5I8EA

Crystal structure of broadly neutralizing hiv-1 fusion peptide-targeting antibody vrc34.01 fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
217
Chain Sequence
b'EVLVQSGAEVKKPGASVKVSCRAFGYTFTGNALHWVRQAPGQGLEWLGWINPHSGDTTTSQKFQGRVYMTRDKSINTAFLDVTRLTSDDTGIYYCARDKYYGNEAVGMDVWGQGTSVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC34.01 Fab heavy chain
publication title Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 217
sequence length 221
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eA01
3LCYA 5J13B 4LVOB 4XCFH 1TMCB 1AR2A 1H3UA 1WBXA 4PJBA 2OZ4H 2JIXD 3MRKA 2DQHH 1V3MA 1NMAH 3UZVB 3HUJF 3MLTA 1RUAH 5D7KE 1DN0B 4IRSC 1LD9A 4LRNH 4Z95L 4HH8A 5SWSD 5J9PB 5HI4D 4NO0D 4XCEA 4LPYA 1P4LB 4BELD 1INQA 3OZ9L 1SYSB 2ZUWA 3SDYH 3DVNB 5SV4A 5E99L 4K94C 3ETBF 4LIQL 3MROA 5DRXB 5BCAA 3S88L 1G6VK 4KK5C 1ZT4B 4HBCH 5IQ7L 4MVBC 1CN4A 2DKMA 5E8NB 3U9PH 3RWHB 5E2UH 4TUOA 1U8KB 3PE9A 3L95B 2DQUH 3WKML 5DJ6B 1ZOXA 3MNVA 1K3ZA 3OR7A 1HINL 4DOHE 1S5HB 3P0YL 4G6MH 4L8SC 4JY5H 5GGQL 1G7LA 5KN5A 1U8LA 4Z7QF 1J0KA 3R0MA 4FG6D 1Q9KB 5BV7L 1X5AA 2FH8A 1VFAB 4FOMA 2JB6B 1KIPB 4YQXL 5DI8B 3IDMA 1FH5H 5FGSA 5T5NF 1FSKC 1NFDF 3PV7A 4KKBD 2L0DA 2KKQA 2HTLC 4U7SA 3SKJH 3BEWA 4FQ2L 1PFCA 2VSCA 4JM2B 4X80L 5CD3A 5T5FH 3VXUD 1ACYL 3Q3GB 3SGJA 1P2CB 4ONHA 1XGUB 4M8QA 1Q94A 4KJPD 3ZHKA 3LSOB 2VKXA 4BFIA 4TN9A 4K23H 4ZFOA 4R26L 1MLBA 4RMRA 1J8HA 1MCWW 4NSKB 3EJYD 5E4EC 4GXUM 4X6EB 4U1IB 3UEZA 2RIKA 3Q5YA 4K94H 1QRNE 1S7UA 5TDPB 4D0DA 5T3ZE 3UJIH 4M6OL 3RNKA 1OCWH 4K3EH 3TYGL 4FTVA 3BPLC 1RUMH 1IRAY 3KPOB 4HFWB 3BGAA 1HXMB 4MXQD 4Q7DA 4JM4L 4QHMB 3UTZB 2QV2A 4Y4HD 2NQCA 1JGDB 1NGZB 4UT6L 4FABH 1HCFX 1CTOA 3HB3D 4JO2L 1CFTB 3TZVA 2PXYD 3AXLB 1TZGH 4HT1H 3L3DA 4S1SL 9CGTA 5FO7B 1Z5LA 4XPTH 2FHBA 2FWOB 2GSIA 2JJSA 5KVGH 1KPVA 1BWMA 4U6VL 4WDIA 3MUGA 1CR9L 1IM9A 4LLQB 3ULVL 4P57A 3T8XA 5AAWA 1NCCH 5F7DA 4KMQA 4OD2B 3VG0L 1MAML 1I85A 1QVOA 3C6LA 3HMWH 4PTUB 2JELL 1YYMH 4KHXL 4YHML 3NCEB 1RK0B 1U2CA 1CGTA 3MV7D 3ZDYE 5CEXA 2AJYH 5JQ6L 2AV1A 2C7UB 3G04B 4XNQA 3MJ8B 4IBLT 1DQLL 1F6FB 3A6CL 4X4XB 4KVNL 3W82A 1GZPA 1AJ7L 2R8SL 2AJ3A 1A7PL 5GGSB 3UTSD 1IEHA 4G7VL 4LCWB 1ZSDB 4OFKA 1PW3A 3BP4B 1IGYA 4NQDA 3VXTA 