1PBQA 4GWXA 1LAXA 3T1BA 4E0XA 5ELVA 4O94A 1INPA 2G93A 4H8JA 1O63A 2MKZA 1K9ZA 3N6TA 4X04A 1SYIA 2I3VA 3U93A 3OD7A 4PAIA 1D9VA 2Y7RA 3EHSA 2F8DA 3IOVA 4X48A 4QSDA 4OERA 2HXWA 5EQ9A 4YB6A 4GWWA 1AIVA 2PMSA 3T96B 3G7WA 2Y7IA 4NF5A 2CZIA 3RPLB 2CEXA 3RTFB 4F3BA 2DWIA 1NV3A 4N8YA 1IXHA 2ZMBA 4NF8A 5B7DA 1LLSA 1FBEA 5F24A 1Y3NA 2I0CA 2V4CA 3DM0A 3RT6B 4U2RA 4X1DA 3IJOB 4QHQA 4E0WA 5H8HA 1Y9UA 2KLFA 1URSA 1FQBA 1OQHA 3MWBA 2O1LA 3S9EA 1FSAA 2F97A 2I6EA 5BUUA 4PFBA 2OX3A 4HTGA 1B6HA 1P1WA 5ET8A 3MYUA 1EH3A 4F1VA 3T9XB 4ELQA 1B58A 4XXUA 2OLBA 3M3LA 1FQFA 4OFLA 4LN5A 4DIGA 3FIRA 2REGA 1LEVA 1P1UA 3G3IA 1BLFA 2XWKA 2ZXTA 3FJGA 4R6HA 3L6GA 4EF1A 1JVXA 5CM6A 1TXFA 1QUKA 1Y20A 2XWVA 4OYVA 5F7VA 4I8CA 3SESA 1LAGE 1FQDA 3LSXA 1I6QA 4LZ8A 3ZSFA 4OMBA 3VVDA 3MPKA 1A7LA 1IXCA 2VPOA 3ZKLA 2VHAA 1SW4A 1NNPA 2Q88A 2XHDA 1KA1A 1OIBA 4O3BA 5HM4B 1ZMGA 2CZLA 3PPQA 4IO3A 1UTHB 3HHGA 2QRYA 2VPNA 5EQ8A 3SEYA 2IA4A 2XX8A 3E78A 1ANFA 3CR9A 3S4UA 2FIXA 1IZ1A 4YZZA 3LC8A 4MLQA 5JK4A 3PTYA 1LB9A 1NH7A 2JJKA 3ECRA 1JEUA 3K02A 1MH3A 4BDRA 4JSOA 3QAXA 1NV7A 3TFLA 4RK9A 4BDLA 4QBAA 3C36A 1I6BA 3RGYA 3MJNA 4RK2A 1IMCA 3VFJA 3IK6B 1KA0A 4X1BA 4GWOA 4N15A 2QSXA 3UIFA 4NX1A 4EQ9A 2O7UA 2DP8A 3Q26A 3M3FA 4BDMA 3CRBA 3OO9A 5A5XB 1QJMA 1GV8A 2XXWA 2ONSA 5J16A 3MQ9A 1PB8A 2X7QA 5H8HB 4BDNA 1JW5A 1PEBA 4Z0IA 4R2FA 4AS4A 5I58B 4OXVA 2F7AA 3H03A 2OWSA 4PBQA 3SEVA 1FTAA 1M5EA 2HQ0A 1FPKA 2FBPA 2F3BA 1FBPA 3RN8A 3RPLA 2F35A 1N04A 1D4NA 4FBPA 3TTKA 1POTA 3UORA 5LOMA 1YYZA 2A5SA 2NOOA 3IORA 1M5FA 1B0HA 2B4MA 2ZNSA 1B0LA 5H8NB 1XHYA 3O66A 4Q5TA 1URGA 2O6AA 3EQ1A 2HPGA 1MQJA 3HV1A 3B7DA 1USYH 1LFGA 4FE8A 4BDQA 4G8HA 4F2OA 5AA2A 5IAIA 4KQPA 4R9FA 4ESXA 2OWTA 1CB6A 4PTKA 4N6KA 4F3SA 1WVJA 2REJA 2VOZA 2WYKA 4P1LA 4EUOA 3HN0A 1XVYA 2R71A 4DE8A 4IO4A 5EYFA 4OA4A 4YKPA 3CSGA 3KOSA 2H25A 1FTKA 1B9JA 3IB0A 4KR5A 4QSEA 1Q35A 3CSBA 4YMAA 5AA2D 2HZLA 3KOTA 4EDPA 3IFCA 3TODA 3BFTA 4GWYA 2V3TA 4OVTA 1B05A 4IY6A 2Q9TA 1IIWA 4KPTA 4MNPA 3ILUB 2RF1A 4WXJA 1SBPA 3NOHA 2F78A 3E13X 2H4IA 5IGAA 3OO8A 3KG2A 1Y3PA 4QFOA 4K3FA 3H7MA 2HAVA 1GTKA 4G68A 1NMUA 1OMPA 1B1XA 4PDHA 4U4XA 1FCKA 2I3WA 1XI6A 4XKRA 1NH8A 3K1NA 4PETA 5FBPA 1LCTA 4F22A 4OANA 3PPRA 1LBWA 1D9YA 4GQOA 3USDA 4HW8A 5AA3A 5A5XA 3CFZA 4XIGQ 1US5A 1GR2A 4IO2A 1MXWA 4DDDA 1NI9A 2DS9A 1B4ZA 2RCBA 5KDTB 4JXIA 2WBBA 2UVHA 3SDFA 2Y5KA 2DVCA 1VFDA 1Y4TA 4QFNA 1MQIA 4G8NA 1AOVA 5H8QA 3IFAA 4NG7A 3RUMA 1YXIA 2QJEA 2ZYKA 4R2BA 3TTNA 2UXAA 4GWUA 2VT5A 4MF3A 5IZ3A 2PCRA 1Z7NE 4U23A 2RINA 1LBZA 4ESWA 4PE3A 2OJTA 3TTLA 3E3KA 2D21A 3OMBA 5EHSA 1UTHA 4ND9A 1FPBA 1EZ9A 2XD2A 3LBSA 4MBPA 3N5LA 1LBYA 4JB7A 2WX9A 3H6TA 5EYGA 1MY2A 3HSTA 1LFIA 1R9QA 2VD3A 4O7MA 4R74A 2XD3A 3O6GA 4EF2A 3VDFA 5ET7A 3TCFA 1R6ZA 3UGWA 1MPDA 1VDWA 4GD5A 4NHBA 2GFEA 1K9YA 4JVDA 2XWOA 5L9MA 3DELB 5I58A 1FPJA 4NMYA 4GFRA 1GGGA 3Q27A 1PBPA 3TQWA 4G68C 4MHFA 3JV9A 1NV2A 4NF0A 3QIMA 5JTYB 1MY4A 1US4A 3FJMA 4OWDA 5IM2A 4IGTA 5CMCA 3RY3A 1TT1A 1I6AA 1VFEA 2QVUA 2QVRA 4FAJA 1IEJA 4GL0A 4F2QA 1QUJA 4ZDMA 5TP9A 3GBAA 4NN3A 3K6XA 1FPEA 1A8FA 5K2XA 4ELOA 3OO7A 2ZZVA 4XF5A 2XXYA 4PCDA 4PDDA 2XWIA 3H06B 5JEIA 1RYXA 1EZPA 2A5TA 1N0TA 2VGQA 2AL5A 1WDNA 4EXLA 5BWJA 2F36A 4WEPA 4M4GA 4NQ8A 4H5FA 2E1SA 2QVVA 3C33A 3OO6A 3E4RA 4GWZA 1FQAA 4YKIA 5DT6A 5LTCA 1NNKA 3FV2A 5H8QB 3L6HA 3SEXA 4NE4A 1P99A 3KSJA 3OELA 3IOWA 5ET6A 1MY0A 4AB5A 2RKMA 3K6WA 1YCJA 4ISUA 3RLFE 3EF7A 4ZECA 3A09A 1IMBA 4HE1A 2WKYA 4ZZEA 2DOJA 1SI0A 3OSRA 1LBBA 2F6PA 3FASA 4HE0A 4AS5A 2B65A 3CHGA 4PGPA 1Z7ME 2D5WA 3OENA 4IR8A 4HCYA 2Q89A 3R6UA 3EPEA 4GBVA 1DCUA 3A3CA 2B3FA 1II5A 4WKMA 1TWYA 3OXNA 3KZGA 5EYHA 1FPFA 2I0BA 3MW0A 4N6DA 4P11A 1JNFA 3LUZA 4RJZA 4MLVA 4U21A 5L9SA 4GIZA 3KSXA 1RDYA 5FTIA 4FORA 4TLLB 5CC2A 2QL3A 4OESA 1B40A 4GXAA 3KN7A 5AA4A 4F3PA 3OEMA 3F11A 2OZZA 4DI4B 1TFAA 1M5BA 2XX7A 5CMBA 3UP9A 5F1QA 1NV5A 4I3YA 4PFIA 2ANJA 1DBZA 4OQOA 4DXCA 4POXA 4X9TA 2Y7PA 3FZVA 4H46A 1QKBA 3KN8A 1MDQA 3S9NC 3IR1A 1MM6A 5DEXB 1LGBC 2X26A 1H45A 5AA2B 3G3HA 2O1MA 5J1DA 1LB8A 1OVTA 4F3GA 1FBHA 4JVCA 3ZKKA 1G0IA 2Z22A 3TMGA 3V89B 5L8DA 4OFJA 3DP8A 2DXRA 1ZLQA 4TLMB 4N6PA 1UTBB 2DXYA 4GX4A 2DVZA 2LAOA 3M3KA 4IO7A 3TPAA 3UN6A 4KD5A 4H5GA 3FXRA 4YU0A 2DWJA 2XXIA 3DLNA 2FHYA 1NUZA 1D9QA 4LP2B 4LQ2A 1LAFE 2KQZA 3WAEA 4G68B 2BJJX 4I40A 1DTZA 4LVQA 4P56A 1FJ6A 5JTYA 1ZIUA 3PMWA 4MJOA 3LV0A 1FBCA 4AB6A 4XKNA 2ONRA 3QMFA 2V3QA 2W7YA 3LR1A 3H6VA 4PAFA 1SVXB 1VSOA 2Q2AA 4PFYA 3EKIA 4OTEA 3RQTA 3VLUA 4PC9A 2XXTA 2DSFA 3RPWA 2GHBA 4F1UA 5I57B 3O9PA 3HO7A 5A5LA 3M8UA 3TCHA 2PFZA 5H8FB 1P1QA 4QXDA 3PUXE 3C35A 2B3BA 5I2KB 4H0WA 4AQ4A 2PBWA 3B50A 3FD3A 1IQ7A 4XEQA 2RC7A 4R75A 1RYOA 4ZE8A 1N7WA 4HS7A 4KFQA 2F6GA 3R7XA 1FBDA 3SEWA 4THIA 1D3KA 3B6WA 1B5IA 4EQBA 1RDZA 4MFIA 1DSNA 3G3FA 4G61A 2A5TB 3TEPA 3TUSA 4GOTA 2XXRA 1B2HA 4RA1A 4P1EA 4LATA 3PUZE 2DE3A 4F39A 1A54A 1FPGA 5KZTA 4H67A 1NNFA 3V5AA 3JZJA 3O28A 5H8NA 5H8FA 3ISPA 4LZ7A 1EYKA 3PMVA 1NV1A 1B5JA 2OK2A 3KN3A 5B70A 4YKJA 1MM7A 1HSEA 3UA8A 3SERA 4NF6B 4O3AA 1NV6A 1CE2A 3LUYA 4ZS9A 3O6HA 5HBCA 3H6WA 3I5OA 2XA5A 4F19A 4PAKA 3OSQA 2F7CA 3FV1A 4LA9A 2Q8MA 3E79A 3C34A 4RY1A 2WYPA 4MEVA 1FPIA 1SDXA 1B46A 4LUBA 2QMXA 3D1RA 2QFLA 1SPIA 4N07A 3H3GA 2ZNTA 3PPPA 4H1XA 2ZZWA 5IKBA 2Q8JA 4QFKA 1FPDA 4H6DA 3K01A 3MVXA 3IJXB 1IXIA 4UACA 1NFTA 3MBPA 1B32A 1J1NA 1FBFA 4U1OA 2QPQA 2OCUA 2P3NA 1AWBA 4PGNA 5IZ1A 4N81A 4U4SA 1B7UA 3FJ7A 4ZE9A 1BIYA 3IX1A 3I6VA 4QFLA 3E9XA 1XS5A 5ET5A 3KEIA 5ESYA 1SQYA 2PVUA 1N7XA 3C32A 2PT1A 3RNNA 4U1ZA 3T22A 2I4BA 3DP6A 3FVOA 4GRKA 4M1VA 3VXCA 3PPNA 4KXPA 4DCYA 4UABA 4JBZA 2H99A 3QXMA 5T3JA 5CBRA 5KDTA 1AH5A 2CMOA 3IB2A 2UVJA 3HHFA 4JSDA 1A40A 2NUVA 4DCXA 2AL4A 4O3CA 5K2YA 1UIVA 3N26A 4DI3D 2O68A 3U92A 2R6GE 5I57A 3ZS6A 4ELPA 3MP8A 2V25A 1QVSA 3V8XB 1FRPA 1B52A 3K1MA 4RPNA 2I49A 1AL3A 2Y7WA 4OHNA 3I3VA 3TQLA 1MXYA 3BIGA 3CG1A 3GXAA 1H76A 4ZEIA 1FTJA 4I9DA 2RC9A 3MC2A 4RNSA 4ZZAA 1KWHA 1Q1KA 2KR0A 4YKKA 2O84X 3VVEA 2QS1A 4ZEKA 5M2VA 1WODA 3SETA 1B1HA 2AYSA 4PFWA 1FQEA 3PD8A 2V3UA 3Q29A 3GLBA 4IO5A 3ODBA 1N76A 4L17A 5IZZA 3JYRA 1MPCA 1FPLA 2WBDA 3THIA 4NF4A 4PE5B 4YB7A 1NL5A 2YJPA 2DE2A 3TKDA 4R6YA 2QMWA 2F7BA 3KGCA 3K00A 4DLDA 3RYDA 3KJTA 4LQ5A 1YTVA 1IMEA 1S7YA 1EYIA 2I48A 4GX6A 1OLAA 1PDAA 3MP1A 1O7TA 4BLAA 3PUYE 3FVNA 4MNCA 3N94A 5DEXA 1VR5A 2UVIA 1EZOA 3T9UA 1XC1A 3S9LC 1B3LA 1MG1A 3K0VA 3KC0A 3RT8A 2FA7A 2V93A 4C1TA 4RXLA 2RC8A 3OOAA 3VXBA 4N13A 3ROJA 4LZ5A 3PPOA 1SW5A 2H5YA 5TPAB 1T0KA 3GBBA 4OVRA 1XT8A 4G2ZA 4UA8A 2XXUA 4C0RA 4OVSA 1A8EA 2B4LA 4JVIA 4HCWA 3CI8A 5FHMA 2OWZA 4NWCA 2CZKA 1B5HA 3K4UA 5I2NA 4QRZA 1BP5A 2Z8DA 1PC3A 4MNIA 4OEUA 4WEDA 2GH9A 3RTWB 4FIMA 1Y4CA 3U65A 4R72A 1JQFA 4Q30B 4ZEBA 4F18A 4GBWA 4PF8A 3VVFA 4F29A 4FECA 1UIUA 3CIJA 3PUVE 1FBGA 4PP0A 3BIHA 1DPEA 3MZ9A 4IB2A 1NV0A 2NWJA 5I59A 3CG3A 4U22A 3MVZA 4O8MA 4NF6A 2XXVA 4YICA 3C31A 1H43A 1ZBMA 3QUJA 1A55A 3KFMA 4GWSA 1DMBA 3K6UA 4N8GA 2ZNUA 3MAMA 3LSLA 4F31B 1FTOA 2UYEA 1IMAA 3KJ7A 3HFUA 1R1NA 2XXXA 1QKAA 1R9LA 3FGSA 2XXPA 2PYYA 3W9WA 5ITOA 4OZ9A 4DZ1A 3TCGA 2VD2A 1M5CA 2V84A 4JWYA 4NEDA 1B3HA 2THIA 1NUYA 3EHTA 2QS3A 5AE4A 3TTRA 1LFHA 3AXFA 2HFBA 4QSCA 1BKAA 2F34A 4BDOA 3PMXA 4JWXA 1DOTA 5TP9B 4Q8RA 4RPOA 4JDFA 3T9VA 3IAZA 5I56B 1MXVA 4OENA 2DWAA 1HSJA 1CNQA 3OEKA 4H65A 5I2KA 2ESNA 4QF9A 4P0GA 4ZEFA 3TELA 1O64A 4PF6A 5DYHA 3PU5A 3FVGA 2G29A 3C9HA 2H9BA 4DXUA 2ZZXA 3R26A 4MCOA 3BFUA 1UQWA 4OVPA 4QFPA 1B4HA 4P0IA 3CVGA 1B7ZA 1YPNA 2XX9A 1N84A 1POY1 1LBXA 3GYYA 4EXKA 3O97A 3C4MA 3D4GA 4KYEA 3U8QA 1GVCA 3T0JA 1MS7A 2QS2A 3PV0E 4KHZE 1ELJA 1EYJA 4GL8A 3IL1B 2Y84A 3S2VA
