5I6XC

X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium-dependent serotonin transporter
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 42
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xC01
2VXVH 4Y5YC 1CVSC 4HX1A 1G84A 4WU7A 1CLOH 4XP5H 3K0WA 5CP7B 3WEXB 4P23B 4AQ1B 3OF6A 4RMSA 4JO3H 2A6KB 1AD0A 4YBLB 1UM5H 2GJ6D 1T4KB 2NX5D 1A6WH 1R5IB 2CMRH 2YR3A 2IG2L 1K2DA 4LCUA 4P2YA 2LV4A 4XMLL 4YHOL 5E94A 3SDAA 5JW5A 1NCNA 3QWQB 1S9YA 1SYVB 1YMMB 3OWEA 4U6VL 5LG1A 5I66A 2V7HB 3AS0A 2VLKD 3NIGF 1R3HA 3WD5H 5SV4A 3TZVC 4G8GA 1DLFH 5SWZA 3RDTA 2DKUA 3QCTL 4K7PY 1DFBH 4YXKH 1I1AB 1KIRA 4G9FB 1I7TA 3FMGL 3VH8G 3UPAA 1QSEA 5C7XH 4XNXH 3VGDA 5DTFA 1QTYT 2W38A 5CBEA 3V4VH 1UC6A 5I1CH 4Y2DD 3C87A 1JTTA 3IGAB 4KZDL 1TQCC 3B5TA 4G6KH 4J1UB 2RR3A 4HKZA 4OI8A 1HSBA 3QWRA 5AZ2H 3DV6B 1U3HD 4XPHL 2VSDA 3GKWL 4RIRB 4KVNL 3B9KB 3ZDXE 1X5JA 3WNKA 5CP7A 4XMKH 3WEXA 4P23A 1G9ML 2A6KA 2GJ6E 3S88L 3EKCA 1T4KA 4PV9B 5GJSH 1FH5L 3IRPX 3MXVH 1AKJD 1M6OB 4OJFH 1SYVA 1WFOA 2V7HA 2VLKE 3CFKB 5IK3B 2J8UF 2AK1H 1MLCB 4XP6L 1AXSB 2R2BB 1U2HA 4MXWL 4JPKH 4KZEH 1I1AA 3RGVD 5ILTL 4G9FA 4LRIC 3NPSB 3CMOH 5IVZA 3TT1H 1JPSH 2H2PC 4UINL 1GVIA 3IGAA 4J1UA 1V3JA 5D72H 1KTRL 4OLYH 3DV6A 3NCJL 4RIRA 4J3SA 1AQKL 3B9KA 5DK0B 2L0DA 4M7LH 4X83A 4WRLA 4HCRA 5AUMB 1KENH 2ZUXA 4PV9A 3LEVL 1JL8A 4OF0A 3BRGC 5IB1B 2C7UB 4LHQB 1M6OA 4JO2L 5HI3C 2CDFB 4FP8H 1NBVH 5IK3A 3ZO0A 2BXZA 4UT6H 1K3ZA 1MLCA 1AXSA 1FPTH 5CAYB 2R2BA 1VKXB 2FGZA 3P3YA 1KT2B 1KCRH 3IDJB 4P9MH 1E4WH 2NY4D 5CLTA 4KI5C 3OAZK 2Y23A 5E00B 3K74B 2FWOA 1BVZA 3S36H 5E2WL 3OL2A 3NH7L 4NN5B 4NFCA 3VFNA 4P2QD 1D9KB 3N85L 5A40E 1A1MA 3HRZB 3T2NL 4TTGA 1F4YL 3BE1L 1BIIB 2LTQB 2GFBB 5DK0A 4OT1H 1KACB 5CSGA 5FAAA 5AUMA 1MWAH 5CGMA 2XXMB 3LKOB 3O8XD 4WCYL 4UNVA 4AEIL 5EZOL 1X5HA 4MAYC 4PJ8C 2C7UA 5B38B 4V1DD 2CDFA 2DJ4A 5D7SL 4ZTPH 5GRXG 4K94H 4KGLA 1CIUA 3OB8A 3H42H 3ULUL 1FO0H 3M45A 4MJ5B 4IDJH 1VKXA 5F70A 1S78D 2E7CA 3W9EB 1KT2A 2KL6A 5LAXB 3IDJA 1A14H 1IC7L 3N1PC 3ARBB 1YQVL 2VDRH 5F44A 4OSUH 4N8CH 1FORH 1P7QD 1QFWI 2BHYA 4X8JB 3AXLB 5E00A 4EQ2A 1JK8B 4DEPC 2DJUA 3CX2A 3K8MA 3C08L 4JDTL 1ZA3B 4P2QE 1D9KA 1U58B 3HRZA 1BIIA 1FFOB 3CFDB 4PJBB 2GFBA 1D6EB 4NQDB 4OV6F 2R1WB 4NJ9L 3LKOA 3BH9B 4PLNC 5GS1C 1MREH 1P4IL 1JV5B 5DUPL 5B38A 1UENA 4V1DE 2ZUYA 4N8VB 1SY6L 3VD5A 2HKFL 3MV01 5I76B 5TFSH 4M6ML 4OCLC 4MJ5A 1INEL 4GRLC 4EN3C 1QG3A 3W9EA 2JJTA 5LAXA 1XFPA 4JQIH 3ARBA 3SGKC 3VRLE 1IM9B 2XA8L 3I85A 1YPZE 3ILQC 3ZDYF 1KCVH 3K4ZA 3X12B 4CBPA 4X8JA 3AXLA 1JK8A 4LF3B 1AY1L 1BF8A 5D8JL 4GLRI 1V3KA 4LEXH 1Z9LA 5IHBA 1CGXA 1X6LA 4AMKH 1ZA3A 4LARH 1U58A 2NY2C 4FNLH 2YK1H 4JFYB 1CFTB 5EWIL 1FFOA 3CFDA 4PJBA 4H88H 3VMNA 3K4DA 4HJ0C 2EXYC 1D6EA 1FBIH 4NQDA 2R1WA 1NDMB 3SBWA 3V0WH 4X9FA 1EJOL 1JV5A 3HPJB 4R4FL 4B0MM 3NCYP 4LSVL 3R1GL 4N8VA 1RIVL 5DMIH 5I76A 4JVPA 1AO7B 2VLLB 3E8UH 3U4AA 3R06B 4CKVX 3BT2H 3ARFC 4D3CH 4NRZB 3MYJB 1E6JH 1IM9A 3AM8A 2AVGA 3LEXB 1AHWB 1KYOJ 1ZK9A 3FAXA 3X12A 1FIGL 5BOZG 5T3ZL 4EI6B 4LIQH 4JGJA 3U7YL 1AGBB 1UVQB 2V5SA 4KHXL 4XXCA 3M8OH 3OR7B 3OAYH 4K3HA 2CRYA 4JFYA 4Y16B 1CFTA 5BW7A 2F53D 2XN9D 2JK5B 4WTZA 3RVVD 1NDMA 4WW1B 4X6CF 5E4IA 1TIUA 2YC1B 1KC5L 2P5EB 5HHXH 3HPJA 2ZUQC 3MNZB 5HGDB 3S36X 2GK0B 2YKLL 1UM6H 3WIHH 1FRGH 3IDNB 3R4DA 1AO7A 3GRWA 2VLLA 3R06A 3IFLH 4X5WB 4HGWB 4NRZA 4M43H 3MYJA 4J3WA 1NMCC 1P9MC 2IBBA 1RUQL 5GGVL 4HWBL 1UWXH 1IGML 4U3XA 1JFQH 3LEXA 4X4MA 1AHWA 4M5YL 1JPFB 3BN9D 3STZB 3PXHA 4HIHB 1JJUA 4WTWA 1JHLL 4EI6A 1KPUB 4DKEH 1AGBA 1UVQA 3MJ9L 1IBGH 2VRAA 3OR7A 2H1PH 4X9BA 4YE4H 3HZKB 4Y16A 4FQ2H 2VITB 4TUKH 2XPGB 1RJZB 2F53E 4FTVB 4N5ED 2XN9E 5GSRB 2JK5A 5FF6B 1RU9L 5I18H 4KAQL 4WW1A 3RTQC 5I71C 3S34H 2AJZA 2YC1A 3DX6A 2P5EA 5E1AB 1KIUA 5HGDA 3GMOB 4R26L 2GK0A 1OARH 2ZPKH 1ZT1B 3G9VA 3ARGD 3IDNA 2P48B 2QTEA 5AZEL 3VXUB 2NY0B 2F8OA 1QRND 3BGFB 4X5WA 3G6DL 4HGWA 2F58H 5HTSA 3QH3B 3QPQC 5CEZD 3ULVL 2BRRH 4K9EH 5TE6H 2VWEC 3K4AA 1MCPL 1VCAA 4FZ8H 1JPFA 5J12C 1BOGB 3STZA 3FZUC 3UC0L 2DQTH 4FQXD 4HIHA 1CDJA 2CD0A 4PLKC 2B7DT 1KPUA 1MEXL 1VERA 1YQ2A 4QRPD 2HT2C 1CZ8L 3RBSA 2E7HA 4WW2C 1IE5A 3MRMB 3EGSB 4YBHA 3HZKA 3IDGB 1PEWA 2VITA 2XPGA 1RJZA 3SOBH 3TFKC 4FTVA 2DQGH 5FF6A 4GG8B 1HXYB 1OPGH 4EKXA 1BQHB 4EUPG 2HFGL 1K8DB 2DTMH 5DJ8A 5E1AA 3GMOA 5F7FA 2AERT 4OM1H 1EO5A 3LD8B 1R3JB 1ZT1A 3UPCA 1EIBA 3VXUA 2NX5A 4GBXB 4MNQB 1QRNE 1WFTA 4IMKA 2ITDB 5B21A 1KN4L 2CLVB 2IALB 4YHPB 1WZLA 3QH3A 5CEZE 4HBQA 3RZCD 3RL1B 3NFSH 3QUYC 3UDWC 5EA0L 2D3VA 2VN4A 4L1DA 1BOGA 2HVKB 1MNUL 5E2VH 5IBUG 3WKNA 1OAZH 3S4SG 5C6PB 4XPBL 2EEBA 2F5BL 3VD3A 1GHFH 3RIFK 2ZP0T 4LVHC 4QRPE 5KSAC 4N8PA 3MRMA 3EGSA 2AP2A 3IDGA 2HT3D 4E5XB 3U0WL 1VFMA 1WZMA 3BGMB 4IRSD 4D8PB 5DJZB 3GI9L 1BQHA 4M7ZB 3P0YH 1K8DA 5JW4M 1SBBA 1GXEA 2I07B 3E0GA 4LLUB 4EVNB 3K46A 2ZCHH 4PJ9D 5FECB 5I8EB 5F7UA 4LOUD 3H8NA 1LO3H 1IQWL 1R3JA 2ZNXA 1KCKA 5ANMB 2X10A 3OTTA 2ILLA 4ZO8A 4GBXA 3DNKA 2ITDA 5DD1H 3EDFA 4F9PA 2CLVA 1F8TL 2IALA 2Z0BA 4YHPA 2B4CC 5C07B 2A9NL 2A9ML 3RL1A 3HNSH 4LSUL 2CIIB 2HVKA 