5I6XC

X-ray structure of the ts3 human serotonin transporter complexed with paroxetine at the central site
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
214
structure length
214
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Sodium-dependent serotonin transporter
total genus 42
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i6xC01
3ABZA 4JANB 3O6FB 1KNOB 4IS6B 1GVIA 2IAMB 2COQA 1FFNA 4Y16C 3SDXE 1P7HL 4DEPB 5GRVL 1NUDA 1MCJA 5C0AE 2VDPH 5ERWA 3RUGE 4L3EA 1CD9B 1GGBL 1NSNH 4PTUB 2VZVA 4JPWH 1JWUA 4OCSL 3W39B 1DQDL 5IVXF 4CN4A 3PL6C 3BZ4B 4NKOA 3N85H 1NDMA 5I16B 3HG1B 5FGSA 5MP6L 4FFVD 2W9EH 4QRRE 3UZQA 5I30H 4RZCB 2VLME 1EAPB 1JGDB 1PQZA 1YECL 3FT2A 3KPSD 4LEOA 4AEHL 4F8QA 2I9TA 1V3LA 2EH7H 1A2YB 5DJYB 2VLKA 5F6HI 4X9HA 2W0KA 4MQXD 4N9GB 4QRQB 5HGDB 4PJ9A 5GSVB 4F37F 1II4E 4IMLB 4NHCL 1NL0L 2CUMA 5TFSH 1X4ZA 2NY3B 4JGUA 2YEZB 3WFDL 3VXRD 3UYRL 4GW5A 4TYUA 3P77A 4JFEA 5D72H 3ES6B 1JWMA 4IRZL 3O6MH 5DHYB 2ZG2A 3UZVB 3QHZL 5E6ZA 3IGAB 4XCFL 3VG9C 5GHWH 1FNFA 1CDJA 5HYQB 3OKEA 1D5MA 4JRXD 2QV2A 1URLA 1YEFL 4X80H 4B41A 3QDJB 3BPNB 2R2HB 3EO0B 1IAOB 1L7TL 3KJ6H 3TCLB 4BZ1H 1E4XL 2DS4A 2C5DC 2AV1A 3BP7B 4HS3B 1I7TA 1OF2A 3C08H 4RDQG 1RUKL 3WO4B 5DJAA 5EA0L 2NPLX 5HI4D 5HHME 5IHUL 4Z5RB 1ZGLP 4F3FA 4L4VE 2XV6B 4K2UL 1PGRB 2R4RL 2ILLA 4B50A 2OXHA 2APFA 1ZT7A 3BWAB 3QXAB 1DQTA 1T20A 1S7SA 1X7QA 3GIVA 4Y88A 3T2PA 3LEXA 1A9EA 4UT6L 1YEKH 3QNXA 3PHSA 4PV9B 4QHLB 2JJTA 1WSST 5LWYL 4LSSH 4M5ZH 3SE3A 4GBXC 4EN3B 1JRHH 2E3VA 2NR6D 1GGCL 3VXNB 4V1DB 1WZMA 2A0LC 3ZHDA 3LDBB 4M6NL 1RJYA 2DQHH 2WP3T 2VLJD 2VH5H 4UQ3A 1A6TB 3O6FD 2BRRL 3SBWA 5J7CC 1D3CA 2YD8A 5T33L 3MJ8B 3MYJB 4OZGB 3IS0X 4OKVB 5F7FA 4HIEB 3Q48A 1ZOXA 5IB1A 1JVKA 4WU7B 1N3NA 4JY5L 4PJGE 3EGSA 4R7NA 5I1AB 2P45B 3T2OA 3W0WE 4NQXA 2IPUG 1P69B 4NN6B 1HKLH 1KUMA 3VFNB 4WW1A 1F8TL 4KI5E 3W2DH 3MRPA 3HS0A 3WJLA 4U1SA 1XF3A 1MVUB 4LKXA 5GGTH 3MCKB 3AMKA 3D69A 4PR5A 3RJDA 2DLIA 4KGLA 4UB0L 1KCVH 3QI9B 5JR1L 1CL7L 2OI9B 2CIIA 3MODL 3VDBA 1J1XL 1YUHB 4LAQH 3BE1L 3CFKB 4EUPH 2BVPB 2IG2L 2VLLA 4JPVL 3ZL4L 1HNFA 4HPYL 2X05A 4ZFZB 3AROA 2P5EE 3F62A 3PWVA 1D9KB 2O61A 2BVOB 5L2KE 3UTPD 4AEIH 1NFDE 1RIVH 2DIBA 2WW8A 3KS0J 1BF8A 3O4LA 2J7LA 3JWOC 5CZKA 4J7RA 1ZHLB 4WI9A 4H5SB 3KPMA 4HWNA 4GQ9L 4Y89A 2CLVA 5E6YA 2BSSB 2CO7B 3SKMB 4R97C 1IE5A 3ARGA 4P59H 4PTTB 5HVHB 2HKFL 3QIBC 2JELH 4PJXB 4U49A 4XNZB 5J11B 1MFEH 1QFWI 4KUCD 5JPNB 1Q94B 4D0DB 1T22B 1D6VL 4YGVB 2A73B 3T3PE 4U1NB 3FQWA 2MQCA 1TFHA 3VWJD 3FQTA 4OIIH 4QXTB 2GJZB 2B2XH 1PX3A 5D8JH 2ZUXA 1CIDA 4JN2B 2EDLA 1DEEB 5HPMB 1RSFA 1RZ8A 3VRIB 4Q74A 3VWJC 1B4RA 4O51A 4WFGD 2E7HA 1FN4A 1FVEB 1INQA 3JWDL 2GQHA 3CFDB 1D6EB 3ARUA 2BNRA 1ZA6B 4OI7A 1LEGA 2VXTL 2VLRD 4ODXA 4P3WA 2YOCA 3C8DA 3BZDA 5JQ6H 1G9MC 1MRCL 1JE6A 2J88H 5GS0C 3WHXB 2ICWJ 3CPLA 3KPPB 4ZODA 5ILTL 2I9LB 1WWAX 4O4YL 3X12B 5IKCB 2HN7B 4XC1H 3WO4C 4BSJA 4JFOA 5INDA 1J8HA 3O3DB 5KAQF 4OZHE 3HA0A 4OCYL 4WFHD 5AUMB 5LGHH 3SKOA 4LEOB 4ZOCA 4QRSB 4O02L 2DQJH 1IC4L 5E9DD 2VDMH 3BIKB 1CDBA 3ZZ1A 4R4FL 4BFIB 3H42L 3UTQB 1LDPH 3EO1A 1FL3A 4QY8A 4Z76B 3VXQA 3QDJD 5F89B 2OR9L 4XP1L 5I1LA 1ZS8B 1IAKA 2XQBH 5DMGC 1ZANL 4KZEH 3TO4D 4D0BB 4KK5D 2OS7A 2X4NB 1UWEL 1MHHA 4MA1B 2B20A 4NKIH 5IMLA 3UP1A 4R2GC 1X5IA 3OF6D 1D5MB 2LTQC 1NCBH 2ZKHL 4P3DA 5AG9A 5C08E 3EW3B 3FT3A 5FM4A 3VRJB 4JN1L 2DWEB 4Z7UF 1X9QA 4PJDE 1IAOA 3SBWC 5FECA 4APQB 1IGYA 1Q38A 5A2IH 2BSED 5I19L 3OAUL 3SKUD 2NX5E 1JPSL 2HVJA 4R3SA 4LDLB 4PBWD 5FGRA 5TQ0H 1V3KA 3UTZB 2QQLL 4M61A 3R4DA 1A4JB 3FO0H 4UIMA 1QLFB 3V4VH 4NQEB 1U8JB 2ZUYA 4PYGA 2R1YB 4L4TD 3BZEA 2VN7A 3F12B 3HE7B 4DQOL 3MNWA 1NSNL 1HSAB 4JPWL 4K3DL 2AW2A 1D9KC 3N1QC 1YN7B 5FYLE 2FJHA 3EBAA 3B6SB 3E3QE 4J1UA 4H20H 4X99B 3MRLA 2CKBA 1H3VA 3RX5A 1FAIL 4Z9KB 5I30L 4R0LA 3GSQB 3L6FA 3N0PB 2VWEE 4JAMA 2C1PB 4NC2B 1QKZH 1T66D 3NGBB 2XWJA 3P0VL 3JWDC 4U0RB 1HNGA 1FDLH 2FNBA 5CP7A 1CGSH 4FOMA 3DO7B 2QQQA 3QUYA 3AS2A 4MNGB 4KHTH 3D0VB 3QIBA 3KYNA 1XH3A 3TYGH 4JKPH 5TQ2L 3WUZA 4KV5E 2ADIA 3UYRH 5TF1L 1G7IB 1LP9B 4QTHA 4WUKH 4BQ8A 4XWGH 4XCFH 2W38A 2NY2C 4P2QD 2DQUL 3PXHA 5CLTA 5DFVC 5MEPB 4X5WA 1YEFH 2EYTB 4XRCA 2YWZA 4ZUVA 4Y4KD 5C0BD 2BSTB 2HJLB 1L7TH 3KJ6L 5FK9B 1FJ1A 4HKBB 5I6XC 5DFVD 4XTRD 4HK3J 4KJWC 1HHGA 5KSBA 4LQFL 1R5WB 4Y2DB 5SWZB 4UMGA 4MD0B 5IB4A 1MCWM 3TZVD 5SX5H 3TYFB 4NJ9L 4Z95H 3I6LD 2FX9H 1BHGA 4GKSA 3M17A 3VXOA 1CICD 1RU9H 4GXUM 3NCEB 3MYZA 4DZBA 4G80B 1T5XB 4X6FA 5DYOB 5HTSA 1X5ZA 1QPPA 3GIZH 3I3EA 2B0SH 2R0LL 1BM3H 5E8NA 1RZKC 1I3GL 5DMIH 5JXED 5DZOA 1JRHL 1QLRA 3BEVB 3A6BL 3MUGB 3T1FB 1H8OA 4JQVC 3IYLW 1YMMD 4NWUH 1YEIL 2HG5A 1T5WB 1OQXA 3FMGH 1PEWA 2ICWB 2H8PB 4I2XE 1RULH 1HZHH 3IDUA 1MHPL 1IM9B 3QRGH 1NMCB 5F1SA 4ZAKA 1Z3GH 4EDWH 1U8QA 2KKQA 5KW9L 2OX5A 4XH2A 5E6IA 4LHUB 4CMMB 2NX5A 4URTB 1Y6NR 1HI6B 1ZSDA 1S7VA 3OJMB 5CKGA 1JPST 1S8DA 1F2XK 2R0ZL 3FZUC 4EBQH 1CL7I 5JIKA 5INDB 4PJIB 1S9XB 5JR1H 2I5YL 1UKQA 4KVNH 1UCBH 3VMPA 1ZE3C 2G9HA 3BE1H 2BRQA 3LSOA 3VXRA 3ZKNC 4HX1A 4NCC1 1A9BB 4LCCB 2UWEB 2UYLA 3RDTB 3NABL 1PDKA 2L7UA 