5I5ZB

Cdk8-cycc in complex with 8-(1-methyl-2,2-dioxo-2,3-dihydro-1h-2l6-benzo[c]isothiazol-5-yl)-[1,6]naphthyridine-2-carboxylic acid methylamide
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
266
structure length
266
Chain Sequence
KAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title 2,8-Disubstituted-1,6-Naphthyridines and 4,6-Disubstituted-Isoquinolines with Potent, Selective Affinity for CDK8/19.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5i5zB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5i5zB01
4F7JB 2WXVB 2WPAB 5CYIB 1E9HB 5HBEB 2B9RA 1VOLA 3POMA 1GH6B 3EOCB 4YOZA 1H26B 1O9KA 3DDPB 4UN0A 3MY1B 1O9KB 4Y72B 5IDNB 4ELLA 4F6WB 4II5B 1VYWB 4CFNB 2C6TB 3K7AM 4EOIB 1XO2A 4NSTB 5HVYB 5LQFB 2EUFA 4CRLB 4BCJB 2WIHB 1D3UB 1JOWA 1JSTB 1N4MA 4OGRB 4BCFB 4EOKB 2R7GA 4EOOB 1UNHD 3MIAB 1OL2B 3M03A 5ACBA 1G3NC 1H1RB 2UUEB 4EOQB 2G9XB 3LQ5B 4CFVB 4F6UB 1VINA 2CCIB 3DOGB 1FVVB 1ZP2A 2PMIB 1H1SB 4BCNB 1OL1B 5EFQB 5IDPB 2UZLB 3G33B 2W96A 4BCOB 5IF1B 1FINB 2W9FA 2F2CA 1PKDB 2UZEB 2IVXA 1H1QB 5FGKB 1H27B 2WHBB 1JKWA 1H24B 1H1PB 1TFBA 1UNLD 2IW9B 2WEVB 4YOSA 4F70B 2C4GB 3MI9B 2PHGA 3MY5B 5LMKB 4RODA 1H4LD 4EOJB 4YC3B 1UNGD 2C5VB 1URCB 3TNIB 3BLHB 4BCND 2IW8B 2W99A 3H4CA 4CFXB 3TNWB 1W98B 5HBHB 1H25B 1JSUB 2C5OB 2PK9B 5HQ0B 3BHTB 4CXAB 4EOPB 1OKVB 4ELJA 1GUXB 4KRDB 4BCQB 4CFMB 4TTHA 2W2HA 1AISB 1OIYB 4F7LB 2C5XB 4BCHB 4CFWB 4EORB 3RGFB 2BPMB 3BLRB 1OGUB 5BNJB 4F7NB 1P5EB 4FX3B 1QMZB 2I53A 4KRCB 4EC8B 4BCQD 5I5ZB 3O0GD 1GY3B 3BLQB 5HNBB 3F5XB 2WMAB 5L2WB 3TN8B 2W9ZA 4YOOA 4CFUB 2JGZB 4BCPB 4BCMB 1AD6A 4EOLB 4OR5B 4EONB 1GUXA 3BHVB 3QHRB 1OKWB 4ROCA 4BCIB 2C5NB 3BHUB 1OIUB 2WIPB 5HBJB 4F6SB 1H28B 2WMBB 1BU2A 4EC9B 3QHWB 1OI9B 1F5QB 3EJ1B 2UZDB 4F7SB 4BCGB 2BKZB 4CFUD 4ROEA 4BCMD 4EOMB 4BCKB 1C9BA 2V22B 4IMYB 3TNHB 4I3ZB 5CEIB 2WFYB 5ICPB 2PK2A 2CCHB 2IW6B 1KXUA 4EOSB 2X1NB 3DDQB 2CJMB 2UZBB 4G6LB 3EIDB 2I40B 2QDJA
chains in the Genus database with same CATH superfamily