2FX8L 1QBLL 1X5XA 4ZD3L 2UZIL 1RUAL 1WK0A 1CXKA 1U92B 2KZ1B 2YMXL 2AJYH 5HPMA 4BM7A 3LZFL 4E5XA 4WFFE 2R1XB 4Q9RH 4KRPC 1Z9MA 1YNTB 4WV1C 3BGMA 1K6QL 5EBWB 4D8PA 5I75B 2FCBA 3SY0B 2AJSL 5DJZA 5F72S 4HIXL 3NTCH 1EERB 1CG9B 2VDNL 2I07A 4LLUA 4PRPD 4EVNA 2WANA 5FECA 1AJ7L 5I8EA 3WNPA 3MJ7B 4DTGL 3KPPB 1A6PA 5ANMA 3HAEH 3IYLW 2FEDC 3VRJB 2AI0L 4JR9H 5GQBA 5DMYA 4MGXA 3TO2B 5CGTA 5C07A 4IJ3C 1BHGA 3OJVC 3LB6D 1FNGB 2CIIA 5D6DC 5IFAH 1JVKA 3L1OH 1ZEAL 4GJTB 5J1TC 4KGJA 1CT8B 3QUZD 1H3WM 1U92A 3LS5L 3O9WB 5DRZB 2J6EA 4XNZC 2R1XA 1OHQA 3BJLA 1YNTA 3CLEH 4OZIB 5EBWA 3SY0A 5IB3B 5DFWH 3ZT6A 4OLUL 1IFHH 3LHPL 3HE7D 3MV9E 5DMJB 1CG9A 2QADB 4PRPE 3HNTL 2OBGA 3SGEH 1IKFL 1DEDA 4H0IA 4M4RA 1WIUA 3MJ7A 1HDMB 4OZFB 5TQ0L 3GFUA 4M3JA 4HS8H 5IESH 1WFNA 2VISB 4LNRB 4YQXL 4HDIB 4ZO9A 3VRJA 1Q0YH 5IVOA 1F4XL 3N1MC 3TO2A 1G7JB 5GS0H 1IMHC 4JZJB 2DF3A 3AMKA 1FNGA 3V4UH 4WO4B 5DURD 4FQLH 1RZKH 3IDYC 1JI1A 3MACH 1FSKB 2WWMC 2ADFH 2BX5A 1CT8A 2WUBH 5JOFB 1XMWA 2CXGA 3O9WA 4U1GC 5DRZA 5E9DD 3TGXA 2MFNA 1NJ9B 2H45A 3TBYB 3KYNB 4NZTH 4WHDA 5DD5L 3PQYD 4LPYA 1VEPA 1DUYB 5FEBA 5I8KH 4LKXB 4OZIA 2Z35B 3OQ3B 4DVRL 5IB3A 3CXHJ 2MQ0A 1AC6A 3IFOB 5IJKC 4X7TB 3RVTC 5L8JB 1HDMA 3MPCA 4OZFA 3O6KH 4PRHB 5FUZL 1MRFL 5C92A 1BQLL 2VISA 4LNRA 4HDIA 3SCMD 2XY1A 2VLRB 4AIXA 5F1NB 4KTEH 5D1XC 1MVFA 4YJZL 4Z7VA 4YHLH 3TESA 1G7JA 4FFYH 1HZHH 4JZJA 1L9MA 1R6VA 6CGTA 4WO4A 3RKDC 2G75B 4OFYA 5GXBB 3GGWB 1RZGB 3I02B 3QDHA 1NC2B 4R2GB 5GS2H 3QEQD 4IIQC 5JOFA 5JR1L 3ZDXF 2VOTA 3OJMB 1NJ9A 2YXMA 1NSNH 1MPAH 2VZ3A 3JUZA 5SWSD 5EOQL 3KYNA 1URLA 3TBYA 3PQYE 2R56L 5HGHB 1I9JH 1DUYA 2HWZL 4LKXA 2E27H 2Z35A 3MLRL 1A6AB 1DBKH 3QIUA 3F8UB 4MS8C 2QQKL 1EO8L 1HWHB 4X80L 3WYRA 2EDYA 4MXQC 3IFOA 2FD6L 2MCPL 1R3LB 3BGAA 4X7TA 2BVTA 2O61B 4PRHA 3TBVA 2RCSH 3MLVL 4TVPD 1FZOB 4L3CB 2NY3D 4MJ2A 3L5XH 4A6YH 2V2TB 3BKJH 5IMLB 2PR4H 5F1NA 2WQ8A 3MGTB 5KBNC 3ME0A 1VFOA 1N6QH 4N0UE 2V2XB 1IKNA 4EQ3A 4HAFA 2OTPA 3D9AH 3PP4L 4OM0H 4BZ2H 2G75A 5C71A 1RZGA 1QRKA 1YNKH 3I02A 5DC9B 3PWPB 1NEZG 3B6SB 1NC2A 4MCZB 5DR5L 3SJVB 3E3QE 1CQYA 2ADIB 2A83B 3LY6A 4JKPL 5E95B 5SWSE 5FHAL 4XCNA 3MRCB 2E9BA 3CXDL 5ICXB 4RMWA 4NQED 5FK9B 5HGHA 1OM3L 4R7DB 3RAJH 6FABL 1A6AA 1FDLH 3UEZA 5KW9H 3GI8H 1CXFA 4I3SL 1R3LA 3MZGB 1YY9C 1FZJB 2CGRH 4UIKH 3GM8A 2O61A 3T0XA 4JG1L 3V9FA 4TVPE 1FZOA 2R4RH 4L3CA 2V2TA 4HWZB 4DUWA 4HUMB 5IMLA 3RY4A 3OKEB 3MGTA 5T1LB 2V2XA 3I6KB 4RA3A 3ZYOA 2FX9L 1RIUL 5GJTL 2AS5M 5BOPA 1FCCA 2JJSC 5ID1B 5EU3B 2Y25A 3PWPA 3B6SA 4RGMC 4MCZA 4Z7WE 1HILB 3QI9C 1LK3L 3O2VH 1LNUB 3SJVA 1F45A 2NYYC 4OIBA 4MZ3A 4Y4FC 1I1AC 2ADIA 5CP3H 2A83A 3OAYK 4YX2L 1RURH 5DZLA 1V5JA 3MBXH 3MRCA 1XF4B 1S7SB 5IROC 5ICXA 4Y4HB 4NQEE 5FK9A 4K7PH 4R7DA 3H0TB 4NHCH 4Z18A 1UQSB 2IFFH 1UA6H 4L4JA 3CH8A 2YD3A 1BEYL 5HD8D 3RA7L 4DZ8B 3PGCB 3VFGH 2PCPB 5D1QD 2C1OB 3U2SB 1U8NB 1WTLA 1I3VA 1FZJA 5L2KB 5HYIA 2F8VA 3F6IA 5KVEH 2AEIT 1J1XL 4HWZA 2QSTA 1DVFB 3OKEA 4F15B 1WLHA 5T1LA 3OPZL 3I6KA 4P3DB 3C8DA 2CJUH 1T3FB 5L2JB 3WKMH 1MFEL 3MJ6A 1MF2H 1WEJH 3TA3D 5ID1A 5EU3A 4ZFGL 4P5TD 5E8DL 1QNZH 1AIFB 5IB5B 2F54D 3MRPB 5FGRA 4M48H 1HILA 4YHKL 4C4KO 1QR4A 2JIXD 1LNUA 3WXWL 4PRDB 1KELL 5JXED 3FB7B 4QXUL 1I3GL 3RVUC 4KQ3H 2FEEL 4TPRH 1XF4A 4I9WD 5IUSA 1MFCH 3ZSSA 3NIDF 2OM5A 4NWTH 5SX4I 3H0TA 1DSFH 3UTSB 1UQSA 2MOVA 3IFNH 4NO3B 4PB0H 2NY1B 4WFED 4ZUWB 3PGCA 3DV4B 2YA0A 3U2SA 2C1OA 3U9PL 1U8NA 4D9QD 1EEUA 2ITCB 5L2KA 2YN5A 2R0ZL 4HUKB 3RX8A 2NZIA 3QDMB 3WLWC 4JFOB 3VRLF 5KSUB 2VO5A 1YPZF 1BJMA 4OGAC 3UXFA 1DVFA 5DJ2B 1Y0LB 2EIZB 4E0RB 4ZUSB 4P3DA 3B2UD 3KYKH 1T3FA 2P47B 4HIJB 3MODL 4RFOH 5L2JA 1GSMA 1C5BL 5D7LB 5CJQH 3IAGC 1AIFA 5IB5A 2F54E 3MRPA 5HJ3B 5C0AD 5K93A 4NO2B 1QO3B 2G2RB 4DW2L 4PRDA 1NCWH 2D0GA 3FB7A 3ULUD 2A6DB 1YC7A 3BYYA 4I9WE 1NUDA 4LPXA 2XG4A 3QIWC 3UTSA 1WWBX 4NO3A 4YBQC 2BERA 3EIFA 4WFEE 5E6IC 4ZUWA 4PJ5D 5FO9B 3DV4A 3VW3H 4D9QE 1QHOA 1J10A 2ITCA 3LEYL 4PJIE 4K23H 5HHNB 3HMWH 4ZAKD 4JM4H 4JFOA 5DD6B 2UWEE 1DJSA 5KSUA 2AK4D 2VDMH 4QHNB 3N9GL 4OGZA 5DJ2A 5F7YC 1Y0LA 4WHYH 2EIZA 5FM8A 5IEKB 4E0RA 5ENWB 4ZUSA 2ADGA 2E6QA 4HIJA 1MCNA 2AJUH 5D7LA 4CVWA 1OF2B 1OT2A 1CDBA 4HW6A 1IQDB 1U8HB 2RB8A 3TN0B 4Z7UE 2FSEB 5HJ3A 3OKLB 5C0AE 4NO2A 1QO3A 2G2RA 5DXWA 4NKOB 1HIML 2WBJC 4NM8L 1XGRB 1BIHA 1YECH 2A6DA 2VWEE 5CHNB 3WS6C 3ULUE 1CFQB 2EIBA 4PIRF 4KJPC 4GRWF 3QFJD 2AQ1A 2FHCA 4JRXD 5J6GB 1H8SA 3VWKC 4O5LL 2IGFH 1MWAB 5FO9A 3KWWB 5EOCL 5FGCB 5HHNA 3I9GL 4RGND 3PWNB 1JYWA 1GAFH 3I75A 3H9ZA 1QYGL 4OD3H 5DD6A 4PY7B 4G7YL 1HHHB 1KIPB 3DRTA 4M1GL 4K7PX 1ADQH 5IEKA 1AXTH 1FO0B 2VC2H 5ENWA 4YXLH 2R23B 3AREC 5C08B 3DSFH 1WFUA 1OF2A 1YEKH 5C09B 4LASL 1IQDA 3TN0A 1SM3L 2FSEA 5GS3A 3IETB 3OKLA 3QDJD 4NKOA 3H3PH 4S1RL 2MCG1 3TVMD 1KN2L 4JKKA 1XGRA 1INQB 2P24B 5CHNA 3P2TA 5JTWA 1CFQA 4QGTA 4POYA 4HUVB 3SDCD 1CFVH 3QFJE 1FAIL 1D5BB 1HKLH 4JRXE 5J6GA 1KJVB 4ZFOB 1FL3B 1MWAA 2X4TB 3KWWA 1RD6A 2DM2A 1TITA 5I9QB 4S1DC 3VMPA 5I1JL 2FATH 2Y72A 5T3ZD 1ONQB 4RGNE 3PWNA 3Q5YA 5I8OL 2Z9TA 4XMPL 3QDGE 4P9HL 4PY7A 4G7VL 1Q0XL 3M07A 