1PKQA 1V7MH 4MAYC 3CU1A 1UXSB 5EUOF 1HDMA 4F8QA 3QXDA 5CHNB 4ZSOE 3VD4A 1BAFH 3DX8B 3VFNA 5LXGH 2E5EA 4RWYL 1G7MA 4RA3A 5IROA 3TYFB 2X4OA 2BHYA 4NGHH 4WRLA 5IFAL 2EKSA 4X6CB 3D3VD 3EO1A 1D5BA 5IFHL 1SY6H 3X12A 4I0PB 4NCC1 1JYWA 3IKKA 2DIAA 4I4WB 1G7HB 1EA9C 1RK1B 1C5DB 3K1KC 4PB0L 2EDKA 4GO6B 4FXGA 4KV5E 1I1YB 4P23C 5GRJL 2HVKB 1N2RA 15C8L 2FGWL 1JTTA 4QF1B 4R7DB 5EIIB 4XVJH 5CWSB 5F88B 3TNNB 2APXA 1G84A 1XGPA 3OV6A 4KZDH 3GBNH 1RUKL 1YQVH 3A67H 1KENL 1I8KB 3S36X 3AMLA 3NPSB 4KUCD 2H6PB 4UQ3A 3I02B 4DEPB 1OQXA 1XCQB 4Y8DC 1BVZA 3CNKA 2CDEA 2XY1A 1R3KA 4P5KB 5DSCA 1MFDL 4FFVC 4HK0B 2H3NA 1IJ9A 1JNLH 2HJKB 5I2IA 3LKSA 4PJAB 5EU6E 5HGAB 1HEZB 1UM4H 5DJYB 2AK4A 1DBBL 1OGTA 3F6LA 4OCSH 2OP4L 5C6PB 4NHUA 3D0LA 2R0WL 4NN6C 1V3KA 2DYPB 2NY6B 1F3DH 4L9LA 4PJHB 5EBLB 5T1KA 3OXRB 5DUMH 3BP6B 4MQTB 1HYRC 4CDGC 4P2OC 1EFXB 5TH2B 5J11C 2C3XA 2YN5A 4XCNB 4GW4B 1T04A 4Z7VB 1FN4B 3WFDH 3T4AB 3TPKA 4ZG1A 1BQLH 2P5EE 2AABL 4WENB 4EDXA 1MJ8H 2D7OA 5HHQB 2A6JA 1YMMD 4NRYA 1T22B 3NH7H 3JTSB 1LE5A 2IH3B 2R2CA 3WNLA 3PP4L 2BJML 2CLVB 5F7EH 3M1BA 3WFCL 5BJTA 1IKFL 1EMTH 1PYWB 2B4CH 3I50H 1BX2A 1SYVA 2Q76B 4TQEH 4BH7B 4QTIL 3D48R 3Q6FA 5DD5H 2VIRB 5FYKE 2NY1D 2H1PL 2X70B 3L5XL 4G8GD 4TVPE 4NNYA 1I8LC 4K9EH 3MRNB 5DRNB 5JPMB 4EUPB 1UZ6E 1DQQB 1IQWH 3VXRD 4Y2DA 2AXGB 5IF0B 2B1HH 5CIPH 3IS0X 2LE9A 3CFJA 2WINB 4MCZA 3S34L 4GUPB 1YPZE 1JGVH 3EGSB 1ES0A 3D0VA 3TBVB 4AEFA 3LQAC 1QSFE 3NBNA 3VGAC 1TJIL 2EE9A 4XPAL 5KVFH 3PDOB 1BD2B 5DHVB 4NFBA 3T0WA 1XF3A 2ZUQC 4IRJB 3OJVC 4B7IA 1WZMA 4JG0H 3AVEA 5CEZD 2A74A 5BMFL 3JZ7A 3O6LL 1JUFB 2VQUA 4Z7OE 3PABA 1BJ1H 4LPUA 1OB1B 4QTHB 5ELIA 3I3EA 1CGUA 3QDJB 5CILH 4JFFA 3RY4A 4QWWD 2FNBA 4OAWA 5J6HB 1P7QD 2EDBA 3MMEA 3BP5A 2B1AL 4XP6L 5B3NA 1KG0A 4KRNA 3D6GA 4BK5A 4I3RL 3ROOB 4QRPB 5SX5H 4DW2L 5IHUH 4CNIB 3KPTA 3H3KA 3SDCD 1YMHA 4WNQA 2GCYB 3GKWH 3JBG7 3DETD 3TV3H 2YPKA 3ARED 2VZSA 2HFEB 4H8WC 5AD0A 3S4SG 5H37H 2E7CA 2O5YL 1FYTB 4NO2A 1VFMA 2NY4B 3ORJA 4KRPB 4KKAD 2R2BA 1NCTA 2WANA 3C6SA 4O2EB 4EI5A 3A6BH 1XGTB 2DQJL 3QO0A 1F42A 2N7AA 4YHKH 3FTGB 2ADIA 2R56H 1OTSD 2YC1A 4XCFL 3QUXA 4LVOC 3X3GH 1KCRH 3UO1H 3K2UH 1NL0H 2IQAB 2PYEB 4LIQE 4HAFA 2GJZB 1MIMH 1WICA 5J56B 4PJ5A 2Y7QA 1I7ZA 