chains in the Genus database with same CATH topology
3IOTA 2G93A 2UYFA 4ND9A 2DE4A 1SDXA 5ITPA 1B46A 4H8JA 4LUBA 2QMXA 3T66A 1EZ9A 2XD2A 3LBSA 4MBPA 5CMMA 3N5LA 4JB7A 4N07A 3H3GA 3UK4A 1B51A 1O63A 3H6TA 2ZNTA 3PPPA 3N6TA 4I62A 2O51A 1SYIA 4H1XA 1MY2A 3HSTA 1LFIA 2I3VA 3U93A 5FHOA 1R9QA 3OD7A 1MXZA 3MUQA 2VD3A 1D9VA 2Y7RA 5IKBA 1I69A 1JETA 3EHSA 4YB5A 5ISUA 4R74A 2XD3A 4QFKA 2Q8JA 3O6GA 4H8IA 4H6DA 3VDFA 4EF2A 2F8DA 3K01A 3TCFA 3IOVA 1R6ZA 4X48A 4QSDA 3MVXA 3IJXB 1IXIA 3UGWA 1MPDA 4GD5A 4OERA 4UACA 4YAHX 4POWA 2HXWA 4YB6A 1S50A 2GFEA 1NFTA 5FTHA 3MBPA 5L9MA 1B3FA 1B32A 1J1NA 1AIVA 1YAEA 2PMSA 3T96B 2HAUA 3DELB 3G7WA 5TPAA 5I58A 4U1OA 2Y7IA 4GFRA 2QPQA 2OCUA 4NF5A 4NMYA 1GGGA 3Q27A 1PBPA 3TQWA 4G68C 3EHUA 1A99A 3RTFB 3WAFA 3JV9A 4F3BA 2DWIA 4U4SA 3H4ZA 1B7UA 4OFOA 3S9EA 1IXHA 2ZMBA 2GHAA 3FJ7A 1Y1MA 3QIMA 4NF8A 4EXLA 5B7DA 5JTYB 4ZE9A 1BIYA 1LLSA 1MY4A 1Y3NA 1US4A 3FJMA 4OWDA 3IX1A 3T93B 2I0CA 4IGTA 3I6VA 4QFLA 3E9XA 3DM0A 5CMCA 5I57B 3RT6B 1XS5A 4U2RA 3RY3A 4R6KA 3KEIA 1TT1A 1SQYA 3O2AA 3IJOB 1OQGA 1I6AA 1VFEA 4X1DA 4QHQA 4TOZA 3TZAA 4E0WA 4FAJA 2PVUA 4FEDA 5H8HA 5AA4B 2UVGA 1Y9UA 1IEJA 2KLFA 1URSA 2D3IA 1N7XA 3C32A 3IO4A 2VP1A 2PT1A 4GL0A 3RNNA 4U1ZA 1FQBA 3T22A 3PUWE 4F2QA 2I4BA 1OQHA 1QUJA 2O1LA 3DP6A 3FVOA 2F97A 3HCQA 3MWBA 4GRKA 3GBAA 4M1VA 4ZDMA 5TP9A 3PPNA 3SKPA 3VXCA 1EU8A 1DTGA 3K6XA 4DCYA 2I6EA 5BUUA 2ZYOA 4JBZA 2H99A 3QXMA 1L5TA 5CBRA 4GLIA 1AH5A 4HTGA 3BKIB 5KDTA 1B6HA 1A8FA 1P1WA 2CMOA 5K2XA 3OO7A 4ELOA 3IB2A 2UVJA 2XXYA 3K2DA 1ATGA 2ONKE 3D4CA 3HHFA 4FJPA 4JSDA 1A40A 1OLCA 1EH3A 3H06B 4F1VA 3T9XB 4ELQA 1B3EA 1B58A 4GF8A 2NUVA 4XXUA 5JEIA 2RCAA 4DCXA 2AL4A 2DYXA 4O3CA 2OLBA 3M3LA 1UIVA 3N26A 5K2YA 1FQFA 2O68A 3U92A 1RYXA 4OFLA 2R6GE 5I57A 3ZS6A 1B7HA 4DIGA 1EZPA 2A5TA 1N0TA 1MY3A 2ZYNA 5DVFA 4ELPA 3FIRA 2I58A 1N3XA 2VGQA 3MP8A 2AL5A 3FATA 1S9TA 1WDNA 2P1SA 1SYHA 1QVSA 1SW1A 2V25A 2REGA 3IO6A 3FVKA 1P1UA 3G3IA 4NF4B 1BLFA 3FJGA 2ZXTA 4R9GA 3V8XB 5BWJA 1B52A 3K1MA 4R6HA 2F36A 3L6GA 4EF1A 1JVXA 4WEPA 4M4GA 5CM6A 1TXFA 4I1DA 4RPNA 3QUFA 1QUKA 1Y20A 4OYVA 1IXGA 2I49A 5F7VA 1AL3A 5CMKA 2Y7WA 4I8CA 3SESA 1FQCA 4OHNA 4H5FA 3I3VA 1LAGE 3TQLA 2E1SA 1FQDA 3LSXA 1MXYA 1I6QA 3C33A 3OO6A 3E4RA 4LZ8A 2HZKA 4OMBA 3ZSFA 3VVDA 3CG1A 3MPKA 3GXAA 1H76A 4IGRA 4ZEIA 1FQAA 1A7LA 4YKIA 1IXCA 5DT6A 1FTJA 1NNKA 3FV2A 4EQ7A 4I9DA 2RC9A 3ONMA 5H8QB 1P1NA 3ZKLA 3L6HA 3MC2A 2VHAA 3SEXA 4RNSA 1SW4A 4ZZAA 4NE4A 5AA1A 1HSLA 1NNPA 2HCAA 4Q0CA 1P99A 4ELRA 2Q88A 2XHDA 3KSJA 3OELA 3O29A 1KWHA 3IOWA 1Q1KA 4YKKA 1MY0A 1OIBA 2O84X 4O3BA 3VVEA 4AB5A 1MDP1 2QS1A 1TFDA 2RKMA 3K6WA 4ZEKA 1YCJA 5M2VA 4ISUA 5HM4B 5ICQA 3RLFE 1ZMGA 2CZLA 2X7PA 1WODA 3SETA 3PPQA 1B1HA 2AYSA 3EF7A 4XKPA 4PFWA 1FQEA 4IO3A 3PD8A 1UTHB 4ZECA 3A09A 2V3UA 3Q29A 3GLBA 4IO5A 3ODBA 1N76A 2QS4A 3HHGA 4L17A 2QRYA 3JYRA 2WKYA 1MPCA 5I2NA 5KCJA 4ZZEA 2DOJA 2IA4A 3SEYA 3THIA 2XX8A 1SI0A 3OSRA 1LBBA 2ABHA 1ANFA 1FTLA 1FW0A 2F6PA 1XOCA 3CR9A 3FASA 3MZBA 2F5XA 4NF4A 4OETA 1B3GA 4MH5A 5HPQA 4PE5B 3S4UA 2YLNA 4RYAA 4YB7A 1IZ1A 1NL5A 4YZZA 3LC8A 1MQHA 2B65A 4GXSB 2YJPA 1LB9A 2DE2A 3B6TA 3PD9A 4MLQA 3TDJA 1NH7A 4R6YA 2YPNA 3TKDA 3TTMA 3ECRA 2QMWA 1Z7ME 2F7BA 1JEUA 3K02A 2D5WA 1MH3A 3KGCA 1H44A 4BDRA 3K00A 4DLDA 4JSOA 1SW2A 3QAXA 3OENA 3KJTA 4HCYA 3TFLA 2Q89A 3R6UA 4LQ5A 3K1PA 1YTVA 4RK9A 4BDLA 3VLVA 3EPEA 1MXUA 4JWOA 2AIXA 3C36A 3A3CA 3TAJA 2B3FA 1S7YA 3W15C 1II5A 1I6BA 3RGYA 1IITA 3MJNA 4WKMA 4RK2A 3U1OA 1SD3A 1TWYA 2DQVA 1MRPA 2I48A 3KZGA 3OXNA 1QUIA 3IK6B 4X1BA 3VFJA 4GWOA 2I0BA 2M8CA 3MW0A 1JNFA 4P11A 2QSXA 3N6UA 4KI0E 1OLAA 1PDAA 1URDA 3MP1A 4RJZA 3UIFA 5I84A 4EQ9A 4MLVA 1BTJA 1O7TA 3FUZA 1QULA 4BLAA 2O7UA 3PUYE 4R73A 2XXHA 4U21A 2DP8A 3Q26A 1PB7A 3FVNA 5L9SA 4GIZA 3M3FA 3H6UA 4BDMA 3CRBA 3KSXA 3OO9A 2XXQA 5A5XB 3N94A 3O6IA 5DEXA 1VR5A 1QJMA 5FTIA 2UVIA 4FORA 3G3JA 1GV8A 4TLLB 1XC1A 2PX1A 3T9UA 4FATA 3S9LC 5CC2A 1B3LA 1MG1A 2QL3A 2Z8FA 3K0VA 2XXWA 3G3GA 1B40A 4NWDA 4OESA 2FA7A 2ONSA 4XKQA 3LSWA 2V93A 5CI5A 3RT8A 4GXAA 4G4PA 4C1TA 4RXLA 3MQ9A 2RC8A 1PB8A 3KN7A 1SI1A 3OOAA 2X7QA 5H8HB 3VXBA 5AA4A 4N13A 4BDNA 1JW5A 1PEBA 5DVIA 4Z0IA 4LZ5A 4R2FA 3PPOA 1SW5A 2H5YA 5CBSA 5TPAB 4F3PA 5I58B 1T0KA 4OXVA 1QW0A 3OEMA 3F11A 3GBBA 5DVJA 2F7AA 3U72A 4LONB 3H03A 2OWSA 2OZZA 1MQDA 3SEVA 1TFAA 2Q2CA 1M5BA 1XT8A 1M5EA 2HQ0A 2XX7A 4G2ZA 4UA8A 5CMBA 3UP9A 2XXUA 4C0RA 3QSLA 5F1QA 5CRYA 4DXBA 4PQJA 3RN8A 1ZKBA 2ANJA 1A8EA 3BBRA 2F35A 3T9HB 4HCWA 1N04A 1MQGA 3ILTB 4OQOA 4POXA 4DXCA 3CI8A 1D4NA 5FHMA 1MPBA 3VE1B 3TTKA 1POTA 4X9TA 3UORA 4NWCA 5LOMA 2A5SA 2Y7PA 3B6QA 4F1YA 4IY5A 3FZVA 2NOOA 3IORA 1B5HA 1QKBA 3K4UA 3KN8A 1MDQA 1M5FA 1B0HA 2IEEA 2ZNSA 4OEVA 4XTCQ 1B0LA 4OVJA 2O69A 3S9NC 5H8NB 1XHYA 3IR1A 3O66A 4IO6A 1MM6A 4QRZA 4Z7EA 4Q5TA 1BP5A 3K6VA 2Z8DA 1PC3A 5DEXB 1LGBC 4KYSA 2X26A 1H45A 4OEUA 4WEDA 5AA2B 3LSFB 1URGA 2GH9A 3G3HA 2O6AA 2O1MA 4FIMA 3RTWB 4C1UA 3U94A 4KYDA 1LB8A 1OVTA 1Y4CA 3EQ1A 3TYHA 4F3GA 4FEBA 4R72A 5J1DA 3S9MC 1XVXA 1JQFA 4GVOA 1MQJA 3HV1A 1P1OA 3ZKKA 4Q30B 4ZEBA 3QK6A 3B7DA 3MVWA 4NF8B 2Z22A 3TMGA 1LSTA 4F18A 3V89B 1USYH 2E0SA 3VVFA 4F29A 5L8DA 4OFJA 1LFGA 2DXRA 3DP8A 4FECA 1UIUA 3CIJA 1ZLQA 1JEVA 4TLMB 3PUVE 4KCCA 4N6PA 4FE8A 4BDQA 1UTBB 2DXYA 4PP0A 4G8HA 4PFTA 2DVZA 3SEUA 2LAOA 4ONYA 3M3KA 4IO7A 4NTLA 3TPAA 4KD5A 3UN6A 4F2OA 5AA2A 5FHNA 5IAIA 4H5GA 3FXRA 1DPEA 4KQPA 4YU0A 4R9FA 4ESXA 2DWJA 3MZ9A 2OWTA 2XXIA 1CB6A 4IB2A 3DLNA 2NWJA 2PT2A 1M5DA 4F3SA 1WVJA 5I59A 2REJA 3CG3A 4U22A 2VOZA 4LP2B 4LQ2A 3MVZA 4EUOA 1LAFE 3V83A 3HN0A 1VE4A 1XVYA 2R71A 3VV5A 3WAEA 2HEUA 2Z8EA 3CFLA 3VLWA 4DE8A 4G68B 4IO4A 5EYFA 4NF6A 2BJJX 1UTBA 4YKPA 1DTZA 2XXVA 3C31A 3CSGA 3KOSA 3PGFA 4YICA 2H25A 1H43A 1FTKA 1B9JA 4LVQA 1ZBMA 3IB0A 4KR5A 5JTYA 1ZIUA 3PMWA 1A55A 3QUJA 3KFMA 1DMBA 3K6UA 4QSEA 3IOUA 1MH4A 2ZNUA 5TU0A 3MAMA 1Q35A 3CSBA 3LSLA 4AB6A 4F31B 4XKNA 1FTOA 3FXQA 4KCDA 2ALUA 2ONRA 4YMAA 5AA2D 2UYEA 3GZGA 3KJ7A 2V3QA 2W7YA 2HZLA 2NVUB 3KOTA 3LR1A 4EDPA 3H6VA 3MPLA 1R1NA 1SVXB 1Y3QA 2XXXA 5KCJB 3TODA 1QKAA 1R9LA 1VSOA 2Q2AA 3BFTA 3FGSA 2V3TA 4G77A 4PFYA 2XXPA 1ZU0A 1B05A 2PYYA 4IY6A 4OTEA 2Q9TA 1IIWA 3RQTA 4KPTA 3VLUA 3W9WA 5ITOA 3G3KA 2XXTA 2DSFA 3ILUB 4OZ9A 2RF1A 3RPWA 4WXJA 4DZ1A 1SBPA 3TCGA 