4AEIL 4JHZA 4RFNB 5A2LH 5DJZB 5HPOA 4EQ2A 3FN3A 3NACH 5IBTL 5F89A 4RMRA 4ZDHB 4PRIB 1MRFH 1DZBA 3B9KD 4U7MA 1MHCB 3DVFA 5E2UH 2NY5H 2X4NA 2OK0L 1X5AA 2HH0L 1IEAB 4NZDA 1P2CA 3DVIA 3VDAA 4W4NA 4CVZB 4IHOA 2UV3A 1BEYH 3T0EA 3SCMB 4QHMA 3MRMB 5C0BB 4TUJA 5ID1B 3TA3A 4YHPA 2Q86B 2AK4D 4KH2A 4DUXA 2FWOB 4APQA 4WWKD 4KROC 4NN5C 4K94L 3QQ4A 2VLMD 5JW4N 1XFPA 3L3IB 4HF5L 3B2VL 5TDOA 1GHFL 4N8PA 4M61B 4QYOA 1A4JA 4Q2ZB 5GS0D 3RX8A 2Q8BH 1QSFD 32C2B 4LRIA 1JGVH 4H88L 2VXTH 3WLBB 3BZEB 3HB3C 3IFNL 3LQZA 4MHHG 1QD0A 1G0DA 3K8LA 1LK2A 1BOYA 4OLEA 4L5FH 3QJHB 4ONFL 1UENA 1CT8B 3UPRB 5FCUL 1NGQH 5EU5A 1R24B 2J6EH 5C0IB 3ILPB 4G8GB 4PRPD 3UPCA 1GGUA 5EBLB 1HWHB 4Q9QH 3OR7B 3MGOA 5HHOA 1E27A 5CGTA 4U6XB 1UA6L 3QEGH 4GH7B 3VGAB 4Y4KC 1LILA 4MJ4A 1T3FB 2OTUA 5CSBA 2CK2A 3IDGB 1TETH 4PJ7E 5LGHL 1H3WM 2C7UA 3ZMRA 3H9HB 3NIGF 1UXSB 4Y5YC 1CGUA 3C5SA 1I3RA 4EI6B 3VD9A 3C6SB 2L7JA 5GS1A 4ZPTB 4Y4FC 3VGEA 5IROA 2EKSB 1C5BL 3HLAB 3SJVA 4NQVA 4J4PD 4OBSA 4Z0BH 4KZEL 3NOIA 3I02A 5EC2A 5T1LB 4GRLA 4LP4A 4X4MA 4F15C 2VO5A 1MJ8H 3QHTC 2ZNWA 1DBKH 5JIPA 1C12A 2WUBL 4OZ4B 1XGUB 2I60H 4FTVB 4F7MB 5F1NA 3QO1A 3ZT7A 1UEMA 1MAML 3RVUD 3GO1L 3MRDA 4ONGH 2AXJA 1AGEA 3AY4C 1TDQA 5EZIL 1I1YA 1NCCH 3FJTA 1R3LA 4DTGH 3GBLA 2FBJL 4KI5C 5IW1B 3QUXC 4K9EL 5LAXB 4KAQL 5CJBA 4MB4A 2BP3A 3WIFB 5IB4B 4NYLA 1JHTA 3BQUB 5TJWK 2AXFB 5DJ0A 2XRAH 4JDZA 5CILL 2VISA 3P4MB 4JO2L 5EU6D 3TV3H 4MZ3A 5DFTA 1IM3A 4GT7A 5I0ZA 3G6JA 5CBAB 1FYTD 5AAWA 1DVFC 1CLCA 2P5EA 5I8KL 3BH9A 1BBJA 2AJ3B 4C56D 2V17H 1QFOA 1U42A 3K74B 1NC2A 2AJZA 3SDAB 1A3RH 1SVZA 2E9WA 4MJ5B 2HFGL 1OAZH 3MJ6A 5KSAC 1ZV5A 1X5HA 4Y16B 4LLWB 3U0PA 2AXHA 2ITCB 1VACA 5B38G 5C07A 3S7GA 4KTDL 4KHTL 1Y0LA 2QADB 3DX6A 3FB5B 5MEQA 1MQ8A 1T1YB 3JZ7A 4YDKH 4XI5C 1H3PL 3MX0A 3C8KA 1FNAA 5I8OH 1YEJH 1PLGH 2UWEE 2YMXH 1S7RB 2FECI 5FYJH 4FQXB 1KB5H 1N0XL 4LVNB 1S7VB 2VERN 3HAEB 5K9JH 3VGDA 2WK2A 3QCUH 3WDHA 1UVQB 1ORQA 4PJIA 4PJHE 1BQSA 5IB5B 2C4FU 4YAQB 4ODHH 4M5YH 3CFBB 3WNKA 5HHNB 3MV11 4BUHA 5JPMB 1DQJA 5CBEB 1KULA 2UYLB 4NQCE 2Z92B 3GRWA 3MOAL 3B5HA 2YPVH 4RGMC 2AXGA 3V6FA 1KN4H 4LQFH 5D1ZD 2ZUQC 4UOW0 3WDJA 4EI5D 2V2XA 5C6TL 4UINL 4LNRA 2DM3A 1WFUA 4XWOD 2FBOJ 1Z9LA 5IFAH 1BJMA 4PUBH 3DURA 2CMRL 1B0GB 4JJHA 2FO4A 4FQXC 4PJAF 3EOBA 1IZKA 2CKNA 5JO5A 3K4ZA 4Q9RH 5B39A 5K59E 3GSVA 2D2OA 4NO2B 4Y5XB 3MLRH 4MD5A 4BUGA 4OM1L 1BAFH 4Q0XH 3RGVA 5KN5A 2R0LH 2AK4A 1I3GH 3U9PL 3CFJA 4X9BA 5DJXB 3DUUA 3MJ7B 4HIXL 4G9FA 4HS6B 5FYKD 3BRGC 1CGTA 3A6BH 4NKDA 1YEIH 4G43A 5DRZB 4HKZA 2X4SA 3RNQB 5D1QC 5GRJL 2J2ZA 3S8WA 3BQUD 4HT1L 5D1ZC 1OD7A 3VE0A 3NPZB 2Z35B 3CH8A 1IBGH 5H94B 3CUPB 2J3SA 5JDJA 4XMPL 4PJIF 5KW9H 3WEXA 1A5FL 5FYJU 3WSQL 1JNNH 1NH6A 3PE9A 4TQEL 1PG7L 4XC3H 4HWZB 3RA7L 3IXAB 5TE6L 2EE6A 2GK0A 2XQYK 3NPSC 4JRYA 2XWTB 4EBQL 5DJ6A 3DMMC 4JKLA 5AYUL 4G7VL 3WO3B 4XP4H 43CAA 4P9MH 1N6QL 4YK4B 2YZ1A 5F93C 1KXQE 5EU6E 1PYWA 1S7QA 4RGNC 1L7IL 4QHUB 3RKDC 5IM7A 4L9LA 5I74C 3FRPA 4KWUA 5DMKB 2NY1B 1MCQA 3GMLB 1INDL 3MOBH 4QXWA 4OLZH 1JWUB 5D6DA 3C2AH 2NW2A 3MV8D 4OCMC 5E2UL 2OK0H 5KSAB 1UM6H 4X6DB 5CHNB 1IC7H 2BVQA 4QO1A 1JP5A 2W9DL 4PJEB 3BPOC 4EOWL 1EV2E 1QZ1A 1OL0A 1OPGL 3VI4E 4YK4C 5FDWB 1HEZA 1JV5B 2R4SH 2N1KA 1AGCA 4CW1A 2XKUA 3O11B 1MJJA 5F3HA 4MWFA 4L3CB 4OFYA 1JN6A 3B43A 1CICA 4G6KL 2E7MA 4Q58C 4IRJD 5DVMA 1DQMH 3DECA 3T4YB 4Q9CA 2CSPA 3SOBH 4NIKB 5C9JA 4JFEB 3BVNA 2X09A 4CL7A 4NP4L 2XIDA 1H5BC 2OTWA 4M8QA 5E70A 2IADA 3OAYH 5DUML 1CGVA 2AJXH 1IL1B 1QBML 4UU9A 3G6JB 2BNUA 3HR6A 5MENB 1YY8A 2CDEA 4CNIA 5CLWA 5IOPA 1HYSC 5D1XB 4XPHL 1I7TB 1M1SA 1CK0L 4HS8L 1OARH 3SE4A 2PYEA 4O5LH 3U4BL 1UA6H 3QEGL 3RGHA 5E2WH 3OXSA 1OSPH 5IESH 3NTCH 1PZ5A 3HN3A 4UQ2A 1RJLA 1NC4A 4BQCA 4TVPL 2H2PC 5ECJE 4Y4HA 4HUWA 1AY1L 3B83A 5HXMA 3C87A 1K85A 4QOKE 4N1CA 3IU4L 2X10A 4K23H 1C5BH 2IMMA 5EOCJ 4CMHC 2ERJB 1ROWA 4MD4B 4UILH 3NCJL 4UDTB 4P4RB 1CQKA 3FB6A 3HAEG 1EEZB 3G5XB 1U8MA 3VXNA 5DRNB 4V1DA 3GBNL 4CVWA 5I73C 1K6QL 3PXJA 1P7QA 4C56B 4UZGA 4F80A 4ALAH 3MFGB 4YXHH 1ZKAA 3SHSA 3QULA 2EDXA 3WL9A 3O6LH 5A3IC 1M05B 4NNXB 1F58H 3LKSA 1NCCL 4LEXL 4RGOH 3HTLX 4R7NB 3EYFA 3RGVD 5I1AA 3U2SA 2FBJH 4JM2C 2YD5A 3KVQA 5BRZA 1WTGT 4PY8J 1DCLA 4PJCA 4A6YA 4PB9H 3T0ED 3TBVA 3ZKXC 4J6RH 2XQYG 3OXRB 4CMHB 2VABB 4P5TC 3S88H 4OUUB 5KSVB 1X5GA 4X9GA 5DQ9B 1QSEA 5AZ2H 1OT1A 3MRCB 4OFYD 2V5RA 3GFUA 2EZ0D 5GS2D 2BVPA 1A6AB 5I74B 3L5WB 2YA2A 1JWSA 3HUJB 2BFVL 1HCVA 2IEPA 1X5KA 1CD8A 3QCVH 5FOJA 3VGBA 1FGNH 3AVEA 1HQ4B 2ATPA 1U3ZA 2X4PA 1TZHB 3MLWH 1L9NA 3FB7B 4ISVB 3WKML 4WO4D 4G6AD 4ENED 3KPQA 1NKRA 1HH6A 4FZ8L 4LVOB 2F8OA 4Z7UA 2DQCL 3KGRA 1UEYA 4ONHA 2UZYB 1J0YA 2OJZH 2F53B 2ZOLB 3TT1L 1W72B 4QT5A 1PW3A 1JHLL 3JV0A 2DYPD 3LKPB 2XKNA 1N0XH 4O2FA 1F6FB 1ZEAL 4NM8H 3M1BB 1A7RL 1DEEA 5D6CA 2P5WA 3PABB 4N8VA 1KB9J 2YS4A 1TZGL 3MJ9A 2PXYB 4L29A 1ES0A 4P57A 2NXYB 5C0EB 1LEGB 3FONA 2BDNL 4M48H 3RVVC 1LHZA 4YE4H 4LIQL 1JRHI 1U8OB 4GAJL 3UJIL 1U8LB 4XXCA 2XICA 3GSNA 1KG0A 4O2CA 2KQMA 4A6YH 2A9NH 3MLYH 5SX4I 1KCUL 4JRXE 4JFOB 2HTKC 1F00I 4OLXH 3BPCA 3HG1A 3ARZA 