2NXZD 3KXFE 4BUGA 1QRNA 3G5VB 1RUAL 2YKLH 2XZQL 5MEOB 1F00I 3HZVA 1T7XA 4NQSA 1FFQA 1RQ5A 3QIWB 4LRNL 4S0TD 4L3EE 4ZTOH 4R9HA 4UAOB 4PJBF 1RJLB 3QO1A 3SDYL 3KPQA 4BZ1H 4P3DB 3HAEA 5DO2C 3I6LE 4DWHA 1EJOH 1AI1H 2UWEB 5GRYA 2Q86B 4PGCB 3FKUS 3LN4B 4HBCL 4MQXC 1ZHBB 1FRGH 5TJWK 5IBUB 4U1LB 2VC2H 2PETA 4UDUA 3PQYD 4WFGD 3U9PL 1HHKB 4JKMA 3T77B 5E2UL 2FJGA 3UJTL 2DQUL 4Z5RB 5ANMA 2NZ9C 3S3PA 3U82B 1A6UH 3KLHC 4KK8C 4G6ML 4A6YH 5MEPB 3QZWG 1KIQA 1AIFB 3JWDH 1IAII 4JZJB 4K3DL 4ODUB 5F97E 3QQ9D 5M7QA 2VLKD 5J3HC 4MLIA 4QRRA 2EH7H 1J5OH 4K7PY 3MLZH 1RVFH 1FH5L 4XTRC 5FHBH 2RFXB 5CSGA 5JHDB 3SKJL 2Y5EA 2CO7B 5DYOA 4F33A 4OZHA 2NY2D 4XAWL 5D6CB 2ITDB 4JM2C 5F8RC 3ARDC 5E8EA 1REIA 3OGCA 4D0BA 4NRXA 2NY0D 2VAAA 4OZIA 1JGEA 5C0IB 4KGLA 3CUPB 3MRGA 5D71H 4ZUSA 1IGFH 4RGNB 5DHYA 4U49A 3C9NB 2X7LA 4K94L 5HYJD 5D7IB 4ENEC 3UJIL 1OCWL 4K3EL 3QBTB 3MUJA 3QG6B 4LSVL 1FAKT 2NTFA 1A7OH 1B3JA 4TPRL 2GTZA 4XC3H 4IHOB 1RUML 3MYZA 3FB7B 1YEDB 1N3NB 4JFDD 3S96B 2NXYD 1CG9B 4LNRB 5D1XA 2DJSA 3MO1A 3L5HA 3WFHA 3MV7B 4FABL 5E56A 5T33H 1AD0A 3BXNA 3D85D 3O6KH 4KFZC 5BS0D 4HT1L 4V1DE 2FZ3B 1ED3B 4RGMB 2HT2C 5IK3B 1U6AL 5TDOB 1EGJL 3OJDB 5KVGL 3EBAA 5JW3H 2F58H 2X09A 4FQXD 1VFUA 1MWAA 1A3LH 4NQCD 5EU6A 3WIIH 1MCBA 5F9WB 2YRLA 4YBQD 1GJIA 4B7LA 3A6OA 1T7VA 3LIZH 2ZUTA 3FQUA 3D3VB 2MCG1 5T1LA 4WTXA 1AGEB 4I5BA 3DVGA 5CBAB 5HYQA 1OHQA 3KPRA 3RGVA 1JK8B 1C5CH 1DANT 3FB5B 3TO4D 2MCPH 2Z0BA 4LPXA 4PJEA 3MUHL 4APQA 5L2KD 2VQTA 1ND0A 1ZA3A 3R4DA 5DJ8A 1PZ5A 3EOAB 5CEYA 4LHQB 2HWZH 3H3BC 3BGFB 3DJ9A 1PX4A 1BAFL 1ZGLA 4JPVH 1AE6H 5E2VH 5KS9B 3RI5F 4GRLD 4NGHL 5SWQA 4M1CC 1XF2B 5SWSE 1SY6L 1YEEL 1UWXH 4I0PC 5I16B 1TNMA 1FIEA 2NX5B 1QACA 1TZIB 1ORSB 3GM8A 2ARJQ 2NTSP 3IDIB 1F13A 2IANB 3GIVB 4R4BA 1U8HB 2BY0A 4XVJL 3ILQC 3ZDZF 3QNXA 5CS7A 3HNVH 4X5WB 1A9EB 5F7LB 1JPFB 4KZDL 1YQVL 1W72B 3DRQA 4IOSD 4OFYA 4OI9A 4P9HC 4DN3H 3NPSC 1RV6X 5D1QB 4DEPC 1EEQA 1OD9A 4NKQB 3C5JB 4OZFH 1J88A 4KGJA 3EO0A 4YWGH 2UUDK 4AENB 3DOSA 1JNLL 1XIWA 4PJDA 2P46B 2J12B 1X5ZA 4Q9QH 3NZHH 4PJIE 2DWEB 3WDJA 1FDLH 1ZLSL 4OCSL 1F90L 4JLRA 4MMZC 2R0KH 3LDBB 3QPQC 3VXUE 3STZB 5EO1A 4XWOC 2V2WA 4F7PA 3PWUB 5J57B 4DVRH 1T0MA 4AEHH 1RZ7H 3U6RB 3SCMA 3ARBD 5FM5O 4NRZB 