5I66A

X-ray structure of the fab fragment of 8b6, a murine monoclonal antibody specific for the human serotonin transporter
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
EVQLQQSGPELVKPGASVKISCKASGYTFTDYYMNWVKQSHGKSLEWIGNINPNNGGTSYNQKFKGKATLTVDKSSTTAYMELRSLTSEDSAVYYCTRSPVRPYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 8B6 antibody, heavy chain
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66A02
5INDA 4M6MH 3BJLA 5DEGA 1WCQA 4DVBA 4CDGC 2A83B 3QDJD 3T0VA 4UQ2A 2HJLA 1ORSB 2CK0H 3SN6N 3OKMB 3P9MA 3H9ZA 1FJ1A 1FFRA 2EE6A 5B22A 1OTUC 1ZTXH 2W65B 4R96B 3RX8A 4O5LL 3FFCE 3P4NB 2XN9A 3JWNC 4UBDC 3WHE1 4Y5YB 4LLQA 3SDCC 4NHUA 4HK3N 3IETB 3B83A 3QJFA 4QHUB 5FYJL 4G6AD 4JFFB 5D7JB 4ZUTA 2QV2A 4HIHB 2WAHA 2W60A 4JQXC 4DZBB 4J3WA 1Y6MR 3TCLB 1IE5A 1GOFA 1HXMA 2EICA 3O4LB 5C0NC 3ARGB 3QUKB 3C60C 3F6LA 3Q1SL 1S8DA 2RCSH 2GHWB 3QZWG 5D7JA 4YXHL 5JOFA 1DLFH 3VRJA 4YR6A 2NXZC 1XEDA 2XZAH 3EO1B 4F7TB 2ARJA 1WGOA 3IFLL 3WS3B 4P2OB 3QXAB 2EXYC 2OJZH 1SJXA 4F7EB 3VFWA 4JB9L 4N0RA 1V7NH 2KBGA 1YN7A 4YE4H 4LVHB 5FKAA 4S0TD 4OF6A 5IVXB 5CJQL 4IMKA 4Y2DD 1NKOA 2VAAB 3WFDH 2JJUA 5I8KL 1G9NC 2VDML 3DLQR 4U1LA 1BQHA 3CLFL 5I73C 1JWUB 2R2EB 5BV7B 3ULUC 4F9LA 5EA0L 3MNWB 4M6AA 5IB4A 5KS9F 4H26B 1A6ZA 5KW9L 4G6FB 1NL0H 2EIBA 5HHVH 3GSXB 4M8QA 2Y23A 5C0IB 1KPRB 3RTQC 4E0RA 4ODVL 2GFBA 3GMQA 4HKBA 4ALAH 5LGHL 2FWOB 4M3JA 4R0LB 1BLNB 1BFVL 3Q3GB 3TWCH 4PRHD 5I18L 4KI1A 3RNQA 3MRNA 2F53B 2VLRD 3PHQB 4I18A 3CX5J 1OP9A 3ZDYE 3Q6GL 1LO0H 1A3LH 4WTZG 4Z7OE 2NX5D 2IQ9L 1X4YA 5HPOA 5DHVA 4OD2A 2CKBA 5INCA 4WW2A 3FQUB 2CKBB 4MXVF 5GZOC 1P4IH 3VWJA 4PREA 4PS4L 3IGAB 2H3NB 4EI6A 3MLRL 4HGWA 3GB7A 3QIBC 5EU5B 2D0FA 2FNBA 5FYJE 1Y0LA 2ZSVB 1YQVL 3CLFH 4F7CB 3GBLA 1QPPA 4WWID 5JNYB 4NN7B 2RJMA 1QLFB 5LQBL 4XNMB 4P46C 3QIBA 5DJ0A 2XFXB 3QWQB 4NSKA 5HGDA 3JWDH 2JE8A 3RKPA 4PRIA 5JW4Q 4DKAA 4NNYB 1A3RH 2DTML 3RAJL 5CD5D 1IEAA 4RZCB 5IMLA 3BX7C 2FEEL 1QSED 4JO3H 4OZFB 1ZLWH 4HIIA 3PGFL 1MJJA 3X12A 4M6NL 5HY9B 2KPNA 1HHKA 1QLRA 1A6VL 4G3YH 5FGBA 4Q0XL 1C5CL 3P9LA 1RUKL 2X4UB 3FB6B 3CVHL 3LKQA 1NCNA 2FIKB 5IJVB 1JRHI 2WZPD 4D8PB 1DBKH 4PRDA 1INDL 3L6FB 2F8VA 1PY9A 2FO1A 5CHNA 1AD0A 3EOAB 2WUCH 2NTFA 4OQTA 1S8DB 4IEFB 2JB6B 3JUZA 3O3AA 5DS8A 4FA8A 4JY6A 2Z0BA 5HPMB 2FBJL 1KJ2H 3VFGL 5DJXB 1PFCA 5JPNB 4JN1L 3FB8B 4Q9QH 5DD1H 1YMHA 3BQUA 1YEIH 3H3KA 1SM3H 1UB5B 2EYTA 3TH3T 3GGWA 5DC4B 5BRZD 3BE1H 1ZXQA 3VDAA 1FV1B 3KR3H 2DM4A 4HKJB 2WBJB 3LD8B 2F54D 1A3RL 1L6XA 1MSPA 1T3FB 2X1XR 4WWKB 3HCVB 4LDLB 2VH5L 5KVGH 1NJ9A 4WI6A 1ZMYA 3HI6H 4F9PA 5HHXL 3LIZH 4JFPB 3L7EA 3SDAB 3A67L 4KTDL 5C1MB 3VGHA 5F8RC 1NCWL 3BZFB 3ZDXE 4LEOB 3IDIA 2JIXB 2B2XH 3LKSB 5BW7A 2W92A 3WHXB 1ZV5A 1MCRA 4H5SA 3TH4T 3DMMB 3FQNB 3EDDA 3IJYA 3QIBD 5GSRB 3ROOB 3RPKA 3V0WH 4ZFZB 5H94B 2DQFB 3GSWA 5SX4H 3RY4A 2CLRB 4RNRB 1TFHA 1VACA 4G6KH 2E7LA 4X6BB 3RWHB 3KNBB 1UWEH 1BVKA 5I66B 4HXAL 2X1QA 3QDMA 3DVFA 1F4XH 3L3GA 2BERA 4QTIH 5JR1H 2IPTL 1U2HA 4B50A 3WO3B 1SM3L 3RP1A 2Q7YB 2VMFA 3SDXA 5IBUB 4LAJH 1FNGA 3RVTD 5C8JA 3MA9H 1VGEL 2OR9L 3UTPD 1UEMA 3NZ8B 4NDMA 4UNTA 1WC7B 3I3EA 1N5AB 2H9GB 3IDUA 2LAAA 1VHPA 3NZHH 2AJZA 1NGPH 4ZYKB 1EHLH 5DJDA 3VMPA 2OX5A 4RGNC 5EWIL 4DEPB 2YR3A 3TO4D 2YXFA 3ZLQC 5T1MA 4PJ8D 5FIEA 4RX4A 3B9KA 5KVEL 2VN4A 2CLZB 2DQUL 3BESR 1RMFH 4A6YA 3O0RL 1Z9LA 3O3EB 3TIDB 1HQ4A 3OB0K 1GGYA 4WHDA 5FYJU 3L5HA 2AV1B 1XF3B 3MRCA 4ODHH 3MV7E 2GJ6A 3OKDB 3FO9A 4HLZG 4KRPC 2PR4L 3SPVA 1MCLA 3TBVA 4M62L 1GVIA 4PV8B 3CVHA 3QIUA 5J12C 3ULVC 4UILH 1K5NB 3C8HA 2VSCA 3U9PH 3VH8B 4M7LL 4PG9A 1JTPA 2EXYD 4Y4KD 4JFDD 3RVVD 5DD0H 4YAQB 3RWFA 4I18C 3MTRA 5DRZA 1WC7A 3EOBB 5GGTA 4MWFB 4XNQA 1EJOH 5ICYA 4HIEB 3BKYH 2DI8A 4HH9B 4URTB 4WW1A 4Z7WF 3LB6C 5EBWB 5IMOA 1P69B 1H9VA 5F7HA 1NPUA 4PRNB 3QDJE 1ACYL 4N0UA 3S36H 1QFWL 1INEL 1FLRH 4JFOA 2ERJC 5JQ6H 3D0VB 1CE6B 1EEZB 3FT3A 3L3IA 4U7SA 1NFDA 4ZXBC 1N64L 3H3PL 2G60L 2P44B 2W0PA 2F5BL 3RU8H 4JDVB 5C0RL 3KYNA 2F15A 3LZFH 3OKEA 3KLHC 1AGBA 5EA0H 1OB1A 1OCWL 5FHAH 5HYFA 1EO8H 1S9WA 3RDTD 2SEBB 2PXYC 3QWRA 4GBXB 5MP6L 3INUL 1I3RB 1AIFA 4ODHL 4X4MA 5FGRA 2I9TA 1F11B 3FB5A 2P5WD 5KJRL 4N8VG 1P4BH 5TFSH 4JO4L 2BNQE 4GQ9L 5DRXB 4V1DE 3RA7L 4NUJB 2CGRL 5LCVH 4U1MB 2B0SL 3I2CH 1L0QA 5SWZE 1BGXL 5H35A 1XIWD 3HZVB 3NVQA 3MACL 3B9KD 1HH9B 1CD9B 2IQ9H 1H3PL 1RZFH 1DLHA 2BSTB 2ENSA 1Z0NA 3NOIA 4OGYL 5EO9B 4R7NA 3DNKA 3DRQA 4CW1A 5EO1B 2BOBB 1FFOA 2P8MA 4XVTH 4AEIH 3HE7D 5KSAA 3CFEA 2XTJE 3HNTL 1QBAA 5E9DB 4NKDA 2YUVA 4KJQD 1D6EB 4IIQC 4LEXL 1C5BH 1KT2A 4E5XB 4XPFL 4HMEA 4Z76A 1DQJB 4P4RA 2D4FA 4JVUA 1G9ML 4NRXB 5HGBA 4GW5B 2GY7B 5KZCB 5EZOH 2XI9A 2ITDA 3JWOL 4JEGB 3BP4B 1MRDL 4MJID 1S7TB 3VG9C 4WFEE 3L3OB 5D8JL 1FNGB 2A9MH 4YQXH 3V6FB 3WN5B 4QXUH 3C08H 3I02A 2DL9A 4FQXD 3DWTA 4TNWF 1QQDA 3MFFB 4JPVH 1JWMA 1YECH 3TBTB 1PGRB 1A4KB 3QDMB 3BN3B 1BJ1J 3S35L 2P7TB 3V4VL 3WLWC 3O6FC 3NN8B 3HAEA 1HHHA 2VABA 4TVPE 1SJHB 2LV4A 4KPHL 4JAMA 4PJBA 4RMSA 4WI9A 3RIAK 5L2KE 2HYMA 2I9LB 4M5ZH 3WL9B 4N0UE 1YUHA 2FJHB 1CDCA 4Q9RH 5HYJD 4Q2ZB 4G42A 2EC9U 4L8DB 4NBYB 1F3DJ 