2YR3A 1DFBH 1NCDH 5AUMA 4MAYC 5BV7C 4Q0XL 5H35A 1QYGH 3VRLE 4YHNA 4XNQA 2FX8L 3NCBB 2QL1A 4HMDA 3BX7C 4OT1H 1JN6B 1FL3B 1I3UA 1X6NA 5AZEH 1CFSA 1RZKH 1LE5A 1K5NA 3U6RB 3QDMA 3S35L 4MXVF 5IW3A 3G6DH 3U46A 5DD1L 4G5ZL 5C3LD 2Y4SA 4KY1H 3BVNB 2H1PH 2YPKA 3GSNL 3GHBH 3BPLC 4PJBA 3RVXC 4LRNH 2ZP0T 1U95B 4W4OA 1NC2D 3GI8L 2YRZA 5KSAD 1B0RB 2HMID 3H3BC 4I18C 3ARED 1OAKH 1TTGA 2VKWA 4MCYB 5TE6H 5BS0B 1I1AA 2EE9A 5DURB 3IDIA 4FTVE 2KL6A 1G84A 4YC2C 1QFUH 3MA7B 1MREH 4DGIL 3JV4A 1LO4H 1U8IA 3M8OL 4D9RE 2DTML 3B9DA 1ADQL 4UIMB 3B3IA 2Y36L 3NFPA 2PW2A 1L7IH 4DVRH 4JFZH 1HXYA 3GZKA 4R9HA 3D3VE 4PJXE 5DVNA 1RIHH 3H9SE 4GG6B 2EDNA 2CRMA 5HI5C 1AGBB 2FIRT 3LB6C 4JLRA 5IGXH 1T20B 1X7QB 1YN7A 4PRBA 3HMWH 1BFSA 2X70A 3WFEH 5DJ8A 2EC9T 3RVTD 3FB6B 5CWSB 1U8PB 3ZDXE 4EN3A 3CD4A 4Z7OF 5C08D 3ZSSA 3BDBA 3JVGC 5T3ZH 4QRRB 4GW1A 5DVLA 1L0QA 4MB3A 4KQ4L 2D31A 2H9GA 3RDTC 3P30H 4X9IA 1WFNA 4K71C 5K33A 2VDOL 4OJFL 1XCTA 3P2TA 4NJAL 2EXYC 1EEYA 3K81A 2ICEB 3SKNB 3LKSB 3GSWA 4FFZL 1CWVA 5E2VH 4OCXL 4YPJA 1F4YH 3ARFB 2V5SA 4WVRA 4HDIB 2HRPL 4RMUA 5IFHH 4RQQB 4HSQA 3VFRB 5I2IB 1O5DT 1U8HA 4KTEL 2O5YL 3QQ3B 3IFLL 1G6RL 4X4XB 4PJ8D 3RVWC 2V7HA 1U41A 4ODTL 2DN7A 3D9AL 1FYTA 1QSEB 5F7EH 1FCGA 3MRQB 2YD9A 4PJDF 3QZWB 5FCSH 3MRCA 5DHVB 2NXYC 1G9NC 2EIBA 5DQDL 4OLUL 1NGWB 5BV7L 3OKLA 1JWSB 1FJ1B 2AEQH 1DBAH 1BWWA 3GJFK 2R15A 5F6IB 1HHGB 1EPFA 1OARL 5KSBB 2J4WL 1U0QA 3KLHD 3R1GH 3CDFA 3MR9A 4WFFE 3RL2A 4G8IB 5T5FH 3BO8B 2PN5A 5IESL 4OIBA 4RWYH 3KXFB 1FZKB 4IDJH 1WBYA 4L4VA 4MXWL 3UJTH 2BSSA 4TVPH 3SKMA 3NBNA 3MREA 3DYMA 4YDJB 5E94A 1J7VR 5KANG 4DUVA 4AENB 3EDEA 3MGTA 1ZLVH 4QOKD 4OUOA 1M7IA 3NIDE 2XZCL 5IMMA 5AAMA 4D0DA 3KWWA 2DLHA 3WS3B 1BF2A 1J9CT 3GGWB 1M7DA 2GJ6A 4UUJA 5JNYA 3BJLA 3FQTB 5MEND 4TUKL 1ZLSH 4TNVK 1GOGA 1P7KA 2P5WB 1TVHA 4LLMA 4JN2A 4KRNA 4P4KA 1GOFA 2DQFB 4XP9L 3FTGA 4KUZL 4WO4B 1FFOB 4UNUA 5DUPL 3AXLB 5CEZL 4F57L 4JVPA 4HJJH 2V7NA 5C0RH 1EDQA 2N7AA 4PB9L 5T1MA 1T04A 3NZ8A 4OQTH 1Z9OA 2J8UA 1S8DB 2OP4H 4HH9A 3V6OC 3BGFC 2F5AH 3F7RA 4NZRL 5TE7L 4LCCC 3QEQD 1T7WA 4WNQB 1IGTA 2P7TB 3SCMD 2NZIA 4XGZB 4KKLC 2NY4D 4IRJA 1WCBB 1CG9A 3TBSA 3STLB 1WWCA 4HWBA 4NN6C 4LSUL 3L5IA 3FRUA 4X6CA 4YFLF 2QSCH 1T7XA 2BC4B 2NX5D 3BGMA 4MX7A 3S5LG 2G2RB 5C1MB 4XMLH 2FECL 5FHAH 4WO4C 5SWQA 5HDBE 1MLBB 1X4XA 3ULVC 4DJMA 3RAJL 1CFSB 1LE5B 4L3EB 1X5YA 4CAGA 4NRYB 3U46B 4JPKH 3WKMH 4J3XA 3VWKC 1KGCD 3OPZL 3R06A 1CVRA 3OHXA 2FL5A 3F5WA 2EC8A 1JF6A 2IAMD 2O5ZH 1NFDA 4KXZI 1NEUA 1TVBA 3MA9H 3MRMA 5C0BA 5ID1A 2VDRH 2G75A 3TA3B 2FGWL 1V7ML 4YBLC 3G6JE 2OSLA 4X5XA 1I8MA 4E42A 2GKIA 2NXZB 3JWNC 3B9KA 3BDXA 4XCYA 4NM8L 2LV4A 4LLYA 3QISA 1VFBB 3UTSD 5LQBH 3GI9L 5E08L 2Q3ZA 4M6MH 1J05A 3LRSA 4X9FA 5D1QA 1CU4L 1MIMH 1KCKA 4AIZA 4YX2L 2YEZA 1S5IH 5EC1A 3VA2C 5GGSB 3VFUB 2PW2B 4HXAH 4BJLA 5BMFL 3U36B 3V4PH 3BH8B 3MTRA 3LQZB 1AIFA 4NWTH 5LVEA 3AAZA 5IEHA 3OKEB 5DK0B 4C54A 4IJ3C 4CJ0A 4EXKA 1YPZB 4OLVL 3K0WA 3UJIH 4OV6F 3IAGC 4RGNE 3ZYIA 3T8XB 1IAMA 3SPVA 4HIIA 5FGBC 5EU5B 4KKAC 1KCUH 2FJHB 5D70H 1FIGH 2EIDA 4G9FE 1YMMA 4KI1A 2XZAL 1G6VK 1X5LA 3MRLB 4GW1B 3IDGA 2NZ9C 4N9OB 4G42B 4ZFOB 4HULB 2X4TB 4HV8B 4RBPK 5D7IA 1P9MA 4HJGA 4W68A 3K4DA 2QKIB 1C8PA 4RGMB 4HGWB 1U3HB 5AYQA 3ULSB 4MNGA 3TN0B 1KEML 2CIKA 2D7TL 4PRPA 3KYMA 3OKOA 4Z7VB 3CXHJ 1MNUL 3VH8A 3WFHA 2HYMA 3NFSH 3LIZH 5T1KB 5FKAA 1MHEB 3KYNB 4LLQB 4P2YA 1LO2H 4RA3A 3THMH 4Z7QF 5EU6B 2GIYA 1NGXB 2V7HB 1ED3A 4LRNL 2EYRB 4JQXC 2VZUA 1G7LA 5DD5H 1RZFL 4BK5A 3PDDA 4JFYB 2EYTA 3UTTA 4X7CC 3SEPA 1S7XB 3SDAD 1N5AA 3MRHB 5L0QB 3Q6GH 3GDBA 3AMLA 3MYJA 4G7YL 5L2KD 4GXVH 1CGWA 3ARDD 3KYAA 4DGIH 2Y6SD 4GJTB 3EGSB 4F58L 4MA8H 4NQXB 3HC3L 1N5YH 4Z7VE 3EUUA 4Y1AD 3QDGD 3BYYA 4HCRA 1AXTH 5ADOL 1FIEA 4YDJA 4BH8B 4Y4FD 3VXOB 5JOPE 2P5WD 15C8L 4HUMB 3EFDH 4R97B 1MCOL 3VFOA 3PWPB 5DYOA 5I1CH 4CVUA 4WV1A 2X4UA 3BKCL 3WFEL 4XNZC 1EFXD 5IHBA 5E8NB 1A6UH 3MBXH 1T0PB 5EBMB 3F7YA 2CRYA 3O2VL 4X6CE 3V5DA 3S35X 1REIA 1BX2B 4UT9H 4TSAH 3STZB 5J0BA 2XN9E 2VSDA 1T5WA 2ICWA 2R0KH 1GGIL 4G8EA 2ZUTA 2CLVB 1UYWL 1IM9A 1CLOH 2P5ED 3QWRA 3IRPX 5HHQA 4M1CD 4JM2D 5D7JB 4F7EB 3OAZH 1HOCB 2R29H 4L4TA 5ISZE 1MPAH 2KH2B 4PREB 1XIWD 2FEEL 2A77H 1OGAD 2FATH 4KC3B 4LNVA 3TJEH 4W4OC 5E5RB 4KTEH 2VB5A 2KZ1B 3IFLH 4I3RH 4M1CC 4U1NA 3SDYH 5F7YC 1TVDA 3BPOB 1WF5A 4ODSH 4Y5VB 3KNBA 5F3BB 1JZ6A 3RU8L 1QLEL 1XCQB 2CPCA 1CBVH 1KCLA 4IMKC 1OT2A 4IIQA 4WW2C 5DEGB 1FFQA 3O4OB 3T77B 5JPMA 2AJSL 4K3JH 5HHOE 5KS9F 3P9WB 4JQIH 4ETYA 1YEHL 1YPZF 3MUHL 5EU7C 5J12B 1BZQK 1MLBA 4HUNB 5F7UA 4I0PC 2NY7H 5F9AC 2I27N 4LNRB 4UNVA 2E27L 4ZFOL 1A6PA 5C07D 4PYHA 3R0MA 3MFFA 1HHHA 3VXPB 1UG9A 2FYYA 4M7LL 4E9LA 5CJOL 4MXWH 3UJTL 3DBXA 1KJMA 2ARJA 1HH9A 1S9YA 4I48B 5EO1B 1RVFL 2V6HA 5E24E 3PF2A 1NFDB 1Q0XL 2OM5A 4DGYL 4KROD 2VUYA 2R0WH 4JM4H 5KSUB 1F4WL 2XZCH 3DGCR 2W59A 5DJXA 1WVZA 3SDCD 3QUKB 3SE8H 4YHPB 1P1ZB 2ZSWA 4V2CB 2LABA 4TUKH 4BFIA 4HKZB 4NNPH 4PJEF 5KG9B 4LGPB 3RNQA 4HQQL 4UTBH 5MI0C 3B8SA 3DGGB 3VXQB 1ZS8A 4OGZA 5F9JB 1RZJH 3VE0B 4PY7B 4XP9H 4KJYA 4QHNA 2EDOA 2PR4H 2IFFL 4QRRD 