1LWRA 1HHHA 1KIPA 5SV3A 1JTPA 1JNNL 3V8OA 3WBDA 1FO0A 2VIRB 1I9RH 2BJMH 2R23A 5JHLH 2YD9A 1AH1A 2CRIA 3FHAA 5C08A 3PHQB 5ID0B 1M05B 5C09A 5EZLB 1G6RL 2XV6B 1GGIL 3IETA 4I5BB 3F7QA 3QDJE 4U1LB 4ALAH 4ZXBA 5BMFL 2AEQL 5BS0E 3ETBF 1BJ1J 1INQA 4OFKA 2P24A 5HHMB 2LE9A 2EC8A 1A7QL 4NJAL 4BUGA 4HUVA 2NMSA 4JG0L 5FGSA 2BNQD 1D5BA 5JMRA 4ODHL 1UXWB 2P45B 5DRNB 1KJVA 1QLFB 4ZFOA 1FL3A 2X4TA 4XBEH 4XCCL 4XVTH 4QHLB 5BO1H 3QUMH 1A7PL 2PO6B 4RBPH 4F7CB 5T3ZE 1ONQA 1RFDL 1EEQA 4P2OC 5D1ZB 4GUPB 5CLWA 1MIMH 3ROOB 1MSPA 4MHHI 4QGYA 5L0QC 1DQMH 3VA2C 2O93L 4XBGB 3RIFF 5GZND 2VIRA 4DGIH 1QPXA 1N26A 2BXYA 3RNQB 2VDOL 3PHQA 5ID0A 5DUML 4PGEB 1M05A 4JCMA 3MQIA 5FUOL 3SCMA 2A74B 3GHEL 1WZ1H 4X6CB 5EZLA 3ZE1E 3R8QA 3T4YA 5F1SA 4I5BA 4U1LA 1OSZB 3QQ4B 4QEGA 7FABH 3TH3T 4EI5B 1J5OH 1JRHI 1BJ8A 2RFXB 3CU7A 4YHMH 5CJOL 4YWGL 1OY3B 4P2RB 3X13B 5GIRB 1AGDB 1CGSH 2OTWB 4CN6A 4QRQB 3L7FB 2BNQE 2WBWB 3ULVD 1UXWA 4GS7C 2J12B 3IAPA 5DRNA 4NNYB 1QLFA 5A43C 2PKDA 3AUVA 4U49A 4RRPA 2AXHA 4QHLA 2PO6A 1MFDL 1MCCA 4F7CA 1MHEB 4FQQB 2IMMA 4HH8A 5D1ZA 2JLLA 4FFWD 1SBSL 3OB0H 4GUPA 5DJYB 4RSVA 2OK0L 3ROOA 3RUGB 2AKRB 5HDBE 1OGAB 5D71L 3LPWA 5IOPB 4U6HB 4XBGA 3MUHL 3T0WA 4E42B 4JDVB 3RNQA 4H8WC 1BFVL 4PGEA 1WJ3A 2A74A 4UT7H 1AR2A 2H26B 5C0BD 2EXWD 2A1WH 5B38G 1OSZA 3QQ4A 3T2PA 2B1HH 4KDTA 4EI5A 4IRJD 2YZ8A 4UNUA 1D6VH 2RFXA 1JMXA 4RISL 4NZJA 5HVFB 3CSBA 4LHUD 4NQVB 4P2RA 4AENB 4XTRD 3X13A 4KMQA 2HH0H 5GIRA 1AGDA 2OTWA 2QHRL 1UWGH 4QRQA 3MUY1 1RZJC 3L7FA 4U4BA 3DGCR 3NA4A 5GGTH 3U79A 2P5WB 3ULVE 5GHWH 3RI5F 3VG9B 3P0VL 5FYKU 3CFBB 3U36B 4YEEA 15C8H 1A5FL 3C60B 1MHEA 4FQQA 3WHE1 4JFDD 5DJYA 1V7NL 5MEND 3RUGA 2AKRA 1P4BL 3WIHA 3QQ9C 1OGAA 5IOPA 4U6HA 3TM6A 2DIBA 5CCKL 4HXAH 3LD8C 3U6RB 3FFCB 4JDVA 2R15A 1Q72L 3LQAC 5ESQB 1MJ8H 5GRWA 2H26A 4LPVA 4XP9H 5I1HH 3L5JA 4R7NB 4XXDB 4N8VG 3T2QA 1X4ZA 1REIA 5J1AA 1AR1C 1CDHA 1F00I 3HE6B 5I1EH 4AENA 1N59B 4R6UA 3HZMB 3LMJL 2P5WA 2XIDA 3BP5B 1I8IB 5K9JL 3LKRB 4R9HA 3LCYA 3PL6C 3KGRA 2YSSB 1EFXB 4L4TE 3U36A 4G9DB 3BESR 4QY8B 3O0RL 2K7PA 2A2QT 3C60A 1C8PA 4QRSB 3C5SB 2UV3A 4OCXH 4DQOH 3LVEA 4OIIL 1U95B 1NBZA 5E8NB 3PHOB 3MNWB 3H2WA 1G6VK 3U6RA 3FFCA 2VQ1B 5DJCB 3MC0A 4WTZG 1CU4L 5HDQH 5ESQA 2OL3H 4NWUL 3S3JA 3QHZL 1OAYL 2NY5L 4R7NA 4XXDA 4JE4B 4JVWA 4UV4H 1XIWC 5EH1A 3BDYL 3B2VH 2IQAB 4BH7B 3HE6A 3ULSB 1N59A 5MHSD 1EA9C 3HZMA 4ODSL 3V5KB 3AGVA 4U1HB 3BP5A 4HK0B 3LKRA 3F7YB 4F58H 1X5AA 2YSSA 1EFXA 5I1GL 1NGYB 4G9DA 5T1KD 4QY8A 2EEDA 4QRSA 4EDWL 3C5SA 1J9CT 3QCVL 3T2OA 1J7VR 1JP5A 5F9AC 1KCSL 1B0WA 5IW3A 4ESKA 4JRWA 2FIRT 4K8RL 3K1KC 1BBDH 1U95A 2VLJD 4IM8A 1X5ZA 3KPQA 5E8NA 3PHOA 3Q1SH 4C59B 1UM4L 3SO3B 3MNWA 5A3ID 2VQ1A 2VLMD 5DJCA 1B0RB 1GOHA 3TIDB 4F9LC 3QDAA 3RWCB 3W5NA 1JPST 5I15H 2WUCL 5KSBE 3HG1B 3CDCA 3P30L 3CK0H 1A3QA 4DN4H 4X99B 4UILH 3LN5B 3KPTA 1CTNA 3HC0A 2DWEB 3NZHL 4G8IB 2IQAA 4M7LT 4BH7A 1UG9A 3ULSA 1KJ3H 1XF1A 1MFNA 3V5KA 4U1HA 2DQHL 4HK0A 3ZKMD 3F7YA 4BK4A 1B4JH 2BNRD 1IC5L 4TQEL 1A47A 2XQBL 5HY9B 1NGYA 1KB5H 3W11C 2GKIA 3KPLB 1H0DB 2ZOLB 1MCLA 1MJUH 4PJ5A 2VLJE 3HAEB 4GMTH 5E99H 4U2ZA 1HE7A 4UI2A 3TIDA 2VLME 1B0RA 4WWKC 3RWCA 1IGCH 3THML 4Y5VC 4JY6B 4KROC 3HG1A 1XGYL 4FZEL 5C6TH 4G43B 2XA3A 1NGPL 3OKYA 4X99A 4XCFL 5I6XC 3LN5A 1W0VB 1NGQH 2Y6SC 2DQIH 2DWEA 3QIBC 4G8IA 4LLDB 2ZSVB 2ARJB 2YA1A 4M3KB 3TO4A 2MPAL 1RAMA 4Q2ZB 2GYSA 4UU9B 1A3RL 2FB4H 3C6LB 5CILH 5HY9A 1X3DA 4BA8A 3KPLA 1H0DA 2ZWLT 5ITBH 1NGWB 5ETUA 1E4KC 2ZOLA 3QPXL 1Q9KB 3FMGH 2FRGP 3ZZ1A 4H26B 5C1MB 3Q6GL 2F5AH 1QSFD 2V17L 4PS4H 2AXJA 1CFBA 2OSLB 3IB4A 4Z7WF 2NXZC 2PXYB 3HI5L 3SGDH 1NC4D 3FFDB 3GK8H 4JY6A 3NIFE 1TPXB 4U7MA 5HGGS 2E7BA 4G43A 3VFTB 3BUYB 4JHAH 3KR3L 5EG6C 4JAMA 1MRCL 1N5AB 5T33H 1W0VA 2V9QA 3CX5K 4LLDA 2WWKT 1T03H 2ZSVA 2ARJA 1FGNL 4M9OA 1W72L 2YZ1A 3DMMD 2VXTH 4D94A 4Q2ZA 4UU9A 1U6AH 1QLEL 2B2XL 4UT9L 4N0CD 5IW1B 1P4LB 5FYLL 2OX5A 3C6LA 1CBVL 1S7XB 2ZSWA 1OT1A 4MXWH 1NGWA 3AS1A 1S7RB 1B4RA 5ILTH 2ENSA 1Q9KA 4FABL 4KMLB 4H26A 1XR9B 5T3XL 1YDPB 2DQEH 1FVEB 2RGSA 1BVKB 2OSLA 1A1NB 3P73B 4P5KB 2PXYA 5FUCE 2W91A 3BZ4B 2XZAL 3FFDA 4QLRA 1CE6B 3BDXA 1J0YA 4XAWH 2HLFC 3ABZA 5F9JB 2CO6B 4TSBL 3VFTA 3BUYA 4F33B 1BMGA 4NBYB 2FBJL 5EORH 4YXHL 1N5AA 4YLQT 5BJTB 4OTXL 1HHKB 1NUGA 3VXRE 4AY0A 4KJQD 3S35H 3K2UH 3CMGA 4M6NH 3BQUD 2EE9A 4Y0GA 4KKCC 1HN1A 5IW1A 1G9EA 1P4LA 4ZPVB 2BMKB 3SGJA 4WUUD 1S7XA 2E6JA 3S37L 1AI1L 2D4FA 5AEAA 2F19H 1S7RA 3VWJD 5J13B 5ADPH 3QG7H 4FG6D 4O2EB 4WUKH 1CE1H 1XR9A 5HI5D 4L8SB 4S0TD 1YDPA 4J6RL 3GBML 1E4JA 1FVEA 4JHWH 4XPGL 1YA5A 1XZ0B 1F3DJ 3WV0A 1OTSD 1IEAB 3BKYH 4A6YB 4ZS6D 2Y36L 5GISL 1A1NA 3LKQB 3P73A 3HC3H 3LH2L 4P5KA 4P4KB 2AXGB 1FQ9C 4PRIB 3ZYJA 3BZ4A 3X3FL 4MJ4A 1H3PL 4U6YB 1CE6A 1PZ5A 3LPGA 2AV1B 3T0BA 5F9JA 2I5YL 1KIQB 2UVFA 3ARDD 3W81A 5C0CD 5HVWA 4F33A 12E8L 4KFZC 3OJDB 2YD1A 1WAAE 2OR8A 3MCLL 3BKCL 3EOBB 5BJTA 1HHKA 1EO7A 5DWUH 1X4XA 3DYMA 3N1QC 4S1SH 2UY7A 5D7SH 4XNYL 1D5IH 3V4PH 1KFAL 3FQUB 2UVEA 4ZPVA 2BMKA 3RFZC 4WUUE 3L5IA 2UWEF 3LN4B 3ZTNH 3TNNB 2ESVD 4Y4HC 3MOAL 2FLRT 