3PL6D 4GAYA 3CSPA 1T1ZA 4PY8I 4MDIB 1TQBB 2DJUA 2BVOA 5JO5B 5F3HB 3UJTL 2FLRT 5ISZA 3P4OA 2KL6A 3EYUL 3DOSA 4CMHC 5HHPA 5I8KH 3HUJE 3T0WA 3IJHB 4WU5B 4EEEA 3NBNA 1WZ1L 2ZWLT 2ZPKL 2EEDA 4UAOC 4R4NC 2EXWC 2EH7H 1ZHKB 3QZWA 1K4DB 4OGAC 5EOQH 3BZDA 3RZCB 1MH5A 1NL0L 1T83C 5ENWA 4X9IA 1G9NL 4GRLB 1CTOA 1GGCL 1Q72H 4H0IA 2CD0A 1ORQB 4MAYB 3KLSA 4Z18A 3DO7A 4RGMB 3V52L 1H5BA 3V5DB 1FYTD 1JTOA 1WLHA 1U8QA 1T7ZA 4HIXH 1ADQH 1YEJL 3E8UH 3S5LA 1IC1A 3SY0B 1ZA6B 1P9MA 1WAAF 5HXMA 2VLME 3GM8A 4LASH 3EAKA 3MZGB 3M1BB 1OM3H 1UXSB 5FA4B 2HRPL 4OLVL 4H25B 4UOW0 4LKCA 4RWYL 1U42A 5I74B 1WBXB 5HDLA 3ZYZA 1AR1C 2AEPL 1KJ2B 3BWAA 1NC2B 1TTUA 3IKKA 3LKQB 2XTJC 5E00B 4PJ5B 4DZ8B 1MJ7H 2QADD 3SDXE 3UJTH 4H20L 1IAMA 3QNYB 1Q9LA 2Y5TB 1AGEB 4MAUL 4HXBH 3T3MF 3MLXH 1IEAB 4S0SD 4JY5H 3MRLA 1WEJH 1T66C 2H2SD 1ETZA 4KV5E 3WFEH 1S9KC 1GGCH 1Q72L 4XBPA 1SVCP 3DXAE 4IHOB 3RVUC 5GSVB 1KIRB 4NRYB 3BZEB 2VLLA 2OR8A 5IVOA 3PWNA 2VYRE 4MXQC 1OW0C 3DXAD 3REWB 4P57A 3BP4A 3SO3C 1CFQB 5IGXL 3QUZB 1PG7H 5ITFA 3PF2A 3TN0D 1PZ5B 3LDBB 4CBPA 4Z76B 1JYWA 3SO3B 2EKJA 4ZO7A 1TVDA 3RJDA 4P2QE 3MUJA 3RNKB 2C5DC 4FFVC 2CJUH 4XVSH 4DQOH 1J0JA 1YEDB 4X9BA 2OI9B 1A14L 1UC6A 4NWTH 4JFEE 1KCLA 2N7BA 3FO0L 2C3VA 1U91A 1Q94B 4PLJC 3MA7B 2DBLL 2P42B 4WO4A 3WLBA 3GIVA 4GKSB 4AEHH 3ESUF 3QXDB 4W6WB 3VWJD 3I6KA 3HE7C 2DIBA 3IS0X 3QEQB 2BSTA 4QT5B 4MA8H 1D9KC 3BPLB 3MV8B 3QFDA 2C3WA 1MIMH 5EU3A 3P4OB 4M9OA 3VFGH 1IAOB 2QJDA 4JQVC 4LNRA 3PP4L 1CLYL 1FL5B 2BVPA 3C09C 2OMBA 3IU3B 2YWZA 4Q6IC 4UT7L 5HI3D 1H3UA 3QEUB 5JW4M 2VLMD 3D25B 1VESA 4JREB 3C09B 1ZLUH 1XGTA 5D7IB 1IQWH 4J3UA 4TOYL 1UCBH 3P0GB 1RULL 4PJCB 5SWZA 1T5XA 4B5EA 2WBKA 5JOEA 4KHXL 1OSPH 5C6WH 3PQYD 4YBLB 1DQML 3S36L 1KIQB 4KU1A 4BA8A 4MJ6B 4JZNB 3IT8D 1AGBB 2D2OA 4MXWH 5LXGH 4KTDH 1JGVL 4J6RL 3LD8C 1CS6A 2YUWA 5DJAA 4X99B 3U6RA 3LKPA 4OF3A 3CSYA 4OLWH 1FIGH 1R3JB 3EO1A 5T3XH 3CVIH 2N4IA 4CJ0A 2CDEB 1FYTA 4P59L 1RZ7H 3ULVH 1HDMB 4RFOH 1TTGA 3K8LA 3KYOA 4PPTA 5E0QA 5LWYL 4K7PL 1UZ6E 5B8CC 1WFUA 5J1TC 1QYGH 2BXZA 1W0WA 3QUXC 3P4LA 4PG2A 2AJVH 4HWZB 4LCCC 5ID0A 2VLJE 2FECL 1R5VA 5L2KD 4YHLL 5B8CA 3ULUL 1RVFL 3KWWA 4JDTH 1UH2A 1TCRA 3ZTJG 1CWVA 5J4MA 2AK4D 1IGCL 4XI5D 1EJ6A 5I15H 1NFDE 2VDOL 3GM0A 3ZHKA 5D1ZB 4MNQD 3DTXA 1H3PH 4FXGA 4K8RL 1B4JL 1NAKH 2KDGA 4F9LC 1WBYB 1TVBB 2PCPB 5KSUB 3U0TB 5T33L 3UYPA 2VE6B 2I07B 4TULL 1WBYA 3PG2A 5KSUA 3TYGL 3MRQA 2YA2A 3VXUA 3O3EA 1JBJA 1FAIH 1QBLH 4UU9A 1MUJB 1BVZA 3OZ9H 1OAUH 1XF5B 4OCWL 3QIWB 5DVMA 5FECB 4TSAL 5ID1A 5JUEH 3GI8H 4NNPH 4AENA 2ESVA 4EQ3A 1X5XA 4NT6B 4X5LA 3O0RH 3LS4H 2EEBA 3TBWA 3NCFB 1N59B 3HI1B 1JNLH 4J23A 4PBWD 4NBZB 1JP5A 4YHKH 1MFEH 1RZ7L 5CKAA 4ODTL 5EUKA 1RZKC 1YPZE 2H8PA 2C3HA 4Y19B 5A2FA 1KACB 1E27A 3WE6A 3GMPA 4ZXBD 5C9JB 1FBIL 1KTLA 5E95B 5AAWA 4PJAE 3VXMA 5CSBA 4FQ1L 5GISH 5DMGD 5CCKH 1MOEA 1BM3L 4NM4L 2LE9A 5SWZD 3EFFB 2FH6A 5IMOB 5J89A 5JHLH 3BISA 2CLRA 4RNRA 4X4YA 1X7QA 4OI8A 4Z6AT 3HC0A 2IPUG 2Y25A 4G7VH 2NW3A 1GJIA 3TT1H 3LH2L 2OCFD 3I75B 5B38A 1NBZB 1QFWI 4I5BB 1T89A 2V5YA 1P6FA 2OTWB 5F6HI 1A6TA 4WHCA 5E1AA 4NN6C 2IMNA 2GJZB 2C7UA 4LEOA 1IM9D 4ZPVA 4WUUB 3VDBA 1SJEB 3SPVB 3MCLH 4GAJL 1EHNA 1KBGH 4GRWE 4BELD 1HSBB 5A16B 3SKNA 2XN9E 2WW8A 3BJ91 3DHJA 3KPQB 4U1IB 4M9PA 3DVNA 3RWEB 2XRAH 5MERA 3V0VA 1KPVA 5FGBC 4O5LH 3O8XA 5AD0B 3VXOA 2GT9A 2HWZL 2P45B 4XPGH 3U30C 4AEEA 3WIIH 3MCKA 2H6PA 5GHWL 2A74A 2CO6B 1HIMH 2R0KL 4JFEA 3VXSB 1A22B 1LEGB 4XC1H 5E8OB 3S5LG 4TVPD 3SE8H 4QLRA 4ZYKA 1E4XH 1YZZA 5D71H 4LHQB 4K23H 4JFXB 1PZ5A 3T4YB 2NZ9C 4C56D 3NIGE 1FO0H 1UQSB 1IGMH 2IALA 4XBGA 3CZFA 4NKIL 1GZPB 5IQ7L 1L7IL 5DQ9A 4P49A 3MV9B 3PGCA 2GIYA 5LAXB 3MLSH 3UPAA 5I9QB 3TYFB 5DMYA 1J8HA 4UAOB 2Q7YA 1Q38A 5C2BH 3RRQA 5JDSB 2GEEA 5HYSA 3LN9A 1WJ3A 2QHLA 1FG9C 2ZUTA 5CAYB 3DXAA 1UGNA 3GSNL 5BZWA 4UV7L 5EO0A 4LHJB 3MLWH 5DUBB 4RAUA 3P77A 4NQCB 4NN5C 4LLVB 4QRRE 5GS2H 2ICWI 2XN9D 3T65A 4PRAB 4UZGA 2YRZA 3U4EB 5AWNH 4R2GB 4FTVA 4YEEA 4LCUB 1I1YB 4XP5H 4AT6A 1ZHBA 5AG9A 3RKDD 3RX7A 3NIDE 3T4AA 1FCGA 4ZAKC 1AC0A 1XF4B 1I85C 5ANMA 5IB1B 3LQMA 4S1SL 3H0TB 2XWBA 4J4PC 2XKNA 4JFPA 1FNLA 1IQDA 3O6LL 4ZTPH 5D1QB 5HHVL 2VUYA 3RVWD 4V1DD 1CVSC 2OTPA 2IANE 3BP5B 3GMOA 4ODVH 1F4YL 1ZT7B 1IGJA 4TQEH 1S7QA 5HVHC 2R4RH 5IV2A 2IAMD 4BFIB 1I7UA 2P5WE 4J7RA 2QKIB 4KAQH 3ZTJH 4RQQA 3IDGB 4KRLB 1FV1A 4FABH 3QO1A 1SHMA 1T04B 4MB3A 4MA3B 5DRWA 5JLZB 5T1KB 3UJJH 4OF0A 4UOW1 2X7LA 1E0OB 1Q9KA 3HRZB 1FGVL 4UTBL 1RJZA 5EH1A 2G75A 1YDPB 1A3QA 3QUMH 5H2BA 5GZOD 1D5XB 4MA8L 3NCYP 4I77L 1QO3A 1FZMB 4KXZH 4NJ9H 1MLCA 3AC0A 3QUXA 3SDYH 4W6YB 3TO2A 5C0AE 3HHRB 3MLUH 3O6FA 1GGIH 1LHZA 1YQ2A 3MRNB 4I18B 3T2QA 3BKMH 5TQ2H 3PWVA 1KENL 1OGAA 2UYLB 4PRDB 4KKCC 2BY2A 4Y1AE 5FO9A 5CGYC 4ZOBA 5D6CB 4ENED 2AV7B 4R0LA 5EIIB 1GH7A 3C6LA 1PDKA 4YO0A 3ZE0F 4OFVA 4U1KB 4LSVL 1A6UH 5D2LB 3VFVA 5HY9A 1VERA 4KQ3L 4JO1H 1KB5B 3B9EA 3K4AA 1GZQB 3MRLB 4J4PD 4OZFA 2NY6C 4R8WL 1KEGH 5CD5C 5ITBL 3G08A 3CXDL 3DYPA 4Y1AB 2G2RA 3FN0H 4I0PB 4U7MA 4KQ4L 4GAGH 4KC3B 3G08B 5HHME 3MRBA 4LLDB 4A6YH 1VADB 4KAQL 5C0AB 3P11L 1NBVH 