3N06B 2NY6C 2FLRT 3TVMC 3MLRL 5IMMB 5DUML 4BJLA 1C08B 1HIMH 1XGYH 4LPTA 1SVCP 5C0EA 5LGHH 3HR5A 1D9KD 3DGGB 4X4MA 3MRBA 5E5MB 2W59A 3QXAA 1CXLA 3WFDL 3RHWF 1MNUL 5KSBB 3OKEA 1MJ8L 2LU3A 5GGSY 1AGDA 1NGYA 2JJTC 3SDXE 2YSSB 1CGWA 2XTLA 4PJ9A 1TCRB 2J4WH 4W6XB 4PY7A 4RRPG 5F7EL 4HUKB 1UVQB 1I9JL 4IMKA 4ZOBA 3I50L 3HMXA 1I3VA 5K9KB 4L4VD 4HDIB 1UH2A 3TPUA 4TQEL 5IW6B 1KPRA 2DIBA 1LDSA 5DD5L 5GISH 4DGIH 4I8DA 1P4BH 1XGRB 4FP8H 4JPWL 2ADJB 5GSVB 3SDDA 2X4PB 1A6WL 5JNYB 5JW5B 3RZWA 1A3RH 3HNTL 3QR2A 5FK9B 3O3EA 3PWLB 1QSEA 3TJHC 1ERNA 3LHPL 3AU1B 1FZMA 1BVLB 5I15H 2B1HL 4YJZL 2VDNH 1J8KA 4R7NB 1R5VA 2VDRH 3BH9A 2LVCA 2UYLB 3CFDA 1GGUA 1JGVL 2V7NB 4PRHB 4Y19D 1NCAH 3UTSE 1U8IB 2DTMH 5C70A 1P84J 2ZNWA 4BSVB 1JWMB 5E2TL 5F7UA 5C2UB 1P7QB 5KVFL 4XGZB 1NCUA 5GZOD 1W0WB 4OD1L 3NOIA 5JIIA 3O9WB 4JDVA 1CL7I 3TWCH 1FNAA 2BNQD 4NQEA 3WBDA 1HH9B 4MX7A 4IRJC 5IB3B 4JG0L 4LDLB 4RDQF 5FA4B 1KLGA 3CLEH 3UC0H 2X05A 1NBZA 4MDIA 4QCIB 2DM3A 3ARFA 3OKOA 4H0GA 4UU9A 1TTUA 5CILL 3QIBB 5H35B 4TTGA 5MENA 5GJSH 3PIQA 1YN7B 4HJ0C 1AXTL 1U8MB 4FNLL 5CZXD 4DZ8A 3TH4T 5IB4A 4Y5XB 2X5PA 2EIBA 3STLB 4U2YA 4QHUA 4CMMA 5DMGC 5DQJA 4RFNB 1C12A 1DVFA 3IDJA 5T5NG 5E8DH 5CJXC 5T1DH 1H3WM 3T2OA 3BZEB 1BBJA 2GJ6B 3U4EB 2IG2H 5EOTA 3JV4A 1ZLWH 1AP2B 1U0QA 3TV3L 4ZXBD 3KPPB 5I66B 4UMGA 3OMZA 4PG9A 1U93A 4QRUA 3MGTA 2XA3A 3PGDB 2NY4C 4KRPC 3IVKB 3P4OA 1H15A 4P46B 2GSGA 3QDGB 2ATKA 4OKVA 3RUGB 4XPBH 3A6BL 3CPLA 4YHKL 2X2YA 4XMLH 4G9FA 2R56L 3MRHB 1Y6NR 3G5XB 3X3GL 3K2UL 1FVDB 1CLCA 1NL0L 2WM0A 4F7EB 2KL6A 5FECB 4C83B 1MIML 3MRIB 1V3LA 4JRXE 1P1ZA 1JNJA 1D5ZB 3MZGB 3EYVA 2LAGB 4X9GA 3SKUD 8CGTA 3QJHA 4XZUA 2J88H 4XNMB 5TE7H 3G5ZA 4ZTOL 1BQUA 4M4RA 5EO0A 4I13B 2CO6B 4ZOCA 1LE9A 3F7RA 4UAOC 4L8CB 3LKNB 4XPGH 4BZ1L 1UXWB 3VFGH 1WTLA 2YXFA 2Z8WC 1EJOL 3HE7A 5ICYB 4XX1E 4DKFH 5MHSD 5I1DA 2VC2L 1YMME 1UJ3B 4OF5A 5C7XH 4G3YH 2X4QB 2R1WA 1FV1A 3D9AH 2HT3C 2NY2B 3L7FA 3HS0B 4ZFGH 3B6SB 1W0VB 3LEVH 4HG4J 1A6UL 3O2WH 2CPCA 5JIKA 2HJLA 2M2DA 1CD1B 3HC3L 3SBWC 2APVA 5F3HB 4PB9L 4X5XB 3JWDL 4OCRH 2E7LA 3GHBH 4PRNA 4JZJC 5DRZA 2WIIA 3HC4H 2HVJA 3G08A 4G8GE 2EH7L 3HA0A 1J5OL 3MLZL 1MCKA 4JDZB 4RA0C 5FHBL 4DFIA 1G9MH 3KPSD 3QHFH 5DQ9A 3EDDA 2XY2A 1N0XL 