2W9EH 2VXUH 4O2EA 2VB5A 3VXMD 1RVFH 4L8SA 2HVJB 1XZ0A 4A6YA 4HC1H 5C0EB 1IEAA 4Z7UF 3RWIB 3LKQA 4R0LB 1E4XI 4P4KA 5TDOB 1UJ3C 2AXGA 4HWUA 4PRIA 4C56D 4JM2B 4R8WL 4U6YA 4RX4A 4IBLT 5GRUL 5DO2C 2AV1A 3ULUF 1GPOH 3GSWB 2MSPA 1KIQA 3TZVD 3OJDA 3EOBA 2D2OA 3Q0HA 1FYHB 1RK0B 4GMSH 2GY7B 1N4XH 4UAOB 3PF2A 4R4BB 4XNUL 5IBTH 1ORSB 1UWEL 4IOSD 4FFVC 1C5CH 3KPNB 1A6VH 3LN4A 2IQ9H 3TNNA 2ESVE 1RI8A 2Q8BL 1PKQE 5IB2B 2NY1C 4OGYH 3GMLB 1CLCA 2JB5L 3T0EC 3VXME 1EXUB 4ETYA 2HVJA 5C0EA 1EEYB 4J3UA 1VADB 3RWIA 1HWGB 2IAMB 2Y5TB 4R0LA 5TDOA 4C56E 4JM2A 1SQ2N 5I1IL 5J11B 5KAQG 3FN0H 1DQLL 3GSWA 2NR6C 1PGRB 4PYGA 2K1MA 4FQPA 2R39A 1NFDE 4NZDA 3HCVB 5FO8B 5DT1H 3UJIH 1S5IH 3GIVB 1RK0A 3SE8H 1QACA 5CP3A 1OAQH 4YHZH 2YEZB 1CGTA 4XZUB 1ZLWH 2AABH 4R4BA 1EHLH 1ORSA 5C0RL 1A9BB 4JFQB 3P4MB 2EC9T 5I1KL 2B4CH 3KPNA 2VH5L 1MJJB 4HCRL 3VMOA 1MCSA 1IILE 3PXJA 4LGRB 4X9IA 5IB2A 2XG5A 1F3RB 2E7MA 4TNVK 5IFHH 2EE6A 4XRCB 3VFWB 3GMLA 4HBCL 3P11H 5DLML 3EO1B 1BZ7B 2DTSA 4DKFH 5K33A 3S35X 4QXWA 1AD9B 3QUXD 4PJFE 5FHBH 1EEYA 5TDPB 3O81A 1VADA 3LRSB 2IAMA 2Y5TA 3ARQA 5FGBA 3MREB 1G9NH 2IANB 2XTJD 1J12A 1VSCA 5I16B 4D0BA 5KTEH 4UOJA 2ICWB 4APQD 4YFDB 3HCVA 5FO8A 3MRFB 4G6AD 4P3WA 5FCUL 3GIVA 3G6JE 1J8KA 2YEZA 4XZUA 3ET9F 3W0WE 1JZ2A 1A9BA 1CLZL 4JFQA 3P4MA 3RX5A 2Q1EA 2UUDH 5CZVH 5DFVC 3ZDZE 1MJJA 2OMBA 2HP4A 4KDVA 3X11B 5HVGB 3HS0B 2EYSB 4G5ZL 2PYEE 4HPYH 2CR3A 1YEEL 4XRCA 3VFWA 3S98A 3MLZL 2UZYB 3EO1A 1M1SA 1D7FA 4B5EA 1BZ7A 4WVRA 1AD9A 4UB0H 4XGZB 2Y7QB 4PB9L 1JHLH 3TWCH 3LRSA 3ZE1F 1MHPH 3LKSB 2J88H 3MREA 2D9CA 1MCHA 4JB9H 5H8DA 2IANA 5J7CC 3GJFH 2XTJE 4XPFL 4HWEH 5I16A 3BPNB 3C2AH 3JV5A 1NAMH 2P44B 2X41A 1AFVL 1K5NB 4POZC 3MR9B 3B83A 3WO4B 3MRFA 1FCGA 5L6YL 2YHGA 4L1HA 5HHPB 3V0AC 4XVUC 2B39A 1MJ7H 3V6OA 3CIQA 3OZ9H 4HV8B 3GMPB 3SKNB 4WWID 5HDBF 1CL7H 3X11A 3HS0A 2EYSA 2BOCB 4QTIH 3MRDB 3OKMB 2GCYB 2O5YL 3KLSA 4HG4K 1J8HD 5I9QC 4KK6D 4XGZA 1I1FB 5CWSB 1WIOA 2Y7QA 1YJDL 4LSQH 5C70A 3W2DH 3EYSL 1OB1B 4GSDL 4H5SB 4DVBB 2FJHB 4KHTH 3WFCL 2ZCKL 1LK2B 4M62H 5EO9A 3S3PA 2EKJA 3MV7E 4LSTL 1UEYA 2BSTB 3UO1H 4BELD 2PETA 1J0KA 1K5NA 3MR9A 3WE6A 3VD9A 2XZZA 1KEGL 3ULVF 4HMEA 3TC9A 3BAEL 4M93B 5HHPA 5FYJE 1MHHB 4JREB 2P7TB 2CH8A 4HV8A 1K85A 5B4MC 1AC0A 4MYWB 1KEMH 3GMPA 1QBBA 3C5JB 1VFUA 5EU6B 3V6BR 2AJ3B 1SEQH 3P9LB 5I30L 2BOCA 3MA9L 3BXNB 1C08B 5GGQH 1IAIH 3MRDA 3OKMA 4EXPX 5HHVL 3BD5A 2GCYA 5C0ND 5I73C 2VR9A 3MX0A 1HHIB 1MI5D 3B43A 4CMMB 1I1FA 5F89B 3C5ZD 4G6FB 4LBEB 5BRZD 4D0CB 5A1AA 1JYNA 1ADQA 1OB1A 4H5SA 4DVBA 1LK2A 4CN1A 2BSTA 1FV1B 3DI2B 5KOVC 3NPZB 4XB7A 1TJHL 3G6AB 4JKLA 5E70A 2Y1VA 4I3GA 4S1QH 3T1WA 1RJLB 4QHMB 1MHHA 1X7QB 1DL7H 2P7TA 2OR9H 4PBXA 1EMTL 1UH3A 4JQXA 2IJ0C 4XC1H 2C3VB 3O6FC 5EU6A 3SE3C 3EDKA 1ZLSH 2AJ3A 4Q6YA 3AB0B 3P9LA 3DMMA 3FO0L 3BXNA 1C08A 1MCOH 1L0XA 1X5IA 5FDWB 2AQ2A 1OP5K 3QUMB 1KJMB 1KSRA 1OAKL 1CICB 1HHIA 2NTFA 1MI5E 2EICA 4Q0XL 4CMMA 4MNGE 2QKIB 5F89A 3GRWL 4LBEA 5BRZE 4D0CA 4UTAH 4OZHB 4OZ4B 4FXGB 3LZFH 5KG9B 3BSZL 1E0OB 2B8OT 5ISZD 2ED7A 1FV1A 3NACL 2ZKHH 2C5DC 4AQOA 4TULH 3G6AA 4WHTB 4X8XA 5DFTA 2WBKA 1MAMH 2QLVB 5HYJB 1RJLA 4QHMA 5TJWK 1X7QA 2Z31C 1LGVA 2Y06L 2EC9U 3CVHH 2R0WH 4QWWC 2BVOA 2L7JA 3F5WB 2C3VA 2D03L 2A6IA 4R97B 5HHQB 4JQVA 3IDXH 2QL1A 3VCLB 3MBED 5MP6H 3FO1B 5FDWA 1JPTH 3QUMA 3RBGA 1CTOA 1KJMA 5DVNA 4Q9QL 1ROWA 5FA3B 1CICA 2LAGB 5F88B 3VG9C 4N90E 2BNUB 3ZKXB 5KSBF 3ILPB 1E27B 3L3JB 1RSFA 1A7RH 3WJJA 2QKIA 2A0LC 1JUFB 4OZHA 3C60C 4B7IA 1EEZA 4RNRB 2D7TH 3I2CL 3ORJA 4LDEB 4Y5YB 4FXGA 1QHPA 5KG9A 4JRYE 1ZANL 5ISZE 1TZGH 2Q8AH 5CMAB 4X7SH 4LCIL 1JNHB 1DUZB 1FNFA 2YWZA 4WHTA 5JW4N 5HYJA 4JO1L 3MV8D 1W8OA 2Y07H 2VDPH 1WV7T 1T83A 4JY5H 1OCWL 4HGKC 2K3TA 1BFTA 1Z0MA 4PLKD 3F5WA 4Z8FH 3IKCB 1XCTB 2D7MA 5HHQA 4J4PA 1F4XH 4JFXB 3VCLA 4F57H 3FO1A 4N0YL 4PP1D 3IVKB 3IS0X 5F7EL 3Q6FB 1CCZA 2YA2A 2FNBA 4YPJA 5FA3A 1RZFH 2BZDA 4U2YA 5F88A 4KMTH 2VQTA 2BDNH 2BNUA 2X1QA 3AY4A 3MV9B 3ILPA 4PUBL 3EUUA 3L3JA 1OQXA 4KJYB 4RNRA 3F7PC 4HKBB 4I0CC 4MVBD 4Y5YA 5T5FH 5HDOA 1CDCA 4Z0BL 3MGAA 4KK9D 1I75A 4MA1C 5DGQA 2H6PB 1FYTD 3QEGH 4WU5B 3EFDL 5KS9F 5CMAA 1JNHA 5LWYH 1DUZA 4NT6B 5DVLA 1A9EB 1F90L 4K8RD 2NNAB 1P7KB 2OMNA 5DJ6B 1I7ZB 1XCTA 3IKCA 5GGTA 1R3IH 2XACC 1FC1A 4JFXA 2YPLB 4YO0B 3IVKA 4PBVC 3Q6FA 1P53A 3BHBB 4N5UA 4LCWB 5TDNB 3V7AG 1OP3K 1H3VA 2BY1A 4WY7L 3D2UD 1MCQA 3MV9A 2CUIA 3NIFF 4KJYA 3BRFA 5H94B 4QCIB 1CN4A 3LAFA 3H9SD 4HKBA 3QHFH 3QUKB 3DETC 2X89A 3VG0L 4BZ1H 1PJ9A 4TOYL 4Q6IC 5J3HC 5HYEA 4RRPG 3RWHB 2H6PA 2HLAB 2NY6C 1FYTE 2Z92B 3ARXA 3KJ6L 4HFWB 4WU5A 2OL3B 4F7EB 1UB5B 5FA4B 1DEEB 1W8NA 3TPUB 5BV7H 4Z7QE 4JDZB 1UCBH 1A9EA 4QRTA 4K7FB 3QA3B 1DBMH 1NCAH 2NNAA 4NCC1 1P7KA 3ZT5A 5DJ6A 4JFZL 4PJDB 3KG5A 5F6IC 4JN1L 1HQ4B 1B90A 4KY1L 4B41A 2VDKH 1I7ZA 2HJFB 3O41B 5DHYB 4HT1H 2VZTA 4KKLC 3VXSB 4BH8B 5B39B 4HIEB 1UH2A 4LRIA 4TSAL 2YPLA 1FJ1B 4YO0A 3V5DB 9CGTA 1L0QA 2YRPA 2J5LB 2BSED 3MLXL 4M7JL 3BHBA 4XX1G 4LCWA 4TSCL 5TDNA 3PWVA 4NUGH 3NGBC 5L9DL 3T09A 4OFVA 1GGTA 1MCDA 1OSPL 5H94A 2KH2B 4QCIA 