4JY4B 1I3VA 5C0JA 2XA8H 2VLJA 4YWGL 4JCLA 1T83A 3O6MH 2YD7A 4OUUB 5ICXB 2MWCA 2VDQH 1XGPA 1JJUA 4PJ9D 4X8XA 2UYLA 1C5CH 1CFSA 4JKMA 3DRTA 2B4CL 5I71B 5KANG 1C16B 1BVLA 1IGIL 4Z7VB 5BZDA 3I6LD 2HKHL 1ZT4A 2VC2L 3V7AE 1KT2B 3C60D 3H9YA 2XV6B 4PJBF 4Y5YA 4OD2B 1ED3B 3NFNA 2NW2A 5DJZA 3K1KC 3L5XL 5I8CB 3NCJH 4JY4A 4NO2A 3KPRD 4GRLA 1WTGT 1NDGB 2H1PL 1I3GH 1UACL 4MAYC 4HK0B 4PTTA 3RZCA 1LEKB 3WXWH 4C54A 1AD9A 4EXKA 5C0EA 4TTGA 4MB5A 5FM8A 3OJDB 4QCIB 3DI3B 3F12B 1L4IA 4ZUVA 4ZUSA 1DANU 1U3JA 3OB0H 4R26H 2X6MA 2YZ8A 1NGQL 4OZGA 2XKNB 3MBXH 4KJYB 2FIRT 3H0TA 4QRRB 3NCBB 3JV0A 3KPOA 3DJ9A 4O58L 1MJ8L 5D6DA 5FKPA 3UTZB 5M7QA 3ULUD 1ZEAL 2FJFB 2W0LA 4KJYA 3MNWA 1ULVA 1CXEA 4JHBA 5D1XB 2Z31A 1N0XH 4Q2ZA 1W8OA 5F1OB 4DUVA 3LN5A 4EI5D 2OK0H 1LNUB 2X4SB 3OX8B 1QD0A 3LRSB 5I75B 2XY2A 3PP4H 1RIUH 4ONFH 5CUSH 4IRZL 3VRIA 1RHHA 3MXVH 3V8CA 1SJHA 2MMXA 2A6KA 3CCHA 2VLRE 3DX6B 4H8WH 2QSTA 2CDFB 1JHLH 1RJZB 5I8CA 5IB3B 1NC4D 1V3KA 3D0VA 2ID5A 2X4PB 1BZ9A 2CXGA 2P4AB 5E99L 2EDNA 3QUXD 1OGTB 1A1OB 4TNVF 1L7TH 2EECA 3M07A 3DARA 1NEZG 3TYFA 1XH3B 3HZMA 3JV4B 1JPGB 4U3XA 1S3KH 5J7CC 5T1LB 4YH6A 4PD4J 4M43L 3MJ9A 4PJFF 4UBDD 1ZE3C 3GMOB 2I5YL 4X5XB 4WHTB 1J9CT 3QDJA 1D6VL 2ZG3A 4WY7L 4YUEH 3K46A 2K7PA 4HUMB 3VXSA 4GRWB 3CDGA 4CNIA 3AY4C 2VLKB 4R97C 5C0BD 1MCJA 1AHWC 2HN7B 1IKNC 3OKDA 5EWIH 3CFKB 2H32A 4RFOL 4XPGL 4NKOB 4U1IA 3CX5K 4BFGA 2QR0B 5D7IF 3OR6B 1RMFL 1KJMB 1U8LB 3VCLA 3SDDB 3WXVH 3BSZL 3G5XA 2QHRL 4CMMB 3CZJA 1AE6H 4P46B 3RWGB 5IFHH 3VFOA 3IDJB 4MGXA 2ADIB 4HQQH 3BRGC 3OAUH 4FTVD 3OGCA 4XRCB 4NKIH 32C2A 4XVUC 4LSDA 4M7KH 4YO0B 4Z7WE 2R2HB 1KNOB 3I9GL 5BRZA 3MRGA 2HMIC 4JGMA 2LVCA 4LVEA 3CDYA 1DBBL 1WWAX 2DJ4A 4P9HH 2F58H 4UT9H 5JA9A 5I76A 4AMKL 4PJIA 4AL8L 5ILTL 4HEPG 1CLOL 3CMOH 1QO3B 3EDJA 3GI8L 3LEYH 4RMWA 3R0MA 3WFHB 3ZZ1A 1KN4L 3QG7H 4L4TB 3VFTA 4PG2C 4BH7A 2JCCE 2IFFH 4BH8B 5FF6B 5FV2A 1KB5L 2Q7NA 2A6JA 4U4BA 5DUPL 4D9RE 2AJ3A 4OCRH 2J88L 2I27N 3HG1A 2W9DH 1TVHA 4ZO9A 4ZPTA 3BXNA 1HK6A 2NX5E 3TVMD 4P4KB 4ZFFB 4X4XB 5KBNC 2F8XC 2Q86A 1MAKA 2DQDH 4O02L 3ME0A 3NFSL 4MNHA 1LE5B 3RWFB 4U0RC 5HGAA 3JTTB 3T3PF 1YMMA 4TUOA 3MLZL 2VXQH 4NCC1 1ZOXA 4CADB 4POYA 5BVPH 4EI5A 4OZHF 3CIQA 4QHLA 2PO6A 1EZVX 4WHYG 3D85B 4ORZC 4K9EC 4NC1E 5J12B 3DX8B 3ET9F 2YPLB 4DVRH 5DD5H 2IANA 4PJ7A 4NJAH 5JXAH 2YC1A 3NMEA 4QTHA 1SYSB 2V17H 1URLA 1UH4A 5T3ZE 3LKOB 1HZHH 3HTLX 3VWJC 2AI0H 1AR1D 2O93L 4CU8A 1VSCA 4S1DC 5DJXA 3KHQA 1RUML 3NFPB 4PIRF 3BKCH 3BOVA 4MJ4A 1NLDH 2DF3A 1T5WB 3G5YA 1JWSB 1EAPB 2J4WL 3U2SA 3UYRL 1XR8B 1W8NA 1FL3B 5C9KA 1T5WA 3G5YB 3GK8H 2YEZA 3QJHA 2FATL 2E6PA 3KDMB 1P4LB 4P5MB 1SY6A 5E2WH 4ONOA 4O02H 1IGYB 4XC1L 1Z9OA 2MPAH 1NMAH 2EDRA 2CDGB 1LDPH 5T5NG 1VDGA 3VGAC 1T7XA 3H9SA 3HZYA 4YBQD 2V2TA 1ZKAA 1BVKB 5I66A 4FXKA 3TESA 4QTHB 1U8IA 5ICZB 1IGFL 1H3XA 1QA9A 3QQ9C 2CIIB 2LFGA 4XMLL 3CH8A 3KPPB 4XNXH 3MLSL 2R69H 1EV2E 1T66D 4JKKA 1PZUB 2IG2H 2R8SH 5JORA 4O4YH 1WAAA 4FXGB 4OM0L 3WHXA 3CU7A 2V2XA 4F8TA 4UQ3A 4I2XE 1QTYT 3TVMA 4CAGA 2BK8A 4EN3C 4F57H 4CRPA 4G5ZL 4EN3D 5I17A 4I4WA 4DKFH 2I60H 3MROB 35C8L 4W4OC 2HAZA 1MCWW 3OF6A 4FMKA 5ID0B 1YYLL 3F8UB 1FZJA 3UTTD 1BAFH 5J6HA 3FRPA 3WIFB 1P4IL 2AKRA 1HCVA 1I7TA 2WSKA 1S7XA 2RGSA 5HYSG 2IFGA 4P99A 1CF8H 3GB7B 2X4TA 5AEAA 2KZWA 1LEIB 2VDPL 2RFXA 4ZD3H 5KOVC 1Q1JH 2OP4L 1U8IB 1IARB 4JCMA 2APWA 4BSJA 4BH7B 5D5ME 5INCB 3CGTA 4EBQH 3P73A 3VG9B 3S37L 3UBXI 4P2CG 5KG9A 3VGDA 3UAJC 4MHHI 1F90L 1QR4A 1TENA 4JJHA 3QNXA 5C71A 4JY6B 4XMKH 1J1OH 3DYMA 3VGEA 3PABB 1AXTH 1NGQH 2AEPH 2DB8A 3RL2A 5GGUB 3L3HB 3IAGC 3QI9D 4QXTB 4GQPH 2WINB 1MJ7L 3AFLA 1CDUA 1RZGA 4HUWA 2MHAB 3DBXB 5DQJB 4ZAKB 3QUML 3D69A 3TNNB 3DSFL 3MRFA 3QFJE 1FAKT 4RX4D 3BEWB 1MJJB 3BKML 1DVFD 1PQZB 3HNSH 4QRPD 2NR6D 5D1XC 1BIIB 2NY5C 5L0QB 5A43C 1KG0A 3L5WB 1SEQL 4HWBA 3QXDA 3SGEI 4XCFH 2JCCB 5DHVH 2VDMH 3QQ4B 1KLUA 1B90A 3CDGB 4AQOA 1OGAD 2ICES 3HPLB 4I0PC 4HH8A 3MLXL 3QXAA 4JRYE 3D6GA 1D5IH 2IQAB 1NLBH 3ARBA 4OZGE 1OWWA 1S3KL 1MHPL 4PP2B 1BHGA 3TV3L 5JXEA 2AJUH 4N1CA 1FQ9C 4XVJL 4Z95H 1CG9A 3O6KL 2B1AL 4F7CA 1WZKA 1PAMA 1UXWB 1MIEL 5LKNA 1MI5D 4KDVA 4XVSL 1AXTL 3PGDA 2IBZX 3PWNB 3PV6B 4F2MA 4QHUA 2EC8A 1A1OA 3VH8G 5I18H 5GRXG 4KJPD 2XQYK 1T1XA 3CSYB 4WW2B 3LB6D 2MTPA 1YN6B 4NZTH 2A6KB 2ICCA 4LSQL 4NPYB 4PJHE 1MIML 1A21A 3NIDF 1MFBL 1RUQH 4X7SL 2M2DA 1OARL 3FQRA 5A40E 1J0HA 3AXLB 2J8OA 1CTNA 3NA9L 1MCIA 5HVFB 2RHEA 4BZ2H 3OAZK 2DBLH 5D7LD 1CXIA 2CR6A 2YMXL 5GS0L 3MXWL 4HQQL 1IQWL 3W0WE 1UYWH 2IGFL 1E6JH 4TOYH 4K07A 1AY1L 3QEHB 3VFOB 5E5UB 5EC2B 4OZGB 1D5IL 4JRYB 3QEHA 4KI5C 3MLTB 3IU3A 1YUHB 4NO5A 1OP5H 2HJKA 2DAVA 4O2FB 4F58H 1ACZA 4L4VD 3SCMD 3SGEH 2DLIA 4P2RB 3HZKA 1NCAL 1XR9B 3QQ3A 3MOBH 2LQRA 2BOCA 3EW3B 3VWKB 3SE4A 3ARFA 4Q58C 2E6JA 2FH8A 2YD5A 3P30H 4EXPX 4C55A 3U0WH 4OZHB 3HR5B 5T1DL 3RDTA 3VXRA 2YSSA 3L3OA 1JGVH 4MQ7B 4HULB 3O3UN 4LSQH 3QZWB 2AXFB 2DQCL 4XPBH 5KSBA 3RVTC 2ZNXA 4BFBD 1BEYL 4HAGA 4LRIA 3QUKA 4HC1H 2BY0A 1I7TB 4HJGB 3MV7A 1GGUA 2PTTA 3MXWH 1KN2H 2YKLL 1DBAH 1BD2A 3QUMA 4WV1A 2X4PA 1NAKL 4M1CD 3NACH 1L0YA 1DVFA 