2GHBA 2VD2A 4F1UA 1IUDA 1M5CA 2P0SA 3KBRA 2H98A 2F78A 3E13X 2V84A 3O9PA 2H4IA 3Q28A 4JWYA 4NEDA 3OO8A 3HO7A 1B3HA 2THIA 3KG2A 1MXXA 3M8UA 4YMBA 1Y3PA 4PFUA 3EHTA 2QS3A 3FXUA 4K3FA 3H7MA 4QFOA 3TCHA 5AE4A 3TTRA 5H8FB 1PB9A 1F9BA 1MY1A 1P1QA 1LFHA 3AXFA 1OVBA 2HFBA 2HAVA 1GTKA 1H3DA 2O7IA 3PUXE 4G68A 1NMUA 1OMPA 1B1XA 4QSCA 1BKAA 2B3BA 3C35A 5I2KB 4H0WA 1JW4A 2GRVA 4AQ4A 2PBWA 2F34A 4U4XA 1FCKA 4BDOA 2I4CA 2I3WA 3PMXA 3FD3A 1IQ7A 4XKRA 4JWXA 2RC7A 5DTBA 1NH8A 1DOTA 1NKXA 4R75A 1RYOA 3CFXA 5TP9B 4Q8RA 4ZEDA 3K1NA 1ZTYA 5I59B 4PETA 1LCTA 4RPOA 4JDFA 1FTMA 4F22A 1LBCA 3T9VA 3MZ1A 3PPRA 4ZE8A 1N7WA 4HS7A 4KFQA 2F6GA 3IAZA 5I56B 1AMFA 3A3UA 3R7XA 1MXVA 2Y7KA 4OENA 3SEWA 2DWAA 4THIA 1D3KA 1D9YA 1HSJA 4GQOA 3OEKA 3B6WA 2Z23A 1B5IA 4EQBA 4MFIA 1DSNA 3G3FA 4H65A 3USDA 4HW8A 5I2KA 5AA3A 2A5TB 5A5XA 3TEPA 2ESNA 3CFZA 1RKMA 4QF9A 3TUSA 1ZJLA 2XXRA 1B2HA 4GOTA 1US5A 4RA1A 1GR2A 4LATA 4XIGQ 4ECFA 1LAHE 1N3WA 3QYTA 1JVYA 4P0GA 4ZEFA 2NXOA 3TELA 1O64A 4IO2A 3PUZE 5DYHA 2DE3A 4F39A 3PU5A 3P7IA 3FVGA 1A54A 1DPPA 2G29A 3DP4A 3MP6A 1MXWA 4DDDA 5KZTA 2OBGA 4H67A 3C9HA 4NF5B 2DS9A 2H9BA 2R9JA 3R26A 1JW1A 4DXUA 5JK4A 1B4ZA 1NNFA 2RCBA 5KDTB 3BFUA 1UQWA 5EHMA 4QFPA 3V5AA 1B4HA 4JXIA 3IB1A 3HPIA 3JZJA 3O28A 2UVHA 5H8NA 3SDFA 4P0IA 5I2NB 5H8FA 3CVGA 1B7ZA 2DVCA 1YPNA 2XX9A 1N84A 1POY1 1VFDA 4LZ7A 1Y4TA 2FNCA 3PMVA 4QFNA 1MQIA 4G8NA 5B70A 1AOVA 1B5JA 2OK2A 1USYE 3KN3A 3Q25A 4YKJA 1MM7A 2DWHA 1HSEA 5H8QA 3MVYA 3RUMA 3UA8A 2QJEA 3SERA 4NF6B 4EXKA 2ZYKA 3O97A 4R2BA 3TTNA 4O3AA 5H8SA 2UXAA 3C4MA 3D4GA 4MF3A 2ZYMA 4KYEA 3U8QA 3W9VA 1GVCA 1Z7NE 5L9OA 5HBCA 1MS7A 4G8MA 2FYIA 4U23A 1CE2A 3LUYA 4ZS9A 2QS2A 3O6HA 2RINA 1LCFA 3H6WA 3PV0E 4KHZE 4TQUQ 1ELJA 2P2AA 3I5OA 1Y1ZA 5I56A 1EZOA 4F19A 4ESWA 4GL8A 1NNTA 3IL1B 5ICTA 3EN3A 2F7CA 2OJTA 2Y84A 3FV1A 3OSQA 3TTLA 1PBQA 3E3KA 1LAXA 2D21A 4LA9A 3OMBA 3S2VA 5EHSA 4E0XA 3C34A 1UTHA 5ELVA 4RY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IOT A;  2G93 A;  2UYF A;  4ND9 A;  2DE4 A;  1SDX A;  5ITP A;  1B46 A;  4H8J A;  4LUB A;  2QMX A;  3T66 A;  1EZ9 A;  2XD2 A;  3LBS A;  4MBP A;  5CMM A;  3N5L A;  4JB7 A;  4N07 A;  3H3G A;  3UK4 A;  1B51 A;  1O63 A;  3H6T A;  2ZNT A;  3PPP A;  3N6T A;  4I62 A;  2O51 A;  1SYI A;  4H1X A;  1MY2 A;  3HST A;  1LFI A;  2I3V A;  3U93 A;  5FHO A;  1R9Q A;  3OD7 A;  1MXZ A;  3MUQ A;  2VD3 A;  1D9V A;  2Y7R A;  5IKB A;  1I69 A;  1JET A;  3EHS A;  4YB5 A;  5ISU A;  4R74 A;  2XD3 A;  4QFK A;  2Q8J A;  3O6G A;  4H8I A;  4H6D A;  3VDF A;  4EF2 A;  2F8D A;  3K01 A;  3TCF A;  3IOV A;  1R6Z A;  4X48 A;  4QSD A;  3MVX A;  3IJX B;  1IXI A;  3UGW A;  1MPD A;  4GD5 A;  4OER A;  4UAC A;  4YAH X;  4POW A;  2HXW A;  4YB6 A;  1S50 A;  2GFE A;  1NFT A;  5FTH A;  3MBP A;  5L9M A;  1B3F A;  1B32 A;  1J1N A;  1AIV A;  1YAE A;  2PMS A;  3T96 B;  2HAU A;  3DEL B;  3G7W A;  5TPA A;  5I58 A;  4U1O A;  2Y7I A;  4GFR A;  2QPQ A;  2OCU A;  4NF5 A;  4NMY A;  1GGG A;  3Q27 A;  1PBP A;  3TQW A;  4G68 C;  3EHU A;  1A99 A;  3RTF B;  3WAF A;  3JV9 A;  4F3B A;  2DWI A;  4U4S A;  3H4Z A;  1B7U A;  4OFO A;  3S9E A;  1IXH A;  2ZMB A;  2GHA A;  3FJ7 A;  1Y1M A;  3QIM A;  4NF8 A;  4EXL A;  5B7D A;  5JTY B;  4ZE9 A;  1BIY A;  1LLS A;  1MY4 A;  1Y3N A;  1US4 A;  3FJM A;  4OWD A;  3IX1 A;  3T93 B;  2I0C A;  4IGT A;  3I6V A;  4QFL A;  3E9X A;  3DM0 A;  5CMC A;  5I57 B;  3RT6 B;  1XS5 A;  4U2R A;  3RY3 A;  4R6K A;  3KEI A;  1TT1 A;  1SQY A;  3O2A A;  3IJO B;  1OQG A;  1I6A A;  1VFE A;  4X1D A;  4QHQ A;  4TOZ A;  3TZA A;  4E0W A;  4FAJ A;  2PVU A;  4FED A;  5H8H A;  5AA4 B;  2UVG A;  1Y9U A;  1IEJ A;  2KLF A;  1URS A;  2D3I A;  1N7X A;  3C32 A;  3IO4 A;  2VP1 A;  2PT1 A;  4GL0 A;  3RNN A;  4U1Z A;  1FQB A;  3T22 A;  3PUW E;  4F2Q A;  2I4B A;  1OQH A;  1QUJ A;  2O1L A;  3DP6 A;  3FVO A;  2F97 A;  3HCQ A;  3MWB A;  4GRK A;  3GBA A;  4M1V A;  4ZDM A;  5TP9 A;  3PPN A;  3SKP A;  3VXC A;  1EU8 A;  1DTG A;  3K6X A;  4DCY A;  2I6E A;  5BUU A;  2ZYO A;  4JBZ A;  2H99 A;  3QXM A;  1L5T A;  5CBR A;  4GLI A;  1AH5 A;  4HTG A;  3BKI B;  5KDT A;  1B6H A;  1A8F A;  1P1W A;  2CMO A;  5K2X A;  3OO7 A;  4ELO A;  3IB2 A;  2UVJ A;  2XXY A;  3K2D A;  1ATG A;  2ONK E;  3D4C A;  3HHF A;  4FJP A;  4JSD A;  1A40 A;  1OLC A;  1EH3 A;  3H06 B;  4F1V A;  3T9X B;  4ELQ A;  1B3E A;  1B58 A;  4GF8 A;  2NUV A;  4XXU A;  5JEI A;  2RCA A;  4DCX A;  2AL4 A;  2DYX A;  4O3C A;  2OLB A;  3M3L A;  1UIV A;  3N26 A;  5K2Y A;  1FQF A;  2O68 A;  3U92 A;  1RYX A;  4OFL A;  2R6G E;  5I57 A;  3ZS6 A;  1B7H A;  4DIG A;  1EZP A;  2A5T A;  1N0T A;  1MY3 A;  2ZYN A;  5DVF A;  4ELP A;  3FIR A;  2I58 A;  1N3X A;  2VGQ A;  3MP8 A;  2AL5 A;  3FAT A;  1S9T A;  1WDN A;  2P1S A;  1SYH A;  1QVS A;  1SW1 A;  2V25 A;  2REG A;  3IO6 A;  3FVK A;  1P1U A;  3G3I A;  4NF4 B;  1BLF A;  3FJG A;  2ZXT A;  4R9G A;  3V8X B;  5BWJ A;  1B52 A;  3K1M A;  4R6H A;  2F36 A;  3L6G A;  4EF1 A;  1JVX A;  4WEP A;  4M4G A;  5CM6 A;  1TXF A;  4I1D A;  4RPN A;  3QUF A;  1QUK A;  1Y20 A;  4OYV A;  1IXG A;  2I49 A;  5F7V A;  1AL3 A;  5CMK A;  2Y7W A;  4I8C A;  3SES A;  1FQC A;  4OHN A;  4H5F A;  3I3V A;  1LAG E;  3TQL A;  2E1S A;  1FQD A;  3LSX A;  1MXY A;  1I6Q A;  3C33 A;  3OO6 A;  3E4R A;  4LZ8 A;  2HZK A;  4OMB A;  3ZSF A;  3VVD A;  3CG1 A;  3MPK A;  3GXA A;  1H76 A;  4IGR A;  4ZEI A;  1FQA A;  1A7L A;  4YKI A;  1IXC A;  5DT6 A;  1FTJ A;  1NNK A;  3FV2 A;  4EQ7 A;  4I9D A;  2RC9 A;  3ONM A;  5H8Q B;  1P1N A;  3ZKL A;  3L6H A;  3MC2 A;  2VHA A;  3SEX A;  4RNS A;  1SW4 A;  4ZZA A;  4NE4 A;  5AA1 A;  1HSL A;  1NNP A;  2HCA A;  4Q0C A;  1P99 A;  4ELR A;  2Q88 A;  2XHD A;  3KSJ A;  3OEL A;  3O29 A;  1KWH A;  3IOW A;  1Q1K A;  4YKK A;  1MY0 A;  1OIB A;  2O84 X;  4O3B A;  3VVE A;  4AB5 A;  1MDP 1;  2QS1 A;  1TFD A;  2RKM A;  3K6W A;  4ZEK A;  1YCJ A;  5M2V A;  4ISU A;  5HM4 B;  5ICQ A;  3RLF E;  1ZMG A;  2CZL A;  2X7P A;  1WOD A;  3SET A;  3PPQ A;  1B1H A;  2AYS A;  3EF7 A;  4XKP A;  4PFW A;  1FQE A;  4IO3 A;  3PD8 A;  1UTH B;  4ZEC A;  3A09 A;  2V3U A;  3Q29 A;  3GLB A;  4IO5 A;  3ODB A;  1N76 A;  2QS4 A;  3HHG A;  4L17 A;  2QRY A;  3JYR A;  2WKY A;  1MPC A;  5I2N A;  5KCJ A;  4ZZE A;  2DOJ A;  2IA4 A;  3SEY A;  3THI A;  2XX8 A;  1SI0 A;  3OSR A;  1LBB A;  2ABH A;  1ANF A;  1FTL A;  1FW0 A;  2F6P A;  1XOC A;  3CR9 A;  3FAS A;  3MZB A;  2F5X A;  4NF4 A;  4OET A;  1B3G A;  4MH5 A;  5HPQ A;  4PE5 B;  3S4U A;  2YLN A;  4RYA A;  4YB7 A;  1IZ1 A;  1NL5 A;  4YZZ A;  3LC8 A;  1MQH A;  2B65 A;  4GXS B;  2YJP A;  1LB9 A;  2DE2 A;  3B6T A;  3PD9 A;  4MLQ A;  3TDJ A;  1NH7 A;  4R6Y A;  2YPN A;  3TKD A;  3TTM A;  3ECR A;  2QMW A;  1Z7M E;  2F7B A;  1JEU A;  3K02 A;  2D5W A;  1MH3 A;  3KGC A;  1H44 A;  4BDR A;  3K00 A;  4DLD A;  4JSO A;  1SW2 A;  3QAX A;  3OEN A;  3KJT A;  4HCY A;  3TFL A;  2Q89 A;  3R6U A;  4LQ5 A;  3K1P A;  1YTV A;  4RK9 A;  4BDL