4PLKC 5KVDH 3JSSA 4K8RL 1S7WB 4Z8FL 5DLML 1VPOL 2BNQD 4DOHB 1DLFL 1CGYA 3WLBA 5F7NC 1EGJA 2NY0D 3U30C 2AV7A 3QWQB 1SQ2N 4K3EH 5JMOC 3SPVB 3IDNB 5FYLD 5LBSL 4Z7WB 2GFBA 3GK8L 3DXAA 4Z7WF 5CINL 1OM3L 1YMMB 4PRID 4YHLH 3VXRE 1LDSA 5EIVA 1NGPH 1PYWB 5E4EB 1IQDA 3UTZA 5DSCA 1UWGL 1NUFA 4HV8A 1QLFA 1J0IA 2EIZA 4NQEA 5DD6B 1S5HA 1YYMH 1RZ7L 1EMTL 3MJ9L 3GMLA 2EDFA 1FVCA 1U91B 4RRPG 2VDKH 5T1KA 2VDPL 3LH2H 2HT4C 8CGTA 2VXUL 5I66B 3EJZC 4X4YA 3I02B 4OCSH 5L2KB 1NAKL 3UTOA 3ZKND 3WFCH 4E41D 4PJEA 4TTGA 4XNMA 2Q7YB 2VXVH 2A83B 1MJ7H 4RFNC 1J86A 4PRDA 3QXWA 4R26H 1DBBH 2W9EL 1J0KA 3QDGA 5E6IC 4QKXB 3ARGD 1Z9SA 2XWJB 1F90L 4GQPH 2IBZX 1O0VA 3IFPA 5D2LA 3ARDA 5LXGH 3MLXL 3RWFA 5ICZA 2FO1A 4Y2DD 5SWZD 4M6ML 3GSRB 5HVGB 5GS0H 4UIKL 1SMAA 2ADJA 4YX2H 1NL0H 1AE6H 1TCRA 5C92A 3ISWA 3HCVA 3WXVL 1YYLH 2OTWB 4M8QB 4EKXA 5BMFH 1WIUA 3EHBC 5KVGL 1N4XL 3ESUF 4KDTC 4KROB 4NN5B 4UU9B 3HNSL 4XPGL 3IKCA 4XVSH 5E4IA 4M7ZB 5EU4A 1J8KA 2ZPKH 5D1XA 2QHRL 5C08A 4X80L 2NR6C 2AJUH 5I76B 4GBXB 4LCWD 4XB8A 4NRZB 5D7LD 3CH1B 4XPAH 3QUZC 4LSQL 5ID0A 1YEEL 1OAYL 3STZA 5J1AB 2XN9D 1XR9B 4OSUL 5EA0H 1AD0B 5E8OB 4LLWA 4YFDB 3IFOA 2PO6B 3CX2A 2BNRD 3RUGA 4LCUB 5FV1L 1AGFB 3SGDI 1KLUB 4IRJC 5E8EA 3X3FL 3CDYA 3VXSE 1CN4A 1YJDL 4L4TB 4M1DH 5HI4C 2E8YA 4WTWA 2FGZA 3T09A 2DLEA 4QTIH 3I75A 4LVHC 3THML 5JOPD 1S7RA 3Q5OA 4P2OD 4OZIA 2NY6D 4FXLA 1I1FA 3TBYB 1QLRB 2OL3B 3WIIH 1M71B 2IGFH 3HAEA 1SY6L 5FKPB 2VITB 3HR5B 5CEYB 1RZFH 3CZFB 2JLLA 1UVQA 2HT4D 4DN4L 3QULB 1E4JA 4ODVL 3WL9B 3T77A 3QQ9D 2PYED 4HWUA 5IMKB 5HHNA 3FHAA 1P84K 4Q9BA 5HI3C 5C0GB 5CZVH 3QFJA 4GG8A 4S1SH 3UTPE 6CGTA 1KTLA 4F58H 1H9VA 4U1JA 4OTXH 3EJJX 1EBPA 3MPCA 4EDXB 5BXFA 5B3JF 1W0YT 2GHWB 4PV8A 1HKLL 5FB8B 3RJQB 5KSVA 2HFTA 4PGDA 4U1LB 5BZDA 3K80A 3GSUA 3VWKA 5K9OA 4YR6B 1HH9B 1S9YB 2JK5A 4I48A 5J11C 3MZTA 4PJ7A 3RTQB 1PFCA 3KYOA 3BP6A 5FA4A 2MNUA 4AEHH 5C8JA 5CSZB 3LCYA 1MCOH 2EH7L 1KCVL 4PJFE 3BW9B 2Y9RT 3BKCH 1WV7T 3HUJE 4JRYE 4P49A 2IFGA 1A6UL 3MRRB 4LBEB 1FH5H 2VUOA 4LAQL 3MBEA 2Y06H 1ADQA 2C3HA 3MJ7A 3DI2B 4WHYG 1NGZA 1P5UA 4D9LH 4L8CA 2ZJSL 1YNLH 3CCHB 3SDDC 6FABL 1XZ0B 2NXYD 1ZVSB 2BXZA 5FXCH 1UT9A 1AKJB 5A3ID 4NHUA 1GGIH 4H0GA 4TSBL 4IOIB 1U36A 2WINA 4NO5A 1CI5A 3NMEA 3QAZC 4M9PA 3SDXB 5H94A 5GIRA 1C7TA 3RWJA 2XY1A 5DI8A 3TPKA 1RY7B 1P2CB 5EH1A 3KDMB 4QHMB 3IU3A 2YN5A 3IDNA 4EUPG 2PETA 1RUPL 5TDPB 1CQYA 2HMIC 5I18L 2VE6A 5T1KD 2XWTA 3RU8H 4WTXA 2CXGA 3H6JA 2VZ1A 1AQKL 3BAEL 4HC1L 3GB7B 1MCFA 4W6WB 2UVFA 3U0WL 2DLFL 4DKAA 4K2UH 3IDJA 3CC5A 4ACPA 1QRNA 4TN9A 3VGAC 3BD3A 5F8RC 1UM4H 2MHAB 3NAAL 5JIIA 3TT3H 2JCCE 4R96B 5FIEA 5CKAA 5JOFA 1T2XA 3S98A 2VKXA 5I1HH 3QJHA 5F96H 5HJ3A 2HT2D 1HXMA 2BCKA 5E7BA 1R0AL 2VL4A 1T03L 1RVFH 4XC1L 4XNUL 3OR7A 4AL8H 5HHOB 1Q0XH 2A83A 3PQYD 1MRDH 4MQXC 4JM4L 1T3FA 3OKMA 2VXSH 4L9DA 4QRTB 4OCYH 3Q6FA 3SE8L 4X6DF 4BELD 4PRNB 2VDLH 3VGHA 4MWFB 1LO0H 3BIBX 1T21B 5JMRA 2I07A 3H42H 4OD3L 1FP5A 2OR8A 2FX7L 3IT8D 4WUUB 2DL2A 3D39A 3GRWH 4MSWA 5HY9A 2HJKB 2OR9H 2AEPL 2IFFH 5KVDL 1IKFH 1XGRB 5GGTL 3LV3A 4YNYA 2FD6L 3H9ZA 5F7DA 3BMVA 5T3XL 1TCMA 2DM2A 1DJSA 3MODH 2NTFA 1NCNA 4AT6A 4E41B 3NIGE 1K8DA 2EDTA 4MQTB 1AXIB 1J1XH 3BQUC 5CCKL 5J6HB 4I2XB 1KIRB 4MCYA 4K3EL 5LBSH 3QH3B 5C08B 2FSEA 1QSZA 4GBXA 4LCWE 1RIVL 2YBRA 5CINH 1OM3H 5ITFB 3LKNB 2YK1H 1MEXL 5LAXA 3OAUH 4GQ9H 1JPSH 3NFPB 4BQ6A 1MWAA 5B8CB 5TQ0L 3B5GA 1EVUA 3IFOB 2PO6A 1UZ6E 1GAFL 3V4VL 3PGCA 3MJ9H 2MOVA 35C8H 1GZQA 4ZUWB 5L9DL 4B53A 2CK0H 4X6BA 4JLRB 4MDIA 3ARVA 4OLWH 3CFEA 1TIUA 4FG6D 5SWZE 3RVUC 5C0JA 2J8OA 4N90E 3WJLC 3TIEB 4ZS6C 3AB0B 2VXVL 1BQHB 4G8GD 4EJ1C 1Q1JH 3O0RL 5I17B 3T2NL 3PJSB 2WMPA 4Y19A 1RURL 1VADB 3FAWA 3D1MC 4FFWD 1JF5A 4KKAD 1MLCB 4O58L 5LXGL 2ITCA 4DAGH 3DHMA 4ZYKA 3DX7B 1QHPA 2X5PA 4HDIA 5ILTH 3MRNB 5KAQG 3TYGL 4EDXA 5BXFB 4PLJC 2RR3A 3WXVH 3RVVD 1JHKL 5J6GA 1R3IL 4YZFE 4XMKH 1NKOA 2X7LB 2XNAA 4YR6A 4NOFA 1I8IB 3HNSH 4XPGH 3E2HB 1I7ZB 5FOBA 3D2UB 1SEQL 4YHZL 2QHRH 2VDML 4OKDA 3BW9A 2RFXB 1A1OB 1K4CA 5ESAA 1Q9KB 1IGFH 2VIRA 2WBJC 4YPGB 2EECA 4N1EA 3S37L 3MBEB 1DDHA 4S11A 4MJ6A 1X44A 1DTUA 3U4EB 1NGZB 2ARJQ 5IWLC 2XQBL 1DUYB 1OAYH 4YBHA 1G7MA 4FQIH 3QWRD 4ISVA 3QXVA 3WFBL 1VEPA 1AFVH 5GRVK 4NO5B 3QCTH 4IJ3B 4NJ9H 5SV3A 4KKBD 4ORGA 3GMOA 1IC5L 2A9MH 5I9QC 1RU9L 3WN5A 3L5JA 3CDCA 3TVMB 3RGVB 4LPTA 1P4IL 5IMOA 4RMVA 1JK8B 3QA3A 5LKNA 3CFJB 2EDDA 4NQED 3O6KH 4OQTA 3ULVL 5FUCE 1SEBA 1G1CA 2IGFL 1TVHB 2VDQH 3PUCA 4LLMB 2QTEA 3PABA 3C5JB 4ODVH 4NWUL 1AC6A 2ERJC 3L5HA 3TP4A 2IANE 4HD9A 2IAMA 4YH6A 3L9RB 5CZVL 4QRPD 5ERWB 1GPOH 2RB8A 3NZ8B 4LSTH 3MRJA 4OTXL 3ZE1E 3PP3H 3QPQC 2VNCA 1F2QA 4H0HB 1EO8H 2OTPA 1QSFE 3MV8B 4J4PA 4U1HA 3HZKA 5DTFA 2XTJC 1CYGA 1PG7W 3RNKB 4FQCH 3RBGA 1T7ZA 1BVKA 4M4RA 1FNEA 1QKZL 5DRXA 4JM2B 5D7JD 3WUWB 3FRUB 4MZ2A 4OFPA 3P0VH 4GRWE 5E2JA 1YEGL 2JB6A 3QJFB 4KVNL 2L4OA 1CGSL 2FEEI 4M9OA 3RWCB 1EXUB 3EJYC 4CBPA 4XNQB 4PRNA 1J87A 4GUPB 3H9SB 3BT2H 5DD0H 1A7PH 4XZUA 5TPWH 4A2LA 3D3VB 4CN6A 3ECBB 4GRWF 4JKPL 3OZ9H 3MRFB 4NRYA 1UXWA 4P5MB 5TQ2H 3PGDA 4D3CH 1N0LA 5HI3D 