3G9AB 4OAWB 5C08E 1QHOA 5KN5B 2ZZUT 4WUKL 5FCUH 1XMWA 4I0KA 1KG0B 5H35B 4NKMB 4HBQA 4HWBL 3DURA 5IWLA 4PV9A 3VFVB 1A9EB 3IAQA 3GHBH 3P40A 5DRXA 3VXUE 2JELH 1G0DA 2AQ2A 2Z93A 1FLRL 3TNNA 4UIKL 4YHKL 1KJ2A 1O7VA 4FFZL 4ODTH 1A4JA 2OI9C 4P2RE 4X7DC 4GG8A 3BVNA 1G6RL 3C87A 3DO3A 3U7YL 1CFNA 4UI2A 4LCWE 1NGXA 1Q9WB 5CMAA 4JO2H 4PB0L 1XR8A 2BNRB 3KGRA 4QYOA 4HK0A 4PTTB 5F9WC 1ZLVH 4YZFF 1G7MB 3SY0A 3X3GL 5ALCL 3RWDB 1MAMH 5CJXC 3CNKA 3D2UD 4XPTL 4N9OB 3KS0H 1U8OB 4JG1L 4K3JH 4ZNEE 4B0MM 3T0AA 1F6AB 4OJFL 4AG4L 3VI3E 2X44D 4FQ1H 1KYOJ 3P0YL 4HX1B 3ULSB 3G5VB 3OKOA 1KELL 1K4DA 4AMKH 1F3JA 2YPLA 3W2DH 5AUMA 2FL5A 3U83A 3EIFA 1ITBB 5F7EL 1UG9A 3ZT6A 1GIGL 1ITCA 2E9WA 4M4RA 2PO6B 2VQ1A 4ZOCA 5DVOA 3IFLH 3VE0A 2CPCA 3HLAB 1CT8A 5E1HB 4GAYB 25C8L 5D72L 3S9DB 2PKDA 1LK3L 4FQLH 4P3CH 4KMTL 1HE7A 2V2XB 2NY1B 1EFXB 4GBXA 1TVHB 4GAJH 4MD0B 5DJ6B 1NFDF 3PE9A 4OIIL 5C3TA 3ZE1F 3U1SL 1RZKH 4NHCL 3BEVB 2E7MA 4JDVA 1BJ1H 2O26U 4JANA 3TCXA 1JHKL 3S96B 5BOPA 1ZHLB 3QUYC 2VXQL 3RL1B 1HCFX 3ZL4H 4QO1A 1HH6A 4X5WA 3FB7B 3OJ2C 1JWMB 3T3ME 5CGYD 2AJZB 1FL6B 4X98A 3DUUB 4DN3L 1E4XL 5IB2B 3VFUA 1OHQA 1Y18B 2AXHA 2DS4A 3DUUA 4FQ2L 4M7JH 1BIHA 3VD9A 1C8PA 5CZXD 1EXUB 1F5WA 1I7RB 4NP4H 4RDQF 1W72H 3GMRB 4O2CA 5CFHA 1I9RL 5B39B 2G75B 2HMID 1HILB 3L7FA 4TPRH 4K8RC 1MHEB 1YEKH 5D2NE 3BEVA 2EYRA 3MBED 4MA3A 2ARJQ 1P7QB 1U95B 4QRUA 1N64H 5LBSL 1U8MA 5JIHA 2D7NA 3IU4L 3UZQA 1AKJA 1AGDB 1LP9B 4I13B 4TRPL 4ELKB 3DX8A 3WDIA 2VOTA 3BPOC 4XAKE 4PGEA 2EE2A 1IQDB 3QDGE 2MSPA 1QVOB 1QSEA 5FUCE 4DN4L 3O6KH 1CBVL 3EJJX 4PGEB 4LPVA 5IROC 5TFSL 5IJKA 3T4AB 4XNXL 1DDHA 3SE4C 5D93C 3AVEA 4HDIA 3TA3B 1NCCL 4FABL 5DMJB 4R4BB 3E8UL 8FABB 1RI8A 4S10A 4D9LH 1X5HA 1I1YA 4OFPA 3K74B 4QRTA 3I2CL 4E41A 4PRPE 3AU1B 3OKNA 4N8VB 1BPVA 3UC0L 4GMSH 1DLFL 4KK9D 4HGKC 4FS0A 4QKXB 1S9YB 5C0FA 3SGKC 3VXSE 1I1RA 1BZ7A 1CICC 3MJGX 3N1QC 5CIPA 3HG1D 3RWHA 2GW5A 4NYLA 5E2UH 3EKCA 4YC2B 3QWOA 1Z0MA 1FG2A 5EORL 2ATKA 2D9CA 5DHXB 4GOSA 5EOCH 4XAWL 4I3SL 1NGXB 2EDEA 1IT9L 2FBJH 4MWFA 4XNQB 2FR4B 3LKSA 4JRWA 2FJGA 3JTSB 1DDHB 1UM6L 3SJVA 1GGIL 1S7WB 3ELAT 3I3BA 2Z93B 32C2B 4WI3A 3VH8A 2D03H 4HKXB 5MI0B 4D0CB 1LEGA 4X4ZA 4JFEB 5EN2B 3HI5L 1JRHH 2RR3A 3WMSA 3JV5A 3U4BL 3VU2A 1ZHLA 2DIAA 2JF1A 4PRPB 4JFHE 1UKSA 3GBNH 4EVNA 3U48A 1YECL 1NBVL 2MCPH 4KKBD 5BXFB 1RIVH 4X8JB 1AXSB 3S35H 4KTYA 1TJHL 3C6LD 1A7NL 1INQB 3N9GH 1MRCL 2B5IC 1UVQB 3DETD 2H32H 4HKJA 4M3KB 4NO2B 3D1MC 1TQCC 3FZUD 1U8PB 1NCWH 3QUMB 4WV1B 4UUJB 5CEZL 5IR1B 4Z77A 3WS6A 5E1AB 1A14H 3GIZH 1BFOB 4RIRA 5JNYA 1IKFL 2AK1H 1YPZB 5BV7H 1B0GA 1J87A 4DCQA 5E8EA 1N3NB 4NBXB 1EXUA 4FMFA 5I74C 4WFGE 1G84A 3VFMB 1U36A 4MJ2A 3VXMD 3DRTB 2O5YH 3MLVL 5IIEB 1K9TA 4RMQA 1CICD 2GJJA 5JMOC 4E41D 1JNHB 1MCHA 4PJ9C 4TSCH 2H1PH 1WQVT 1YJDL 2DLGA 2W9LA 2X5PA 5DJYB 3D39B 2L4OA 5ESQA 2P24B 2RAMA 3KNBA 4HJJH 2AGJH 1I9IL 3QHFL 4L5FL 1F4HA 3TBYA 3RNQB 3QEGL 2VZ3A 3AB0B 3F62A 1OTUD 4H1LG 1RULH 3Q48A 4OLYL 1VKXA 3G5ZB 5DHYB 4IDJL 4O00A 4XP6L 4KKBC 4GUPA 2HTLD 2Z31B 1EIBA 2NY6D 1OM3L 5D7IA 1TZIB 4IRJD 2UY7A 3ZT7A 1KPRA 1HOCB 1U3HB 2DQHL 4J6RH 3U7YH 4ZUUA 5KVEH 3IDNA 4WEMB 5FYKU 4ODUB 1FL5A 4OQ1A 4XNMA 4JREC 4LCIH 5GS0D 3LN4A 3T3PE 5BS0B 4MNGA 1RJCA 3LQAC 3SGJA 1X5LA 3MBEC 2W38A 2JJWA 2QQLL 3ROLA 1PYWA 3EJZC 2YOCA 5HHMB 5I2IB 2R1XA 5E08L 2H3NA 4XPTH 4UB0H 4DFIA 4ZUWA 3N1GC 4EQ2A 2HT2C 2AQ3A 1G7LB 4PJXE 5HVWA 4XHJD 1JV5B 4Q9QL 1G7IA 5BOZG 1T1XB 4OCLC 1U8OA 3DROB 4W4NA 1YC8A 3LQAL 4F33A 3KJ6L 4GXVH 2K1MA 1W0YT 5FA3A 4RQQB 4L5FH 1WIUA 4P57B 3OHXA 5HHNB 1HXYA 2JB6A 6FABH 3E3QE 1T89C 2APVA 5KSBB 1BLNA 4TULH 3BZEA 1IFHH 3L6FA 1P1ZB 8CGTA 3QUYD 1H0DB 1X9QA 3U36B 2NY2D 4O2EA 4DK6A 2XQYG 3L3KA 4YPGA 1JMXA 4TTDD 2V7NA 4J3TA 4I3RH 4RMVA 5GRVK 4PRHA 3QQ4A 3MV11 3VG0H 3F58H 2R1YA 4DUWA 1A7RL 1FFQA 3ULVE 3ORJA 1EGJH 5IF0B 1EO8L 4QHKJ 1RZKL 2AJSL 2QQKL 4MJ6A 5DEGB 2CK0L 4M1DL 3QNYA 1JHKH 5SV4A 4I9WD 4D3CL 1CVRA 3FCTA 1LDSA 3IXTA 4OZGF 1YNLH 1GOHA 4Z8FH 5E7FA 3RWIB 5KN5A 4J1UB 1BJMA 2A77L 5CBAB 3THML 2VJXA 1LE9B 2QLVB 3RUGE 1NC2A 1XGTB 3GSNA 1I1AD 1R5IB 2PNDA 2OYPA 1RIHH 2CGRH 5LCVL 2C4XA 4JRXB 4UT7H 1CXHA 1MNUH 1FNSH 4LLWA 5SWSD 4OCMC 2BVPB 4G7YL 1WFNA 1AE6L 4I1NB 1D9KD 2W91A 4XPAH 1V3LA 5J57B 4DWHA 1ZGLM 1UM4L 3IXAA 4NNXA 3ARGA 4QT5A 1RZFL 2VXVL 1NANH 5FDWA 4DZBA 4CDHA 4XBGB 1A6AB 2GY5A 5JHDD 4NHUB 1OSPL 1FZMA 3PWPD 4WDIB 4LRIC 4PGBB 1MVUA 3EJYC 4B7IA 3KYKH 5CZVH 1K8IA 2CKNA 4G43A 4I8DA 3BT2H 1L9NA 4OI7A 3Q5TA 5C0GB 4P9MH 1TQCB 1XR9A 1UWGL 1S9XB 1JZ5A 1PVHA 2V9TA 5F7WC 2FYYB 2QSQA 5E4EB 1HYSD 1MPAH 4IJ3C 2DQEH 3WNNA 2V7HB 2E8ZA 3WIFA 2YPKA 1D5ZA 1HSBA 5F1KC 2UZYB 2R56L 3DI2B 4Y5XA 1N7ML 1JN6B 5LGHH 1IBGL 4MMZC 4NRYA 3MGTA 5C3LD 4AG4H 1HIML 2R0KH 5AYQA 2IMMA 2H26B 4HBCH 1HHIA 3HC3H 3GSXA 4WNQB 3EZJB 1D9KA 2NY0C 2G9HB 2X1PA 5I19L 3L5JA 1IZJA 4ZFGL 3ZO0A 5J11B 5C7XH 2VSDA 3HC0B 3SOBL 3A0OA 1Q9LB 5GZND 2Y7QB 2LU7A 3GEWB 3BEWA 3O45B 3UEZA 2QADC 5IF0A 4R9HA 4H8WC 3DGGA 3CPLB 3JZ7A 3KJ4C 2PYEB 2EH8H 1CFTA 5I30L 2CDGA 1ZGLP 2C4FT 3NABH 4Z0BH 3C5ZD 4F7EA 5E6IB 4NZUH 4NQEB 4WI7A 1UENA 