A;  3VLV A;  3EPE A;  1MXU A;  4JWO A;  2AIX A;  3C36 A;  3A3C A;  3TAJ A;  2B3F A;  1S7Y A;  3W15 C;  1II5 A;  1I6B A;  3RGY A;  1IIT A;  3MJN A;  4WKM A;  4RK2 A;  3U1O A;  1SD3 A;  1TWY A;  2DQV A;  1MRP A;  2I48 A;  3KZG A;  3OXN A;  1QUI A;  3IK6 B;  4X1B A;  3VFJ A;  4GWO A;  2I0B A;  2M8C A;  3MW0 A;  1JNF A;  4P11 A;  2QSX A;  3N6U A;  4KI0 E;  1OLA A;  1PDA A;  1URD A;  3MP1 A;  4RJZ A;  3UIF A;  5I84 A;  4EQ9 A;  4MLV A;  1BTJ A;  1O7T A;  3FUZ A;  1QUL A;  4BLA A;  2O7U A;  3PUY E;  4R73 A;  2XXH A;  4U21 A;  2DP8 A;  3Q26 A;  1PB7 A;  3FVN A;  5L9S A;  4GIZ A;  3M3F A;  3H6U A;  4BDM A;  3CRB A;  3KSX A;  3OO9 A;  2XXQ A;  5A5X B;  3N94 A;  3O6I A;  5DEX A;  1VR5 A;  1QJM A;  5FTI A;  2UVI A;  4FOR A;  3G3J A;  1GV8 A;  4TLL B;  1XC1 A;  2PX1 A;  3T9U A;  4FAT A;  3S9L C;  5CC2 A;  1B3L A;  1MG1 A;  2QL3 A;  2Z8F A;  3K0V A;  2XXW A;  3G3G A;  1B40 A;  4NWD A;  4OES A;  2FA7 A;  2ONS A;  4XKQ A;  3LSW A;  2V93 A;  5CI5 A;  3RT8 A;  4GXA A;  4G4P A;  4C1T A;  4RXL A;  3MQ9 A;  2RC8 A;  1PB8 A;  3KN7 A;  1SI1 A;  3OOA A;  2X7Q A;  5H8H B;  3VXB A;  5AA4 A;  4N13 A;  4BDN A;  1JW5 A;  1PEB A;  5DVI A;  4Z0I A;  4LZ5 A;  4R2F A;  3PPO A;  1SW5 A;  2H5Y A;  5CBS A;  5TPA B;  4F3P A;  5I58 B;  1T0K A;  4OXV A;  1QW0 A;  3OEM A;  3F11 A;  3GBB A;  5DVJ A;  2F7A A;  3U72 A;  4LON B;  3H03 A;  2OWS A;  2OZZ A;  1MQD A;  3SEV A;  1TFA A;  2Q2C A;  1M5B A;  1XT8 A;  1M5E A;  2HQ0 A;  2XX7 A;  4G2Z A;  4UA8 A;  5CMB A;  3UP9 A;  2XXU A;  4C0R A;  3QSL A;  5F1Q A;  5CRY A;  4DXB A;  4PQJ A;  3RN8 A;  1ZKB A;  2ANJ A;  1A8E A;  3BBR A;  2F35 A;  3T9H B;  4HCW A;  1N04 A;  1MQG A;  3ILT B;  4OQO A;  4POX A;  4DXC A;  3CI8 A;  1D4N A;  5FHM A;  1MPB A;  3VE1 B;  3TTK A;  1POT A;  4X9T A;  3UOR A;  4NWC A;  5LOM A;  2A5S A;  2Y7P A;  3B6Q A;  4F1Y A;  4IY5 A;  3FZV A;  2NOO A;  3IOR A;  1B5H A;  1QKB A;  3K4U A;  3KN8 A;  1MDQ A;  1M5F A;  1B0H A;  2IEE A;  2ZNS A;  4OEV A;  4XTC Q;  1B0L A;  4OVJ A;  2O69 A;  3S9N C;  5H8N B;  1XHY A;  3IR1 A;  3O66 A;  4IO6 A;  1MM6 A;  4QRZ A;  4Z7E A;  4Q5T A;  1BP5 A;  3K6V A;  2Z8D A;  1PC3 A;  5DEX B;  1LGB C;  4KYS A;  2X26 A;  1H45 A;  4OEU A;  4WED A;  5AA2 B;  3LSF B;  1URG A;  2GH9 A;  3G3H A;  2O6A A;  2O1M A;  4FIM A;  3RTW B;  4C1U A;  3U94 A;  4KYD A;  1LB8 A;  1OVT A;  1Y4C A;  3EQ1 A;  3TYH A;  4F3G A;  4FEB A;  4R72 A;  5J1D A;  3S9M C;  1XVX A;  1JQF A;  4GVO A;  1MQJ A;  3HV1 A;  1P1O A;  3ZKK A;  4Q30 B;  4ZEB A;  3QK6 A;  3B7D A;  3MVW A;  4NF8 B;  2Z22 A;  3TMG A;  1LST A;  4F18 A;  3V89 B;  1USY H;  2E0S A;  3VVF A;  4F29 A;  5L8D A;  4OFJ A;  1LFG A;  2DXR A;  3DP8 A;  4FEC A;  1UIU A;  3CIJ A;  1ZLQ A;  1JEV A;  4TLM B;  3PUV E;  4KCC A;  4N6P A;  4FE8 A;  4BDQ A;  1UTB B;  2DXY A;  4PP0 A;  4G8H A;  4PFT A;  2DVZ A;  3SEU A;  2LAO A;  4ONY A;  3M3K A;  4IO7 A;  4NTL A;  3TPA A;  4KD5 A;  3UN6 A;  4F2O A;  5AA2 A;  5FHN A;  5IAI A;  4H5G A;  3FXR A;  1DPE A;  4KQP A;  4YU0 A;  4R9F A;  4ESX A;  2DWJ A;  3MZ9 A;  2OWT A;  2XXI A;  1CB6 A;  4IB2 A;  3DLN A;  2NWJ A;  2PT2 A;  1M5D A;  4F3S A;  1WVJ A;  5I59 A;  2REJ A;  3CG3 A;  4U22 A;  2VOZ A;  4LP2 B;  4LQ2 A;  3MVZ A;  4EUO A;  1LAF E;  3V83 A;  3HN0 A;  1VE4 A;  1XVY A;  2R71 A;  3VV5 A;  3WAE A;  2HEU A;  2Z8E A;  3CFL A;  3VLW A;  4DE8 A;  4G68 B;  4IO4 A;  5EYF A;  4NF6 A;  2BJJ X;  1UTB A;  4YKP A;  1DTZ A;  2XXV A;  3C31 A;  3CSG A;  3KOS A;  3PGF A;  4YIC A;  2H25 A;  1H43 A;  1FTK A;  1B9J A;  4LVQ A;  1ZBM A;  3IB0 A;  4KR5 A;  5JTY A;  1ZIU A;  3PMW A;  1A55 A;  3QUJ A;  3KFM A;  1DMB A;  3K6U A;  4QSE A;  3IOU A;  1MH4 A;  2ZNU A;  5TU0 A;  3MAM A;  1Q35 A;  3CSB A;  3LSL A;  4AB6 A;  4F31 B;  4XKN A;  1FTO A;  3FXQ A;  4KCD A;  2ALU A;  2ONR A;  4YMA A;  5AA2 D;  2UYE A;  3GZG A;  3KJ7 A;  2V3Q A;  2W7Y A;  2HZL A;  2NVU B;  3KOT A;  3LR1 A;  4EDP A;  3H6V A;  3MPL A;  1R1N A;  1SVX B;  1Y3Q A;  2XXX A;  5KCJ B;  3TOD A;  1QKA A;  1R9L A;  1VSO A;  2Q2A A;  3BFT A;  3FGS A;  2V3T A;  4G77 A;  4PFY A;  2XXP A;  1ZU0 A;  1B05 A;  2PYY A;  4IY6 A;  4OTE A;  2Q9T A;  1IIW A;  3RQT A;  4KPT A;  3VLU A;  3W9W A;  5ITO A;  3G3K A;  2XXT A;  2DSF A;  3ILU B;  4OZ9 A;  2RF1 A;  3RPW A;  4WXJ A;  4DZ1 A;  1SBP A;  3TCG A;  2GHB A;  2VD2 A;  4F1U A;  1IUD A;  1M5C A;  2P0S A;  3KBR A;  2H98 A;  2F78 A;  3E13 X;  2V84 A;  3O9P A;  2H4I A;  3Q28 A;  4JWY A;  4NED A;  3OO8 A;  3HO7 A;  1B3H A;  2THI A;  3KG2 A;  1MXX A;  3M8U A;  4YMB A;  1Y3P A;  4PFU A;  3EHT A;  2QS3 A;  3FXU A;  4K3F A;  3H7M A;  4QFO A;  3TCH A;  5AE4 A;  3TTR A;  5H8F B;  1PB9 A;  1F9B A;  1MY1 A;  1P1Q A;  1LFH A;  3AXF A;  1OVB A;  2HFB A;  2HAV A;  1GTK A;  1H3D A;  2O7I A;  3PUX E;  4G68 A;  1NMU A;  1OMP A;  1B1X A;  4QSC A;  1BKA A;  2B3B A;  3C35 A;  5I2K B;  4H0W A;  1JW4 A;  2GRV A;  4AQ4 A;  2PBW A;  2F34 A;  4U4X A;  1FCK A;  4BDO A;  2I4C A;  2I3W A;  3PMX A;  3FD3 A;  1IQ7 A;  4XKR A;  4JWX A;  2RC7 A;  5DTB A;  1NH8 A;  1DOT A;  1NKX A;  4R75 A;  1RYO A;  3CFX A;  5TP9 B;  4Q8R A;  4ZED A;  3K1N A;  1ZTY A;  5I59 B;  4PET A;  1LCT A;  4RPO A;  4JDF A;  1FTM A;  4F22 A;  1LBC A;  3T9V A;  3MZ1 A;  3PPR A;  4ZE8 A;  1N7W A;  4HS7 A;  4KFQ A;  2F6G A;  3IAZ A;  5I56 B;  1AMF A;  3A3U A;  3R7X A;  1MXV A;  2Y7K A;  4OEN A;  3SEW A;  2DWA A;  4THI A;  1D3K A;  1D9Y A;  1HSJ A;  4GQO A;  3OEK A;  3B6W A;  2Z23 A;  1B5I A;  4EQB A;  4MFI A;  1DSN A;  3G3F A;  4H65 A;  3USD A;  4HW8 A;  5I2K A;  5AA3 A;  2A5T B;  5A5X A;  3TEP A;  2ESN A;  3CFZ A;  1RKM A;  4QF9 A;  3TUS A;  1ZJL A;  2XXR A;  1B2H A;  4GOT A;  1US5 A;  4RA1 A;  1GR2 A;  4LAT A;  4XIG Q;  4ECF A;  1LAH E;  1N3W A;  3QYT A;  1JVY A;  4P0G A;  4ZEF A;  2NXO A;  3TEL A;  1O64 A;  4IO2 A;  3PUZ E;  5DYH A;  2DE3 A;  4F39 A;  3PU5 A;  3P7I A;  3FVG A;  1A54 A;  1DPP A;  2G29 A;  3DP4 A;  3MP6 A;  1MXW A;  4DDD A;  5KZT A;  2OBG A;  4H67 A;  3C9H A;  4NF5 B;  2DS9 A;  2H9B A;  2R9J A;  3R26 A;  1JW1 A;  4DXU A;  5JK4 A;  1B4Z A;  1NNF A;  2RCB A;  5KDT B;  3BFU A;  1UQW A;  5EHM A;  4QFP A;  3V5A A;  1B4H A;  4JXI A;  3IB1 A;  3HPI A;  3JZJ A;  3O28 A;  2UVH A;  5H8N A;  3SDF A;  4P0I A;  5I2N B;  5H8F A;  3CVG A;  1B7Z A;  2DVC A;  1YPN A;  2XX9 A;  1N84 A;  1POY 1;  1VFD A;  4LZ7 A;  1Y4T A;  2FNC A;  3PMV A;  4QFN A;  1MQI A;  4G8N A;  5B70 A;  1AOV A;  1B5J A;  2OK2 A;  1USY E;  3KN3 A;  3Q25 A;  4YKJ A;  1MM7 A;  2DWH A;  1HSE A;  5H8Q A;  3MVY A;  3RUM A;  3UA8 A;  2QJE A;  3SER A;  4NF6 B;  4EXK A;  2ZYK A;  3O97 A;  4R2B A;  3TTN A;  4O3A A;  5H8S A;  2UXA A;  3C4M A;  3D4G A;  4MF3 A;  2ZYM A;  4KYE A;  3U8Q A;  3W9V A;  1GVC A;  1Z7N E;  5L9O A;  5HBC A;  1MS7 A;  4G8M A;  2FYI A;  4U23 A;  1CE2 A;  3LUY A;  4ZS9 A;  2QS2 A;  3O6H A;  2RIN A;  1LCF A;  3H6W A;  3PV0 E;  4KHZ E;  4TQU Q;  1ELJ A;  2P2A A;  3I5O A;  1Y1Z A;  5I56 A;  1EZO A;  4F19 A;  4ESW A;  4GL8 A;  1NNT A;  3IL1 B;  5ICT A;  3EN3 A;  2F7C A;  2OJT A;  2Y84 A;  3FV1 A;  3OSQ A;  3TTL A;  1PBQ A;  3E3K A;  1LAX A;  2D21 A;  4LA9 A;  3OMB A;  3S2V A;  5EHS A;  4E0X A;  3C34 A;  1UTH A;  5ELV A;  4RY1 A; 