3FOLB 2XY2A 2C3GA 4O2EA 3NACL 4PD4K 3FQUB 2YZ8A 4AM0A 1MCNA 5J57B 2YPKB 1XR8B 1AQDB 4JR9L 3C8HA 2O93L 1NGYA 4OD1L 3T3PF 1WJ3A 1IFHL 5CJXC 3C5ZD 3FRPG 4S1DD 1U95A 4MMXC 3GJFA 1NFKA 4XPFH 4QGTA 2HH0H 4ZQKB 4MXQC 5FDWA 5JHLL 1KLGA 4OZFH 1OAQH 3BI9X 4RFOH 1RUPH 5BS0A 1MWAL 1AP2B 4LLVA 1NAML 4NM4L 5ITFA 1CICB 1X5XA 3GJEB 3DWTA 1AQKH 3BAEH 4AIZB 4K94H 1JCKA 2Y07L 3KLSA 3EZ8A 4BYHA 4F3FB 4HF5H 3U0WH 3RIFF 3I6LE 3U36A 3KLAB 2NY2B 2P24B 3VG9B 3U82B 4QXGH 5IK3A 1XT5A 3AAZB 5IEHB 5M94B 2VXQL 1U2CA 1RMFH 3I6KB 2P42B 5AEAA 3CVHH 2C3WA 2R2CA 5HHPB 5MENA 5IOPB 3IJSB 2MQ0A 1LQSR 3QIUC 2YA0A 4Y8DC 4PGJA 1NGQL 5GQBA 2HP4A 3BKJH 3A0OA 1YMME 3HG1E 3PDGA 1BQHA 1JFQL 3TN0C 3NIDF 1MRDL 5SX4H 3QWOA 3ARBD 1HILA 2D31B 1A6TA 3PJSA 4BSWB 1W0VB 5GS2H 1MFDL 2WQ8A 3H0TB 3S6CA 2BMKB 4OZGA 5FFLA 1KJ2A 1XCTB 2DRUA 3WXWL 4MGXA 5FUZL 4WU7A 4JG1H 1KCSH 3L3KB 4X7DC 2YRLA 5FKAB 4XCCL 1ETZA 5DF0A 2FX7H 1PY9A 4U1KB 3O3BB 3MRPB 5IBUG 3WIHL 3I50L 1MFCH 5EB9A 1U8MB 2FD6H 1UKTA 4G6JH 3BD4A 4PR5B 2FJGB 2I5YH 3HI1A 3RFZC 3NH7H 1KIPB 1JYNA 1NMCC 2YD6A 4XPTL 2H32B 5EZOH 2NNAB 2HKHL 4YHMH 4N0UB 3NABH 2AP2A 3GSXB 1Q9KA 1M05A 3GO1H 1VGEL 4H1LB 2P49B 7FABH 4HW6A 3IJHB 1TPXC 1FFPB 2YRPA 5D7LE 3SY0B 3BDYH 3Q0HA 1WEJL 3MR9B 1BLNB 4K9EH 3RL2B 3TBVB 4H5SA 3PNWA 4KAQH 4OBRA 1YMHA 1P4BL 4N1HB 4GG6E 4HBCL 4ZUUB 3E1F1 3ARGB 4JGMA 1HDMA 3EOTH 4PJXA 1WBZB 2XRAL 4TVPE 4HUVA 3QUMH 1NUNB 2CK0L 4JO2H 4H26B 2X4QA 4P23C 4PJFA 1M7IB 5IMMB 4GAYB 1A6AA 3T65A 4OZGF 2OL3L 1DBMH 3O45A 4RNRB 3IETA 3O3EA 5JNYB 1ZA3B 4PJDA 5E4EC 4MAUL 4MAYD 3E8UL 4OCWH 2V17L 2CKBH 1JI1A 1N6VA 1T4KA 3NZHL 4FXGB 4OCNC 5GGUA 3O0RH 1ZT1A 4G8EB 1F3DH 4KXZH 4P4KB 3VFPB 3S37X 1RURH 2Y1VA 25C8L 1FG2A 2I25N 4O58H 1XIWC 1HHIB 1IEBA 2C9AA 4DAGL 3A6OA 1WWBX 1F4HA 4S1RL 4Y1AA 3L3HA 1U9KA 4P9HL 4M6OL 3QNZB 2F53A 4P23B 1T6VN 2NLJA 1RK1B 4OFIA 5FCUH 4K9EC 3MLSH 4YDKL 1H3PH 2EH8L 4U1HB 5EBWB 2F58H 5I8EB 2HN7A 1V7NL 5DTFB 4Q9QL 1UACH 4P9HC 2GTWB 1FYTE 3O3DA 3M1BA 3F7QA 4JDTL 1WCBA 5DRXB 5EOTA 1SEQH 2PTUA 4JDVB 4RWHA 4TTDC 1A7QL 1JYVA 2AERT 1BVLA 1LEIB 5B21A 3TIDA 3RWCA 4HUKB 5DZNA 4GLRH 1QSFB 3D3VA 2HRLA 3UROR 3LN4A 4Z0BL 5E56A 4FQIL 1RUMH 5I1LB 4FRWA 1FZOA 3LD8B 4S1QH 4JZJA 4H8WH 3MV9D 1AI1H 3KS0H 3CFCH 4ZNEE 2VR4A 4M7ZC 2Z4QB 1BWMA 3DSFH 2L0DA 1NEZG 4XCNA 4JJ5A 1EA9C 1MAMH 4P3DB 1RFDL 4P99A 1JGDA 2ICCA 3ZE0E 2V9QA 3WE6A 3ZDZE 4MNQE 1I8MB 3MROB 4DTGL 1FC2D 4WCYH 5F7HA 5DO2D 5FYKE 5I8CA 4HIXH 2VDQL 4PJ9B 3L7FB 5GSVA 1DR9A 3DGGA 2FHBA 1IAII 1MI5E 1T7VA 1LE9B 3M45A 2E7BA 4NO3B 4YO0B 2MWCA 5JUEH 3UDWA 2IQAB 1J12A 4LSVL 5E1AA 3QYCA 5GGSA 1SJHA 3TV3L 3G9VA 1S7UA 2ARWA 2P24A 1RUQL 4R2GB 3HE7A 5C09D 1ZLWH 1TXKA 3FFDB 1CTOA 4XMPH 5F1IB 3A6CH 2BVYA 5DS8B 2WIMA 4HIIB 4Y19D 3GNMH 5CEXA 2ED9A 1JGEB 3C6LC 4M4PA 4XC3L 1G9ML 3INUL 3OQ3B 4X8XA 1MIEH 2WBKA 3FQRA 4V1DD 5DRWB 3MA7A 1NJ9B 3JV4B 3PWPE 4K3HA 1H15B 3AS1A 3IJYB 3LB6D 5EZJB 5AYUH 2C1PA 1EZVY 3LS4L 3QWOB 1PVHA 4J3OC 4U33A 5ELIA 4WWKB 3FCTA 2AKRB 1GXEA 3H7BA 1OW0C 5D7IB 3LS5L 4XXDA 3DO7A 2B4CL 2DDQH 2GITA 3L3OB 5IVZA 5TPWL 3L3KA 1BFVL 4OFDA 5D71L 5GRXG 2DQEL 5DA0B 4GW4B 4MLSA 1KB5L 1T1ZB 1CS6A 4OLZL 2DQIL 3REVA 4XXCC 3O2DA 5EU6A 2F8XC 3SDAC 5EUOB 5ISZD 5FO7A 3ULUC 4O9HH 3LN5A 1YNKL 3T4AB 3IVKB 4NZJA 2R1WB 4LMQE 3DLQR 3MMEB 1FVDA 2XFXA 4YIQA 4XPFL 4X5WB 4UQ3B 4P2OC 2W9DH 4EOWH 4NNYB 1OHQA 5HDLA 2YUXA 1YEDA 4I0CC 4WWKC 4WI2A 1QVOA 2Z8SA 4FQLL 1PBYA 5FK9A 3MOAH 2ID5A 1AJ7H 5D96C 1X3DA 1SMOA 3GSRA 5L6YH 3NVQA 4AK1A 4RMTA 1WUNT 3OR6A 5F6IC 3TA3C 3QFDB 4Q9RL 1BBDL 4X7TB 4K7PX 4YHOL 1V3JA 2EKJA 2BX5A 4QXGL 2WUCH 2X9WA 4KJPD 2VXQH 3MLRL 5H2BB 3X13B 1RMFL 4OM1H 1BAFL 4PJFB 3CAFA 4TUOB 3ARFD 1YUHA 3CVHL 4M1GH 2AABL 1CFNB 4FQ2H 3AU1B 5GGQH 5J3HC 1KIQA 4MAYA 2OZ4A 4F15B 1HHJA 4LHQB 3UJJH 1R3KA 2PTTB 1S9KC 5GRJH 4EEEA 1K8IB 4ZNEA 3U4BH 3F6LA 4E41E 4G8IA 4HT1H 5DA4A 3CXDH 3I3DA 3U7YH 2QSVA 4HEME 2DJSA 2YUZA 1AXSB 1FG2B 3MV01 1FO0A 1UWXH 4BFEA 1HHIA 1IEBB 4KJWD 5IHZB 4QHKI 2GK2A 2RQ8A 2DLGA 3RA7H 1J0HA 3WHE1 3VW3L 5LG1A 1HIMH 2NX5B 1FSKC 1HI6A 1ZSDB 2B5IB 5DK2B 2UY6A 4GO6B 1M71A 1HCFX 2P5WE 3NCJH 4G7VH 1A14L 2VITA 2APTA 2BVUA 4UDUA 3CZFA 4P9ML 1ODAA 2GTWA 1QRKA 2JKXA 5E99H 4CVXA 1A1NB 4HMEA 4U3CA 2IALB 1KBGL 3G5YA 1Y6MR 4HJ0C 4BFGA 4O51B 4XI5D 4LK4A 1INQB 3EJZD 1BVLB 3RDTA 3R8QA 4M7KL 4TPRH 4JANA 1VGEH 4ZUTB 2AJVL 3L3GB 4X6EA 1INDH 3MOBL 2NCMA 3QIBD 4F9LA 1EJOL 1F58L 4LEXH 4RGOL 5C0AA 2ENYA 4ETQA 4PTUA 2W0FB 1FZOB 3DVGA 3X12A 1WZKA 4BM7A 3HAEH 1E4XI 4JHAH 1KJMB 4OFVA 3SGJA 4FQPA 4F37K 3QUML 4PJ9D 2P7TA 1GRWA 5CSZA 5F97E 5IJVB 1KC5L 1CG9B 4NUGH 4HWEL 3HI6H 2R2EA 4OZHB 5IQ9B 1YA5A 3MRRA 1EAPA 4LBEA 4MA7H 1AD9A 3QUKA 3WN5C 1F13A 2BC4A 2EIEA 2G2RA 1P1ZA 2ZSWB 2AJYH 4R2GD 3CK0L 5KVMC 3EAKA 4I3GA 4G9DA 4XVJH 3UTSE 2WQRA 3EOAB 3D0LA 5CP3A 4KMLB 4WHDA 1OSZA 4IMLA 5EO9A 1KFAL 4Q2ZA 2MSPA 3C9NB 1Q0YL 3OHXB 25C8H 4KJYB 5E1AB 3QT2A 1NPUA 4CKVX 5DHYA 4NQTA 3JV6A 2CLZB 4M6OH 2DQCH 4DKFL 3MLZL 4X5XB 2YWYA 2GFBB 3WLWC 5HYFA 4O5LL 3BKML 2ED8A 5FHBL 1DE4B 4HS3A 1ZEAH 4LARL 4X4ME 5KBNC 1ORSA 1IQDB 3GUTB 3CC5B 