4P5MA 2J8UB 4UIMA 1TNNA 3LZFL 1EEYB 5CINH 4N0YH 4FNLH 2EH7L 3HUJB 3PABA 5TDPB 3ZHLA 5TE6L 2UWEF 5GS2D 4PJHB 4OGXH 3LV3B 3TCLA 1N5YL 1T7YA 4KZDH 5DD3L 3ECBB 4X4ME 1MFEL 2NY3D 4JHAL 2RQ8A 3FN9A 3C8KB 4OLZL 2B5IB 4HWEL 4PP2A 5FECA 4YFDB 4ZSOE 2X4RA 4ESKA 2WIMA 5C0CA 3MUGB 4PGDB 3CMGA 2B0SH 2EXWD 4KKAD 5DZLA 3HPJA 4UQ2B 2GT9B 3BPOB 2A1WH 1FNEA 5I2IA 3ROLB 4LP5A 2VLJD 4RWYH 2VDRH 2F5AL 3OQ3B 1JPFA 4JFYA 2MKWA 2R69L 1DL7H 1KJVB 1I8KB 2LVEA 2CMRL 5TE4L 3TT1L 3TM6A 1CF8L 4RGOL 4ZFOA 3DV4A 1R5VB 5EUOF 2OTWA 4ZG1A 2MHAA 5DQJA 1UKQA 4G5ZH 3ZHDA 2I60L 2AJXL 4YHOH 3VFRA 5J3HD 1W0VB 1HNFA 4TRPH 5GGUA 3O9WA 5ESAA 2D7TH 5IUSA 4XWOD 2C1OB 4X4YB 3KYMB 4MS8D 4GG6E 1DUZA 2ICWA 1FVEA 1MI5A 3O9WC 3QI9A 1NFDB 2CKBL 5F1SA 5DVLA 1HINH 2YXMA 1UCTA 1GHFL 1A6UL 1QRND 2EKSB 4IDJH 5FYKL 3GNMH 4K23L 1XGYL 2HT3C 5CP3H 1PG7L 2VZVA 3CXDH 2WWKO 2X1OA 4POUB 3UC0H 3ILQC 4RBPK 5C0DB 3ARVA 4NQCE 1NFIB 4Q9RL 3RUGA 1K5NA 2R0ZL 4WFED 3ZKNC 1A7BA 2CR3A 5D5MB 2BSRB 4ERSL 3DRQB 5ELIA 4GRMA 4P5KA 3GUTB 3ARSA 1NAMH 4UU9B 5IT2L 3SKOA 2NXYB 1BX2A 3B9KC 1RUAH 2DWDA 4G8FB 1IILE 4YK4C 2FSEB 4FFWC 3V5KA 1MREH 5DEFA 4YHOL 3VRLF 3B9DA 1UWEL 2DQTL 4BQ6A 3SQOH 2EYRB 5D7KD 3QXUA 5CGMA 5K9QG 1LILA 1NAMA 2CH8A 2DWEA 1JRHL 5FOJA 4HPYL 5D7IE 3QSKB 4TUOB 4Y7MA 4ZNEA 2BC4A 5B39G 3QDJB 4XPHH 5DLMH 3WSQL 2DM2A 1M1SA 1LO2L 1RIVL 2GYSA 5MEQB 5FUZL 2HLAB 1CFQA 1A7NH 3FFDB 3O4OC 3N50A 1EHLL 1HDMA 3UAJD 1FG2B 3OKEB 2XWJA 4JFFD 2PW1B 4X6FA 1ZHNA 1MIEH 3O9WD 5JPMA 1AI1L 5GSVA 2FEDD 1A0QL 2UWEB 4KY1H 3DX6A 4JFOB 1OF2B 3CVIL 1MY5A 4OCXL 4OB5L 4H1LH 4MX7A 4TSBH 5I76B 1DQLL 1DQDH 3V5HA 1VPOL 3DMMA 5HGHA 1DN0B 3RWJA 4LQ1A 1A7OH 2VZSA 1JPTL 1RUPH 4FP8H 5DK0A 1RU9H 2QQNH 3C6SA 1UEYA 1D5BA 1QSZA 5E00A 1YY9D 1CT8B 5D1ZC 1OAXH 1E28A 3GKWL 3VE0B 1JPFB 3VXQA 5IB5A 4ZO8A 4H25A 5F7MC 5ECJE 1JGLH 2BNUA 4PJDA 4PRBA 4FN0A 3MOBL 5ABDE 3ARXA 1FNEB 1J5OL 4XTRD 3QCVL 3HPJB 1I85A 4U3HA 1ZA6A 2AEQH 5D2NB 1N4XH 5D7LE 4DKEL 1FDLL 3WLBB 4XGZA 1UB5A 2HVJB 4PJEB 4TSAH 5JW4R 2DI9A 4HMCA 3Q6FA 1TCMA 4NQDD 2R39A 1Z5LB 4GH7B 4NQSA 1A0QH 5E4IA 1YEEL 1BQHG 3LV3A 5IHZA 3O6ML 2JK5B 3X11A 3STZA 5JIPA 4WDIA 4L8SB 4JHZA 2DQEL 1QACA 2NTFB 2C26A 4HLJA 4ODWA 2OSLA 3QO0B 5TH2A 1QSFD 1M7XA 3HZMB 3QIWC 5EFIB 1AFVH 3BVNB 4DFHA 4XPBL 1RV6X 4JLRB 1KLGB 1MLBA 1AJ7L 4QXGL 3WXVL 5GRUL 2VIRB 2IPTH 1CFTB 1IC4L 3GSVA 4QHMA 4X0KA 5I1LA 1TJIL 5FO8B 4HFUL 3VRLE 3TLRA 3TIEA 4G42B 4U7KA 4N5EC 3ROOA 1E4WH 6FABL 3BGAA 4Y16B 1U8LA 3VCLB 4YDLB 5DC0A 3HFML 1VFAB 4CU6A 3FT2A 3D18A 4M7ZB 3CFBB 1CCZA 4Z7WB 1OP3H 5H8DA 3V6OA 5E2VL 3AS2A 3BGMA 2VZTA 2MNUA 5AG8A 5JMRA 1PKQB 4WUKH 5FCUL 4J8RA 4L8CB 3QDGA 4OZIB 1Q9OA 1BD2B 1JK8B 3MCLL 2F74B 5AYUL 4NCDA 4F37F 4ONGH 3QFJD 2YD3A 1WK0A 3V95A 5MEOB 4P3WA 1MVFA 3AB0C 2GSGB 2QBWA 3A6BH 3G04B 4FQJL 2P5EB 4YHYC 4NCC2 4P59H 4JM2F 1CZ8H 1RK0B 3HG1E 4JZJB 4XCCL 4DKDC 5DO2D 4PREB 2A77H 1XGUA 1NDGA 5L2JA 2K7QA 2DI7A 4OJFH 3BPCA 1KV3A 4RGMC 3X13A 5L88L 1MF2H 5KVFL 1JI2A 5F7LB 5FOBA 2RIKA 2EYTB 1B88A 1KCSL 2LTQB 5C07D 5DHVB 5GRUH 1AQKL 1H8NA 3QDME 1H5BB 3V5DA 3HB3C 4KI5F 2NXZB 4LHUB 4K94L 3JV6A 3OKKB 4XPAL 3W2DL 2VDOH 2ZUUA 1UM4H 5C92A 5F7EH 5I71C 3CFCL 3MV8E 3VFNA 3O41A 2HLFC 4XHJC 1N6QL 3IXAB 4NNXB 5B3JE 3ZKMC 3NPZB 4YPJA 4Y4FB 3MPCA 5IBLC 1FZKB 1F4AA 2WNGA 4Y5YC 1A5FL 3KPMA 1SMOA 4EN3A 2FWOA 1I1AC 1CGTA 4U6VL 2GJ6E 4NJAL 5JXAL 3ZYJA 1XIWC 5JQ6L 2F54B 4LCYB 3FFCA 1AKJD 3VMOA 4LPTA 4NFDA 4CN6A 4UV7H 2M1KA 3OR7A 3LRGA 3BHBA 3UTZA 1X5GA 4WFGD 3PDGA 3IAPA 5IW1A 1OTSD 3UTTE 5IFAH 3PHOA 4PGZA 5TDOB 1KXVC 4LSUL 5T5NF 2R2EA 4OKVA 3LOWA 1A6PA 4G8IB 1MRFL 3BPNC 4XWGH 3IDMB 4D9QE 1T21A 3FQRB 1YNTB 4X9GA 1AD9B 5MI0C 4HF5L 2JIXD 4LP4A 5JZ7C 2R29H 2APBA 1OAYL 4LBEB 4PJCF 5J1AB 1M6OA 5GQBA 3DX7A 3TBTA 5ESQB 4Q97A 1HHJB 2MPAL 3BSZH 4XNUH 1A7QH 3PJSB 2XWJB 5D6CA 1TJGL 1T80A 4N8PA 4C56E 5ACMA 3MV9A 1HXYB 3JSSA 2GK2A 4POZD 1VB9A 3Q5OA 4OGYH 2OJZL 1NDMB 2BZDA 2IG2L 3H6JA 4P9HL 4AEIL 3UZVB 4YAQA 4FQHB 1ZGLA 1I4FB 3DV6B 4BM7A 5IHZB 1CR9H 4LIQL 3EYFA 4PG9B 3VXRB 3FQUA 4AL8H 2BJML 2HT2D 1J05A 4NZUL 3MRDB 4YXHH 3GMLA 3ARFB 4PJEA 4LPUA 4XPFH 5JLZA 2MCG1 1NMBL 4MD5A 5GS1B 3FO2B 4LGRB 5GXBB 2AVGA 2PW2B 3TO4B 4OGXL 5IVXE 1ODAA 4ZS6C 5T3ZD 4IS6B 4PJ8B 5FYKD 1T0MA 5A16A 1ZT7A 1IC5L 2HJKB 5J56B 3GRWH 5K9JH 2BDNL 2WM0A 4JR9H 1HOCA 3T0BA 5BMFH 1JGEB 1OAQH 3BYTA 1NFIA 5B38B 3VGAB 2DICA 4KPHH 3BN9D 3LPFA 2I9TB 2Y5EA 4Y16C 4GMSL 2R0LH 5CWSB 2H2PD 3UTSB 5I1IH 3KXFB 1BFVH 4Y4KB 4ODXA 4MX7B 2CMRH 5TE4H 1TZGH 4NYLB 3P77B 2C1PA 5E2UL 2AERT 4Z9KB 1JNHA 3EYOB 3REVA 3FQTB 2DBJA 4F7MA 4D9RD 2BRRL 1FVEB 1NFKA 4JM2A 5ISZE 5IIEA 3GMPB 4N0UB 12E8L 3LQZB 1F45A 43CAA 5JXED 5C0ND 2E5EA 2HKHH 1WICA 3PGCB 5DXWA 2RBLA 3T09A 4ETQB 4QRTB 3HI1A 3SDCD 3JWDC 1F02I 1OAXL 4GLRH 3ESVF 3VXUD 4HJ0D 4HK3J 4L3AA 4PJEF 4UUJA 5LVEA 5ID1B 3BZFA 3GBNL 3DETC 4MZ3A 2ORBL 4RMTA 4UQ3B 4OM1L 3RBSA 1GSMA 5C09A 1LDPL 3G6JF 1C1EH 4HZAA 2P5WB 2Z8VC 5SX5H 4XVJH 5SX4I 5B38G 1AHWB 4PJGB 4MLIA 3R4DA 1WUNT 4R26L 1T2XA 1SBSH 3SKOB 4PRAA 4YDLC 2DM3A 3NIGF 2PO6C 4LLVA 5CEZE 3B9KB 4XNZB 4OM0H 3TBSA 1KB9K 