4MXQC 4HUMB 1G9NC 3ZDYF 2X4SB 4QT5B 1P7HL 4AG4H 4NQVB 5D71L 5C9JA 4LLMA 1IGFL 3K46A 3D85B 4RGNC 3HB3C 1FO0A 3IU3B 4XVUD 4XVSH 2G75A 1MRDH 1II4E 3GSNA 5HHMD 4P5TB 4OUUA 1A7OL 1FNLA 4XC3L 3MZTA 3UDWA 3VXQA 3K4AA 1QG3A 1WIOA 3QIUA 2YWYA 3DARA 3KDMB 3SDAD 3QCVH 3NAAH 5CP7A 5DJXA 1UC6A 4J12A 5T33L 4JRYD 3U30B 4B41A 1AQDB 3JVGA 2OR8A 2D3VA 4PJCE 3X11A 1AD9B 3GRWL 5KAQF 1YEHH 4JANB 4RGMC 5IFJB 1M71B 3OKKB 3NN8A 1MH5A 2F58L 3FL7A 5DGRA 3UTOA 5F93C 4KWUA 1A3LL 4YC2B 3W9DB 1YEKH 3IJSB 1INEH 2PF6A 2WQ8A 1UB5B 1A4KB 3RVTD 5D1ZA 4X98A 2FD6L 1T6VN 1OARL 3LIZL 4GAGH 2HFFB 3MRJB 3IKCB 4WI8A 3BWAA 1CDHA 2BHUA 1A7RH 3P9WB 3OKLA 3WYRA 1C5CL 3TN0A 3GJFK 1HXYB 2D7NA 5F1OB 4D0CA 2RQ8A 3GUTB 3L3JA 3AC0A 2BY2A 3PHQB 3ISWA 4I0KA 3UAJC 1DSFH 1MRCH 2HWZL 3HPJA 2F74B 2OS7A 3QH3A 4LMQI 3BGFC 3QQ3A 3FAXA 4JPVL 1AE6L 5E2VL 5E94A 3PHSA 4PRIE 1S7TB 1DTUA 1H0DA 1E4KC 5C0BD 2FJFB 3SDXA 5IEKA 4Z78B 1S7XB 4G80A 5GXBB 3U46A 4G8FB 3IXTB 1KT2B 4LCCB 2Y6SD 4HIEA 4N0CD 5F7FA 5I1IH 3VH8B 3PL6A 3B5TA 4YDLB 3WFEL 3MGOA 2P4AB 1A5FH 2PCPA 3UTTD 5IVXA 3RWDA 4LP4A 3QRFM 1KV3A 4MSWA 2VSDA 4PBWD 3GSRB 1EEUA 4HIXL 3G9VA 1RZJH 1WZKA 5KSUB 3ARBB 2R39A 4DN3L 3SGKC 4HX1B 1RFDL 3QXVA 3C5ZD 4KROD 4ZODA 5D1QC 3P77A 1KC5L 2J7LA 3G6AB 5BZWA 4G8EB 4YWGL 2VLKE 1OGAD 5EIQA 2VKWA 3EYSH 4GAYA 4KDWA 5K9QI 4ZPVA 3RL2B 2YMXH 3CH1A 1FVCB 1CLZH 4Q9QL 3NZHL 3BDYH 1FDLL 1ODAA 4XBPB 2R9HD 3V5KB 2H32B 3LDBC 3LPFA 4DVRL 1A2YB 4MD0B 4AEHL 1RZ7L 4JVPA 5FGCB 1UZ6F 5CBEA 2C1OA 2N4IA 4LHUA 4ZAKB 4UT9H 3TNMA 1HIML 1XGYL 1YPZF 4K3JH 2X1WL 1FVEA 3EFFB 1CDJA 3NCYS 5C0AB 3DECA 1IM3B 5HYJE 1AKJA 1ZHKB 3E6FB 4BZYA 3VCLB 3O4OB 2VL5B 4QKXB 3MRMB 1R5WA 2ATPA 5ISZD 4V2BA 3U9UA 4N0UB 2BSTA 4UDTB 3U0PA 4JFDE 5IW1B 1NANH 1KNOA 4L8DB 4MJIB 3DBXA 5DD0H 3GMLB 4HMEA 2OQJA 5ERWA 2G2RB 1MQKH 4OCLC 3ZO0A 3D2UA 2J4WL 3DGCR 3FQRA 4Z7OF 4OBSA 1E4WH 3H0TB 4PRPA 1FZKB 5BS0E 4PJFE 1EHLL 4KXZI 4QNPE 1HHHB 3NA9H 4HFUH 3GSQA 4KQ3L 3SQOH 1VHPA 3OHXA 5GISL 1U95B 4M9PA 4UBDC 1U8JA 4DGIL 4NQCE 1P4BL 4FP8L 1QBAA 2MKLC 3QWQB 2HG5A 4QHNB 1A3RL 3O0RH 2BNQB 4NJ9H 1QFWM 2Z35B 3N1QC 3HZKA 3MRDA 3MBED 1XH3A 2VDNL 4JRXA 3RJQB 2P48B 3FCTA 2VDRL 3GSXA 3WO4B 1FNEA 3UPRA 3G6JA 1SJHA 1BIIA 1NCAL 1ZHLB 2DTML 5INDB 