5EC1B 2C7UB 3GMMB 4JFFE 3S96A 1TZGH 2MHAA 1BFOA 2ZOKB 3ME0A 3GM8A 2R1YA 3CNKA 5JXEA 3C5SB 1AIFB 1LO3L 5JOFB 2GSIB 5DK0A 1U8NB 4NZUH 4UILL 4YHYB 1YQ2A 5DWUL 3GIVB 3O9WD 5HYJA 4GRLB 2FJFB 3BPLB 4PRAB 4MXVE 3PWLA 4PV9A 2A6IB 1E6OH 3CX5K 5FO7B 2CKBB 4I5BB 3PGFH 4G8GE 3MQIA 1C08A 4YXHL 4L9LC 4ELME 4Z7WE 3GSQA 3L6FB 4MXQD 1FVDB 5GS3A 1KSRA 4QRTA 3PP4L 1HQRA 3O6LL 5CSGA 4ZFOA 2X4TA 1DFBL 1NCDL 3MRDB 3BRFA 1V05A 5HGBA 2QKIA 2CLRB 3FQNB 4PJ7F 3V5KB 3MJ8A 2GAZA 4OKVA 4ZOBA 2FX8H 4I3SL 3D0VA 1S9VA 4Z7VA 3D39B 3QXTA 4L4TE 4MSWB 4M43L 3U7AA 3TWCL 4NYLB 1FNGB 1SJXA 5E9DE 2VISB 4OZIF 3GSNH 4FQJL 3STBA 4QNPE 3K2UH 1JBJA 3MLVH 1K8DB 3HS0B 4GLRI 2QLVB 2E7LA 3LKRB 5D2NB 2BFVH 3QH3A 5C0BE 2G60L 4WJ5B 1F42A 3QCVL 4PG2A 2A0LD 1CFNA 5IBLC 5EWIL 1OAKL 1UB6A 5GGRB 1BBJB 1ZGLA 1P7QD 4JGJA 3ARXA 4RX4D 4DN3L 5ID0B 2PTTA 3S9DB 2X40A 5IUSA 3EYUL 4MD0A 3LS4H 1A6VH 3O4LB 4XP6L 2DTMH 1UC6A 2DMCA 1PG7X 1I7RB 4FQQB 1JUFB 4NC1C 1VACB 1XIWA 2DDQL 3RUGB 2R1XB 2J8HA 4JFZL 5K93A 1RJZB 2OJZL 1RZJC 4D9QD 3ZTNL 4NQCA 1T5XA 3RWGA 5IIEB 2DQEH 4YHIA 1W0WA 2EDQA 3ZT5A 1CE6A 3QIWD 5D7JC 2PXYD 1U6AL 1MFAH 4LSDA 4HKXB 3BUTA 2NTSP 5DJCA 1A0QH 3RP1A 4LFHD 5HYSA 1BJ1J 3DMMA 3HR5A 1LVEA 4JVUA 4MNQD 4AMKL 1BX2A 3Q1SH 2IALA 4M7LT 4XHQA 4X7EC 3GBMH 1O7VA 2V5MA 3P30L 4R8WL 2XOTA 4DKEL 1AJ7L 5HYJD 4OJFH 2MMXA 2R8SL 1ZA6A 5A16B 1HOCA 1AC0A 4NFBA 4FFZH 5E2VL 5IBUB 5L6YL 4MQ7B 4XH2B 5E6IB 1NBYA 1F4YL 4YZFF 4CMMA 4XCEB 2IANA 3HNVH 2UZIH 3TBWB 5DO2C 1EIBA 2O5YH 4HMCA 4K94C 2WUCL 4WTZA 1T2JA 4M6AA 1I7UB 1MF2L 2JK5B 2HFFA 5FOBB 3D9AH 3V52L 1T1XA 5CD5D 2GI7A 3AM8C 1SBSL 1ZTXH 1QQDA 3EOYG 5IQ9A 3VXRB 2AK4B 3VU2A 3H9YA 3DX8B 3OB0H 5TE4H 5B38A 4FQ2L 1KTKE 2Y25A 3ULVF 1ZT4A 4NKDB 4BSVA 3UMTA 1A64A 4L8CB 3D0LB 2P8PA 4G43B 5DRZA 4KY1L 2BHYA 1T89A 4QY8B 3GHBL 1AKJA 3GHEL 3QG7L 4UBDD 5T5FL 1C5DB 3HE6A 2H6PA 3WNOA 3E6HB 4KRLB 4RWYL 3W0WA 1MCLA 4Y5XC 3LKOA 4WI4A 4HK3N 2D4FA 1Z5LB 3DO3A 4F9PC 5DI8B 5EORL 4DZ8A 3TVMA 1A22B 1IKNC 1FGVH 4JB9L 3IU3B 3U79A 2GK0B 2ZWLT 4AJ0A 1QFUL 1MREL 2FWOA 1B4JL 4FFVC 2A6DA 4HWBH 4R4ND 5DDHB 3RPIB 43CAB 1JGUH 2Y36H 3T04D 1UJTA 2HVJB 4LLDB 4DVRL 3L5XL 1DN0A 4PY7A 3QXDA 3P9LB 5DEFB 4KDTA 2MCG1 4YGAB 2DMBA 3P4LA 1EJOH 4GMSL 1D5IL 4I18B 2IMNA 3RZWA 2GSIA 4R96A 2C3XA 1IGIH 5CEZH 3MLUL 3F12A 4PY8I 3OG4B 1CLYH 3IXTA 3BJ91 2R69H 3QIWB 3S97C 1A3LL 3UC0L 5IROC 2CGRL 2D7QA 3I84A 4OQTL 3PWLB 1AO7D 3ILPA 3MJGX 4G8GA 5T3ZL 2OP4L 5KSAA 2BCKB 1BVKB 4NZRH 4P2RB 1YN6A 4KQ4H 4J1UB 3CVHB 3EKCA 5T3ZE 4HWEH 2VLJB 2DTSA 2VDOH 3JTTA 4RGNB 2X1QA 1JV5A 3W11D 3B9EA 1IILE 5MENE 3KR3L 1YPZE 4W70A 2AI0H 1DL7L 3H9SA 3FQNA 1MJJB 1C16A 3V5KA 3CK0H 5T5NG 2R56L 4ERSH 4XVJL 5BW7A 3GSOB 4RMWA 2ZUVA 3RVXD 4E5XB 3QIBB 3RAJH 4JFEE 4X4YB 5D93C 3OPZH 2LAAA 2QBWA 5I1EH 2WBJD 2CO6B 1WZ1H 2EEBA 4XNMB 1XGUA 2XN9B 4PG9B 3HZYA 1Q9LB 5L8KB 2DF3A 4CNIB 2HTKD 1Y18B 4WY7L 5JW5A 1OP5H 5DC9B 1QA9B 3R1GL 4XAWL 3TO4C 1FAKT 4L8SA 4WFGE 1YZZA 2RIKA 4LARH 4FFYL 4QOKB 2DYPB 4YDVB 3KPSA 4IDJL 2ADJB 1MIML 4N5EC 5JDSA 4HFWB 2Y72A 4LL9A 4ONOA 2FCBA 4TOYL 3T0XA 1LO3H 1GZQB 2HLFD 3LKQB 4YHIB 2I26N 1EHLL 3MXWL 5DJDA 1R3HB 5C0JB 1R5VB 3GKWL 4NKMA 1VFOA 3UAJC 3TM6A 4R7DB 3VXUE 4H1LG 4XVUD 3PP3K 4LHJB 4Y16A 1IGCH 4JE4B 4IEFB 4NNXA 1HKFA 5DUPH 3DETC 4YBQD 4F57H 2V2WB 2F19H 3OKNB 5E8PB 4HGMA 2KPNA 1A7NL 2BJMH 4I3SH 1KTDB 2E8ZA 3RIAK 1ZHBB 5HVWA 1ETZB 4ODUB 3O81A 3LD8C 1TZIA 3IDMB 3X3GH 2Z31A 3VWKD 4CU6A 1XGQB 5HGAA 2Q3AA 1QUNA 3OXRA 4L4VD 3MRNA 1NBYB 2HJFB 4JHWL 4AEEA 5FDYA 1JZ4A 2F54B 4FMKA 5SWSB 5GRZA 4KKCC 1BMGA 5ITBH 3EJYD 4HHAB 1I1FB 4FQJH 5I73B 4JREC 2OL3A 4U1IA 5J56B 3MV7B 4LDOB 2DQTH 4PJGF 1I8LC 1KPRB 5JHDA 2FIKA 4APQC 1TPXB 3D6GA 2FB4H 1GCFA 3D2UA 3EFFB 3J8F7 3HUJA 1X5JA 4J8RB 4ZO7A 3UAJD 3LSOB 5ESAB 2X89A 1AHWC 3IJHA 4B0MM 3SY0A 1TZHA 4HC1A 1ZHKA 3KXFE 3QEUA 3C60A 2EEDA 3PNWB 4FTVD 3WKNA 5KTEL 4DGVH 1A6VL 5DURD 2OJEA 4P5TB 4DUWA 3HC3H 4ZDHA 4YDLC 2X1PA 5K9OB 4N68A 2D0HA 1PX4A 3LKOB 1KT2B 2Q76A 3KYKH 2ZCLL 5GRWA 3LEYH 3NCFB 3QZWG 4KRPC 2XKNB 1U6AH 2WM0A 3KPRD 5INCA 3QA3B 4C59B 2DKSA 4LPXA 5E08H 3D85B 4HLJA 1CU4H 4OF8A 5DDHA 3RPIA 1I9RL 1QRND 3JWOH 2RCSH 5HHMD 5IW6A 3O8XA 3O9WC 4KUCF 4CGTA 2FRGP 3KPLA 5C0EA 1CGXA 3FONB 2K9UA 5D72L 1B2WL 3P9LA 4QYOB 5DEFA 4KK8C 5GHWL 2XZQL 1DN2A 1G0YR 5IB3A 3PIQB 1EAJA 3PHOA 5L2JA 1LK2B 3MXVL 4C55A 1KJ3H 2PYFA 4Y19E 2XTLA 3TJEL 8FABA 2XZAH 4JRYB 5TDNB 1R24A 4JO1H 1XF2A 2VQUA 1RUKH 4M7JL 1KYOK 4KRPD 5EOTB 4Y5YA 3TO4A 1ZTXL 4YXLH 4HXBL 5LCVH 4PJ8B 1P4LA 1TJGL 3VG0L 2SEBA 2UUDH 5JIHA 3N06B 2W07A 1WLHA 5B22A 3TA3D 5TH2B 5CD3A 3LN4B 3GSOA 3GMNA 3TO2A 1UZ8A 1LO2L 4QHKJ 1QHOA 1N59B 4OV5B 4UT6H 3QG7H 2WBJA 5C0FA 3O2WH 4NKOB 1V5JA 5DD5L 5CJOH 2W91A 3WNMA 3ZE0F 2EDEA 4MNHA 5EORH 4LRIC 2LVEA 1ZLWK 1PQZB 2MPAL 3FT2B 3HZYB 1Q9LA 5T1DL 4DGYH 2I9TB 4IMKA 4MLIA 3ULUD 2BRRH 1CDUA 3N9GH 4TSCH 5FO8B 1F4WH 2VRAA 5DJYA 3O11A 5IVXB 4WFED 3WNLA 5JW5B 1NCAL 3BGFB 3NN8A 1AO7B 4JY5H 4MA8L 1R3LB 5DGRA 3VXSB 5HHOD 5BQ7A 1MCRA 4YFEA 1AHWA 5F9WC 5I1JL 1MVFA 2HJKA 4RAUB 1XGRA 1TTUA 3QP3A 1N26A 3FB8A 3AM8A 4Z0XB 