#chains in the Genus database with same CATH topology
 4N17 A;  3IOT A;  2UYF A;  2DE4 A;  5ITP A;  2CZH A;  3T66 A;  5CMM A;  4N4U A;  3UK4 A;  1B51 A;  4I62 A;  2O51 A;  4N91 A;  5FHO A;  1MXZ A;  3MUQ A;  1I69 A;  1JET A;  4YB5 A;  5ISU A;  4H8I A;  1Q9D A;  4YAH X;  1IMD A;  4POW A;  1S50 A;  5FTH A;  1B3F A;  1YAE A;  2HAU A;  5TPA A;  3EHU A;  1A99 A;  3WAF A;  4P9K A;  3H4Z A;  4NAP A;  4OFO A;  2GHA A;  1Y1M A;  4P8B A;  3T93 B;  3FXB A;  4H45 A;  4R6K A;  1LBV A;  3O2A A;  1OQG A;  3TZA A;  4TOZ A;  4FED A;  5AA4 B;  2UVG A;  2PFY A;  2D3I A;  3IO4 A;  2VP1 A;  3PUW E;  3HCQ A;  3SKP A;  1EU8 A;  1DTG A;  4PBH A;  2ZYO A;  1L5T A;  4GLI A;  3BKI B;  3K2D A;  1ATG A;  2ONK E;  3D4C A;  2P3V A;  4FJP A;  1IMF A;  1OLC A;  1B3E A;  4GF8 A;  2RCA A;  2DYX A;  4P47 A;  1B7H A;  1MY3 A;  2ZYN A;  5DVF A;  2I58 A;  1N3X A;  3FAT A;  1S9T A;  2P1S A;  1SYH A;  1SW1 A;  4NF4 B;  3IO6 A;  3FVK A;  4R9G A;  1NV4 A;  4I1D A;  3QUF A;  1IXG A;  2DDK A;  5CMK A;  1FQC A;  2HZK A;  1NUX A;  4IGR A;  4EQ7 A;  3ONM A;  1P1N A;  5AA1 A;  1HSL A;  2HCA A;  4Q0C A;  4ELR A;  3O29 A;  5I7I A;  1MDP 1;  1TFD A;  5ICQ A;  1BK4 A;  2X7P A;  4XKP A;  2Y5L A;  2QS4 A;  1QGX A;  5KCJ A;  2ABH A;  3MZB A;  1FTL A;  1FW0 A;  1XOC A;  2BJI A;  2F5X A;  4OET A;  1B3G A;  4MH5 A;  5HPQ A;  2YLN A;  4RYA A;  4GXS B;  1MQH A;  3TDJ A;  3B6T A;  3PD9 A;  3TTM A;  2YPN A;  1H44 A;  1SW2 A;  2GQ1 A;  3K1P A;  1DK4 A;  4OVQ A;  3VLV A;  1RDX A;  1MXU A;  4JWO A;  2AIX A;  3TAJ A;  3W15 C;  3U1O A;  1IIT A;  1SD3 A;  2DQV A;  1MRP A;  1QUI A;  3FBP A;  5LDZ A;  2M8C A;  3N6U A;  4KI0 E;  1URD A;  2Q74 A;  5I84 A;  1BTJ A;  3FUZ A;  1QUL A;  4GX3 A;  4R73 A;  2XXH A;  1PB7 A;  3H6U A;  2XXQ A;  1NUW A;  3O6I A;  3G3J A;  4FAT A;  2PX1 A;  2Z8F A;  3G3G A;  4NWD A;  4XKQ A;  5CI5 A;  4P3L A;  3LSW A;  4G4P A;  1SI1 A;  4PFR A;  5CBS A;  3KC1 A;  3A29 A;  1QW0 A;  5DVJ A;  3U72 A;  4LON B;  1MQD A;  2Q2C A;  2HHM A;  4XFE A;  3QSL A;  3KBZ A;  5CRY A;  4DXB A;  4PQJ A;  1ZKB A;  3BBR A;  3T9H B;  3ILT B;  1MQG A;  4I3E A;  1MPB A;  3VE1 B;  3B6Q A;  4F1Y A;  4IY5 A;  5DVI A;  4XTC Q;  2IEE A;  4O7I A;  4OEV A;  4OVJ A;  2O69 A;  4IO6 A;  4Z7E A;  4HE2 A;  3K6V A;  4KYS A;  4MMP A;  3LSF B;  4C1U A;  3U94 A;  4KYD A;  3TYH A;  3S9M C;  4FEB A;  1XVX A;  2WEF A;  4GVO A;  1YZ0 A;  1P1O A;  1FJ9 A;  3QK6 A;  3MVW A;  4NF8 B;  1LST A;  2E0S A;  1JEV A;  4NGU A;  4KCC A;  4PFT A;  3SEU A;  4ONY A;  2CEY A;  4NTL A;  5FHN A;  2PT2 A;  1M5D A;  4X8R A;  3V83 A;  3MST A;  1VE4 A;  5IZ3 B;  3VV5 A;  2HEU A;  2Z8E A;  3CFL A;  3VLW A;  1UTB A;  3PGF A;  5TU0 A;  3IOU A;  1MH4 A;  3FXQ A;  4KCD A;  2ALU A;  3GZG A;  2NVU B;  2L5V A;  3MPL A;  4MX6 A;  1Y3Q A;  5KCJ B;  4G77 A;  2XXK A;  1ZU0 A;  2R8T A;  3G3K A;  1G0H A;  1IUD A;  2P0S A;  3KBR A;  2H98 A;  3Q28 A;  1MXX A;  4YMB A;  4PFU A;  3FXU A;  2HXR A;  1KZ8 A;  1F9B A;  1MY1 A;  1PB9 A;  1OVB A;  1H3D A;  2O7I A;  5DW8 A;  2F3D A;  1JW4 A;  2GRV A;  2I4C A;  5DTB A;  1NKX A;  3CFX A;  4ZED A;  4HXV A;  1ZTY A;  5I59 B;  1FTM A;  1LBC A;  3MZ1 A;  1AMF A;  3A3U A;  2Y7K A;  2Z23 A;  5EQ7 A;  1RKM A;  5I5P A;  1ZJL A;  4ECF A;  1LAH E;  1N3W A;  3QYT A;  1JVY A;  2NXO A;  2FVZ A;  4MAG A;  3P7I A;  1DPP A;  3DP4 A;  3MP6 A;  2OBG A;  4NF5 B;  2R9J A;  1JW1 A;  3SZP A;  5EHM A;  3IB1 A;  3HPI A;  5I2N B;  2FNC A;  2FIE A;  5I3S A;  1USY E;  3Q25 A;  2DWH A;  1JP4 A;  3MVY A;  5H8S A;  2ZYM A;  5EQA A;  3W9V A;  3B8B A;  5L9O A;  4G8M A;  2FYI A;  4TQU Q;  1LCF A;  4MIJ A;  5I56 A;  2P2A A;  1Y1Z A;  1NNT A;  5ICT A;  3EN3 A;  1PBQ A;  4GWX A;  1LAX A;  3T1B A;  4E0X A;  5ELV A;  4O94 A;  1INP A;  2G93 A;  4H8J A;  1O63 A;  2MKZ A;  1K9Z A;  3N6T A;  4X04 A;  1SYI A;  2I3V A;  3U93 A;  3OD7 A;  4PAI A;  1D9V A;  2Y7R A;  3EHS A;  2F8D A;  3IOV A;  4X48 A;  4QSD A;  4OER A;  2HXW A;  5EQ9 A;  4YB6 A;  4GWW A;  1AIV A;  2PMS A;  3T96 B;  3G7W A;  2Y7I A;  4NF5 A;  2CZI A;  3RPL B;  2CEX A;  3RTF B;  4F3B A;  2DWI A;  1NV3 A;  4N8Y A;  1IXH A;  2ZMB A;  4NF8 A;  5B7D A;  1LLS A;  1FBE A;  5F24 A;  1Y3N A;  2I0C A;  2V4C A;  3DM0 A;  3RT6 B;  4U2R A;  4X1D A;  3IJO B;  4QHQ A;  4E0W A;  5H8H A;  1Y9U A;  2KLF A;  1URS A;  1FQB A;  1OQH A;  3MWB A;  2O1L A;  3S9E A;  1FSA A;  2F97 A;  2I6E A;  5BUU A;  4PFB A;  2OX3 A;  4HTG A;  1B6H A;  1P1W A;  5ET8 A;  3MYU A;  1EH3 A;  4F1V A;  3T9X B;  4ELQ A;  1B58 A;  4XXU A;  2OLB A;  3M3L A;  1FQF A;  4OFL A;  4LN5 A;  4DIG A;  3FIR A;  2REG A;  1LEV A;  1P1U A;  3G3I A;  1BLF A;  2XWK A;  2ZXT A;  3FJG A;  4R6H A;  3L6G A;  4EF1 A;  1JVX A;  5CM6 A;  1TXF A;  1QUK A;  1Y20 A;  2XWV A;  4OYV A;  5F7V A;  4I8C A;  3SES A;  1LAG E;  1FQD A;  3LSX A;  1I6Q A;  4LZ8 A;  3ZSF A;  4OMB A;  3VVD A;  3MPK A;  1A7L A;  1IXC A;  2VPO A;  3ZKL A;  2VHA A;  1SW4 A;  1NNP A;  2Q88 A;  2XHD A;  1KA1 A;  1OIB A;  4O3B A;  5HM4 B;  1ZMG A;  2CZL A;  3PPQ A;  4IO3 A;  1UTH B;  3HHG A;  2QRY A;  2VPN A;  5EQ8 A;  3SEY A;  2IA4 A;  2XX8 A;  3E78 A;  1ANF A;  3CR9 A;  3S4U A;  2FIX A;  1IZ1 A;  4YZZ A;  3LC8 A;  4MLQ A;  5JK4 A;  3PTY A;  1LB9 A;  1NH7 A;  2JJK A;  3ECR A;  1JEU A;  3K02 A;  1MH3 A;  4BDR A;  4JSO A;  3QAX A;  1NV7 A;  3TFL A;  4RK9 A;  4BDL A;  4QBA A;  3C36 A;  1I6B A;  3RGY A;  3MJN A;  4RK2 A;  1IMC A;  3VFJ A;  3IK6 B;  1KA0 A;  4X1B A;  4GWO A;  4N15 A;  2QSX A;  3UIF A;  4NX1 A;  4EQ9 A;  2O7U A;  2DP8 A;  3Q26 A;  3M3F A;  4BDM A;  3CRB A;  3OO9 A;  5A5X B;  1QJM A;  1GV8 A;  2XXW A;  2ONS A;  5J16 A;  3MQ9 A;  1PB8 A;  2X7Q A;  5H8H B;  4BDN A;  1JW5 A;  1PEB A;  4Z0I A;  4R2F A;  4AS4 A;  5I58 B;  4OXV A;  2F7A A;  3H03 A;  2OWS A;  4PBQ A;  3SEV A;  1FTA A;  1M5E A;  2HQ0 A;  1FPK A;  2FBP A;  2F3B A;  1FBP A;  3RN8 A;  3RPL A;  2F35 A;  1N04 A;  1D4N A;  4FBP A;  3TTK A;  1POT A;  3UOR A;  5LOM A;  1YYZ A;  2A5S A;  2NOO A;  3IOR A;  1M5F A;  1B0H A;  2B4M A;  2ZNS A;  1B0L A;  5H8N B;  1XHY A;  3O66 A;  4Q5T A;  1URG A;  2O6A A;  3EQ1 A;  2HPG A;  1MQJ A;  3HV1 A;  3B7D A;  1USY H;  1LFG A;  4FE8 A;  4BDQ A;  4G8H A;  4F2O A;  5AA2 A;  5IAI A;  4KQP A;  4R9F A;  4ESX A;  2OWT A;  1CB6 A;  4PTK A;  4N6K A;  4F3S A;  1WVJ A;  2REJ A;  2VOZ A;  2WYK A;  4P1L A;  4EUO A;  3HN0 A;  1XVY A;  2R71 A;  4DE8 A;  4IO4 A;  5EYF A;  4OA4 A;  4YKP A;  3CSG A;  3KOS A;  2H25 A;  1FTK A;  1B9J A;  3IB0 A;  4KR5 A;  4QSE A;  1Q35 A;  3CSB A;  4YMA A;  5AA2 D;  2HZL A;  3KOT A;  4EDP A;  3IFC A;  3TOD A;  3BFT A;  