2C3VB 3GM0A 5L2KE 5C0DB 1NFIB 2FBJH 1CS6A 2VMFA 5D7JB 1RJZA 3S36L 3QEQD 1OAUH 4KHTH 3V6BR 2L7JA 2VR4A 3O9WC 1MEXH 3TWCL 3RBGA 5HHXH 1SJEA 4AEEA 1JZ8A 3H9SE 4EXPX 3CLEL 2GT9B 3EZJB 3MV9A 5HGBB 3TJEL 4MS8C 4F3FA 1OP3K 3IDNA 3QIBC 5GJSL 1HYSC 1KB9K 3L3HA 1AXIB 1ITCA 1RHFA 3VFRA 2X4UB 1LEKB 1XR9B 3BH8A 4Y5XC 4YXLH 1OTSC 3FO2A 4IRSA 3QEUA 3BPCA 4RFNC 5E8DL 3FT4A 2H9GB 2IG2L 1N5AB 2CDGB 3S8WA 2H26B 4JFPA 4JPKH 4AM0A 4LBEA 1SMAA 1JHKH 5D5ME 3QSKB 1EH9A 2EDYA 4KK6D 2A9MH 1S7WA 3TA3B 5TE4H 1RIUH 3IETB 4WW2A 2ED8A 4UUJB 1FL6A 4GXUN 4P46C 3GSWA 5SWZA 4LCIH 4XMLL 5JUEH 3NCYP 3HLAA 4CVXB 4E41D 4EN3B 1JF1A 2HP4A 1G7PA 1Y18A 2WP3O 4L8SA 4KI1A 2NR6D 3N1FC 1FLTX 2CRZA 5TFSH 2J88L 1EGJA 4ETQB 3T0EE 3L3KB 3P2TA 25C8H 5TE7L 3OR6B 3DRTB 2IPTL 1NDMB 2W0FA 1YY9C 4LCUA 1AH1A 1O0VA 3ZE1E 4MNGE 4XPGL 3BX7C 1D7FA 2UV3A 4EOWL 1CFQA 4XP9H 3FRPG 2X44D 4ZQKA 5GHWL 3DX7B 1U8PA 5IHLB 5ICXB 2BNUA 2VDLL 1NLBH 5C0JA 1UJ3C 4G3YL 2VLRD 3D9AL 3KYMA 2ED7A 2QKIB 3IYLW 3CDGB 2NY2C 4ZFGL 1IFHH 2QSCH 3LEVL 4HJGB 3O2WL 1KXVC 2QQLL 2W38A 4XPFH 1HWGB 1OLZA 5E8PA 4L4VE 2J5LB 2V5TA 4J7RA 4OCRL 2Z91B 1UKTA 5HHPB 1ETZA 3VGEA 1YDPA 5I8KH 3HC4L 1J86A 3DROA 4PR5B 4AL8H 2GUOA 4U05A 3P9LB 3MOBL 1YEFL 5DK0A 3RFZC 3WNMA 5E08H 1G9ML 2D7TH 4YDVB 3WNNA 4ODTH 3QXUA 3QHFL 1PSKL 4GAFB 1G0XA 5C0GB 2D31B 1K85A 1CVSC 5E5RB 2PTTA 3FOMA 4GOSA 1FG2B 4Y19E 2YPLE 1K9TA 4AG4L 1I4FA 1VPOH 4MCYA 1GZQA 2DWDB 4JJ5B 4PRIA 3VU2A 4XVSL 5EZJA 1HQRB 4J3UA 5IQ9A 1P69B 5KVMC 1MRDL 3WEXA 3EYFB 1J05A 3P4LA 3OKNB 4JFQB 4LSSL 3RX8A 3WD5H 2GEEA 2N56A 5L2JB 4RMUA 4P5TC 2Z8RA 4F2MA 1JHLH 1M7IA 5GQBA 1KEGL 3O4LD 2ICWB 3AS1A 2DLTA 2XTJD 3NTCH 4M5YH 4YBQC 3V5HA 3QCVL 3EAKA 3NAAL 1FZOA 2VUOA 3W11C 4MAYA 5EC2A 3L3GA 43CAA 4KPHH 3F7PC 3OXSA 1T7WA 4I48B 5INCB 3U30C 2RAMA 5KJRH 5HDOA 2OSLA 2DTSA 1LQSR 1YEHL 3FQWA 5IR1B 3IJYA 1T89C 2IPKA 5BVJB 1YUHA 2NW2A 1A1NB 2XI9A 4FMFA 2G5BB 2V2XB 3TT1H 1XR8B 1JWSB 3MRCB 1YEKL 1INEL 2I9LB 4YC2C 3FN0H 1WISA 3AAZA 3REVA 1M05A 4LP5A 2BNRB 3ARGD 2ZZUT 5L9DH 5GRXG 1NC4B 4HH9A 2CLRB 2HN7B 3BN3B 4O9HL 1T20A 4GAGL 4GBXB 4P23A 2YHGA 3L9RB 5JOFB 1G9NL 3MUZ1 5DMYA 1A21A 3KPNA 5JA8B 2P8MA 1RZFH 1IARB 3X13A 1GYAA 1U8OB 3BKCH 3B4NA 2FR4B 1IAOB 3TO2B 1KEMH 2P7TB 