2CRIA 2GITA 1IC7H 4X80H 2ZCLL 4G8GA 4L3CB 5IM7B 1V8HA 3DUSB 3HE7B 3HUJA 4N5UA 1C5DA 4TNVK 4PY8J 4NDMB 3MLUL 3T1FA 5E9DD 3A6OA 2IH3A 1Z3GL 3EO0B 4WW2C 4IRSD 1A9BB 4OZIE 4PP1C 4XPHL 4C57C 3FB6A 2O5YL 3MLVH 3MUZ1 5I8EA 3FB7A 1LP9F 3JBG7 1RAMA 1KJ2L 5T33H 4X6DA 4X6BA 4OLYH 2CRMA 5FUZH 5I75C 5EU6B 3H42L 1AR2A 5IK3A 3MRKA 1K6QL 2Y7QA 1LWRA 4P3DB 5GGQL 4RRPA 3O8XB 4FQXB 5AD0A 5BO1H 3IJYB 4R4BA 8FABA 3FQNA 4GRLC 1OT1A 4QHNB 3QDMD 4WFFD 3OAZH 1MELA 3QEGH 2G9HA 5IKCB 4A6YL 4OT1L 1XF2B 5HD8D 1MCOL 1FVDA 3FO0H 5CP7B 4AENB 2IBZY 3EYQC 5EZIH 1GYAA 2F19H 3A6BL 4Y5XB 1N2RA 3GMMA 3AGVA 3BP6A 3O2VH 2VXUH 4LCWD 4X80L 3A67H 1AGDA 1LP9A 4Y8AA 4LAQL 2ZSVA 1MCPL 1DBMH 5IHUH 4P0DA 2PW2A 4OZIF 2NW3B 5L88H 3WFBL 1IJ9A 2CRYA 5F88A 1OW0A 2A6JB 1J8HD 4OTXH 1BM3H 1GPOL 5D7JD 3LQAH 1M7IA 4S2SA 4X6DB 3O4LD 4QNPE 3FQTA 3QPXH 1AH1A 5CLTA 3MA9L 3RZCD 3FB8A 4ODXB 5I1DB 4L9LC 3H42H 4U6HA 3QCVH 4YDVB 1YNKL 1G7MA 1ZWIB 3PNWA 1K6QH 5TDPA 5TE7L 5DO2C 4Z95L 1ZLSH 1Q9WA 4N1HB 4G8GB 4L3CA 3OGOE 4NRZA 1TETH 4FQIL 3MLYL 4L4VA 4PJFE 4Z7UB 2IAMA 3NZHL 1KB5H 3RTQD 4XWGL 4C4KT 5JTWA 3EGSA 3RWIA 2IC2A 3BH8B 3HNVH 1LO3L 3D0LA 2A73B 2YZ1A 3GHEL 3KHOA 3BMWA 4D0DB 3BO8B 1AHWA 5DFTA 5DWUL 1NGWB 2P8LA 1T5XB 3PHOB 3GJFA 4NZDA 5DT1H 3T08A 2J2ZA 1PX3A 4JDTL 4XCEB 4AM0A 4X6DE 3MRDA 3L3KB 4YPGB 1MCEA 4C4KO 5DK2B 3K4ZA 1RZJL 1IRAY 4K3JL 1GGBH 4IOSD 4HW6A 2NX5B 4HKZA 3HKFA 1F6LL 1F3JB 3QRFM 2QEJA 3K8KA 3F7PC 4RFEA 2EIZA 2YD9A 3EYVB 3N06B 1FGNL 2YN3A 4K3HA 2PXYB 3W0WD 4ELME 1E4JA 1D6VH 1WIPA 5BQ7B 4WRLA 2EDXA 1QLEL 5CJOH 4X6CB 4TUJB 1JGUH 1J88A 3BPCB 3X13B 5F9OL 3CCHB 5L2JB 2X1WL 3EO9L 2E7BA 1N8ZA 5C0CE 4BSWB 1CZ8L 2OTUA 4QF1B 3MJ9H 5DJ8A 5K9JL 5DSCA 4MNGB 1HNGA 4XBEH 5DDHB 4HPOL 3GMNB 3WKMH 5DWUH 4XZUB 3I50H 3T2PA 3RWCB 5TDOA 1BEYH 2NY4D 4LLWB 3V9FA 4NHCH 1BJ8A 5FKPB 4L8DA 3QEQD 4K94H 4ZFGH 1JGEA 3FFCB 1BWMA 1ROWA 4YK4B 1UADC 2YPVL 1NUDA 4MQTB 3U82B 3G5ZA 3WHE0 5C0BA 1K3IA 1V3MA 3LY6A 4LNRB 5CIPH 3IDXL 3R0NA 2Y5TA 1JPSL 3DIFB 1WWWX 4DN3H 3T8XA 4UTAL 3Q1SH 4OAWA 15C8L 1AC6A 1FGVH 4M7JL 3T1WA 4RMUA 3CFKA 3FO2A 4A2MA 1LD9A 4EDWL 3VXNB 1NGYA 4LVOC 4P23C 4QWWC 1KOAA 5FM4A 2ZUYA 2AEIT 4JZOB 4RCAA 2V5SA 1ONQB 4GG6B 2P46B 1F42A 1H0DA 4L9DA 3S36X 3EO9H 1G6RB 5CJ8A 5DD6A 4XB8A 2YRPA 4IBLT 3QISA 5I6XB 2CK2A 4DGVL 3OAYH 4OFYD 5FA4A 4N90E 1P84J 1I7ZA 1PSKH 5TF0A 5I1AA 5FB8B 4Y5VB 5HHQB 1L6ZA 4OCSL 3MUHL 1JZ4A 1XH3A 4U1NA 4BKLA 2E9BA 1X6NA 3S37X 5I1CH 4JO1L 1TNMA 1HHJA 3EDEA 1G7IB 1F90H 1F4WL 4NIKB 4E42B 4HGMA 4CL7A 1JV5A 1MCNA 3FL7A 4HAFA 1KLUB 3OKMA 3P9MB 4XCYA 3SDAD 4JPVL 3BPNB 2XA8L 4PJGE 1NC4A 2FX7L 2AK4B 1BECA 5DUML 4KI5D 4YWGH 4FQQB 1B9ZA 2VB5A 4LIQH 5EDXA 1DP0A 4WVRA 3HRPA 4U33A 1DVFC 3K1DA 3FO1A 3DMMD 3G6AB 2VR9A 3MRFB 2ZUQC 2VAJA 5LGJA 1XZ0A 2PTVA 3C6SB 4WI8A 2PTUA 3IDYB 2Q20A 4W6XB 2O5XL 4XZUA 1DL7L 3DBXA 5DRNB 4U05A 1YJDC 2X4QB 3B5GA 5C0CD 2V9QA 5DHYA 3O6FB 3QXTA 3WIHH 3MYJA 5F9JA 2JK5A 3TBYB 1IAIL 2X09A 2AJXH 2B7DT 1FCCA 3HA0A 2ZPKH 2DMCA 4FZEH 5ERWA 3B6SA 1U8QB 5L8JB 4GXUM 1QSVA 3SKJL 2NW2B 3F65A 1CFVH 2WK2A 3GNML 2FECI 4D0BA 1G9NH 2D03L 1S9YA 3GFUA 4J3SA 5C0FB 5J13B 4PLOB 3G6DL 1JZ6A 1EUTA 2R4SL 4UT6L 3UTQA 3K2UH 1S7TA 2AJYL 4MA7L 3B8YA 3VFMA 1M05A 2ITDB 3S88L 4KDTA 2A6IA 1TJHH 4XWOC 2D0HA 1TDQA 3D3VD 4DCQB 2P5EA 1G6RA 1TITA 1YPZA 2LABA 4O58H 5F44A 3F7RA 3C5ZC 1RHFA 1AQDA 1JGDB 3O3DB 1RJYB 2BRRH 1E28B 4JQVA 5DJCB 5IEKA 5AZ2L 5ADPH 2LU4A 1KTDB 3CFEB 4U6YB 1ERNA 3IJSA 3SGJC 4LARL 2DQTH 3O2WH 3BP7B 1RIUL 4ONFL 3V4UH 4WI2A 1U93B 2FJHA 2X10A 5FHBH 3MMEB 1YEKL 1T7VA 3D0LB 3E0GA 4NN5B 4HD9A 4ERSH 4YE4L 5T5FH 2I9LA 3KYAA 4WJ5B 1XCTA 2B1HH 4Y16A 2VDPH 4Y1AA 4JFDB 5BVJA 2IGFH 4EVNB 2CIIA 1CGVA 3JUYA 4OLEA 4YLQT 4RAUB 1TMCB 3QAZB 4KUZL 5D5MA 4KKAC 3SDCA 5FO8A 3QT2A 2NY4C 3SQOL 5JW3L 3SKJH 3UTPE 1YJDH 5IVNA 3W5NA 4KMLB 1MLBB 1PX4A 2FJGB 4N0FA 1IL1A 3R06B 1O5DT 4F58L 2KQNA 1NUNB 2EIDA 3TN0C 1P4LA 5C8JB 1ZWIA 3EYSH 4EOWL 4H1LB 5IEHA 3QUYA 5L8LB 4ODWB 2VWEC 2DQIH 1OB1B 1I75A 2HTKD 2DRUA 3TN0A 3X11B 1J8HE 3P73B 3KPSD 3EJYD 4TUKL 1DQLH 4OGAD 2DQFA 2HVJA 4R3SA 4CU7A 2EDWA 3NIFE 2XTLA 4XGZB 4JFDA 4V1DA 5BVJB 2EDOA 4YHNB 1KCKA 5F21B 2H2SC 1F3DH 1XCTB 3I84A 4RISH 1RU9L 2YC1B 4M1GH 4DAGH 1T6VN 2IANB 4X7EC 5TF1L 1QFHA 3BH9A 4P48A 4P5KB 4XCFL 4HS6B 4I4WB 1VPOH 5E03A 3L5IA 4WFFE 4DUXA 5L7XL 2VNCA 4XT1C 1YEHL 1A6TB 1F4XL 1XF2A 2BSED 2A9NH 1D5BB 5FGCE 2FX8L 2BCKA 2P8PB 3QNZB 2GJ6B 1AIFB 1WISA 5LXGL 3EFDL 5L2KA 1V3JA 4AY0A 3LAFA 2FEEI 5CJOL 2FD6L 4OLWL 3MRHA 4V1DB 4QOKB 1R5WB 1TZHB 4GKNB 4JGJA 1DTUA 3J8F7 5KZCD 2IAMB 1S7SA 3OSKA 5ADOL 1N4XL 4M5YL 4PJXB 1EO7A 4MJIB 2J3SA 3ECBA 4Q0XH 3WFHA 4HV8B 3LHPL 3PDOA 5JPMB 4K9EH 3F58L 2C1OA 4XBEL 4U1SB 3K81A 2PN5A 2AJVL 3BRFA 1U41A 5EBWA 1AD0B 3EOAA 5C0BE 3VI4F 3MYJB 5F9JB 3VFRB 4M1GL 4X6CF 1UJ3A 3FKUS 3CZFB 1OAZH 5I9QC 2GITB 5DRZB 4HFUH 5D96C 3H2WA 4KZEH 3B9VA 5JHDA 5IHBA 3WUZA 2ITCA 2Z8RA 5A2KH 4YDJB 3DGGB 3IDJA 2DWEB 1J12A 1S7VA 4KGJA 4QXGH 3UTTA 3GSWB 3FN3A 2MQ0A 2Z4QB 2Z91A 3H9HB 5MEND 2BSSA 2DKSA 5GSRA 3VA6A 4OQTL 1KPVB 1CLZH 3V0VB 3ES6A 5TQ0L 2R23B 1SYVA 