4GWY A;  2V3T A;  4OVT A;  1B05 A;  4IY6 A;  2Q9T A;  1IIW A;  4KPT A;  4MNP A;  3ILU B;  2RF1 A;  4WXJ A;  1SBP A;  3NOH A;  2F78 A;  3E13 X;  2H4I A;  5IGA A;  3OO8 A;  3KG2 A;  1Y3P A;  4QFO A;  4K3F A;  3H7M A;  2HAV A;  1GTK A;  4G68 A;  1NMU A;  1OMP A;  1B1X A;  4PDH A;  4U4X A;  1FCK A;  2I3W A;  1XI6 A;  4XKR A;  1NH8 A;  3K1N A;  4PET A;  5FBP A;  1LCT A;  4F22 A;  4OAN A;  3PPR A;  1LBW A;  1D9Y A;  4GQO A;  3USD A;  4HW8 A;  5AA3 A;  5A5X A;  3CFZ A;  4XIG Q;  1US5 A;  1GR2 A;  4IO2 A;  1MXW A;  4DDD A;  1NI9 A;  2DS9 A;  1B4Z A;  2RCB A;  5KDT B;  4JXI A;  2WBB A;  2UVH A;  3SDF A;  2Y5K A;  2DVC A;  1VFD A;  1Y4T A;  4QFN A;  1MQI A;  4G8N A;  1AOV A;  5H8Q A;  3IFA A;  4NG7 A;  3RUM A;  1YXI A;  2QJE A;  2ZYK A;  4R2B A;  3TTN A;  2UXA A;  4GWU A;  2VT5 A;  4MF3 A;  5IZ3 A;  2PCR A;  1Z7N E;  4U23 A;  2RIN A;  1LBZ A;  4ESW A;  4PE3 A;  2OJT A;  3TTL A;  3E3K A;  2D21 A;  3OMB A;  5EHS A;  1UTH A;  4ND9 A;  1FPB A;  1EZ9 A;  2XD2 A;  3LBS A;  4MBP A;  3N5L A;  1LBY A;  4JB7 A;  2WX9 A;  3H6T A;  5EYG A;  1MY2 A;  3HST A;  1LFI A;  1R9Q A;  2VD3 A;  4O7M A;  4R74 A;  2XD3 A;  3O6G A;  4EF2 A;  3VDF A;  5ET7 A;  3TCF A;  1R6Z A;  3UGW A;  1MPD A;  1VDW A;  4GD5 A;  4NHB A;  2GFE A;  1K9Y A;  4JVD A;  2XWO A;  5L9M A;  3DEL B;  5I58 A;  1FPJ A;  4NMY A;  4GFR A;  1GGG A;  3Q27 A;  1PBP A;  3TQW A;  4G68 C;  4MHF A;  3JV9 A;  1NV2 A;  4NF0 A;  3QIM A;  5JTY B;  1MY4 A;  1US4 A;  3FJM A;  4OWD A;  5IM2 A;  4IGT A;  5CMC A;  3RY3 A;  1TT1 A;  1I6A A;  1VFE A;  2QVU A;  2QVR A;  4FAJ A;  1IEJ A;  4GL0 A;  4F2Q A;  1QUJ A;  4ZDM A;  5TP9 A;  3GBA A;  4NN3 A;  3K6X A;  1FPE A;  1A8F A;  5K2X A;  4ELO A;  3OO7 A;  2ZZV A;  4XF5 A;  2XXY A;  4PCD A;  4PDD A;  2XWI A;  3H06 B;  5JEI A;  1RYX A;  1EZP A;  2A5T A;  1N0T A;  2VGQ A;  2AL5 A;  1WDN A;  4EXL A;  5BWJ A;  2F36 A;  4WEP A;  4M4G A;  4NQ8 A;  4H5F A;  2E1S A;  2QVV A;  3C33 A;  3OO6 A;  3E4R A;  4GWZ A;  1FQA A;  4YKI A;  5DT6 A;  5LTC A;  1NNK A;  3FV2 A;  5H8Q B;  3L6H A;  3SEX A;  4NE4 A;  1P99 A;  3KSJ A;  3OEL A;  3IOW A;  5ET6 A;  1MY0 A;  4AB5 A;  2RKM A;  3K6W A;  1YCJ A;  4ISU A;  3RLF E;  3EF7 A;  4ZEC A;  3A09 A;  1IMB A;  4HE1 A;  2WKY A;  4ZZE A;  2DOJ A;  1SI0 A;  3OSR A;  1LBB A;  2F6P A;  3FAS A;  4HE0 A;  4AS5 A;  2B65 A;  3CHG A;  4PGP A;  1Z7M E;  2D5W A;  3OEN A;  4IR8 A;  4HCY A;  2Q89 A;  3R6U A;  3EPE A;  4GBV A;  1DCU A;  3A3C A;  2B3F A;  1II5 A;  4WKM A;  1TWY A;  3OXN A;  3KZG A;  5EYH A;  1FPF A;  2I0B A;  3MW0 A;  4N6D A;  4P11 A;  1JNF A;  3LUZ A;  4RJZ A;  4MLV A;  4U21 A;  5L9S A;  4GIZ A;  3KSX A;  1RDY A;  5FTI A;  4FOR A;  4TLL B;  5CC2 A;  2QL3 A;  4OES A;  1B40 A;  4GXA A;  3KN7 A;  5AA4 A;  4F3P A;  3OEM A;  3F11 A;  2OZZ A;  4DI4 B;  1TFA A;  1M5B A;  2XX7 A;  5CMB A;  3UP9 A;  5F1Q A;  1NV5 A;  4I3Y A;  4PFI A;  2ANJ A;  1DBZ A;  4OQO A;  4DXC A;  4POX A;  4X9T A;  2Y7P A;  3FZV A;  4H46 A;  1QKB A;  3KN8 A;  1MDQ A;  3S9N C;  3IR1 A;  1MM6 A;  5DEX B;  1LGB C;  2X26 A;  1H45 A;  5AA2 B;  3G3H A;  2O1M A;  5J1D A;  1LB8 A;  1OVT A;  4F3G A;  1FBH A;  4JVC A;  3ZKK A;  1G0I A;  2Z22 A;  3TMG A;  3V89 B;  5L8D A;  4OFJ A;  3DP8 A;  2DXR A;  1ZLQ A;  4TLM B;  4N6P A;  1UTB B;  2DXY A;  4GX4 A;  2DVZ A;  2LAO A;  3M3K A;  4IO7 A;  3TPA A;  3UN6 A;  4KD5 A;  4H5G A;  3FXR A;  4YU0 A;  2DWJ A;  2XXI A;  3DLN A;  2FHY A;  1NUZ A;  1D9Q A;  4LP2 B;  4LQ2 A;  1LAF E;  2KQZ A;  3WAE A;  4G68 B;  2BJJ X;  4I40 A;  1DTZ A;  4LVQ A;  4P56 A;  1FJ6 A;  5JTY A;  1ZIU A;  3PMW A;  4MJO A;  3LV0 A;  1FBC A;  4AB6 A;  4XKN A;  2ONR A;  3QMF A;  2V3Q A;  2W7Y A;  3LR1 A;  3H6V A;  4PAF A;  1SVX B;  1VSO A;  2Q2A A;  4PFY A;  3EKI A;  4OTE A;  3RQT A;  3VLU A;  4PC9 A;  2XXT A;  2DSF A;  3RPW A;  2GHB A;  4F1U A;  5I57 B;  3O9P A;  3HO7 A;  5A5L A;  3M8U A;  3TCH A;  2PFZ A;  5H8F B;  1P1Q A;  4QXD A;  3PUX E;  3C35 A;  2B3B A;  5I2K B;  4H0W A;  4AQ4 A;  2PBW A;  3B50 A;  3FD3 A;  1IQ7 A;  4XEQ A;  2RC7 A;  4R75 A;  1RYO A;  4ZE8 A;  1N7W A;  4HS7 A;  4KFQ A;  2F6G A;  3R7X A;  1FBD A;  3SEW A;  4THI A;  1D3K A;  3B6W A;  1B5I A;  4EQB A;  1RDZ A;  4MFI A;  1DSN A;  3G3F A;  4G61 A;  2A5T B;  3TEP A;  3TUS A;  4GOT A;  2XXR A;  1B2H A;  4RA1 A;  4P1E A;  4LAT A;  3PUZ E;  2DE3 A;  4F39 A;  1A54 A;  1FPG A;  5KZT A;  4H67 A;  1NNF A;  3V5A A;  3JZJ A;  3O28 A;  5H8N A;  5H8F A;  3ISP A;  4LZ7 A;  1EYK A;  3PMV A;  1NV1 A;  1B5J A;  2OK2 A;  3KN3 A;  5B70 A;  4YKJ A;  1MM7 A;  1HSE A;  3UA8 A;  3SER A;  4NF6 B;  4O3A A;  1NV6 A;  1CE2 A;  3LUY A;  4ZS9 A;  3O6H A;  5HBC A;  3H6W A;  3I5O A;  2XA5 A;  4F19 A;  4PAK A;  3OSQ A;  2F7C A;  3FV1 A;  4LA9 A;  2Q8M A;  3E79 A;  3C34 A;  4RY1 A;  2WYP A;  4MEV A;  1FPI A;  1SDX A;  1B46 A;  4LUB A;  2QMX A;  3D1R A;  2QFL A;  1SPI A;  4N07 A;  3H3G A;  2ZNT A;  3PPP A;  4H1X A;  2ZZW A;  5IKB A;  2Q8J A;  4QFK A;  1FPD A;  4H6D A;  3K01 A;  3MVX A;  3IJX B;  1IXI A;  4UAC A;  1NFT A;  3MBP A;  1B32 A;  1J1N A;  1FBF A;  4U1O A;  2QPQ A;  2OCU A;  2P3N A;  1AWB A;  4PGN A;  5IZ1 A;  4N81 A;  4U4S A;  1B7U A;  3FJ7 A;  4ZE9 A;  1BIY A;  3IX1 A;  3I6V A;  4QFL A;  3E9X A;  1XS5 A;  5ET5 A;  3KEI A;  5ESY A;  1SQY A;  2PVU A;  1N7X A;  3C32 A;  2PT1 A;  3RNN A;  4U1Z A;  3T22 A;  2I4B A;  3DP6 A;  3FVO A;  4GRK A;  4M1V A;  3VXC A;  3PPN A;  4KXP A;  4DCY A;  4UAB A;  4JBZ A;  2H99 A;  3QXM A;  5T3J A;  5CBR A;  5KDT A;  1AH5 A;  2CMO A;  3IB2 A;  2UVJ A;  3HHF A;  4JSD A;  1A40 A;  2NUV A;  4DCX A;  2AL4 A;  4O3C A;  5K2Y A;  1UIV A;  3N26 A;  4DI3 D;  2O68 A;  3U92 A;  2R6G E;  5I57 A;  3ZS6 A;  4ELP A;  3MP8 A;  2V25 A;  1QVS A;  3V8X B;  1FRP A;  1B52 A;  3K1M A;  4RPN A;  2I49 A;  1AL3 A;  2Y7W A;  4OHN A;  3I3V A;  3TQL A;  1MXY A;  3BIG A;  3CG1 A;  3GXA A;  1H76 A;  4ZEI A;  1FTJ A;  4I9D A;  2RC9 A;  3MC2 A;  4RNS A;  4ZZA A;  1KWH A;  1Q1K A;  2KR0 A;  4YKK A;  2O84 X;  3VVE A;  2QS1 A;  4ZEK A;  5M2V A;  1WOD A;  3SET A;  1B1H A;  2AYS A;  4PFW A;  1FQE A;  3PD8 A;  2V3U A;  3Q29 A;  3GLB A;  4IO5 A;  3ODB A;  1N76 A;  4L17 A;  5IZZ A;  3JYR A;  1MPC A;  1FPL A;  2WBD A;  3THI A;  4NF4 A;  4PE5 B;  4YB7 A;  1NL5 A;  2YJP A;  2DE2 A;  3TKD A;  4R6Y A;  2QMW A;  2F7B A;  3KGC A;  3K00 A;  4DLD A;  3RYD A;  3KJT A;  4LQ5 A;  1YTV A;  1IME A;  1S7Y A;  1EYI A;  2I48 A;  4GX6 A;  1OLA A;  1PDA A;  3MP1 A;  1O7T A;  4BLA A;  3PUY E;  3FVN A;  4MNC A;  3N94 A;  5DEX A;  1VR5 A;  2UVI A;  1EZO A;  3T9U A;  1XC1 A;  3S9L C;  1B3L A;  1MG1 A;  3K0V A;  3KC0 A;  3RT8 A;  2FA7 A;  2V93 A;  4C1T A;  4RXL A;  2RC8 A;  3OOA A;  3VXB A;  4N13 A;  3ROJ A;  4LZ5 A;  3PPO A;  1SW5 A;  2H5Y A;  5TPA B;  1T0K A;  3GBB A;  4OVR A;  1XT8 A;  4G2Z A;  4UA8 A;  2XXU A;  4C0R A;  4OVS A;  1A8E A;  2B4L A;  4JVI A;  4HCW A;  3CI8 A;  