4HNUA 2WXVB 5CYIB 5HBEB 1H26B 1O9KA 4UN0A 3MY1B 4II5B 4CFNB 4BCJB 2ZPEB 5ACBA 1G3NC 1H1RB 2UUEB 1FVVB 1ZP2A 2CZ1B 3DJBA 5IDPB 3B57A 2UZEB 4YOSA 1JKWA 3VYHB 1UNLD 2IW9B 2CZ6B 4RODA 1H4LD 3QZ5B 3A8GB 1URCB 3BLHB 3H4CA 4BBSM 3TNWB 4BXXX 3A8OB 3QYEA 3BHTB 4CXAB 4EOPB 4ELJA 4BCQB 4OB2B 2W2HA 4OB1B 4M6VA 1E7PA 2C5XB 2BPMB 3VKHA 4F7NB 4FX3B 4EC8B 1GY3B 3BLQB 4MFEA 3F5XB 2W9ZA 2ZZDB 4BCPB 4CFUB 4BCMB 1AD6A 4EOLB 4F6SB 2WJ9A 1BU2A 3TW6A 2UZDB 2BKZB 2KMGA 4EOMB 2ZPIB 2V22B 4IMYB 3TNHB 5ICPB 4NC6A 3GTMS 4AKIA 2CJMB 2KR6A 2UZBB 2DXCB 4ZGDB 2WPAB 1E9HB 2B9RA 1VOLA 1O9KB 1VYWB 2PJQA 4EOIB 1XO2A 5HVYB 4CRLB 1JOWA 1JSTB 4EOOB 1UNHD 2G9XB 3HB9A 2DD4B 1H1SB 2IN3A 5DQWA 4AI6A 3G33B 1PKDB 3BG3A 1H1QB 4JX5A 5EJCA 1H24B 1H1PB 1IREB 4YC3B 1UNGD 1TD6A 4CFXB 2ZPHB 2DPPB 1JSUB 2C5OB 5HQ0B 3TW7A 3HBLA 2QQ8A 3WVDB 4CFMB 4F7LB 4HNVA 4EORB 3X20B 3X28B 4KRCB 2I53A 3NDQA 4BCQD 3HHTB 2WMAB 5L2WB 2QFZA 3DTOA 3A8HB 3QWLA 4EONB 4BCIB 2C5NB 2ZPBB 1OIUB 2WIPB 5HBJB 1OI9B 2ZPGB 3EJ1B 4BCGB 4CFUD 1V29B 4BCMD 4BCKB 2CYZB 2G77A 2PK2A 2CCHB 2IW6B 4EOSB 3QYGB 4G6LB 2I40B 2QDJA 2BS4A 3HZJA 4F7JB 4FM4B 3POMA 1GH6B 3EOCB 1UGSB 2DD5B 4Y72B 4ELLA 4F6WB 3WVEB 2C6TB 3K7AM 4BY7X 3A8MB 4NSTB 5LQFB 2EUFA 2WIHB 1N4MA 4BCFB 4EOKB 2R7GA 3MIAB 3M03A 4F6UB 1VINA 2PMIB 4BCNB 1UGRB 2UZLB 2W96A 2QF7A 3X25B 4BCOB 5IF1B 1FINB 2F2CA 4MIMA 4AKHA 1H27B 2WEVB 2C4GB 3MI9B 2PHGA 2C5VB 2LW4A 3QXEB 3VYGB 1QLBA 2W99A 4HNTA 4LOCA 4TTHA 1AISB 1OIYB 4CFWB 3RGFB 4ZGJB 4BBRM 1OGUB 5BNJB 3HO8A 4HL4A 4ZGEB 1ENWA 2JGZB 4JX4A 3VKGA 4OR5B 3BHVB 4ROCA 3KHIA 3BHUB 3QYBA 1H28B 2WMBB 4EC9B 1C9BA 1UGPB 4AKGA 3A8LB 4I3ZB 2WFYB 1KXUA 2DMEA 2ZPFB 3PO3S 2X1NB 3DDQB 2D0QB 3BG5A 4BY1X 4YOZA 4OB0B 3DDPB 5IDNB 1UGQB 2ZCFB 1D3UB 4OGRB 1OL2B 4MFDA 3X24B 4EOQB 3LQ5B 4CFVB 2CCIB 3DOGB 1OL1B 5EFQB 4OB3B 2W9FA 2IVXA 5FGKB 2WHBB 1TFBA 4F70B 3QYHB 5LMKB 3MY5B 4EOJB 2DXBB 3TNIB 5IHYA 4BCND 2IW8B 1W98B 5HBHB 1H25B 2PK9B 1OKVB 1GUXB 4KRDB 2QGSA 4QSHA 3X26B 4BCHB 2QDYB 4HLQA 2AHJB 3BLRB 1P5EB 1QMZB 3BG9A 5I5ZB 3O0GD 3QZ9B 5HNBB 4Z6YA 3TN8B 3DL1A 1FKMA 4YOOA 2BS2A 1GUXA 3QHRB 1OKWB 2CZ0B 3QHWB 1F5QB 4F7SB 4JX6A 4ROEA 5CEIB 2CZ7B 1AHJB 3EIDB 5DQVA 2BS3A
chains in the Genus database with same CATH topology