3SJVD 1EJOL 2X42A 1S5IL 2AI0L 4JKWA 1HQ4B 2GK0A 3T0EB 3BD4A 3MJ8B 3SKMA 5JW5A 4Y1AD 1JZ2A 3OKYA 4PGJA 1TCRB 1BBDH 1JUFB 2XNAB 3LKRA 2NY1C 5EZJA 4NC0B 3O3DA 3OPZL 1PSKL 3MV7B 3HNVL 4GRLD 4ETQA 4WHTA 2JJSC 1S9XA 2ZUSA 4LKXB 5CD3B 2DQGH 4I48B 4APQC 2A6IB 4HUUB 4Y4HB 3WN5C 1UH3A 1FYTB 3B8SA 1MAJA 2WBJA 1JPGA 2JB5L 5B21A 3AAZA 2XPGA 4LVNB 1F6AA 1QRKA 2AW2A 3OBAA 5I8EB 4IRSC 2Q8BL 1EBPA 4U1GB 1FBIH 3U9UA 2P49B 3NGBB 3WJJC 1FIEA 3WCYA 3HZKB 3L1OH 3MCG1 4HBCL 1FYTE 3EO0A 2F58L 4U3CA 2YA0A 1I1FA 1NC2D 3DIFA 5I19H 5EUKB 1R3KA 3KJ6H 4XVUD 3Q3GA 2CRZA 5D2LF 5DTFB 4BQ8A 2X4QA 1SY6H 4KK8C 2XZCL 3SBWC 1I9EA 1T03L 3X14A 1FORH 4KROC 4YX2L 2H26A 3IDIB 5GS0C 2NNAA 3U30B 4Y0GA 5A2JH 1FN4A 1Z9SA 4ZS7H 3NABL 3RWCA 2C3XA 1JFQH 4OBRA 5EU3B 1BQHB 1NCTA 1DE4B 3O81A 1OAYH 1KB9J 2I07A 1F8TH 3QPQD 3ALXA 1IM9A 2R2BA 5IVZA 1YMMD 1WFTA 1G7PB 2CUIA 3ARBC 43C9B 5C0GA 4KI5E 4ORGA 1A7QL 4KJWD 5HGGS 2FZ3B 5BVPL 5IP4A 1TJGH 1EPFA 5MHSE 3IF1A 5E6ZA 4HF5H 4HJ0C 4F7TA 1CGYA 2X9YA 1KFAH 2Q76B 3DX9A 5BJTA 3TWCL 1D7FA 1QLFA 5AZEL 3SE8L 2W0FB 3NTCH 4H88H 4JM2D 4OV5B 5D71L 4HFWA 5JXEC 1T0PB 1FNSL 2W0FA 4EI6B 2V6HA 1WF5A 4HG4K 1IGML 5DD6B 4LSPL 4JQIL 4MJIE 4S1RH 4UIMB 3VWJB 1KIRA 3DX7B 5F96L 4HS8L 1XGPB 4LQFH 4UNUA 4LLUB 4XP1L 2FB4L 3E6FA 5C6TH 1ETZB 5CBAA 5CILL 43C9A 1UT9A 1KULA 3KYKL 4EUPG 2NXYC 4KMTH 3OXSB 5I16A 4K3EH 3BIKB 3BT2L 1BIIA 1B0RB 1BQLL 1PQZA 2UUDH 1ADQA 4PJCE 3BN9C 2J6EA 5IMLB 4KRPB 5BMFL 4RZCA 5C0BB 1IM3B 3EGSB 3WUWB 5IVXF 3L3JA 2ENYA 2DTSA 3GMQB 1XCQB 4HKBB 5EU6E 4DZ8A 1XGRB 3GO1L 4R4FH 3T0XA 4QRRA 4PRIB 1OT2A 3PQYB 1TZIA 1T2QL 4N8CH 4PGCA 4J3XA 4RGND 4R2GC 1KFAL 2MCPL 1JNJA 5C0EB 3JVGC 2D31B 2F9BT 3M1BA 1T2JA 2ZP0T 3TO4A 3FMGH 2JTDA 5DGQA 5EUOA 2HRPH 4OLVH 1F4YH 1NBYB 3OKLA 3F7YB 4X6EB 4K8RD 4F57L 4X7TB 4YFLF 5FGCB 4I77H 1UJ3C 2BNQA 2IH1B 1ED3A 3VGBA 4U31A 3QB7C 4FQCL 4WO4C 4L9LB 4KTEH 4OBSA 5GRJH 1LVEA 1BMGA 4G9FE 2ARJB 4MD4A 3EYFB 5E56A 4E9LA 4NGHH 2PXYA 1XGUB 1ZGLB 1EAJA 3FQXA 4L8BB 3IB4A 4KV5F 4G6JH 3OF6D 4G9DA 4BUHA 5F1NB 1UYWL 4Z5RB 3G04A 1AY1H 12E8H 1CFSB 2E27L 4YHPA 5ISZB 5L7XH 3QJFB 4FG6D 3DX9B 5BJTB 2IAMC 3FHQA 4XXCC 1JUFA 1X5JA 5E7BA 3GO1H 3RVWC 3SE9L 3TVMB 4JHAH 4HPYH 4M8QB 3BGMB 4OLZH 5HI5D 1OAKH 1INQA 1U0QA 5E8PA 1SBSL 2VDNL 4QGYA 1LO2H 4MNQE 4ELMF 4YDIH 4JAMB 4PJBB 1A6WL 1T20A 4PRPA 2XZQH 3GSUA 1WCBA 5HHXH 1HHHB 3ZYIA 5EU6A 4YXLL 2EIEA 3FN0L 4G8EA 3O3BA 5FKAB 5I1LB 3U7AA 2ITCB 4HKXA 4D0CA 2YWYA 2FRGP 2NNAB 2CJUL 4DQOL 1IGYA 2BVUA 1KLGA 5FGSA 3WS3A 4K2UL 4F37K 2FR4A 5I6XC 3BPLC 4NGHL 5GGRA 5IBLD 4QXTA 5C09E 3VRJB 2VDQL 2B1HL 4WENB 4MJ5A 5FEBA 3UTSE 5EOCL 1CL7H 3RGHA 3P9WB 4NQDE 1SBBA 3U46A 1UZ8A 4LVOB 3U7WH 5F9DC 5I1DA 2IPKB 2D7TL 1UM6H 5JW3H 5F6HJ 2QL1A 4FZ8L 4CW1B 4BFEA 2HKFL 1CLZL 3QBTB 5D7SL 2OZ4A 2Y72A 2J6EH 4W70A 3O4LE 3S3PA 3FHAA 1G7PA 3KLAB 4HUUA 1IM9B 1ADQL 2R2BB 4WUUD 4HDIB 3FT4A 5C08B 3CXHK 1CDYA 1Z2KA 3PGFH 2Y1VA 5C09B 4U1MA 4U6XB 4ODUA 3QAZC 1QVOA 4MDIA 4GAFB 2BFVL 4HEME 3T2NL 4HS6A 3BI9X 3RKDC 4X7SH 2UVEA 4G9FD 1IKFH 1R24A 1G7JB 4OV6F 3I75A 3V5HB 1REIA 2C3GA 1FO0A 3V7MA 3V6BR 3PXJA 1VGKB 2DYPD 3O2VL 1GC1C 2VERN 1EO5A 4KKNA 43CAB 1EZVY 3GSRA 4LRNH 4QY8B 4C56B 4M00A 5D7LA 5EO0B 3L7FB 2P43B 4MDJA 1EDQA 1HILA 3U9PL 4IRZH 1AJ7H 1RZ8B 3SJVE 3GSVB 4RBPH 2XWTA 2GUOB 2Z8SA 4GO6B 1TJIH 3KR3L 1Z6JT 4W68A 1FL3A 4JJ5A 1C08A 4XAKD 5TJWK 3WYRA 2H2PC 3X3FH 1ACYH 3STZB 1YNKH 5FFLA 2MKLC 2X89D 3UO1L 4UINL 2ADIA 4R2GD 5CKGA 5KOMC 5T1DH 2ESVB 4QXWA 2H6PB 3SGDI 5CLWA 5JUEL 3NH7H 1U8PA 3LKOA 3ABZA 4R7NB 5EIVA 1QG3A 2NLJA 1XF3A 5EBGA 3RGVA 5DJ6A 5F89B 1I8MA 2FSEA 3TZVD 1TTFA 3UXFA 4FQJH 3OG6B 1BOGA 3SKNB 4ZS6D 3W11D 2R56H 5L0QC 4GRWH 1OPGH 5KJRH 2Z4QA 1SJEA 4XP4H 4ZPVB 4LSTL 1RUPL 1T1YB 3RVXD 4P9HC 2FBOJ 3HC3L 3PWUA 4NOFA 1AQKH 4GS7C 4ZNCD 4XI5C 3JTTA 1I4FA 2K3TA 1VEPA 4FQ2H 1GXEA 4M1CC 1U6AH 5DK0B 3ZKXC 3BH9B 4Z7UF 4LDEB 1M05B 5IROA 4P4KA 1IGTB 4NQVB 5BS0E 4JKPL 3VMNA 3ZKSD 1KCUL 3I85A 1HI6B 4G7VL 5C6TL 1Q0YH 4KFZC 1MJUL 3LKNA 3L3GB 1A7PL 1D5MA 1RZ8A 5GGRY 4LIQE 3ZSTA 2CO7B 1MI5B 1X5AA 4X99A 5E24E 4XB7A 3C5JA 3MX0A 5DQDL 4OZFH 3CAFA 4ZFZA 4APQD 4WV1C 4QOKA 2OZ4L 1PKQE 4QNPF 3VRIB 5IFAL 5CINL 3ARWA 3STLB 3I50L 4TVSa 5EZOL 3KPNA 2ERJB 5JZ7D 3V79C 1T0NA 2X4SA 3OX8A 1MRDH 4UV4H 4MNGE 3FFDA 4QHKI 4KVCL 5DURD 4P2QD 4Z8FL 1X3DA 3OXRA 1VCAA 3MGAA 2JJVA 5LWYH 3VW3H 4I0PD 1T1WA 3RIFK 3THMH 5GHWH 1GGTA 5IWLC 4WTXA 4FRWA 1I8KA 1KJVA 3S3JA 1NCCH 1RIHL 2VTFA 4L3EE 4ELMB 5DD0L 4LSSH 3MLZH 3MRCB 4KROB 3F7VA 1FO0L 3BQUD 4M48H 3T2OA 4EDWH 4JPWH 1TVBA 2PCPA 1HZHL 3V5KB 5HTSA 5IQ7H 2EYSB 4JHWL 1WBZB 4JRYD 5D1ZA 4PGDA 1H3VA 1IAIM 3TPUA 1FSKB 4A6YB 1FVCB 2CLZA 4DVRL 2ADGA 1J1XL 3HB3D 3C8KA 3LVEA 2IBBA 2J12B 3NGBC 3RGVD 4PJXF 3FJTA 3G6JB 3DV6A 5HJ3B 5E2WL 1W2KT 2J7LA 4EUPH 4FFVD 2DDQL 3BKJH 2EZ0C 4ONGL 3HE6A 3VWKD 1ZSDB 2DKMA 2R9HC 2J8UA 1NLDL 5ALBH 1T6WA 3HC4L 4GG8B 5MEOA 3CSBA 3HI5H 3TJHD 5IBTH 5DJAB 3VW3L 4YHYB 3K4DA 2BOCB 2Q3AA 3H3BC 3QH3A 1GHFH 4P5TB 3RIAF 3QQ3B 4MDJB 1PKQA 3F5WA 2FX7H 4PJ9A 3ARZA 1NMAL 3VXTA 2YD2A 4CJ1A 1F4WH 1U92B 4WJ5A 3LS5H 2EE9A 