5FHM A;  2OWZ A;  4NWC A;  2CZK A;  1B5H A;  3K4U A;  5I2N A;  4QRZ A;  1BP5 A;  2Z8D A;  1PC3 A;  4MNI A;  4OEU A;  4WED A;  2GH9 A;  3RTW B;  4FIM A;  1Y4C A;  3U65 A;  4R72 A;  1JQF A;  4Q30 B;  4ZEB A;  4F18 A;  4GBW A;  4PF8 A;  3VVF A;  4F29 A;  4FEC A;  1UIU A;  3CIJ A;  3PUV E;  1FBG A;  4PP0 A;  3BIH A;  1DPE A;  3MZ9 A;  4IB2 A;  1NV0 A;  2NWJ A;  5I59 A;  3CG3 A;  4U22 A;  3MVZ A;  4O8M A;  4NF6 A;  2XXV A;  4YIC A;  3C31 A;  1H43 A;  1ZBM A;  3QUJ A;  1A55 A;  3KFM A;  4GWS A;  1DMB A;  3K6U A;  4N8G A;  2ZNU A;  3MAM A;  3LSL A;  4F31 B;  1FTO A;  2UYE A;  1IMA A;  3KJ7 A;  3HFU A;  1R1N A;  2XXX A;  1QKA A;  1R9L A;  3FGS A;  2XXP A;  2PYY A;  3W9W A;  5ITO A;  4OZ9 A;  4DZ1 A;  3TCG A;  2VD2 A;  1M5C A;  2V84 A;  4JWY A;  4NED A;  1B3H A;  2THI A;  1NUY A;  3EHT A;  2QS3 A;  5AE4 A;  3TTR A;  1LFH A;  3AXF A;  2HFB A;  4QSC A;  1BKA A;  2F34 A;  4BDO A;  3PMX A;  4JWX A;  1DOT A;  5TP9 B;  4Q8R A;  4RPO A;  4JDF A;  3T9V A;  3IAZ A;  5I56 B;  1MXV A;  4OEN A;  2DWA A;  1HSJ A;  1CNQ A;  3OEK A;  4H65 A;  5I2K A;  2ESN A;  4QF9 A;  4P0G A;  4ZEF A;  3TEL A;  1O64 A;  4PF6 A;  5DYH A;  3PU5 A;  3FVG A;  2G29 A;  3C9H A;  2H9B A;  4DXU A;  2ZZX A;  3R26 A;  4MCO A;  3BFU A;  1UQW A;  4OVP A;  4QFP A;  1B4H A;  4P0I A;  3CVG A;  1B7Z A;  1YPN A;  2XX9 A;  1N84 A;  1POY 1;  1LBX A;  3GYY A;  4EXK A;  3O97 A;  3C4M A;  3D4G A;  4KYE A;  3U8Q A;  1GVC A;  3T0J A;  1MS7 A;  2QS2 A;  3PV0 E;  4KHZ E;  1ELJ A;  1EYJ A;  4GL8 A;  3IL1 B;  2Y84 A;  3S2V A; 
#chains in the Genus database with same CATH homology
 3IOT A;  2G93 A;  2UYF A;  4ND9 A;  2DE4 A;  1SDX A;  5ITP A;  1B46 A;  4H8J A;  4LUB A;  2QMX A;  3T66 A;  1EZ9 A;  2XD2 A;  3LBS A;  4MBP A;  5CMM A;  3N5L A;  4JB7 A;  4N07 A;  3H3G A;  3UK4 A;  1B51 A;  1O63 A;  3H6T A;  2ZNT A;  3PPP A;  3N6T A;  4I62 A;  2O51 A;  1SYI A;  4H1X A;  1MY2 A;  3HST A;  1LFI A;  2I3V A;  3U93 A;  5FHO A;  1R9Q A;  3OD7 A;  1MXZ A;  3MUQ A;  2VD3 A;  1D9V A;  2Y7R A;  5IKB A;  1I69 A;  1JET A;  3EHS A;  4YB5 A;  5ISU A;  4R74 A;  2XD3 A;  4QFK A;  2Q8J A;  3O6G A;  4H8I A;  4H6D A;  3VDF A;  4EF2 A;  2F8D A;  3K01 A;  3TCF A;  3IOV A;  1R6Z A;  4X48 A;  4QSD A;  3MVX A;  3IJX B;  1IXI A;  3UGW A;  1MPD A;  4GD5 A;  4OER A;  4UAC A;  4YAH X;  4POW A;  2HXW A;  4YB6 A;  1S50 A;  2GFE A;  1NFT A;  5FTH A;  3MBP A;  5L9M A;  1B3F A;  1B32 A;  1J1N A;  1AIV A;  1YAE A;  2PMS A;  3T96 B;  2HAU A;  3DEL B;  3G7W A;  5TPA A;  5I58 A;  4U1O A;  2Y7I A;  4GFR A;  2QPQ A;  2OCU A;  4NF5 A;  4NMY A;  1GGG A;  3Q27 A;  1PBP A;  3TQW A;  4G68 C;  3EHU A;  1A99 A;  3RTF B;  3WAF A;  3JV9 A;  4F3B A;  2DWI A;  4U4S A;  3H4Z A;  1B7U A;  4OFO A;  3S9E A;  1IXH A;  2ZMB A;  2GHA A;  3FJ7 A;  1Y1M A;  3QIM A;  4NF8 A;  4EXL A;  5B7D A;  5JTY B;  4ZE9 A;  1BIY A;  1LLS A;  1MY4 A;  1Y3N A;  1US4 A;  3FJM A;  4OWD A;  3IX1 A;  3T93 B;  2I0C A;  4IGT A;  3I6V A;  4QFL A;  3E9X A;  3DM0 A;  5CMC A;  5I57 B;  3RT6 B;  1XS5 A;  4U2R A;  3RY3 A;  4R6K A;  3KEI A;  1TT1 A;  1SQY A;  3O2A A;  3IJO B;  1OQG A;  1I6A A;  1VFE A;  4X1D A;  4QHQ A;  4TOZ A;  3TZA A;  4E0W A;  4FAJ A;  2PVU A;  4FED A;  5H8H A;  5AA4 B;  2UVG A;  1Y9U A;  1IEJ A;  2KLF A;  1URS A;  2D3I A;  1N7X A;  3C32 A;  3IO4 A;  2VP1 A;  2PT1 A;  4GL0 A;  3RNN A;  4U1Z A;  1FQB A;  3T22 A;  3PUW E;  4F2Q A;  2I4B A;  1OQH A;  1QUJ A;  2O1L A;  3DP6 A;  3FVO A;  2F97 A;  3HCQ A;  3MWB A;  4GRK A;  3GBA A;  4M1V A;  4ZDM A;  5TP9 A;  3PPN A;  3SKP A;  3VXC A;  1EU8 A;  1DTG A;  3K6X A;  4DCY A;  2I6E A;  5BUU A;  2ZYO A;  4JBZ A;  2H99 A;  3QXM A;  1L5T A;  5CBR A;  4GLI A;  1AH5 A;  4HTG A;  3BKI B;  5KDT A;  1B6H A;  1A8F A;  1P1W A;  2CMO A;  5K2X A;  3OO7 A;  4ELO A;  3IB2 A;  2UVJ A;  2XXY A;  3K2D A;  1ATG A;  2ONK E;  3D4C A;  3HHF A;  4FJP A;  4JSD A;  1A40 A;  1OLC A;  1EH3 A;  3H06 B;  4F1V A;  3T9X B;  4ELQ A;  1B3E A;  1B58 A;  4GF8 A;  2NUV A;  4XXU A;  5JEI A;  2RCA A;  4DCX A;  2AL4 A;  2DYX A;  4O3C A;  2OLB A;  3M3L A;  1UIV A;  3N26 A;  5K2Y A;  1FQF A;  2O68 A;  3U92 A;  1RYX A;  4OFL A;  2R6G E;  5I57 A;  3ZS6 A;  1B7H A;  4DIG A;  1EZP A;  2A5T A;  1N0T A;  1MY3 A;  2ZYN A;  5DVF A;  4ELP A;  3FIR A;  2I58 A;  1N3X A;  2VGQ A;  3MP8 A;  2AL5 A;  3FAT A;  1S9T A;  1WDN A;  2P1S A;  1SYH A;  1QVS A;  1SW1 A;  2V25 A;  2REG A;  3IO6 A;  3FVK A;  1P1U A;  3G3I A;  4NF4 B;  1BLF A;  3FJG A;  2ZXT A;  4R9G A;  3V8X B;  5BWJ A;  1B52 A;  3K1M A;  4R6H A;  2F36 A;  3L6G A;  4EF1 A;  1JVX A;  4WEP A;  4M4G A;  5CM6 A;  1TXF A;  4I1D A;  4RPN A;  3QUF A;  1QUK A;  1Y20 A;  4OYV A;  1IXG A;  2I49 A;  5F7V A;  1AL3 A;  5CMK A;  2Y7W A;  4I8C A;  3SES A;  1FQC A;  4OHN A;  4H5F A;  3I3V A;  1LAG E;  3TQL A;  2E1S A;  1FQD A;  3LSX A;  1MXY A;  1I6Q A;  3C33 A;  3OO6 A;  3E4R A;  4LZ8 A;  2HZK A;  4OMB A;  3ZSF A;  3VVD A;  3CG1 A;  3MPK A;  3GXA A;  1H76 A;  4IGR A;  4ZEI A;  1FQA A;  1A7L A;  4YKI A;  1IXC A;  5DT6 A;  1FTJ A;  1NNK A;  3FV2 A;  4EQ7 A;  4I9D A;  2RC9 A;  3ONM A;  5H8Q B;  1P1N A;  3ZKL A;  3L6H A;  3MC2 A;  2VHA A;  3SEX A;  4RNS A;  1SW4 A;  4ZZA A;  4NE4 A;  5AA1 A;  1HSL A;  1NNP A;  2HCA A;  4Q0C A;  1P99 A;  4ELR A;  2Q88 A;  2XHD A;  3KSJ A;  3OEL A;  3O29 A;  1KWH A;  3IOW A;  1Q1K A;  4YKK A;  1MY0 A;  1OIB A;  2O84 X;  4O3B A;  3VVE A;  4AB5 A;  1MDP 1;  2QS1 A;  1TFD A;  2RKM A;  3K6W A;  4ZEK A;  1YCJ A;  5M2V A;  4ISU A;  5HM4 B;  5ICQ A;  3RLF E;  1ZMG A;  2CZL A;  2X7P A;  1WOD A;  3SET A;  3PPQ A;  1B1H A;  2AYS A;  3EF7 A;  4XKP A;  4PFW A;  1FQE A;  4IO3 A;  3PD8 A;  1UTH B;  4ZEC A;  3A09 A;  2V3U A;  3Q29 A;  3GLB A;  4IO5 A;  3ODB A;  1N76 A;  2QS4 A;  3HHG A;  4L17 A;  2QRY A;  3JYR A;  2WKY A;  1MPC A;  5I2N A;  5KCJ A;  4ZZE A;  2DOJ A;  2IA4 A;  3SEY A;  3THI A;  2XX8 A;  1SI0 A;  3OSR A;  1LBB A;  2ABH A;  1ANF A;  1FTL A;  1FW0 A;  2F6P A;  1XOC A;  3CR9 A;  3FAS A;  3MZB A;  2F5X A;  4NF4 A;  4OET A;  1B3G A;  4MH5 A;  5HPQ A;  4PE5 B;  3S4U A;  2YLN A;  4RYA A;  4YB7 A;  1IZ1 A;  1NL5 A;  4YZZ A;  3LC8 A;  1MQH A;  2B65 A;  4GXS B;  2YJP A;  1LB9 A;  2DE2 A;  3B6T A;  3PD9 A;  4MLQ A;  3TDJ A;  1NH7 A;  4R6Y A;  2YPN A;  3TKD A;  3TTM A;  3ECR A;  2QMW A;  1Z7M E;  2F7B A;  1JEU A;  3K02 A;  2D5W A;  1MH3 A;  3KGC A;  1H44 A;  4BDR A;  3K00 A;  4DLD A;  4JSO A;  1SW2 A;  3QAX A;  3OEN A;  3KJT A;  4HCY A;  3TFL A;  2Q89 A;  3R6U A;  4LQ5 A;  3K1P A;  1YTV A;  4RK9 A;  4BDL A;  3VLV A;  3EPE A;  1MXU A;  4JWO A;  2AIX A;  3C36 A;  3A3C A;  3TAJ A;  2B3F A;  1S7Y A;  3W15 C;  1II5 A;  1I6B A;  3RGY A;  1IIT A;  3MJN A;  4WKM A;  4RK2 A;  3U1O A;  1SD3 A;  1TWY A;  2DQV A;  1MRP A;  2I48 A;  3KZG A;  3OXN A;  1QUI A;  3IK6 B;  4X1B A;  3VFJ A;  4GWO A;  2I0B A;  2M8C A;  3MW0 A;  1JNF A;  4P11 A;  2QSX A;  3N6U