4ORZC 1AO7B 5L7XH 1DSFL 3BWUC 4PJIF 1MRCL 3UTTB 4HUUA 5FXCH 1Z0MA 1QLEH 2K3TA 1X5KA 3ES6B 3IDGA 4G42A 3ZE2E 2YEZB 4L4JA 4J4PC 2YRZA 3PF2A 4JFZH 1IZJA 1QHPA 3FB8A 2ADGB 5GS0C 4WI4A 5IMLA 3IS1X 5FUCC 1QFUH 3AY4C 4JFYA 3S9DB 4PV9B 2P45B 1JMXA 1EEZB 3BT2L 3IF1B 1T1WA 1LP9F 4LCCC 1BHGA 5I1IL 1S9VA 2CUHA 4YDLC 5MHSE 1A5FL 5BS0A 4HIIA 5J8OA 1FIGH 4LLUA 4M7KH 1IAMA 5HBBA 1F6AA 4P2OA 4NT6B 2XWBA 2IALA 3VGHA 3SDXF 3DMMB 1EO5A 4NHCH 1RZJL 5DEFB 3S4SB 3ARBC 4R3SA 3EOBB 4FQ1L 1PZUB 2J8UB 2V5MA 4BQBA 4GG6E 4MJ6A 5CJOL 1X6LA 5A2IH 1LEIB 4Z6AT 1DEEA 1TNNA 3EYSL 1TLKA 1V5JA 2YMXL 1AGFB 2EYTB 1QLRB 3LPGA 1CLZL 1T4KA 3BDYL 3KPSE 3MLXH 1BMGA 4H0HB 2BSSB 1TJGH 3FFCA 2XKUA 3QB7C 3VXME 3RA7H 1WT5C 1BFVH 4UT9L 5GRZA 2AQ3A 3T1FA 4ZAKC 3F7VB 4ZS7H 3U79A 2BOBB 1OAZH 2FIKB 2AJVH 1IQDB 5D7LA 5EU5B 3H9SA 3IAQA 4K3JL 3GJFB 3RRQA 2PO6D 4GKNA 2F53D 2WWMD 4GT7A 1LNUA 3TCXA 3O4OC 4M6MH 5L6YH 1VGKB 3CFBB 3M07A 5IB1A 1D5MA 5J1AA 4PJAE 1IVLA 4X7SH 3L1OH 1T1XB 2X6MA 5DD0L 4YHPB 4GRWH 2RB8A 3JSSA 3RWFB 3QWRA 3O6MH 2FJHA 4JRYE 1L6XA 3MJ7B 1E4WL 4HC1H 3VD3A 2IADB 3K3QA 4C55A 3KWWA 3QHZL 4XBEL 1QYGH 4PJHE 1KJ2B 4ERSH 2CLZA 1CGSH 1S8DB 3NA9L 3RWJB 4OV5A 4P2QD 2CKNA 4PRBA 3L5IA 1NMCB 2IH1B 1QFWH 2CIKB 2UY7A 4X4YA 5IHBA 2CGRH 5KZCB 1UWGL 2A77H 1NAMH 3KPMA 3WL9B 4ELKB 4ZFZA 1IC5H 1RZ8B 4QHLB 3O0RL 4YHNA 1YY8A 4NJ9L 1HN1A 2X1OA 4KUCF 2ZUVA 1E6JH 1Y0LB 3ULUH 1MCHA 5FYLH 1CD0A 3TBWA 3GJEA 3WO4C 1INDH 1G7JB 3TT3H 3MJ6A 4QO1A 3T0EA 1LO0H 1K5NB 3PGFH 2KH2B 3VFOA 3EYOB 5GS1B 4WEBH 3VXSA 2FHFA 5D7JC 3TM6A 1OAUL 4KHTL 1K6QH 1PLGH 1ZVSB 3BGMA 2AJZA 1MEXL 2I07A 5HHXL 3WCYA 4HEPG 1BQSA 2DDQH 4D9RD 4Z7WB 4NC1C 5DUBB 5C0BE 2MHAB 1PG7W 3UYRH 3HTLX 2O93L 1I7UB 1OWWA 4JDTH 2MWCA 2DJUA 1JI2A 4JB9L 5J6GB 4MGXA 4Z18A 2KZ1B 4N1HB 4M6AA 4DQOH 4YXLL 3H6JA 4Z7NE 1MHCB 4P2RB 4LAQH 4XNXH 5J9PA 2P8PB 4FQQA 1OW0C 1P4LA 3PNWB 3W5NA 1FYHB 4JPKL 3DVNA 2FX9H 4P3WA 5GPRA 4F57H 2E7BA 4NNPL 1HCVA 5I1EH 1JHKL 3CSYA 1JYVA 1M7DB 2OL3B 3EJJX 3LS4H 4K8RC 4KJYB 5TE4L 4OGZA 1OGAE 1HKLH 4RMSA 3TA3C 4YIQB 1WZ1H 4MHHG 5AZ2H 5FGBC 1ZT4A 1IBGH 5KVEL 4NFDA 2XRAL 4YUEH 4LCIL 1BREA 5E8NA 5JUEL 4NM4H 2WBJD 5HD8C 3RWHA 3PWPE 2YPLA 1U8KA 4M7JL 2I25N 3MV8B 4EN3C 3L95A 4WTZA 1CGVA 