4F7JB 2WXVB 2WPAB 5CYIB 1E9HB 5HBEB 2B9RA 1VOLA 3POMA 1GH6B 3EOCB 4YOZA 1H26B 1O9KA 3DDPB 4UN0A 3MY1B 1O9KB 4Y72B 5IDNB 4ELLA 4F6WB 4II5B 1VYWB 4CFNB 2C6TB 3K7AM 4EOIB 1XO2A 4NSTB 5HVYB 5LQFB 2EUFA 4CRLB 4BCJB 2WIHB 1D3UB 1JOWA 1JSTB 1N4MA 4OGRB 4BCFB 4EOKB 2R7GA 4EOOB 1UNHD 3MIAB 1OL2B 3M03A 5ACBA 1G3NC 1H1RB 2UUEB 4EOQB 2G9XB 3LQ5B 4CFVB 4F6UB 1VINA 2CCIB 3DOGB 1FVVB 1ZP2A 2PMIB 1H1SB 4BCNB 1OL1B 5EFQB 5IDPB 2UZLB 3G33B 2W96A 4BCOB 5IF1B 1FINB 2W9FA 2F2CA 1PKDB 2UZEB 2IVXA 1H1QB 5FGKB 1H27B 2WHBB 1JKWA 1H24B 1H1PB 1TFBA 1UNLD 2IW9B 2WEVB 4YOSA 4F70B 2C4GB 3MI9B 2PHGA 3MY5B 5LMKB 4RODA 1H4LD 4EOJB 4YC3B 1UNGD 2C5VB 1URCB 3TNIB 3BLHB 4BCND 2IW8B 2W99A 3H4CA 4CFXB 3TNWB 1W98B 5HBHB 1H25B 1JSUB 2C5OB 2PK9B 5HQ0B 3BHTB 4CXAB 4EOPB 1OKVB 4ELJA 1GUXB 4KRDB 4BCQB 4CFMB 4TTHA 2W2HA 1AISB 1OIYB 4F7LB 2C5XB 4BCHB 4CFWB 4EORB 3RGFB 2BPMB 3BLRB 1OGUB 5BNJB 4F7NB 1P5EB 4FX3B 1QMZB 2I53A 4KRCB 4EC8B 4BCQD 5I5ZB 3O0GD 1GY3B 3BLQB 5HNBB 3F5XB 2WMAB 5L2WB 3TN8B 2W9ZA 4YOOA 4CFUB 2JGZB 4BCPB 4BCMB 1AD6A 4EOLB 4OR5B 4EONB 1GUXA 3BHVB 3QHRB 1OKWB 4ROCA 4BCIB 2C5NB 3BHUB 1OIUB 2WIPB 5HBJB 4F6SB 1H28B 2WMBB 1BU2A 4EC9B 3QHWB 1OI9B 1F5QB 3EJ1B 2UZDB 4F7SB 4BCGB 2BKZB 4CFUD 4ROEA 4BCMD 4EOMB 4BCKB 1C9BA 2V22B 4IMYB 3TNHB 4I3ZB 5CEIB 2WFYB 5ICPB 2PK2A 2CCHB 2IW6B 1KXUA 4EOSB 2X1NB 3DDQB 2CJMB 2UZBB 4G6LB 3EIDB 2I40B 2QDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7J B;  2WXV B;  2WPA B;  5CYI B;  1E9H B;  5HBE B;  2B9R A;  1VOL A;  3POM A;  1GH6 B;  3EOC B;  4YOZ A;  1H26 B;  1O9K A;  3DDP B;  4UN0 A;  3MY1 B;  1O9K B;  4Y72 B;  5IDN B;  4ELL A;  4F6W B;  4II5 B;  1VYW B;  4CFN B;  2C6T B;  3K7A M;  4EOI B;  1XO2 A;  4NST B;  5HVY B;  5LQF B;  2EUF A;  4CRL B;  4BCJ B;  2WIH B;  1D3U B;  1JOW A;  1JST B;  1N4M A;  4OGR B;  4BCF B;  4EOK B;  2R7G A;  4EOO B;  1UNH D;  3MIA B;  1OL2 B;  3M03 A;  5ACB A;  1G3N C;  1H1R B;  2UUE B;  4EOQ B;  2G9X B;  3LQ5 B;  4CFV B;  4F6U B;  1VIN A;  2CCI B;  3DOG B;  1FVV B;  1ZP2 A;  2PMI B;  1H1S B;  4BCN B;  1OL1 B;  5EFQ B;  5IDP B;  2UZL B;  3G33 B;  2W96 A;  4BCO B;  5IF1 B;  1FIN B;  2W9F A;  2F2C A;  1PKD B;  2UZE B;  2IVX A;  1H1Q B;  5FGK B;  1H27 B;  2WHB B;  1JKW A;  1H24 B;  1H1P B;  1TFB A;  1UNL D;  2IW9 B;  2WEV B;  4YOS A;  4F70 B;  2C4G B;  3MI9 B;  2PHG A;  3MY5 B;  5LMK B;  4ROD A;  1H4L D;  4EOJ B;  4YC3 