5HVHC 4FS0A 4UB0H 5I1CL 4WGVB 2X4OA 4I2XA 1I9JL 1X5FA 4JFPA 4RBPH 1T83C 1S78C 1SY6A 1WCQA 3B9VA 3I3BA 5C9KA 1A3LH 3UC0H 5DJDB 1WISA 1B90A 3TBTB 5KSBE 3ZL4H 2KZWA 4JM2F 2DIJA 2Z31D 1NLDH 1NJ9A 1WFTA 1WT5C 4TSAL 3LKNA 4CU8A 3OB8A 4P23D 1JI2A 4MJIA 3MLTA 2H9GB 1HILB 1RJLB 4JRXA 1UWGH 1DL7H 2D7MA 5JHDD 2A6KB 4EI5A 2OYPA 2ZCKH 3CLFL 3U0PB 4PP2A 3MV7D 1EMTH 4XAKE 4ZUWA 4X6BB 5HGHA 1Y0LB 1MFEL 1YQVL 3REVB 5C09A 2OI9C 4ODSL 4X4XA 5HYSG 2F54A 4Q6IC 5SWSA 1EEZA 2ZUWA 3G5XA 3RZCD 4NCDA 5I1EL 1QLEH 2R1WA 3HPJB 1MCDA 1N6UA 2G5BB 3LVEA 4OZGE 4ZUSA 4NO0A 3MMEA 4YIQB 5JW3L 1FZMB 3HI1B 5BO1L 4CN1A 2DM7A 3WFCL 2F74B 4ZAKC 3ULUL 2FIKB 2Z8VC 1DBBL 5IB5A 4PBVC 2JF1A 2NNAA 5ADPL 2HAZA 1F90H 2E27H 2DBJA 3D25A 4FNLL 5ISZA 5CGYC 4ZYKB 4HK0B 1ZHKB 2AXGB 3V6FB 4LHUG 1MRCH 2J88L 4CU7A 3QNYB 2ENSA 4KPHL 2LU7A 5L7XL 4UIKH 5JOEA 1AE6L 3DURB 4U1SB 5IR1A 5DQ9A 1MVUA 4LKXB 3X13A 2DOCA 3F7VB 5EIIA 3HZVA 1BQUA 2CDFA 2R0WL 4TUOA 1K4DB 3IDYC 5HHMB 1I7ZA 2AEIT 4NQDA 2NY3D 4XVSL 4GAYA 2H3NA 4Z7NE 3BESR 4JCMA 1HQ4A 4R4FH 4HQQH 1DDHB 3GKWH 4UTBL 3C09B 5DJ2A 3S4SA 1K8IA 2PKDA 3L1OH 1LDPL 3H3PL 5CIPA 4FXGA 1G7MB 4XP1H 2LQRA 4QRPA 1ZANH 4K8RH 3KPQB 5DLMH 1RAMA 3KPOA 3E6FB 1YDPA 3SDXF 5GXBB 5LGJB 3ROOB 4NZTL 1GGTA 3FO1B 2E9IA 3FL7A 4Y4HD 1VFAB 1Q94A 3DOSA 5T1MB 3IDYB 4FQHA 4P23A 1T22A 4YGVA 1F3RB 4HH9B 5F44A 2DAVA 4HWZA 3OX8A 1G7JB 3H9SD 4UDUB 3IXAA 5FYLH 4ZXBD 3VXUA 5A2FA 2MTPA 2DQTL 3WIIL 2Z91B 2EEAA 3QO0A 5JXEC 1OTTC 4JFQB 3NIFE 5T3XD 2QQLH 1QR4A 1SBBA 1YYML 2AQ3A 2ATKB 3BGMB 4MX7B 4NQUA 1T0NA 1XF1A 4RA0C 1D6EA 3VDCA 1IAIM 4PG2C 3GMQB 1EFQA 3T0VA 3Q5TA 4NO0D 5DMKA 1U8LA 4DQOH 3WBDA 3V79C 4O2CB 4JY6B 3CSYA 5D6DC 3ZDXF 1G0XA 1TTFA 4BZYA 3F5WB 3HZKB 1KPVA 4PGEB 1S3KH 2IPKA 1FBIH 2PYEE 4QGYA 2V5TA 3QUZD 4PJIE 1MH5B 1NBVL 1AD9B 3O41A 4U6TA 4NQSA 4NT6B 2OSLB 1QEWB 3UTTE 5F88A 1LD9A 4G8FA 4X7FC 1UB5B 5DMJB 3NN8B 5ICYB 3OMZA 3FN0L 5KZCB 1AO7A 3L95B 4LLUA 2P44B 5F1OB 3ECBA 1BIIA 1WZLA 4KVCH 1UXWB 4Z76A 2RCSL 1LP9E 1S9WB 2LFGA 6FABH 2EDHA 3FQUA 5E1HB 5C9JB 5KVGH 1IT9H 5DGQA 4TSBH 3SO5A 4GMTL 4MHHI 2BNRE 4WFFD 4GRLD 3ZTJG 1A6WH 4G3YH 4PJAB 3FFDA 3FT3B 5F1IA 1E4WL 5DXWA 1XF4B 1CXLA 1FV1B 3CMOL 3SKJH 1D5XA 3WNNA 1N2RA 4DCQB 1N7ML 3TBTA 1FLTX 5CJQH 3EO9H 2JIXD 1ND0A 5ENWB 5FGCE 3WJJA 1ORSB 2MCPH 1NMBL 2WIIA 3C5ZB 1H15A 3RY4A 4HXBH 4C4KO 3GMMA 3T0BA 4HC1H 2F15A 4LMQI 2OR7A 3OB0K 3P0YH 1NC4B 4GG6A 4MYWB 3KYMB 4Y4HB 4HFUH 1EK3A 3WFHB 4ZFGH 3TT3L 4NQEE 3DROB 1DLHA 4IRSC 2BNQB 5J4MA 5D5MF 2B0SL 4U1MB 1BM3L 4LOUC 3IJSA 1HSBB 3O2WL 2W65B 5DMIL 5I1HL 3HE6C 1GYAA 1QO3A 2EYRA 2G5BA 1C08B 4QRRA 3LN5B 1R0AH 2B1AL 2F74A 1F3JB 4X5LA 1P7QB 4C56A 1DEDA 4POYA 3NCCB 2CR6A 3HRZB 4K07A 5B3NA 1RULL 1N5AB 3MRHA 4TSCL 5HYEA 2VXSL 4Q7DA 1EO5A 2GAZB 3OV6A 3DUSA 4S1SL 1U92B 1Z3GL 4EDWL 3UCRA 4WTZG 4RDQF 1F4XL 1ACYL 3EYFB 4P5KA 3S3JA 3D3VD 1XH3B 1YNTB 1T2QH 4L4JA 5I1JH 5CP3H 3W11C 2R2BA 1G7IA 1LP9A 4QTHB 3QFDA 4Y16D 2YUVA 1BZ7A 2D3VA 3LKRA 5BVJB 1G7HA 5GZOC 2VR9A 3VFSB 5IBLD 2IH1A 3VFOB 4XRCB 4WW2A 3T0EE 5CCKH 5L0QC 2O5XL 4RAVB 1JPGB 2BSTA 3SCMC 4ZXBC 2XA8L 2F9BT 2H3NB 5EBMA 5I75C 3BHBB 3AU1A 4H0IA 4U0QB 1NLDL 1YNLL 4KZDL 1JMXA 4Y2DA 5SWZA 2YK1L 3H7LA 4KKBC 3BO8A 2CH8A 1WFOA 4ZPVA 1JUFA 3FB7A 4QRPE 4NUJB 3TZVA 1DQLL 4KQ3L 5KS9B 4KRMB 3KPOB 2ZCKL 3CLFH 5D7JA 1NQBA 3AC0A 1W72L 4KMQA 4NQCB 2X89D 1W0WB 4Z7UB 1XGPB 2VWEC 5DC0A 1W8NA 5D1QD 1GH7A 3K46A 3T65B 1FE8H 3KNBB 3O3EB 5F3BA 3BEVA 4XHJD 4ZSOA 4PJHA 4LQ1A 3RI5K 3KJ4B 3ULUH 4CVXB 5D6CB 3QO0B 5CEZD 3G5YB 1IC1A 3MV9B 1GHFH 3FTGB 4OF3A 2VZSA 1UM4L 1JMZA 3NAAH 1IRAY 2C4XA 5ADPH 4N0YL 4UTAL 2VOTA 4X6EB 5EUOF 4JY4B 3QUZB 1OQOA 3ZDYE 4XCEA 3EHBD 1BGXH 4JZOB 1QNZH 4QNPF 4ZO8A 5D7KD 4ONFH 4FFWC 1JYXA 1T03H 1I7UA 2BY3A 1KPVB 4PGEA 4MB5A 3V5HA 4Y2DC 4IRJB 1NAMB 1UQSA 3SQOL 1HYSD 3ALWA 3DX8A 4YXKL 2UVEA 4NT6A 5A1AA 4YHZH 5F88B 3LMJH 4U6HB 2RGSA 4BSVB 3SQBA 3O8XD 2GSGA 3QI9D 3KPRE 3FN9A 5DJZA 3S37H 5KG9A 3EOAA 1MCKA 3L1OL 3L95A 3V0WH 4HG4J 3LDBC 5CFHA 3TF7C 3HE6B 4I0PD 1IKFL 2ZG3A 4MS8C 1I85A 3DUHA 3W0WB 4J12A 4MJIE 1MJ8L 3CJJA 3IGAA 4UV7H 1C1EH 1KPUB 1OAXL 4CVZA 3HMXL 2I60L 1WWWX 3PL6B 4ONGL 1NEZA 3WE6B 4E42B 4UOJA 1D5XB 4XCYB 12E8L 1J1OH 5FYLL 1MEXH 3S36H 1VGKB 4GKZA 3Q3GB 3SDCA 1BOGB 3L7FA 2BOBA 3BOVA 4Z7VF 5DJAB 4Y1AE 3P4OA 3MRBA 2LE9A 4G6FD 5DHXB 2IQAA 4P4KD 2NYYD 4WUUD 5HHXL 5CILH 1S7TA 3D5OF 3TH3T 5I1IH 1NBZB 43C9A 2BNQA 5DS8A 1YC8A 3B4NA 3QNXB 4PRBB 1JPTH 1JGEA 3FFCE 3TJHC 4JQXA 3N85L 1EVTC 1KTRL 5BVPL 4IM8A 1E27B 4QCIA 2YXMA 4PRDB 1A3RL 2VLJA 2OLDA 2HFGH 4FQCL 2BK8A 3IJYA 3HNTL 1NBVH 1QSEE 2BERA 1OTSD 3ULVE 5IB2B 4HJGB 2YPLD 3FCTB 1W8OA 5D5MB 3QDJE 3TLRA 4JFDB 3GMPB 3RWEA 3DRQB 4LSPL 3OAYK 1RD6A 3KPNA 4PLNC 2VC2H 4FP8L 5ICZB 4ZPTA 2OQJA 1G6RB 1P9MC 4KVCL 5TFSL 4PJGB 4NQVB 5J13B 1R3IH 3SGJC 3BZFB 4ELKB 2GJJA 5FYJL 1FNSH 4XMKL 3V7AE 4IRZH 3BFOA 3V6OE 4Z78B 4JZJC 1BD2B 3UPAA 1BZ7B 4M8VA 1XF3B 3PWNB 3IVKA 3SE4C 1C12B 3FHQA 4OZ4A 2VMFA 4G3YL 3F58H 2Z0BA 5FGBA 3ESVF 4V1DE 4ODHL 2ICWI 1KJ2H 2YKLH 1AGEB 1JPGA 1QFHA 4CADA 2X9YA 1H5BA 2K7PA 3MRKB 