4DGYH 1PD6A 3IDYC 2WQRA 3B5HA 2OQJB 1RUKH 3VFPA 4LSPH 3S98A 3MNZB 3N85L 4PJHF 1AO7D 4DGIH 5I1GL 2MFNA 4G8IA 4F3FA 5D1XD 4UNVA 2UVFA 3T77B 1KCVL 4HMDA 1ES0B 1KUMA 4Y88A 3MJ7A 5FO9B 2R0WH 4K3EL 1C5BL 2AXGB 1AGFA 1Q1JL 2OP4H 3QFDB 4PJ7F 1GCFA 3V6OC 1IAIH 1NC4B 1WVZA 5F1NA 4KRMB 2OTUB 5D96B 4Y4FA 4IJ3B 4BSWA 4U2YA 2EDYA 5KW9H 4WO4B 3NPSC 1U91B 4K7FA 2E3VA 4R4FL 2D7OA 3UTQB 5H2BB 1QSFA 4L4VE 4PJFA 5F1IA 2X4RB 1K8IB 2AGJL 2DQJH 4WWKC 2NY7H 1XAUA 3RNKA 3Q6FB 4ZTOL 4OFYA 1J1OL 3NFNB 2BNRD 2AAVA 2Q6WA 5T1KA 3MFGB 3OKLB 4FZEL 4NWUH 5A2IH 1P53A 4JKLA 4FXLA 3PGDB 4EBQL 3MRIA 2F53A 1DBJL 2JCCF 5C07E 3D2UB 1X6LA 5F7KC 3RBGA 1BF2A 1RK0A 5E6IC 1LO0L 1CGSL 3ULUF 1FH5L 4GAGL 2VLKD 4WCYH 3CC5B 5D1QA 5GGRB 1X5YA 5B3JF 2VKWA 5D6DC 4R6UA 4FQCH 1JMZA 3V8OA 5JO5A 1KC5H 5TDNB 3GSQA 1XGRA 1IEBA 1CK0H 1K2DA 3VXNA 3QRGH 3CPLA 5T5FL 3PDDA 2QQLH 4NN6B 3L5WA 1JWUA 2VUOA 4AT6B 3EHBD 4LVHC 4U1LB 3KPSE 2OQJA 1GAFH 1A7OL 1LO4H 2AK4A 2APXA 3QA3B 4WW2F 4W81A 4CGTA 2XTJD 5KAQG 2VDLL 2ED9A 2WBWB 4GW1B 3IS1X 2GTZB 2FHCA 3HAEB 3CFIC 5EULV 1RJLA 3QWRD 1IC5H 2NY7L 2XFXA 2YA1A 5KS9B 1JN6A 1JF6A 3I02B 1NANI 1DJSA 3B4NA 3CC5A 3L5XH 3PIQA 2Z9TA 4HIXL 3TNMB 1JNNH 3GSOA 2ADFH 4YZFE 2W59A 4LPXA 4OZFG 1DQMH 3OHXB 3QCTH 4WFHE 5HHNA 2VXSL 1XGYH 4GRWF 1WV7T 3B9AA 2BNQD 4HIJA 4NO0B 3V6ZB 4F33B 1N8ZB 1U58A 3G6JA 3NH7L 3DO7B 5M94B 4UMGA 2IQAA 3BGFC 3ARBB 3ARGD 3MREA 4KRNA 1OVZA 3MBXL 4OKDA 1NH6A 5EBLA 2ZJSL 4P4KD 5ENWB 5KSAB 4YXKH 1S7UB 3LEXB 1NBYA 5K93A 1QBBA 4MA1C 2A83A 2WUCL 5FDWB 4P2OD 1OPGL 1WBZA 5K9OB 4HHAA 2EYSA 4K7PH 1QFUL 2J8UE 4MVBC 5CGTA 2D31A 4FFWD 3ARDD 3VD7A 3BP6B 1WAAE 3LSOB 5FUOH 3TT3L 4NO5B 2N7AA 1ES0A 3NA9H 4OTXL 5TQ2L 2PYEE 4ZSOB 3V7AG 1KGCD 2QQQA 1G6VK 3ARTA 5I15L 4XCEA 1R0AH 4YEFA 5EPMB 3ZKND 1EA9C 3L3JB 5JORB 4J1UA 1QEWA 4G6FD 5DMIL 4LSVH 2P8LB 3C9NB 2FD6H 3ILPB 4NKQB 4JFDE 4BQBA 3LCYA 3GMNA 1R3LB 5IBUG 1Q0YL 4FTVE 2ZCKH 1H3TA 5E2VH 1GRWA 3FTGA 3GJEA 4AZ8A 1JYVA 3U0WL 2D7PA 4J3OC 1V05A 4K3DH 2P24A 2OM5A 1EBAA 3KYNB 3EFDH 1MFAL 4BK5A 4XP9L 1OF2A 2E9IA 3VXRE 4PRHB 3QHZL 5CZKA 4X6CA 2F53D 4NWTL 4Z0XA 5L8KB 4GG6F 1CDGA 5DFWH 3JXAA 1ZLUK 5CJXA 5HHOD 4Z7NF 4CVXB 2BX5A 3INUH 1NGZB 2H8PB 5HGBB 4KZEL 3HE6B 1W0VA 1DQDL 4LRNL 2J1KA 1ZS8B 4K9EL 1GZPA 2B4CH 2I25N 5CSZB 4HKZB 1D6EA 1X5ZA 5DVKA 4PUBL 5HDQL 2Z8WC 5IMKB 1OAZL 3RVVC 1X5IA 2DJSA 3QIUB 1KF9B 1NAMB 4M48L 3RI5K 2A74B 2YKLH 1RZJH 3EJZD 3PWJB 3MCKB 4HWBH 2NY5L 1VGEH 4I0CC 1KXTB 2NMSA 5DMIH 5HDBE 1NGWA 3NCJL 5IVZB 5ETUB 3KPPA 4S1QH 3W11C 1NCBL 5INDB 2ZCKL 3LN4B 5BS0A 1I8MB 3UTTB 2AEQL 3UO1H 5B3NA 1UA6H 3RPIB 5I1HH 3P0VH 5IMMB 3CMOL 3BMVA 4N90D 2ADJA 3VGFA 4IRJC 1GL4B 4HZLB 4R7DA 4OT1H 3NCYS 3FB5B 1II4E 1I8IB 3JTSA 1I3RA 1J11A 2D9QB 1P84K 3MR9A 3TO4C 2VL5B 4L8SC 1DFBL 4ZPTB 3KPNB 4PBVC 1RD6A 3MRJB 1EAPA 2AABL 4JG1H 5IK3B 3CUPB 1FC1A 3QNXB 1AFVL 3S3SA 4LSTH 4JO2L 2DQDL 3QR2A 1UWXK 3U6RB 3S34L 4YHLH 3ULUH 4JRXE 2VDKH 4LOUC 1HSAA 4PRHE 3QI9B 3MODH 3VXMB 1FE8H 3BRDA 4KUCF 4P23D 4QWWD 3C5SA 1DANT 2IJ0C 5A3ID 4E41B 2X2YA 3GSRB 4QY8A 2XZCH 3D9AL 4Y19A 3DGCR 4Y4KC 5I0ZA 5E8NB 4I48A 2XG5A 4JDZB 4JPKL 3DUSA 3QDGD 4S1QL 1S7XB 4IMKC 1KNOA 5DD5L 5BRZB 1INEH 5F3BA 1BBJB 4HUXA 3AM8A 2WBJD 1BD2E 4AYFA 4TVPH 2R1WB 3OJVC 4ZSOA 2I5YH 4ZQKB 4QRPB 1TIUA 4HUNB 1O7SA 2AEWA 4XX1G 3S6CA 5A1AA 3W9DB 2EE3A 5HGAB 2YD8A 4KKLC 2BRQA 4RA3A 4MA1B 2YUXA 2DL2A 4U6XA 1M4KA 1J1PL 3N0PB 2O61A 4IS6A 3UPRA 3BXNB 4C58B 1U3HD 3Q2CA 4ZS7L 4FQLL 4P3CL 5DF0A 4DGVH 4QRUB 4GKSA 2HN7A 3HCVA 4P3DA 4XH2A 3DTXB 3PWJA 4JO4H 1S9VB 4FQPA 1QP1A 3GGWB 4Y2DA 3FQWA 2A38A 2ZG2A 3CLEL 5H37H 4ENEC 2X40A 5CS7A 4KKCD 4WHYH 3V0AC 3V6ZA 3K8MA 1U8KA 5E6YA 3KPRA 4HUKB 4WCYL 3VJ6B 1ZS8A 1W72L 5SV3A 3KYOB 4P2YA 1DQQA 1I9RH 2G5BA 1ZANL 4LLAA 4GSDH 1C5DB 1IMHC 4JPKH 1EEYA 2CDEA 3LH2H 4GMTL 4UT9L 2YK1L 3AY4A 1LO5A 2HVKA 1DSFH 2DD8L 4JRXA 4WGVB 3ZTNH 1IKNA 3RL1A 1LE9A 5D7LB 4Z7OF 1P5UA 3AREC 4U0QB 3IFOB 4GW1A 3BD3A 3J7HA 5SWSA 3O3BB 4ODBD 1YNTA 2BXYA 1VGKA 3IXTB 2QR0A 3GJFK 1OP3K 4OLUL 5EIQA 4NQDA 2NY0B 1EFXA 2A9ML 3SDDC 4YQXL 4QRSB 4PJDF 2FJFA 1CBVH 3CFJA 2D7QA 3BHBB 4BYHA 3DUHA 2ORBH 2ADFL 3V4VH 3QEUA 1KLFA 1FFNA 4ZDHA 4L3ED 1KEGL 1CD1A 1QOKA 4AH2A 1NJ9B 4YGVB 1HHGB 3H9SD 1MQKH 2V7HA 2YD6A 1M71B 1Y0LB 4XMKL 3N85H 5I1GH 1YEFH 3O41B 4HGWB 3R1GL 5EU7C 1S7UA 3LEXA 4OSUH 2YK1H 5JIIA 3MGOB 2HFTA 1PY4A 4BH8A 2ATPA 1P6AB 2BJMH 1KTKE 2D4DA 5JPNA 3K7UA 2CDFA 4PJFB 3GSNH 4JQXA 4EIGB 2AS5M 2L7JA 3DSFH 3U46B 2C1PB 3ULUE 3WD5L 3O3AB 1OTTD 5D7JC 2V9RA 4MJ5B 1PYWB 3DECA 5GRJL 1CQYA 2UV3A 1LGVA 1BZQK 1Y18A 1DEEB 1RUMH 1YA5A 2GSGA 4TNWK 5JHDE 1J0IA 4Y4HC 2ZUQB 1I8LA 1EEQA 4NZRH 1K8DA 5EORH 5FUCC 5HYJA 4D2NA 3B2UC 4JN2A 2CKBH 2F74A 1VEMA 2XT1B 3RAJH 2X4UA 4JFQA 3M17A 4OCSH 5EOTA 5SWSE 3OTTA 5C0IA 4E0RB 4KHXH 1UB6A 5FXCH 1XCQA 3GSUB 2ZKHL 2OXGA 5HD8C 2AP2A 2AJUL 1WFOA 5BO1L 3JWDL 5IB4B 3TJEL 3IDMA 1FDLH 1E6OL 4DTGL 2VZOA 4P5TC 1GZQA 1MFNA 4N9GA 5I1IL 2K9UA 5J8OA 3F5WB 3WO4C 4I9WE 4P5TA 1C7TA 4U1KA 1YN7B 4TN9A 5EZIL 3WV0A 4YHZH 1WT5C 4LLUA 3ARED 4U1NB 4BKLB 1HN1A 3U36A 1N0XL 2A2QT 1FPTL 3DVGB