3O6MH 3H9SE 4U1KB 3QUKA 1FN4B 3RWEB 1UADC 4D9LH 3ZHDA 4MNHB 3RWHA 2HLAA 1GGCH 2Z92A 4HFWA 1AGEB 2OL3A 4LAQL 4F7EA 1UB5A 3FAWA 1DEEA 4MD5B 4MAYB 3BRDA 5TE7H 3TPUA 4JDZA 2QSVA 2AW2A 4K7FA 3QA3A 2J6EL 4RWYH 2HKHH 4KQ4H 2VDLL 4ODTH 4PJDA 4KTYA 1HQ4A 1BZQK 5JIKA 2R0LH 3EOTH 1DQTA 2HJFA 3O41A 5DHYA 3QXTA 4KH2A 1Q94B 3VXSA 4BH8A 4J7RA 4HIEA 5B39A 1ORQA 4Q58C 1FJ1A 1X44A 5L88L 2Y9RT 3V5DA 2WM0A 2QSCL 5MI0C 5AAWA 2PW2B 1A0QH 3OXSB 4OB5H 1BGXL 4DEPB 2BY0A 2PF6A 2RJMA 2R1YB 5IHLB 2J7LA 5GZOC 2G60L 1Y6KR 4EOWH 4U1KA 1PX4A 1FN4A 2EDHA 5FYLD 1GC1C 3RWEA 3BW9B 4KPHL 1AQDB 4O9HH 3I50L 2DDQL 4MNHA 3BN3B 4BJLA 5LQBL 3BP6B 1PG7H 1AGEA 4JFFE 5GS1B 1LO4H 5CSZB 4MAYA 1J0ZA 1ETZB 4PJ8A 4HD9A 2R69L 5GS0C 5T3XD 2OQJB 2RQ8A 5D7KD 5TE4H 3CFCL 1JHTB 3VGBA 1RZKC 4HULB 2YD2A 1LEGB 3WNNA 4Z7WB 1O5DT 2JELH 3FKUS 4GRLB 4EN3B 1J1XH 3EYOB 1Q94A 2W59A 3T65B 4TTDC 3VGAC 1OTUC 5L7XL 1RIHH 2R9HD 4MQXC 4HQQL 1A21A 5KANI 2PW2A 3R0MA 1FVCB 3RL2B 3OXSA 3I3DA 4BZYA 4OV5B 2R1YA 3WL9B 1QSZA 1LE9B 2VJXA 4JPWH 4Y7MA 3HR6A 4BSVB 3TNMB 2NY2B 4GAGL 5FYLE 1DBAH 4TUOB 3BW9A 4PJCE 1AQDA 2N1KA 4UMGA 3BP6A 3ARYA 3L3GB 3VFSB 1VACB 1BFOB 1WC7B 5GS1A 5CSZA 1ETZA 5D1XD 3N0PB 1GGYA 5LBSH 1A7NL 1NCDH 2AJVH 2DICA 4PJ7B 5T3XE 1I8KB 2OQJA 5C86A 2EDWA 3DX9B 4EEEA 5D7JD 5KVGL 1JHTA 1LEGA 1ZHNB 3DVGB 4Z7WA 3ARFB 3O6LL 4GRLA 1UACL 4EN3A 1X6NA 1RMFH 4P46D 3EYOA 3HFMH 3CLFH 3SGKA 1GOGA 3T65A 4L5FL 5IR1B 1NDGB 3MOBL 4D2NA 4I0PD 3VXTB 3DPBA 3D3VD 1G1CA 3NAAH 4Y2DC 1IARB 2WQRA 3D87B 1FVCA 3RL2A 1KB9K 1L7TH 4LVEA 1U3HC 3IXTB 3WL9A 4WI4A 1LE9A 4G6JH 4BSVA 3TNMA 1NFDF 4E41E 5J13C 3HC4H 4TUOA 4LP4A 5GRVL 4ZS7L 3OF6D 3L3GA 2QSQA 1VACA 1BFOA 1WC7A 3VFSA 1N5YH 4IS6B 4PBWD 4P4KC 3CX5J 5E0QA 2ZUQB 1ZHLB 3SDAD 4PJ7A 1I8KA 1N6UA 1P6AB 3DX9A 8CGTA 4TNVF 1SMOA 5FV1L 5C8JB 5IB4B 4XPTH 2QBWA 3IDIB 2OLDA 1NGZB 1ZHNA 3DVGA 3MRLB 4FHBD 3ARFA 4NP4H 4G8GD 5SWZD 3RDTD 3BI9X 3RGVC 4MJIE 2DRUA 1NMCB 3U4BL 5IR1A 3QQNA 1MFBH 1QSED 2YN3A 1NDGA 4OLZH 3VXTA 1QBAA 1ZA6B 3D3VE 4BFGA 4JO4H 4JCLA 5GGSB 5JHDB 1JWUB 2DD8H 2ZCLL 3NCFB 4OZGE 1VPOL 3IXTA 3QWRD 3CSPA 5LGKA 3FN3A 3A6BH 1IGIL 1RZJH 2CKNA 4YC2C 4PJIB 4NNXB 35C8H 1B2WL 2ZUVA 4P23D 3LS4H 3F58L 4GQPH 1OAXL 3ZDYE 1V8HA 3G6JF 3RTQB 5I71B 4IS6A 2DQUH 1EZVX 2NZ9D 1ZHLA 4GH7B 4M6OH 3ZDZF 3GHBH 4XT1C 4PRNA 5C8JA 1C1EL 5IB4A 3FB5B 4J3OC 1B6UA 3OR6B 4YDKH 3IDIA 2EKSB 1NGZA 1U3JA 3MRLA 5T1DL 1VFBB 4G8GE 2R4SL 5SWZE 1I1AD 3IU4L 4G9FD 1PG7X 3LQAH 3LIZL 1ZVSB 2NY4C 1X5FA 2BFVL 5J12B 4OLWL 4Z95H 1ZA6A 8FABB 1CWVA 4LRNL 1KGCD 5GGSA 5JHDA 1JWUA 1MCRA 4JFEB 4WW2B 3A6CL 4XC3H 5LGHH 3B9KD 1RUML 1RUKL 4NNXA 1I8LC 3MUZ1 4LPCA 4PJIA 2Q6WB 3U7AA 2R29H 3O2WH 3MLUL 4JPVL 3O8XC 3U46B 4K3EL 2VXQL 3QAZC 3BYTA 2VL4A 3BD4A 5GPRA 4H25B 3RTQA 4AL8L 4OCRL 2P46B 1CFNB 4RMRA 4LHJB 1CR9H 1TVDA 3REVB 1SEBB 3CC5B 3FB5A 4MDIB 3QB7C 4KVCL 1ACYL 5ADOH 3OR6A 4RGOL 5C2BH 5JUEL 2EKSA 1RULH 3SDYH 1YYLH 1S78C 1VFBA 3FRUB 4JPIB 3V52L 4L9LC 3BKMH 3I6LD 2FYYB 2VXVL 2NPLX 5FYJH 3BMWA 4G9FE 4OGXH 1CLOL 1ZVSA 5DQDH 3QUYB 2DQDH 1ZS8B 5DD3H 1XGQB 1UM5L 8FABA 1A6WL 2CMRL 1FP5A 5F1IB 5AWNH 1CLYH 4JFEA 4LVHB 3GSNH 5KSAB 4WW2A 4M1CC 2HFFB 1QFWH 2DBLH 1KCUH 3WD5L 2VQUA 4HC1A 2WIIB 2X5PA 4X0KB 2EE3A 4OQTH 1DLFL 3QDGB 3U46A 1RHFA 1LEIB 2WP3T 3EW3B 3TV3H 1DFBL 4OGAD 4YXKL 5MEPA 4H25A 1VB9A 3CFJB 3FL7A 5C7XL 5KANG 4XNXL 1CFNA 3V4VL 2CKBH 5I1CL 4U3CA 3REVA 3SKJH 1SEBA 3CC5A 4MDIA 4G6KL 4Y19B 3U0PB 2EH7H 1OTTD 3FRUA 4JPIA 4XBPB 5EZIH 3U82B 5B8CC 1AGCB 3LOWA 5AZ2L 1CXEA 2FYYA 1LDPH 5BS0B 3BWAB 4U1SB 1CXHA 4XMKL 3QUYA 3UDWA 1ZS8A 1XGQA 2EH8H 2N56A 4ZFFB 1CXIA 5GJSL 1KTKE 4OCSH 1A7OH 5F1IA 3WNLA 4YBQD 4OJFL 2EYTB 5JW4R 1D9KD 1P5UA 5HI4D 5KSAA 3BEVB 3NFPB 2HFFA 1FE8H 1I1RA 2CDEB 2WIIA 3QO0B 4KRPB 3T1FB 2V5MA 4GLRH 4XVJH 4X0KA 4WV1B 4G6MH 4JN2B 1CF8H 3QDGA 1ES0B 1LEIA 4JPKL 3A67H 3D2UA 4KZEL 5IT2H 1NBQA 4PJAE 5CGYD 5EZJB 3CFJA 4W70A 1F4WH 3CMOL 4MSWB 4YEFA 3TT1L 1JPSL 2L7UA 4XWGH 4AH2B 3KDMB 4M9PA 2EDQA 4Y19A 5D72L 3U0PA 3DHJA 4OLYL 4XBPA 1AGCA 2X42A 3CXHK 2Q3AA 1JNJA 5BS0A 2M8XA 1CK0H 3BWAA 4XHJD 3ARBD 4U1SA 1WQVT 5CJ8A 4IJ3B 4M7LL 2CUMA 3O3DB 5MEOB 4ZFFA 5M95B 1KENL 2EDBA 2IF7A 1VENA 5F9OH 1MH5B 4Z78B 3U0TB 4GAJH 4LLYB 3WDHA 4F7PB 4FP8L 2EYTA 2B0SH 1R3KB 1T7WA 3NFPA 1NBVL 3GZKA 1J1PH 4XNZB 2ICEB 3EYUH 3QO0A 4MQ7B 4UT6L 3T1FA 4WV1A 5ACLA 2KUTA 4NQDD 3RVVC 4JN2A 1ES0A 1KCRL 4LHUG 3GJFB 5HHOB 4P9ML 5EZJA 3K81A 1E4WL 4CDHA 1NAMB 4EBQH 3TLRA 3N06B 3UTQB 2QQQA 3QT2A 4MSWA 3T8XB 4C58B 4N0RA 2BVYA 4AH2A 3KDMA 4R90H 3S36L 5F9DC 1A1OB 3VXNB 3DOSA 4Z77B 3U1SH 2NTSP 4L29B 4F8TA 1YEJH 2XFXB 4KKBD 1IM9D 3O3BB 4OT1L 3BN9C 3O3DA 1MWAL 5MEOA 5D6DA 5E2TH 3IDYB 4G8FB 2ZJSH 1MH5A 4Z78A 4LLYA 1N3NB 3UTTB 4F7PA 4U1GB 4ZTPL 1R3KA 3VGGA 4K94L 3NCYS 3K3QA 2DL9A 3JWDC 3U4EB 4S1DD 2ICEA 3H42L 1FO0L 4MQ7A 4N5EC 2L4OA 4IDJL 4NQDE 2OJZH 1ITBB 1F58H 1JWMB 5EOCJ 1A14L 3LSOB 5HHOA 2VDRL 4CU8A 3E2HB 5KVMC 1J1OH 4TNWK 1FNSH 1NAMA 2IMNA 4WI9A 5JQ6H 4OSUL 4N8CL 3UTQA 1UYWH 1WSST 4NC0B 3T8XA 1FORL 3ARGC 4OCWH 5DHXB 4EJ1C 1G7PB 1AO7D 2IPTH 