2MCPL 4NM4H 2R23A 4UINH 5IHUH 1RV6X 5JDSB 2Y07H 4ZOEA 2AXFA 5DJ0B 1TQBC 1OWRM 2J12B 3P0YL 3VCLB 1WBYB 4L4VB 1GZPB 3RUGF 3SDDD 4QRUB 3VI3E 2VZTA 1I3VA 1IM3B 5SV4A 2F53D 1CCZA 3PWPA 1P4IH 3DV4A 3MUJA 1CE6B 4NN7B 4JKKA 1YEKL 4OF7A 3O6KL 3VI4F 3CLEH 5BS0E 4M5ZL 3F7YB 3GGWA 1M7DB 2XT1B 4UUJB 3FFCA 3W5MA 1GGCH 1BQHG 3C6LD 3BKJL 4M6NH 3DMMB 3G6AA 4UT7H 1JFQH 4YHYC 3ROLA 1U8KA 5T33H 1FN4B 1FVEA 1TQBB 1KENH 5EN2A 3KAAA 4XBPB 1GIGH 2CQVA 5HHQB 4POZD 5I9QB 4WO4A 4I13B 3OKYA 5FYJE 4LSTL 5FUZH 1F4XH 1KCSL 4RGND 5C2BH 1TJHL 4MS8D 3QUZA 5CJ5A 2H26A 5HYIA 4TVSa 4JZOA 4XCCH 3WHXA 3CPLB 3QIUA 5C0ND 3QDME 1DQQB 3W2DL 5EO0B 1RZGA 3S34H 3ZKXB 1KPRA 5JHDB 3WIHH 4PJ7B 3V4UH 3ARYA 4WI6A 1J8HB 1YEGH 3HE7C 4E0RB 5J8OA 4BZ2H 3NH7L 1QR1B 4WENB 3CFBA 2O5XH 2EDRA 3SKOB 4OZFG 4POUB 5DD0L 3WYRA 3L3GA 4MDJB 1MFNA 2EO9A 5SWQB 4KZDH 4LP5A 3B5TA 3UTQA 4D3CL 5CGMA 7FABL 4FQ1L 4XVTL 4P2QA 4P4KC 1UJ3A 4NHUB 3BDYL 5KVEL 4JR9H 2W0FA 4OQ1A 5ESQB 1IKNA 3OGOE 3E6HA 1BD2D 2GEEA 3WDIA 3V6ZA 4GSDL 2HKFH 5FF6B 3RWJB 2JELL 3QI9C 3VXMD 3SGKC 5CGYD 4NO2A 4Y5XA 5JHLH 4XB7A 4AH2B 3EYVA 1BJ1H 4RFOL 3OG6B 1X6LA 5IG7B 1MWAH 3W82A 5EUKA 5C0CA 1T89C 3I85A 3D2UD 1PKQB 2B2XL 5EOCL 5D8JL 1QFWH 2F53E 1IQWL 3E8UH 3O8XB 1XGTA 3GB7A 4OCWL 1VFBA 3U9UB 4C83B 3MBED 4ZFFB 3RWIB 3NA9H 3SOBL 1HYRC 3NZHH 5EO9B 4QHNB 3V0AC 5AD0A 3FO2A 3C9NA 1Q8MA 2JJSA 3V7MA 5BJTB 3ZT6A 1WC7A 2V5YA 4D9RD 1UGNA 1P84J 3SO3C 4AQOA 5JQ6L 4Q6IB 1F6AB 1RUAL 1N8ZA 4NQCD 5DUBB 1PY4A 2VQTA 2YPLB 4XBGA 1TQCB 1QFPA 3T8XA 4PJCF 4XPHH 1MFBL 4KJQC 2J6EA 2EH8H 1KJVA 4NBXB 2ZUQB 3JTSA 1YN6B 2K3TA 1UACL 2VLRE 4UAOB 3SQOH 1MFDH 2KUTA 4JKMA 4Z77A 2SEBB 1B6UA 2FLBT 3JTTB 4U3HA 4YXKH 1C5CL 1ZVHA 5DD3H 4PP1C 5DD6A 4JFDA 1K3IA 4L9LB 3QUYB 1U3HA 2D9CA 4WHTB 1U91A 4MCZB 2EXWC 3V0WL 5IEKB 1N59A 5I1KH 4TULL 5C0FB 4LF3B 4F2MB 3FQXA 4ODWA 4ZD3H 2PCPB 1R5IB 4G6JL 5F7MC 5L2KA 1T80A 1UWEH 4OF6A 4LKCB 2AEWA 2IBBA 3ZE1F 2R9HD 1G7LB 1A21A 4C56E 4XPTH 1OAXH 2W60B 4ALAL 4JO4L 1HQRB 2VTFA 1HEZB 5IVOA 4D2NA 4JN1H 2XYCA 4ZUVB 5IVXA 1D9KD 3OJ2C 4PJ5E 4OCRH 4M02A 4KKNA 1KN2H 4L3CA 3S36L 1RZIA 1YJDC 3KLDA 5I19H 1VKXB 2EZ0C 4I8DA 4WCYL 4PFEA 3TVMD 1AHWB 1P6FA 2R23B 3S3SA 4BK4A 3KPSB 3LEVH 3HCVB 2CJUH 3LPFA 4ZMAT 1JZ8A 3QUXA 3QPXH 2OCFD 4GKSB 1RI8A 3W0WD 1P53A 1FHGA 5IP4A 4JFPB 3ZDZF 5EU3A 3VI3F 3LKQA 2OL3H 3FO9B 1MAJA 4KI5D 4QXUL 1KIUA 4JG0H 2X4UB 1JPTL 4Z7QE 5CIPH 4H20L 1G9MH 3INUH 2CKBL 2PYEB 1FAIH 4NKMB 5A43C 3ULUE 3HNTH 3QSKB 1PZ5B 4QLRA 4RIRB 3QDHA 3HZMB 1U8KB 1MLCA 3LZFL 5GS1C 5B39G 4S1RH 3ZKSD 1JNLL 1RJZA 1KTDA 3HKFA 3TT1H 1MY5A 1E4KA 1JHLH 1V7NH 2AGJH 3ARBC 2H2PD 3VGFA 1KB9K 4OZIB 1WAAE 1DQQA 1ZGLM 5EO0A 1I9EA 5DMYA 3O8XC 2WSKA 1WICA 4JDTH 5JA9A 2ICES 4O9HL 4G6MH 2DQUH 5AWNL 4XNYH 1ITBB 3F58L 4FA8A 4OGAC 3QDGE 3L3DA 3NGBC 2MFNA 3OAZK 1KJ2L 4I0PA 4GRMA 5BV7B 1I9IL 3VXMA 2AQ2A 5ALBL 1VHPA 5HDQH 1VCAA 4EN3D 4KMTL 2Z93B 4U3XA 4PB0H 2RJMA 5DR5L 1ZWIB 1AI1L 1FORL 5A2KH 3HC4L 2QADD 1UH2A 5ESQA 4U1LA 4LPWA 4UAOC 5EIIB 3SDCC 2APXA 3BSZL 2IJ0C 4YHOH 1B3JA 2Y5TB 2ARJB 3IKKA 1NCTA 3MNZB 1IEAA 1PEZA 1G9EA 4AQ1B 3SCMA 4BKLB 4NGHL 1F45A 1JIBA 2IBZY 5A40E 4EIZC 2HLAB 3G04A 2VLRB 3VGGA 4S1DC 2ATPB 5IT2H 2NY4C 2X4PB 2ITDB 2P1YA 4X83A 1IVLA 4LU5H 1RZKL 1T0MA 3S35H 5DD1H 3RWIA 3QPQD 5C70A 1AGDA 1HZHL 5F9JA 5LGJA 1CF8H 1I8KB 1KENL 2A2QT 2H6PB 3CXDL 4Y4HC 2ZCHL 1H3XA 2XTJD 3ROOA 32C2A 4N90D 4ONHB 5DEZA 3A6CL 4LCIL 2C4FT 4FQHB 4ZS6D 3ET9F 4KU1A 5T5NF 4DZ8B 3GNML 3ZO0A 4EVNB 3WIHA 4PJ9C 2F5BH 1MQKH 5FYKL 2R0ZH 1KJVB 1MY7A 3CFIC 5B4MD 2WWKT 1HK6A 3JTSB 3V4UL 1XF2B 4B5EA 3WHE0 1ADQH 4M3JA 5GGSY 3ZHKA 3LS5H 2B4CH 3TESA 1FFNB 3H9HA 2VDNH 3W9DA 1RIHL 4TPRL 2AJVH 2GUOA 3LHPL 4IOFD 5CD3B 1U8OA 4OZHF 2ZNXA 3GMNB 3TO2B 3QFJD 4FQ1H 1NCUA 4HJ0D 4XVTH 5SX5K 5D9SA 1R3JB 4PD4J 5KVEH 2EC9U 1MRFL 3FQXB 4ODWB 1XR8A 4R90L 3VJ6B 2ESVB 4X0KA 2APVA 4R4NC 4QWWD 3G08A 3OKMB 2Y7QA 4LCWA 1A1MB 4NUGL 3HI6L 3P73A 2VLKB 1P6AB 5FO8A 3R0NA 4OGXH 4NJAH 2ZG1A 1H8NA 2DM4A 1C16B 1LP9F 3SDDA 5EOCH 1BIIB 5I15L 1IQWH 3RWFB 3VXSA 2IH3B 2WWMC 4WUUA 4XT1C 5KVFH 1BBDH 3EYOA 3PV7A 4KRPB 5IV2B 1JPFB 1KFAH 4WW2F 5BZWB 3LV3B 2D7OA 4ODTH 3FB8B 3X11B 1LEKB 4G9FD 3EYQD 4JHBA 4NQDD 4PJAA 2CRZA 4PGCB 3U48A 2XN9A 4M1GL 4PG9A 1RUAH 1UWXK 4MJ2A 3ZTJH 4AYFA 5CBAA 5MHSD 5EU4B 1IGML 4L5FL 1RIUH 2P5EB 3AREA 3BP7A 1DBAL 4L8SC 1ND0B 3BH9B 1I1AD 4Y8AA 1QA9A 1O7SA 1OAUH 3NFNA 5C09E 3ILQC 2X6MA 3G6JF 2FDBP 4MJIB 3U7YL 2VSCA 2DYPA 4YDVA 4XNXH 3H0TA 4I9WD 3S36X 5CEZE 1HXYB 1XF5A 4JFED 2G5RA 3QXAA 3UTTD 3FB5A 4MDIB 3UYOD 3DRTA 1HIML 4LCYB 4LPUA 1EBAA 3C8KB 1PD6A 4TULH 3NIFF 5E03A 5C09B 3VMNA 4D8PA 3O3BA 1A14H 1CD1A 1JNHB 5ICXB 3DV6A 1KB5A 2FEDD 5MERA 4AIXA 3IS1X 3T3ME 4N8CL 4OM0L 1SM3L 2IF7A 2WZPD 3MGAA 4P2RD 5I17A 4JO4H 3CMGA 5ANME 3RVTC 3CX5J 3VXMB 1EEYB 4H1LA 1LNUA 5EZIH 3TJHD 3GSWB 1FPTH 1EFXB 2QR0B 4YJZL 3QFJB 4GG8B 4N8VG 1TZIB 2PUQT 4HK0A 4MVBC 2V2XB 2R2BB 2Z31B 4M03A 3C6LA 1CD0A 3QNYA 2HJFA 3ZYZA 3X17A 5GJSH 1FFRA 2F5AL 3NCYS 3MACL 3MCKA 5D2LE 3AS0A 1VEOA 2D0FA 3MZGB 3VFSA 2IH1B 3K2UL 2NY1C 1NGWA 4LSUH 3U4AA