B;  1UNG D;  2C5V B;  1URC B;  3TNI B;  3BLH B;  4BCN D;  2IW8 B;  2W99 A;  3H4C A;  4CFX B;  3TNW B;  1W98 B;  5HBH B;  1H25 B;  1JSU B;  2C5O B;  2PK9 B;  5HQ0 B;  3BHT B;  4CXA B;  4EOP B;  1OKV B;  4ELJ A;  1GUX B;  4KRD B;  4BCQ B;  4CFM B;  4TTH A;  2W2H A;  1AIS B;  1OIY B;  4F7L B;  2C5X B;  4BCH B;  4CFW B;  4EOR B;  3RGF B;  2BPM B;  3BLR B;  1OGU B;  5BNJ B;  4F7N B;  1P5E B;  4FX3 B;  1QMZ B;  2I53 A;  4KRC B;  4EC8 B;  4BCQ D;  5I5Z B;  3O0G D;  1GY3 B;  3BLQ B;  5HNB B;  3F5X B;  2WMA B;  5L2W B;  3TN8 B;  2W9Z A;  4YOO A;  4CFU B;  2JGZ B;  4BCP B;  4BCM B;  1AD6 A;  4EOL B;  4OR5 B;  4EON B;  1GUX A;  3BHV B;  3QHR B;  1OKW B;  4ROC A;  4BCI B;  2C5N B;  3BHU B;  1OIU B;  2WIP B;  5HBJ B;  4F6S B;  1H28 B;  2WMB B;  1BU2 A;  4EC9 B;  3QHW B;  1OI9 B;  1F5Q B;  3EJ1 B;  2UZD B;  4F7S B;  4BCG B;  2BKZ B;  4CFU D;  4ROE A;  4BCM D;  4EOM B;  4BCK B;  1C9B A;  2V22 B;  4IMY B;  3TNH B;  4I3Z B;  5CEI B;  2WFY B;  5ICP B;  2PK2 A;  2CCH B;  2IW6 B;  1KXU A;  4EOS B;  2X1N B;  3DDQ B;  2CJM B;  2UZB B;  4G6L B;  3EID B;  2I40 B;  2QDJ A; 
#chains in the Genus database with same CATH topology
 4HNU A;  2WXV B;  5CYI B;  5HBE B;  1H26 B;  1O9K A;  4UN0 A;  3MY1 B;  4II5 B;  4CFN B;  4BCJ B;  2ZPE B;  5ACB A;  1G3N C;  1H1R B;  2UUE B;  1FVV B;  1ZP2 A;  2CZ1 B;  3DJB A;  5IDP B;  3B57 A;  2UZE B;  4YOS A;  1JKW A;  3VYH B;  1UNL D;  2IW9 B;  2CZ6 B;  4ROD A;  1H4L D;  3QZ5 B;  3A8G B;  1URC B;  3BLH B;  3H4C A;  4BBS M;  3TNW B;  4BXX X;  3A8O B;  3QYE A;  3BHT B;  4CXA B;  4EOP B;  4ELJ A;  4BCQ B;  4OB2 B;  2W2H A;  4OB1 B;  4M6V A;  1E7P A;  2C5X B;  2BPM B;  3VKH A;  4F7N B;  4FX3 B;  4EC8 B;  1GY3 B;  3BLQ B;  4MFE A;  3F5X B;  2W9Z A;  2ZZD B;  4BCP B;  4CFU B;  4BCM B;  1AD6 A;  4EOL B;  4F6S B;  2WJ9 A;  1BU2 A;  3TW6 A;  2UZD B;  2BKZ B;  2KMG A;  4EOM B;  2ZPI B;  2V22 B;  4IMY B;  3TNH B;  5ICP B;  4NC6 A;  3GTM S;  4AKI A;  2CJM B;  2KR6 A;  2UZB B;  2DXC B;  4ZGD B;  2WPA B;  1E9H B;  2B9R A;  1VOL A;  1O9K B;  1VYW B;  2PJQ A;  4EOI B;  1XO2 A;  5HVY B;  4CRL B;  1JOW A;  1JST B;  4EOO B;  1UNH D;  2G9X B;  3HB9 A;  2DD4 B;  1H1S B;  2IN3 A;  5DQW