1A1OA 1HH6B 3INUH 3VXNA 2W60B 4CVXB 4Z77A 3B9VA 4L29A 2XFXA 1WICA 4IRJB 4ZUVA 3PP3K 3O3BA 5M94B 4NZUH 3S8WA 4ZFOL 4FQXC 1QKZH 1YY8B 4G8FA 1MREL 4U1JB 4HG4J 1W0WB 3D39B 3JWOC 4YDVB 3WUWG 2APFA 3GSXB 4POUB 1N3NA 1F11B 3EZ8A 1EUUA 3UTTA 1T7YA 1PLGH 1CFSB 3T04D 4L4TB 1U42A 4K3GA 2FHBA 3U4EA 2DYPB 2XKSA 4Y16D 5TFSL 3H3KA 2HRPH 2BHZA 4U1NB 1JWMA 2P1YA 4J12A 3LSOA 3BZEB 4JQIL 4DN3H 4ZOEA 2XY2A 5BVPH 2V5RA 2P5ED 3QJFB 5IJKA 1KCVL 2DLGA 4M7KH 1UFUA 1P1ZB 4PJHB 5I1GH 1G7PA 5IGXH 1AO7E 1HH6A 3H9YA 4LEXL 1DE4B 2W60A 4CVXA 4AMKL 4LARL 2VKWA 4E9LA 3M17A 3FQTB 5D1XA 2VXSH 3QQ3B 4NNPH 4FNLL 3WFEH 2YK1L 2EDKA 3RZCC 4H88L 2X6MA 4MXVE 4X4ME 4YNYB 5CD3B 1FBIL 3VU2A 3GO1L 4ZFZB 1YY8A 4U1JA 3V0WL 1W0WA 3D39A 4OF7A 1I3RB 4YDVA 4IIQA 2CSPA 3GSXA 4OBSA 1F11A 1CFSA 4L4TA 2HT3C 2DYPA 1ND0B 4RMUA 5DMIL 2EDFA 3E8UL 3BT2L 4IRSC 4K3DH 4FTVD 2DMCA 1U8OA 4U1NA 3KAAA 3AY4C 3BZEA 2FEEI 2HT4D 1E6JL 4P48A 2VDQH 4U0RC 3VJ6B 4PJ9C 2P5EE 3QJFA 2EDRA 4LOUC 5F7HA 1IC5H 5IMMB 3O4LB 1P1ZA 4PJHA 4BKLB 3MLTA 1UCTA 3FRPG 3MRGB 4LIQL 3T3PE 5DMKB 5D4QA 3VXUD 2DQCH 1DE4A 2EDJA 2NY0D 4YDLC 1A7BA 3M8OL 3QQ3A 3LRGA 1M71B 3CVHB 1IAOB 3IAQA 4OFPA 5F71A 4YNYA 5CD3A 3OG4B 3QRGH 3CH1B 4ZFZA 3QNYB 2QQLH 4RGMB 1YNLH 1I3RA 3MLSH 4FQIH 3QI9B 5ACMA 3J8F7 5HHXL 1HHJB 4Y4FB 3FQRB 3UCRA 2SEBB 3T0DA 2FX7H 3MJGX 1UM6L 1YEGH 1DBJH 2ICCA 3WIHL 1FRGL 1ULVA 1ND0A 3QRFM 1PG7W 3DIFB 3IFLL 3AVEA 4O00A 4O2FB 5B22A 4M43L 1JGDB 5CUSH 3VJ6A 2ZZUT 4Z7NE 3RVWD 4MA7H 1S7TB 2DLFH 5IMMA 3O4LA 4BKLA 3F7VB 4J8RB 1JGEB 1LHZA 1Z3GH 1HQRB 3MLYH 3MRGA 4QXGH 4DKEL 5DMKA 1BX2B 3VXUE 2NX5E 4HJJH 1R5IA 4GBXD 1IBGL 4MNQD 2VAAB 5D93B 4FFZH 4YE4L 2H1PL 2OCFD 3BJ91 4JFHD 4FQ2L 1M71A 3CVHA 4TUKL 3LB6C 1IAOA 4YH6A 1YMMA 3CVIH 3WDJA 2JJSA 3CH1A 3DUSB 5I18L 1NCTA 2OR7A 2UZXB 3QNYA 3S34L 3BIKB 5FM5M 3SDXB 5C0DB 1TCMA 5SX5H 3QUZC 4NQSB 2GJJA 3QI9A 2GJZB 2DLEA 1HHJA 5JW4Q 4Y4FA 3FQRA 2SEBA 2VSCA 1OARL 5ACZB 2J8HA 2ZPKL 1IJ9A 5E03A 1WF5A 5DZNA 3DIFA 1JI2A 3I3BA 5FXCH 5IROA 4JJHA 1O0VA 4O2FA 3KJ4C 3HE7C 2F58L 2NXYD 1A4KB 3QBTB 1JGDA 2BRRL 4K9EL 4H1LH 5TE6L 3KS0J 1P7HL 1KXVC 3OGOE 4FZ8L 5C9KA 1S7TA 2DQTL 3ALWA 2MMXA 3F7VA 4J8RA 1JGEA 1K9TA 1HQRA 1MIEH 3MLWH 4IRZH 3VH8B 1BX2A 1EHXA 5J56B 1RK1B 2GI7A 2VAAA 1SJHB 3HA0A 3S96B 3ZKND 2RBLA 5C07D 5JXAH 4AIZB 1FNLA 5I74C 2DQGL 2I25N 3CSYB 1FZMB 3CFKA 3DUSA 2PNDA 1OPGL 3MROB 3SDXA 3BIKA 5C0DA 1NEUA 5JORB 4YHIB 4NQSA 5EIVA 2DTML 2GJZA 3LQZB 4PJCF 4OM1L 1KNOB 5ACZA 1HNGA 2J5LC 2NLJB 4RA0C 5IBLD 2KDGA 4MQSB 4YDIH 3QIWB 4LQFH 1A4KA 4CN4A 5E6IB 5EU5B 5IIEB 1CQKA 3I84A 3NFSL 4ONOA 1C7SA 1QFOA 5E2VL 5ABDE 3JV4B 4HEPG 2PTVA 5BXFB 1VGEH 5BV7B 1OAZL 3BD3A 1IZKA 5ANME 3OV6A 5LXGH 4NKMB 1OAUH 3VH8A 1GHFL 1KBGH 3HZYB 4N9GB 1RK1A 4QRRB 1SJHA 5IB1A 4HFUH 4LMQI 3S96A 1RZ8B 2KZWA 1T5WB 5C07E 4Y2OA 5EFIB 4AIZA 4O02H 3CSYA 3RZWA 1FZMA 3VXRB 2MTPA 5J0BA 1V05A 3MROA 5I1DB 3P0YL 5JORA 4YHIA 3E3QC 1RZ7H 1NMAH 3LQZA 2ZCHL 3O9WD 4NZRH 2WBJB 5D5MB 3HPLB 1KNOA 5IG7B 1LO3L 1PW3A 12E8H 2NLJA 5E8PB 5JDSB 1TJGH 2X1WL 1T6WA 4ONGH 4GXUN 3QIWA 1IGTB 4LL9A 5DD1L 5CSBA 3RIAK 1OW0C 5E6IA 5EU5A 5IIEA 1Z6JT 3UAJD 3VWKB 3HNSL 2QADD 2O5ZH 2DM4A 5E8OB 4ODXB 4HHAB 3JV4A 4PJXB 1WBZB 2J4WH 3OX8B 2NY3C 2JF1A 4D9RD 5IWLC 4NKMA 3HZYA 4N9GA 4QRRA 2AJYL 3NIDE 2D4DA 4OCMC 1ZOXA 4R4ND 1RZ8A 1TVHB 1T5WA 3G5XB 4ZYKB 4Q9RL 1S5HB 5DC0A 5EFIA 3AREB 2YUWA 4OZGF 4WO4D 3VXRA 1OL0A 4OFYD 3OAUH 1FNAA 3NTCL 5I1DA 1WT5C 1QLRB 3L9RB 2WBJA 5D5MA 3HPLA 5IG7A 4YGAB 4DZBB 3WLBB 3R8BB 1FLRH 2UY6A 3WS6A 5E8PA 5JDSA 3B9AA 5AYQA 1XGTB 1KF9B 4OZIE 3AS3A 3QIUD 1IGTA 3BX7C 1VA9A 3SGDI 1VEOA 1T20B 3DYPA 1UKSA 3VWKA 1EPFA 4ODXA 1ITCA 5IFAL 3AROA 1KV3A 2R2CA 2HTLD 3L1OL 3VFRB 5C0GB 4PJXA 4PRHD 1WBZA 5AG8A 1G7HB 4D9RE 3BH9A 1QFUH 1CXLA 1TVHA 4I8DA 4Z7VE 3G5XA 4ZYKA 1CGUA 1WAAA 1S5HA 5C0IB 3A6OA 3AREA 3CLEL 2AJXH 1UEMA 3VFUB 2WWKO 1IFHL 3PE9A 3WFZA 2JCCB 1NC2D 4R2GD 1QLRA 2Z8VC 3O4OC 3L9RA 3D69B 5I1IH 2ICES 3SHSA 2YD4A 4ORZC 1H15B 4DZBA 2OS7A 3WLBA 1JCKA 2BRQA 1E6OH 4HS8L 4NBXB 2VZSA 1XGTA 1Q0YL 4LF3A 4RDQG 2OXHA 4LPTA 4G3YH 1PX3A 4Z7OE 5HD8C 5GS0L 2O26U 1T20A 3FO9B 4GKZB 5D1QC 4GG6B 3VDBA 2CLRB 3V4UL 1RY7B 1ZLUK 4FQLL 1RZKL 1NAKH 2KKQA 5EN2B 5C0GA 3VFRA 3MACL 4PRHE 5T5NF 3LKPB 2ADFL 4P2OB 1G7HA 1D3CA 3PGFH 2WUBL 1YC8A 2FBOJ 5EPMB 3KLAB 5L0QB 4XI5D 5DMGD 3WFBH 4GRWE 1INDH 2AGJH 4NZTL 5C0IA 3RHWK 5I8KL 3TA3C 1IL1B 3VFUA 4P5TC 1N0XH 3KXFB 4KUZH 5GRVK 3KYOB 3PWPD 2JCCA 3FT2B 4RAVB 3G04B 3D69A 3S37X 3SJVD 1W2KT 2Q7YB 2FECL 1H15A 4X7EC 2W9DH 2H2SD 3O6KL 4LLQB 4Y1AB 4IOFD 1NCCH 3ARTA 4CL7A 1H3UA 4KTEL 1MQKH 3O11B 1S9VB 4YHLL 4GS7B 4FFYL 5CZXD 1Q38A 1HZHL 3FO9A 4GKZA 5M7QA 1NANI 4GG6A 2M1KA 2CLRA 1MLBB 4PJFB 5SX4H 5EN2A 7CGTA 5ICYB 4PJGB 4NM4H 3LKPA 3C8KB 4P2OA 5EPMA 4ZTOH 3KLAA 3RY5A 3S5LG 3HI6H 5D7IE 1LO0H 3B4NA 4O58H 4Q9CA 1NSNL 1MPAL 5T1LD 4WEBH 3B2UC 3MNZA 4LSRH 5C0JB 1I9JL 1IGJB 2E27L 1IL1A 1DBKL 4LFHG 4X4YB 4KDWA 3KXFA 4PYHA 3KYOA 3PWPE 3D1MC 3FT2A 3IDMB 4P59H 1CYGA 4RAVA 3W0WB 4CW1B 1KB9J 3SJVE 2Q7YA 4FQ1H 2BP3A 2PN5A 5FM4A 4HEME 