A;  4KI0 E;  1OLA A;  1PDA A;  1URD A;  3MP1 A;  4RJZ A;  3UIF A;  5I84 A;  4EQ9 A;  4MLV A;  1BTJ A;  1O7T A;  3FUZ A;  1QUL A;  4BLA A;  2O7U A;  3PUY E;  4R73 A;  2XXH A;  4U21 A;  2DP8 A;  3Q26 A;  1PB7 A;  3FVN A;  5L9S A;  4GIZ A;  3M3F A;  3H6U A;  4BDM A;  3CRB A;  3KSX A;  3OO9 A;  2XXQ A;  5A5X B;  3N94 A;  3O6I A;  5DEX A;  1VR5 A;  1QJM A;  5FTI A;  2UVI A;  4FOR A;  3G3J A;  1GV8 A;  4TLL B;  1XC1 A;  2PX1 A;  3T9U A;  4FAT A;  3S9L C;  5CC2 A;  1B3L A;  1MG1 A;  2QL3 A;  2Z8F A;  3K0V A;  2XXW A;  3G3G A;  1B40 A;  4NWD A;  4OES A;  2FA7 A;  2ONS A;  4XKQ A;  3LSW A;  2V93 A;  5CI5 A;  3RT8 A;  4GXA A;  4G4P A;  4C1T A;  4RXL A;  3MQ9 A;  2RC8 A;  1PB8 A;  3KN7 A;  1SI1 A;  3OOA A;  2X7Q A;  5H8H B;  3VXB A;  5AA4 A;  4N13 A;  4BDN A;  1JW5 A;  1PEB A;  5DVI A;  4Z0I A;  4LZ5 A;  4R2F A;  3PPO A;  1SW5 A;  2H5Y A;  5CBS A;  5TPA B;  4F3P A;  5I58 B;  1T0K A;  4OXV A;  1QW0 A;  3OEM A;  3F11 A;  3GBB A;  5DVJ A;  2F7A A;  3U72 A;  4LON B;  3H03 A;  2OWS A;  2OZZ A;  1MQD A;  3SEV A;  1TFA A;  2Q2C A;  1M5B A;  1XT8 A;  1M5E A;  2HQ0 A;  2XX7 A;  4G2Z A;  4UA8 A;  5CMB A;  3UP9 A;  2XXU A;  4C0R A;  3QSL A;  5F1Q A;  5CRY A;  4DXB A;  4PQJ A;  3RN8 A;  1ZKB A;  2ANJ A;  1A8E A;  3BBR A;  2F35 A;  3T9H B;  4HCW A;  1N04 A;  1MQG A;  3ILT B;  4OQO A;  4POX A;  4DXC A;  3CI8 A;  1D4N A;  5FHM A;  1MPB A;  3VE1 B;  3TTK A;  1POT A;  4X9T A;  3UOR A;  4NWC A;  5LOM A;  2A5S A;  2Y7P A;  3B6Q A;  4F1Y A;  4IY5 A;  3FZV A;  2NOO A;  3IOR A;  1B5H A;  1QKB A;  3K4U A;  3KN8 A;  1MDQ A;  1M5F A;  1B0H A;  2IEE A;  2ZNS A;  4OEV A;  4XTC Q;  1B0L A;  4OVJ A;  2O69 A;  3S9N C;  5H8N B;  1XHY A;  3IR1 A;  3O66 A;  4IO6 A;  1MM6 A;  4QRZ A;  4Z7E A;  4Q5T A;  1BP5 A;  3K6V A;  2Z8D A;  1PC3 A;  5DEX B;  1LGB C;  4KYS A;  2X26 A;  1H45 A;  4OEU A;  4WED A;  5AA2 B;  3LSF B;  1URG A;  2GH9 A;  3G3H A;  2O6A A;  2O1M A;  4FIM A;  3RTW B;  4C1U A;  3U94 A;  4KYD A;  1LB8 A;  1OVT A;  1Y4C A;  3EQ1 A;  3TYH A;  4F3G A;  4FEB A;  4R72 A;  5J1D A;  3S9M C;  1XVX A;  1JQF A;  4GVO A;  1MQJ A;  3HV1 A;  1P1O A;  3ZKK A;  4Q30 B;  4ZEB A;  3QK6 A;  3B7D A;  3MVW A;  4NF8 B;  2Z22 A;  3TMG A;  1LST A;  4F18 A;  3V89 B;  1USY H;  2E0S A;  3VVF A;  4F29 A;  5L8D A;  4OFJ A;  1LFG A;  2DXR A;  3DP8 A;  4FEC A;  1UIU A;  3CIJ A;  1ZLQ A;  1JEV A;  4TLM B;  3PUV E;  4KCC A;  4N6P A;  4FE8 A;  4BDQ A;  1UTB B;  2DXY A;  4PP0 A;  4G8H A;  4PFT A;  2DVZ A;  3SEU A;  2LAO A;  4ONY A;  3M3K A;  4IO7 A;  4NTL A;  3TPA A;  4KD5 A;  3UN6 A;  4F2O A;  5AA2 A;  5FHN A;  5IAI A;  4H5G A;  3FXR A;  1DPE A;  4KQP A;  4YU0 A;  4R9F A;  4ESX A;  2DWJ A;  3MZ9 A;  2OWT A;  2XXI A;  1CB6 A;  4IB2 A;  3DLN A;  2NWJ A;  2PT2 A;  1M5D A;  4F3S A;  1WVJ A;  5I59 A;  2REJ A;  3CG3 A;  4U22 A;  2VOZ A;  4LP2 B;  4LQ2 A;  3MVZ A;  4EUO A;  1LAF E;  3V83 A;  3HN0 A;  1VE4 A;  1XVY A;  2R71 A;  3VV5 A;  3WAE A;  2HEU A;  2Z8E A;  3CFL A;  3VLW A;  4DE8 A;  4G68 B;  4IO4 A;  5EYF A;  4NF6 A;  2BJJ X;  1UTB A;  4YKP A;  1DTZ A;  2XXV A;  3C31 A;  3CSG A;  3KOS A;  3PGF A;  4YIC A;  2H25 A;  1H43 A;  1FTK A;  1B9J A;  4LVQ A;  1ZBM A;  3IB0 A;  4KR5 A;  5JTY A;  1ZIU A;  3PMW A;  1A55 A;  3QUJ A;  3KFM A;  1DMB A;  3K6U A;  4QSE A;  3IOU A;  1MH4 A;  2ZNU A;  5TU0 A;  3MAM A;  1Q35 A;  3CSB A;  3LSL A;  4AB6 A;  4F31 B;  4XKN A;  1FTO A;  3FXQ A;  4KCD A;  2ALU A;  2ONR A;  4YMA A;  5AA2 D;  2UYE A;  3GZG A;  3KJ7 A;  2V3Q A;  2W7Y A;  2HZL A;  2NVU B;  3KOT A;  3LR1 A;  4EDP A;  3H6V A;  3MPL A;  1R1N A;  1SVX B;  1Y3Q A;  2XXX A;  5KCJ B;  3TOD A;  1QKA A;  1R9L A;  1VSO A;  2Q2A A;  3BFT A;  3FGS A;  2V3T A;  4G77 A;  4PFY A;  2XXP A;  1ZU0 A;  1B05 A;  2PYY A;  4IY6 A;  4OTE A;  2Q9T A;  1IIW A;  3RQT A;  4KPT A;  3VLU A;  3W9W A;  5ITO A;  3G3K A;  2XXT A;  2DSF A;  3ILU B;  4OZ9 A;  2RF1 A;  3RPW A;  4WXJ A;  4DZ1 A;  1SBP A;  3TCG A;  2GHB A;  2VD2 A;  4F1U A;  1IUD A;  1M5C A;  2P0S A;  3KBR A;  2H98 A;  2F78 A;  3E13 X;  2V84 A;  3O9P A;  2H4I A;  3Q28 A;  4JWY A;  4NED A;  3OO8 A;  3HO7 A;  1B3H A;  2THI A;  3KG2 A;  1MXX A;  3M8U A;  4YMB A;  1Y3P A;  4PFU A;  3EHT A;  2QS3 A;  3FXU A;  4K3F A;  3H7M A;  4QFO A;  3TCH A;  5AE4 A;  3TTR A;  5H8F B;  1PB9 A;  1F9B A;  1MY1 A;  1P1Q A;  1LFH A;  3AXF A;  1OVB A;  2HFB A;  2HAV A;  1GTK A;  1H3D A;  2O7I A;  3PUX E;  4G68 A;  1NMU A;  1OMP A;  1B1X A;  4QSC A;  1BKA A;  2B3B A;  3C35 A;  5I2K B;  4H0W A;  1JW4 A;  2GRV A;  4AQ4 A;  2PBW A;  2F34 A;  4U4X A;  1FCK A;  4BDO A;  2I4C A;  2I3W A;  3PMX A;  3FD3 A;  1IQ7 A;  4XKR A;  4JWX A;  2RC7 A;  5DTB A;  1NH8 A;  1DOT A;  1NKX A;  4R75 A;  1RYO A;  3CFX A;  5TP9 B;  4Q8R A;  4ZED A;  3K1N A;  1ZTY A;  5I59 B;  4PET A;  1LCT A;  4RPO A;  4JDF A;  1FTM A;  4F22 A;  1LBC A;  3T9V A;  3MZ1 A;  3PPR A;  4ZE8 A;  1N7W A;  4HS7 A;  4KFQ A;  2F6G A;  3IAZ A;  5I56 B;  1AMF A;  3A3U A;  3R7X A;  1MXV A;  2Y7K A;  4OEN A;  3SEW A;  2DWA A;  4THI A;  1D3K A;  1D9Y A;  1HSJ A;  4GQO A;  3OEK A;  3B6W A;  2Z23 A;  1B5I A;  4EQB A;  4MFI A;  1DSN A;  3G3F A;  4H65 A;  3USD A;  4HW8 A;  5I2K A;  5AA3 A;  2A5T B;  5A5X A;  3TEP A;  2ESN A;  3CFZ A;  1RKM A;  4QF9 A;  3TUS A;  1ZJL A;  2XXR A;  1B2H A;  4GOT A;  1US5 A;  4RA1 A;  1GR2 A;  4LAT A;  4XIG Q;  4ECF A;  1LAH E;  1N3W A;  3QYT A;  1JVY A;  4P0G A;  4ZEF A;  2NXO A;  3TEL A;  1O64 A;  4IO2 A;  3PUZ E;  5DYH A;  2DE3 A;  4F39 A;  3PU5 A;  3P7I A;  3FVG A;  1A54 A;  1DPP A;  2G29 A;  3DP4 A;  3MP6 A;  1MXW A;  4DDD A;  5KZT A;  2OBG A;  4H67 A;  3C9H A;  4NF5 B;  2DS9 A;  2H9B A;  2R9J A;  3R26 A;  1JW1 A;  4DXU A;  5JK4 A;  1B4Z A;  1NNF A;  2RCB A;  5KDT B;  3BFU A;  1UQW A;  5EHM A;  4QFP A;  3V5A A;  1B4H A;  4JXI A;  3IB1 A;  3HPI A;  3JZJ A;  3O28 A;  2UVH A;  5H8N A;  3SDF A;  4P0I A;  5I2N B;  5H8F A;  3CVG A;  1B7Z A;  2DVC A;  1YPN A;  2XX9 A;  1N84 A;  1POY 1;  1VFD A;  4LZ7 A;  1Y4T A;  2FNC A;  3PMV A;  4QFN A;  1MQI A;  4G8N A;  5B70 A;  1AOV A;  1B5J A;  2OK2 A;  1USY E;  3KN3 A;  3Q25 A;  4YKJ A;  1MM7 A;  2DWH A;  1HSE A;  5H8Q A;  3MVY A;  3RUM A;  3UA8 A;  2QJE A;  3SER A;  4NF6 B;  4EXK A;  2ZYK A;  3O97 A;  4R2B A;  3TTN A;  4O3A A;  5H8S A;  2UXA A;  3C4M A;  3D4G A;  4MF3 A;  2ZYM A;  4KYE A;  3U8Q A;  3W9V A;  1GVC A;  1Z7N E;  5L9O A;  5HBC A;  1MS7 A;  4G8M A;  2FYI A;  4U23 A;  1CE2 A;  3LUY A;  4ZS9 A;  2QS2 A;  3O6H A;  2RIN A;  1LCF A;  3H6W A;  3PV0 E;  4KHZ E;  4TQU Q;  1ELJ A;  2P2A A;  3I5O A;  1Y1Z A;  5I56 A;  1EZO A;  4F19 A;  4ESW A;  4GL8 A;  1NNT A;  3IL1 B;  5ICT A;  3EN3 A;  2F7C A;  2OJT A;  2Y84 A;  3FV1 A;  3OSQ A;  3TTL A;  1PBQ A;  3E3K A;  1LAX A;  2D21 A;  4LA9 A;  3OMB A;  3S2V A;  5EHS A;  4E0X A;  3C34 A;  1UTH A;  5ELV A;  4RY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...