A;  4AI6 A;  3G33 B;  1PKD B;  3BG3 A;  1H1Q B;  4JX5 A;  5EJC A;  1H24 B;  1H1P B;  1IRE B;  4YC3 B;  1UNG D;  1TD6 A;  4CFX B;  2ZPH B;  2DPP B;  1JSU B;  2C5O B;  5HQ0 B;  3TW7 A;  3HBL A;  2QQ8 A;  3WVD B;  4CFM B;  4F7L B;  4HNV A;  4EOR B;  3X20 B;  3X28 B;  4KRC B;  2I53 A;  3NDQ A;  4BCQ D;  3HHT B;  2WMA B;  5L2W B;  2QFZ A;  3DTO A;  3A8H B;  3QWL A;  4EON B;  4BCI B;  2C5N B;  2ZPB B;  1OIU B;  2WIP B;  5HBJ B;  1OI9 B;  2ZPG B;  3EJ1 B;  4BCG B;  4CFU D;  1V29 B;  4BCM D;  4BCK B;  2CYZ B;  2G77 A;  2PK2 A;  2CCH B;  2IW6 B;  4EOS B;  3QYG B;  4G6L B;  2I40 B;  2QDJ A;  2BS4 A;  3HZJ A;  4F7J B;  4FM4 B;  3POM A;  1GH6 B;  3EOC B;  1UGS B;  2DD5 B;  4Y72 B;  4ELL A;  4F6W B;  3WVE B;  2C6T B;  3K7A M;  4BY7 X;  3A8M B;  4NST B;  5LQF B;  2EUF A;  2WIH B;  1N4M A;  4BCF B;  4EOK B;  2R7G A;  3MIA B;  3M03 A;  4F6U B;  1VIN A;  2PMI B;  4BCN B;  1UGR B;  2UZL B;  2W96 A;  2QF7 A;  3X25 B;  4BCO B;  5IF1 B;  1FIN B;  2F2C A;  4MIM A;  4AKH A;  1H27 B;  2WEV B;  2C4G B;  3MI9 B;  2PHG A;  2C5V B;  2LW4 A;  3QXE B;  3VYG B;  1QLB A;  2W99 A;  4HNT A;  4LOC A;  4TTH A;  1AIS B;  1OIY B;  4CFW B;  3RGF B;  4ZGJ B;  4BBR M;  1OGU B;  5BNJ B;  3HO8 A;  4HL4 A;  4ZGE B;  1ENW A;  2JGZ B;  4JX4 A;  3VKG A;  4OR5 B;  3BHV B;  4ROC A;  3KHI A;  3BHU B;  3QYB A;  1H28 B;  2WMB B;  4EC9 B;  1C9B A;  1UGP B;  4AKG A;  3A8L B;  4I3Z B;  2WFY B;  1KXU A;  2DME A;  2ZPF B;  3PO3 S;  2X1N B;  3DDQ B;  2D0Q B;  3BG5 A;  4BY1 X;  4YOZ A;  4OB0 B;  3DDP B;  5IDN B;  1UGQ B;  2ZCF B;  1D3U B;  4OGR B;  1OL2 B;  4MFD A;  3X24 B;  4EOQ B;  3LQ5 B;  4CFV B;  2CCI B;  3DOG B;  1OL1 B;  5EFQ B;  4OB3 B;  2W9F A;  2IVX A;  5FGK B;  2WHB B;  1TFB A;  4F70 B;  3QYH B;  5LMK B;  3MY5 B;  4EOJ B;  2DXB B;  3TNI B;  5IHY A;  4BCN D;  2IW8 B;  1W98 B;  5HBH B;  1H25 B;  2PK9 B;  1OKV B;  1GUX B;  4KRD B;  2QGS A;  4QSH A;  3X26 B;  4BCH B;  2QDY B;  4HLQ A;  2AHJ B;  3BLR B;  1P5E B;  1QMZ B;  3BG9 A;  5I5Z B;  3O0G D;  3QZ9 B;  5HNB B;  4Z6Y A;  3TN8 B;  3DL1 A;  1FKM A;  4YOO A;  2BS2 A;  1GUX A;  3QHR B;  1OKW B;  2CZ0 B;  3QHW B;  1F5Q B;  4F7S B;  4JX6 A;  4ROE A;  5CEI B;  2CZ7 B;  1AHJ B;  3EID B;  5DQV A;  2BS3 A; 