3ULUC 2RCSL 3MRJB 4IMLB 4Y1AA 3TH2T 1CI5A 5LVEA 4NHUB 4PJAF 4Y4HD 2PYEB 3L5XL 4Y5XC 4A6YL 4Z76B 3BKJL 5AAMA 2PR4L 4X98B 3ZHLA 5KN5B 1ZLVH 3O11A 1N6QL 3D9AL 1IT9H 4OM0L 4TVSa 2VR5A 1MLBA 3ARZA 4PJFA 4BZ2L 3MFGB 1YNKL 3HR5B 4GKOA 4PJGA 5ICYA 5L2KD 3GMNB 1QEWB 5D2LB 3C8KA 4S0SD 5GSRA 4TYUA 5IW6B 5CJXC 1DVFD 5E2UH 4M1DH 5C0JA 2ARJQ 1IGJA 2EZ0C 3RAJL 3KHQA 4X4YA 4I2XB 1FDLL 3OMZA 3PNWB 5BVJB 2DIJA 5KW9L 3IDMA 4CW1A 1EK3A 3W0WA 2B20A 4NKIH 2I9TB 1A2YB 3GI8L 2AEWA 2CGRL 4UIKL 2DB8A 5CINH 4NQXB 3QWOB 3MRJA 5H35B 3TT3H 2RHEA 4IMLA 3GNMH 4NHUA 2R4RL 2PYEA 4Z76A 3UTSD 4X98A 2O5XH 5F3BB 5KN5A 2NY1D 4HK3N 4Y88A 1IC4H 3NBNA 3WXVH 4NGHH 3BVNB 3JV6B 3PL6B 1O7SA 5DS8B 3HR5A 5L2KE 1BM3H 3AU1B 4RGNC 3GMNA 1QEWA 5D2LA 4IHOB 2AEPH 3O2VL 4GG8A 5I30H 1HXYA 1VESA 1OOAA 3MV7B 5IW6A 1RURL 1XCQB 3VI4E 1EGJH 2CLZB 3MBXL 5EU7E 3LQMA 1D5ZB 4N9OB 1J88A 1LP9B 4K7PL 2C3XA 4NHCL 2IFFL 4I2XA 1UA6L 5D7LD 3WCYA 5KVFL 3PV7A 3PNWA 5BVJA 4H20H 5EOTB 5AD0B 4MNQA 5FDYA 5B3NA 2I9TA 1A2YA 3VFGL 1AXIB 3TVMC 3ALXA 2E5EA 4PGDB 2FZ3B 4NQXA 4TNWF 4XHQA 5KVEL 1XIWB 1F6AB 5H35A 2A77H 3GSNB 1EBPA 3SDCC 5EBMB 3W39B 5F3BA 5TF1H 4P57B 2X1XR 2NY7L 1IGFH 2CJUL 2LU7A 3BVNA 3JV6A 3WKML 3PL6A 5D2NC 1MF2L 1WEJL 5DS8A 3QFDB 2ERJC 3AU1A 1QNZL 3HI1B 4M48L 2J1KA 4IHOA 1G9NC 2CKBB 3MA7B 3MV7A 4K2UH 1XCQA 3HMXH 5IBUB 1NLDH 1D5ZA 2DMKA 4KQ3L 4TPRL 1MFCL 3B3IB 4NWTL 1LP9A 1DSFL 5KZCB 3IFNL 4PB0L 5D7LE 4PJEB 1CD9B 5EOTA 5AD0A 4MQTB 3TN0D 5JW3H 4PG9B 3PV6B 3FJTA 4PGDA 4M00A 2FZ3A 4DJMA 3B5HA 1DZBA 1XIWA 1F6AA 3VFMB 3GSNA 2WZPD 3W39A 4NRXB 4P57A 2GT9B 1BAFH 1FLTX 3TYFB 4NO0B 3NABH 3KYKL 4OQTA 4KU1A 1NL0H 4RFOL 1U8LB 4JFPB 3DECA 3QFDA 4MAUH 5CJQL 3ZE0E 5DVOA 4MXVF 2FGWH 2CKBA 3MA7A 1NCWL 1BBJB 2OTUB 1JN6B 1P2CB 5GZNC 4N1CA 1LE5B 1T66D 2X4OB 4ZO6A 1XH3B 2J2ZA 1GC1H 3B3IA 1JPGB 5C08D 3KPPA 3UYRH 4ENEC 5D9SB 4F9LA 4WWKB 4Z6AT 4PJEA 4I3RL 4Y5VB 1PSKH 5C09D 3D85B 5CJBA 4KROB 4H0GA 2DIAA 4PG9A 1CD1B 3PV6A 3VW3L 4MCYB 4ZXBD 3D18B 4W81A 3PHSA 5I6XB 4K23L 2DLHA 3HMWL 4S11A 1MAKA 2DI8A 3MO1B 3VFMA 1YEIH 3QIBB 4JM4L 4UBDD 5IVXE 3GSRB 2VDML 5DA0B 1H8OA 3ULVC 3ECBB 4NRXA 1GGBH 2F74B 2GT9A 1JRHH 1CIDA 4HMDA 3TYFA 4NO0A 1N7MH 1U8LA 4JFPA 3T3PF 3VXOB 2AJUL 5FGCE 1K8IB 4Y4KB 3QR2A 1KTLB 3WJLC 4FFWC 2ATKB 3GM0A 3BPOC 1H5BC 4JRYB 4EIGB 1BBJA 2OTUA 3E2HC 1P2CA 1YECL 1LE5A 1FZKB 2X4OA 1XH3A 1JPGA 3DYOA 2NXZB 2FHFA 5D9SA 4WWKA 1T2JA 4Y5VA 1ZTXH 5C09E 2EXWC 3D85A 1YN6B 1MCBA 1CD1A 4QO1A 2IGFL 2GQHA 4ZO7A 4MCYA 3D18A 4IRJC 4OD1H 4KJWD 1F02I 1EV2E 5HHMD 4I4WB 3MO1A 3CNKA 1FGVH 3S97C 1GAFL 4AEHH 3QIBA 4XTRC 2EDLA 3PJSB 4OD3L 4OLVH 3GSRA 3SKMB 3U7WH 4JGUA 4LCCC 4Z7NF 3ECBA 1YYMH 4RAUB 3QP3A 1ADQL 1AXTL 2VC2L 4YXLL 5E9DE 3GIZH 4X6DB 5EC1B 2DAVA 3DSFL 3VXOA 2C3WA 4P99A 1K8IA 2PO6D 4Y4KA 3ZLQC 4ETQB 2HTKD 1YEKL 1KTLA 3OXRB 5EIIB 1R5WB 5DK3A 5D1ZD 2ATKA 1E4KA 2C3HA 3H3PL 4JRYA 4XNMB 5J06A 3WUZA 1BQSA 3HB3D 1A3LL 4ODVH 1X9QA 1FZKA 3MXWH 3O2DH 4AG4H 1KTDB 1CFVL 4MA8H 5F21B 2V9RA 1J0JA 1HKLL 4EIZC 5HYQB 2VLRA 1YN6A 2IPUK 4HF5H 1EJ6A 4WI5A 3KYMB 4EI5D 2P8MB 3V7AE 2FATL 5IP4A 1I8MB 1T89C 1A6UH 4I4WA 1NMBH 4Z9KB 3NCBB 3PJSA 3GGWA 4P2RD 3E6HB 3H3BC 3SKMA 2CK0H 5IQ7H 1F6FB 4RAUA 3QEQE 3RWGB 1I9RL 1S3KH 2BJML 3OAZH 5JHLL 4X6DA 5EC1A 2XWBB 3DXAB 4JY4B 3EDJA 3MOQA 3J7HA 4PV8B 3L3OB 1U8QB 1JYXA 1ACZA 4ETQA 3OXRA 5EIIA 1R5WA 4KTDH 4ZNEA 2ADJB 4ALAL 4XNMA 1OGAD 3DO3A 5HDLA 4CVUA 2H8PB 2E9WA 2B1AH 1MOEA 4HS3B 3VGHA 1KTDA 3AS2A 5HYQA 2LQRA 4PR5B 4XBEL 2G9HB 1NBYB 4XVTL 5BO1L 3QUML 2P8MA 4XX1E 1KULA 3S7GA 2RAMA 4LIQE 5F7KC 4P2RE 1MIML 3E6HA 4J3TA 3MRNB 3JTTB 4LVNC 4NC1C 5H2BB 3SQOH 1DQML 4DGVH 2P5WD 3RWGA 2X1OA 3CPLB 4DGIL 2XWBA 3DXAA 2VDLH 3V79C 4JY4A 3LPFA 4PV8A 1U8QA 3EJZD 5DD0H 1BOYA 3C60D 1WZ1L 4AK1A 4DK3A 1BJ1H 2ADJA 3RUGE 5TH2B 43CAB 7FABL 1N64H 1J5OL 4HUXB 1PKOA 1OGAE 1NUNB 2QSCH 2H8PA 1NEZB 4YHML 4M03A 5A3IC 1UJTA 3C6SB 1TTFA 3FFCD 4LCYB 4NOBA 5HXMA 1CGSL 1UJ3B 4HS3A 5H37H 4M5ZH 1YEFH 1AP2B 4KXZI 4PR5A 5D93C 4PRBB 2G9HA 1NBYA 3BEWB 1UWXK 2M26A 5J6HB 3I50H 3TF7C 5DRXB 1DQDH 2BK8A 1HYSD 3DVFA 4L4VB 2HJKB 2Q86B 3HE6D 4NBZB 3MRNA 5I8CB 3JTTA 5H2BA 4PD4J 3QSKB 4QNPF 2P5WE 3ZKMC 4DGYH 3CDFA 3CPLA 2VTFA 4UUJB 1EFXD 1T1WB 2J8UB 2QR0B 1UGNA 1S7SA 4Y4HA 3HHRB 4UT7L 5IHUH 2JJWA 3O3EB 1JGLH 2IFGA 3GBNH 2A1WL 43CAA 5TH2A 2B1HL 5TF0A 3DX8B 4HUXA 3T0EB 1D6VL 2RIKA 4DZ8A 2PCPA 4JZNB 4JFFB 5K9QI 1NEZA 2C9AA 1WISA 3C6SA 3FFCE 4LCYA 2HH0L 1UJ3A 1UWGL 4NFDA 1TETH 2V9TA 5GGTL 1JZ7A 3GEWB 1S7UB 5GHWL 2W0LA 1AP2A 4PRBA 1RZIB 3K2MC 4U05A 3BEWA 5J6HA 25C8H 3S6CA 15C8L 5DRXA 4OZIF 5F96H 1T80A 4L4VA 2HJKA 3BIAX 2Q86A 5I8CA 3KLHD 1KG0B 3SDDB 4LU5H 1YEHH 1LO2H 2Q76B 4OUUB 4HXAL 1T21B 4UUJA 2J8UA 3BOVA 2QR0A 3O6LH 1MJ8L 4H1LB 4XP9L 5I1HL 3O3EA 4Z7VF 3V7MA 5LCVH 4DKDC 1L7IH 3DETD 5ALBH 3DX8A 3T0EA 4QOKB 4JZNA 4JFFA 1ZSDB 3UJTH 4GAYB 5I1EL 3IJYB 1NCBH 1YUHB 5FUCC 3QDMA 4K3JH 5BV7C 5IMOB 4UV7H 1K4DB 3HG1D 5BQ7B 1I9IH 4S2SB 1RZIA 4AIOA 4GRWH 4BQBA 4NKDB 2R8SH 4U0QB 4OCXL 4Z7OF 4DQOL 5KAQF 4DOHB 4FQJH 5A2JH 1KG0A 3SDDA 3TO4D 