#chains in the Genus database with same CATH homology
 4F7J B;  2WXV B;  2WPA B;  5CYI B;  1E9H B;  5HBE B;  2B9R A;  1VOL A;  3POM A;  1GH6 B;  3EOC B;  4YOZ A;  1H26 B;  1O9K A;  3DDP B;  4UN0 A;  3MY1 B;  1O9K B;  4Y72 B;  5IDN B;  4ELL A;  4F6W B;  4II5 B;  1VYW B;  4CFN B;  2C6T B;  3K7A M;  4EOI B;  1XO2 A;  4NST B;  5HVY B;  5LQF B;  2EUF A;  4CRL B;  4BCJ B;  2WIH B;  1D3U B;  1JOW A;  1JST B;  1N4M A;  4OGR B;  4BCF B;  4EOK B;  2R7G A;  4EOO B;  1UNH D;  3MIA B;  1OL2 B;  3M03 A;  5ACB A;  1G3N C;  1H1R B;  2UUE B;  4EOQ B;  2G9X B;  3LQ5 B;  4CFV B;  4F6U B;  1VIN A;  2CCI B;  3DOG B;  1FVV B;  1ZP2 A;  2PMI B;  1H1S B;  4BCN B;  1OL1 B;  5EFQ B;  5IDP B;  2UZL B;  3G33 B;  2W96 A;  4BCO B;  5IF1 B;  1FIN B;  2W9F A;  2F2C A;  1PKD B;  2UZE B;  2IVX A;  1H1Q B;  5FGK B;  1H27 B;  2WHB B;  1JKW A;  1H24 B;  1H1P B;  1TFB A;  1UNL D;  2IW9 B;  2WEV B;  4YOS A;  4F70 B;  2C4G B;  3MI9 B;  2PHG A;  3MY5 B;  5LMK B;  4ROD A;  1H4L D;  4EOJ B;  4YC3 B;  1UNG D;  2C5V B;  1URC B;  3TNI B;  3BLH B;  4BCN D;  2IW8 B;  2W99 A;  3H4C A;  4CFX B;  3TNW B;  1W98 B;  5HBH B;  1H25 B;  1JSU B;  2C5O B;  2PK9 B;  5HQ0 B;  3BHT B;  4CXA B;  4EOP B;  1OKV B;  4ELJ A;  1GUX B;  4KRD B;  4BCQ B;  4CFM B;  4TTH A;  2W2H A;  1AIS B;  1OIY B;  4F7L B;  2C5X B;  4BCH B;  4CFW B;  4EOR B;  3RGF B;  2BPM B;  3BLR B;  1OGU B;  5BNJ B;  4F7N B;  1P5E B;  4FX3 B;  1QMZ B;  2I53 A;  4KRC B;  4EC8 B;  4BCQ D;  5I5Z B;  3O0G D;  1GY3 B;  3BLQ B;  5HNB B;  3F5X B;  2WMA B;  5L2W B;  3TN8 B;  2W9Z A;  4YOO A;  4CFU B;  2JGZ B;  4BCP B;  4BCM B;  1AD6 A;  4EOL B;  4OR5 B;  4EON B;  1GUX A;  3BHV B;  3QHR B;  1OKW B;  4ROC A;  4BCI B;  2C5N B;  3BHU B;  1OIU B;  2WIP B;  5HBJ B;  4F6S B;  1H28 B;  2WMB B;  1BU2 A;  4EC9 B;  3QHW B;  1OI9 B;  1F5Q B;  3EJ1 B;  2UZD B;  4F7S B;  4BCG B;  2BKZ B;  4CFU D;  4ROE A;  4BCM D;  4EOM B;  4BCK B;  1C9B A;  2V22 B;  4IMY B;  3TNH B;  4I3Z B;  5CEI B;  2WFY B;  5ICP B;  2PK2 A;  2CCH B;  2IW6 B;  1KXU A;  4EOS B;  2X1N B;  3DDQ B;  2CJM B;  2UZB B;  4G6L B;  3EID B;  2I40 B;  2QDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...