1DN0B 4N0CC 2Q76A 3SN6N 2N7AA 5GGVY 1HINH 1T21A 2WINB 1TMCB 5HBBA 4U1IB 5HDQL 2OL3L 4H1LA 3RHWF 2OP4H 4E41B 5I19H 2BVPB 4OLXH 4YK4C 5I1AB 4XPAH 4QOKA 4PJ5E 4UV4L 1ZSDA 3P0GB 3B2VL 4GAYA 2GAZB 3L5HA 3IJYA 4M02A 1YUHA 4WEMB 3KPRB 2G5BB 5IMOA 4HAGA 4UZGA 5ECJE 3WN5B 1K4DA 2AK4E 3HG1E 5DDHB 3MRQB 5BQ7A 4QHNA 4S2SA 3ZTJH 4F58L 2ED8A 1WGOA 3RKPA 4NKDA 4P46B 5ESAB 3KPSB 4MJIB 2QJDA 4KJQC 1IZJA 1U8HA 3BQUC 1DN0A 4BQ9A 4HPOH 1BBDL 3Q1SL 3B9DA 3GMQB 1J0IA 2WINA 3AFLA 3C6LD 1JGUH 3BPCB 1Z5LB 4U1IA 5I15L 2R4SH 5D7IF 3VWJC 3WFDH 4E41A 5T5NG 2BVPA 1MRDH 4FG6C 3CK0L 3G5VB 4DN4L 5I1AA 1BZ9B 1PY4A 5HI5C 4UILL 5F3HB 2DQJH 3JWDH 1OTSC 4ZS6C 4LRNH 2GAZA 1KJ3L 3KPRA 2PXYD 5KVDH 2G5BA 5D6CB 3SE9H 5GS0D 2GITB 3JXAA 4PGBB 4QTHB 3WN5A 5DDHA 3MRQA 3ARDC 1VFAB 2H32H 4YIQB 4FQCH 3LV3B 2JJVA 2APBA 1KB5L 3ARVA 1HCFX 5ESAA 3KPSA 4MJIA 3UPRB 5DEFB 3ES6B 1I1YB 4HLJA 4ELME 1MJUL 4I48B 5CEZH 4GMTL 2HFEB 2Z8SA 5E99L 2NQCA 3GMQA 4UIMB 4DFHA 4HKZB 3ZMRA 1IGCL 1Z5LA 3BPCA 4GO6B 4U6XB 4GRMB 2YBRB 3JWOH 1T2XA 5C6TL 1NPUA 3G5VA 1BZ9A 4FN0A 5I73B 3CGTA 3EO9H 5TPWH 5F3HA 3BP4B 1NGQL 2DQIL 5D2NE 2R0KL 2BVQB 1L4IA 4NYLB 1ED3B 2WLZA 5D6CA 4ONFH 2GITA 4PGBA 4UNTA 4QTHA 5E5UB 3IDUA 1VFAA 2FB4L 4YIQA 3LV3A 5CILL 1E4XH 1FC2D 2WLYA 5GS2D 5ITBL 1JNLH 3UPRA 5DEFA 2FDBP 3ES6A 1I1YA 3DGGB 3AMLA 3D5OF 5IVZB 5K9QG 1WWCA 3TJEH 4I48A 2F5AL 3WSQH 2HFEA 4PS4L 5GRJH 4UIMA 3L95B 3L3DB 1AE6H 3GK8L 3O6FB 1IEBB 3VI4F 3VDCA 4MJ6B 4U6XA 3NA9H 4GRMA 2YBRA 2X70B 3DLQR 5DJ0B 1U9KA 5DHVH 2FJFB 4JHAL 5T33L 4ODUB 3BP4A 2BVQA 1T03L 4NYLA 4P4KD 4PRID 1ED3A 4WEUD 2VXTL 1WZKA 1TQBC 1J11A 1U6AL 4RX4D 4AZ8A 4LSSH 3PDDA 2MKLC 4PLOB 5FV2A 1UKQA 4I1NB 5JQHC 2ZUTA 1NUFA 2ORBH 4FMFA 3PDGA 3DGGA 4GQ9H 4X6CA 2H41A 4LSPH 2Z31B 3SE4C 2DQEL 2QQNH 1JHKH 4JANB 4OUOA 2FWOB 4EDXB 3L95A 3L3DA 3W9DB 4HIIB 3VFNB 1U36A 3O6FA 3SE3A 1IEBA 1A1MB 3LKNB 4MJ6A 4XAWL 2X70A 2WAHA 5DJ0A 1Q1JH 4WGVB 2FJFA 4NQTA 5TQ2H 2HJLB 4NNYA 3NN8B 4DAGH 3LN9A 2EIEA 1JZ6A 5EORL 5FYJU 4ODUA 3QUXC 2CK2A 4W6XB 2V2WB 5KJRH 5HSFA 4PJAB 5EIQA 1UKTA 1NLBH 4HXBH 4PRIE 3S35L 3K2UL 2YPVL 4JM2D 4M6NL 4L3EB 2XTJC 4P3CH 4WFGD 4KK8D 3EJYD 4ZNCD 4W6WB 3MLPA 4O4YH 4LNVA 4APQC 2PW1B 4G6AC 4E42A 3EYFB 1TDQA 4UOW1 4ZSOB 4RZCB 2F19L 1N2RB 4X4XB 1BFSA 5ADPL 1L0YA 4HLZG 2EDNA 3QG7L 1PFCA 2X4SB 3B9EA 4WUKL 1CE1L 4EZMA 1RJYB 5C0BE 2Q87A 4L9DA 4W4OA 2Z31A 1V3LA 3HNVH 4XAKD 4JANA 4JHWL 3ZE0F 3BKYL 1RQ5A 4EDXA 3QCUH 3MUGB 3HC3L 3W9DA 4HIIA 1V7MH 2OZ4H 1CD8A 2UYLB 1KJ2H 4NQVA 5FKAB 3LKNA 5IKCB 2GSIB 2HJLA 1EAJA 3NN8A 1DBBH 4AJ0A 5AYUH 4OCYH 3CFBA 2V2WA 5DWUL 5ITFB 4ERSH 1T2QH 4PJAA 2IAMD 4KWUA 5JA9A 2YRLA 4S1SL 4KK5D 4JFDE 4L3EA 4PREB 1JYVA 5MENE 4J23A 1R0AH 1D5IL 4WFGE 3V4PL 1A8JH 2P42B 3EHBD 4MA1B 2LFGA 5IVXF 2PW1A 3ZTNL 3QO1B 5JNYB 3V95A 2DN7A 1U93B 3EYFA 4ZSOA 4P9HC 4RZCA 2W9EL 3K8LA 1N2RA 2YUVA 4X4XA 4YZFF 2VXUL 3RU8H 2X4SA 1F3DH 1RJYA 4R96B 2X9WA 1RVFL 4DUXA 3T77B 3EDEA 4PLJC 4XAKE 1JGVH 5JIHA 1GIGH 4HC1L 3VI3F 4V2CB 4XP1H 1JZ3A 1JF1B 2XWJB 3MUGA 1FNEB 5FIEA 2UYLA 5DQJB 2WK2A 5FKAA 3GSOB 2XZQL 3ZL4H 1GPOL 4M1CD 3DRQB 2E6PA 5IKCA 4L8CB 1FHGA 1MFAH 1I8IA 2GSIA 3L3HB 4YUEH 2E9JA 4BQ8A 4ISVB 1QBMH 2PTTB 2V5YA 4KK6C 1A02N 4KRMB 2WP3O 3U83A 2VYRE 4XP4H 5ITFA 4GMSL 5A2KH 1N4XL 3IT8D 1Z2KA 4FQHB 5IBTL 4PREA 4X7FC 1XF3B 2IAND 1C5CL 4Q6IB 5J8OA 4K71B 2MQCA 1A6VL 2NY6B 3QO1A 1XR8B 2IQ9L 5JNYA 1U93A 2WV3A 3CUPB 2V7NB 4NQCB 1TZIB 2A6JB 4OGYL 3IF1B 4I77H 5FCSH 4R96A 3T77A 1HNFA 5D70H 1QFPA 5F6IB 1JF1A 2XWJA 1FNEA 5DQJA 3GSOA 3FHQA 1T7VA 1FG2B 5MHSE 3DRQA 3FN0L 1BD2B 4L8CA 4NC1E 5C0NC 1I4FB 2YOCA 3L3HA 4MD4B 3GO1H 3TYGH 3X3GH 3UJJH 4ISVA 2PTTA 5DT1L 4CADB 1KLGB 3NGBB 3UJIL 1S5IL 3C5ZC 1LD9B 3SE8L 1OAQL 4YHZL 1EGJA 3WHE0 2AABL 4FQHA 1EHLL 3C09B 1HK6A 1RUPH 1XF3A 2IANE 4NSKB 4UTBH 2XRAH 3F12B 2B4CL 4Q6IA 5ALCH 1T1XB 1NFKA 2XZCH 1CGYA 1KLUB 4Y89A 1XR8A 3B8SA 4Q9BA 4UOW0 3CUPA 4TVPH 2V7NA 4NQCA 3OKOB 4XVSH 5IFHL 4NO5B 5JPMB 1TZIA 2A6JA 3TCLB 2XTLA 3IF1A 3P11L 4BFEA 4GXVL 4DKFL 4F80A 3GB7B 3V6OE 2MHAB 5FHBL 5F7NC 3RY6C 1EZVY 1G9NL 2IG2H 1ZVYA 5KS9E 1FG2A 3BZFB 3UZEA 4XMLH 4YHOH 5KTEL 1BD2A 1WTGT 3LDBC 5MI0B 1I4FA 4U6VH 4MD4A 4CADA 2BNRE 1KLGA 4HWNA 1LD9A 4CMHC 4Y4KC 2AJZB 3DX6B 3HMXA 3QCTH 2HYMA 4NSKA 3F12A 2JKXA 2Y5EA 3RWDB 5CZVL 1T1XA 3HUJE 1DCLA 4HKJB 1KLUA 3HAEA 3RJQB 1X4YA 2Q3ZA 1ERNA 4KZDH 4HPYL 3OKOA 4NO5A 5JPMA 1CDUA 5J1SC 4XPHH 3TCLA 1I85C 1BQHG 3GKWH 4XWOD 1QZ1A 4KVNH 2LVCA 1R5VB 2APVA 3GB7A 4UB0L 2MHAA 1EVTC 3TWCL 1G9MH 1MHPL 5FB8B 3S88H 3RUGF 2J88L 1MCKA 1FH5H 5EU6D 4JB9L 3MBEC 4N0FB 3FB8B 3BZFA 4HWEL 1T7XA 3VGAB 2KBGA 5DEZA 2I9LB 3C2AL 4HH9B 1NQBA 1NAML 2H3NB 3IXAB 1IRAY 1GRWA 4CNIB 4YAQB 2GIYA 4XP6H 4LAJH 2HFTA 1DP0A 4G6FD 5DJ8B 1MCJA 1MJ7L 5CD5D 2C26A 5LGJB 3OZ9L 2HA1A 3RWDA 2E3VA 2GJ6B 4HKJA 2NX5B 4N1HB 1DLHB 1QSFE 4UINH 1CL7L 4PGJA 4QTIL 2WSKA 3UZQA 1IAMA 2VLKB 3NCJH 1AQKH 1R5VA 1GOFA 1YZZA 4LSQL 1T0NB 5F7MC 5IM7B 3W2DL 5FB8A 1TZHB 3RVXD 3LEVH 5EU6E 4KHTL 4N0FA 2NY5C 3FB8A 4PP1C 4JO2H 4M62L 1G1YA 2I9LA 3UO1L 4HH9A 2H3NA 1IAKB 1CICD