1PQZA 1ZA6B 5DJ6A 4MXWL 1A22B 1S5HA 2VLJD 4N0YH 5BRZD 1HILB 2M8XA 3GRWA 1MCOH 2XN9B 4LSRH 4WW2F 1Q9KA 1VFAA 3CZFB 2JB6A 1KIPA 4X7EC 5DI8A 25C8L 1YJDH 4IOFC 4NN5B 2V6HA 4HXBH 3LZFH 3MXVH 3H3PH 3TIDB 4LFHD 4JM2A 1BQHA 2YD6A 4JKLA 1JYNA 1UM5H 4UIMB 3OSKA 5ISZE 3JWOC 1CF8H 1P2CA 7FABH 1XGUA 5ESQB 4ODBD 5EBMB 4DUWA 3LSOA 2AJUL 4ACPA 2VDMH 2EDDA 1G7QB 3D25B 3VG9B 3WN5B 3C87A 1IFHL 2AV7A 2QSCL 3BW9A 4NSKA 1RUPL 4X6EA 4U1IA 3Q6GH 4XPFL 4XVTH 4P59H 4OCYH 2ENYA 3RWGB 5TDPA 1N64H 2J5LC 2DM7A 3K4DA 1XF5A 4F9PC 5B8CB 4R96B 2BDNH 5KG9B 4PJCF 2CKBH 5I8KL 5HI5C 2XXMB 4AL8L 3I75A 3KPOA 4HFWA 1HXMA 1TQCB 3BDXA 4QHMA 3UTZA 1F3JB 5E08L 2BVEA 2D7TL 4ODTL 3CX5J 1JGDA 1NGZA 2W0PA 3B9EA 4TNWF 5FKPB 1CFTA 4S1QH 4UV4H 3AXLA 5C09D 2V5RA 3P11L 5D93B 2Q20A 1JRHH 4P4KD 5FO7A 3BRDA 1WAAE 4NBYB 4WHTB 2FWOA 4U1HB 5GRVL 2I9TB 1VPOL 2F54D 3DPBA 4LLQA 2V7HB 2G60H 3NFSL 3W39B 3HN3A 1F02I 4OD2A 3QEQE 3SOBL 3LN5B 1MRFL 2GHWB 3JWOH 1QO3B 1RK0A 3O3BB 3WD5L 1A14H 1Q9LB 1ULVA 2C7UA 3WV0A 1JHLL 2GTWB 3G04A 3BD3A 4PGBB 5HGHB 3MJ8A 5E1HB 1QHOA 3E3QC 4LF3A 4X4XA 5IM7A 3RVTC 3NTCL 4M5YL 3L6FB 4WU7B 5GGSA 4OUOA 4Y8AA 2V17H 1A1MB 1ZSDA 4LCWA 3CX2A 5DZNA 3BP4A 4BYHA 1CQYA 1UXSA 4JPIB 1MI5B 1L7IH 2PNDA 3E1F1 5CHNA 3ULUD 3BYTA 4HAGA 2R4SH 5FYLD 5TPWH 4HS6B 4H5SA 4M3JA 3TYFA 3C2AH 4NZRH 3B9AA 1ZEAH 1EHXA 4X6CA 4B50A 1VDGA 3TT1L 1SM3H 5FM5M 4PJGE 4I0PA 4R8WL 1WC7B 3MFGB 4I4WA 1G7HA 5L9DL 1RK1A 3HUJB 5C07D 5E8OB 5JW4R 4CJ1A 1AGBB 1T2QH 4EQ3A 1U36A 4GBXC 1I1YA 1CDBA 2HVKA 2J8OA 2XACC 3Q2CA 4PY8J 4QF1A 3VXMA 1U3YA 4R7DA 4WWKB 5CWSA 4O00A 4E41E 3BKCL 2B5IB 3RPKA 2J1KA 4QXTB 4YDJA 1KEML 2Y6SC 1GGBH 4N0CC 2AGJH 5SX4H 4Y5YA 3V4VH 1I8KA 1ZGLM 4KTEH 4I2XB 2H6PA 4LPVA 5CKGA 3CMOL 1QLEL 2O61B 2JE8A 5ESVB 2DLEA 3LPWA 4P5KA 2CK0H 4MNHB 3SPVB 4HK0A 3G9AB 2HJKA 5B38A 4PJAA 4FXLA 4JFZL 5HGAA 1HEZA 5DJYA 3EYQC 1MCSA 5IGXL 1NDGA 2X4NB 3ALXA 3Q5TA 4Y16B 4LL9A 2DYPA 4E5XB 1T0PB 2B7DT 1FIGL 4M7KL 4PJHA 4UOW1 3RQ3A 3OXRA 5DRWA 3BP6A 5LGJB 2VLRE 3FO9B 5EPMB 4CU8A 5E03A 1K8DB 1NFDB 2LFGA 2ZUSA 1EX0A 1EFXA 5TH2A 4UTAH 4NHCL 3DMMC 1MHPH 4R2GD 4XCNA 2Z9TA 4GW4A 4MD4B 4Z7VA 3RI5K 3Q48A 5IKCB 3CVIH 2E8YA 4PJFF 4QNPF 1XEDA 2JJTA 1R3JB 5E1AB 2ZCLH 2I27N 5HHQA 4OFIA 1T22A 2NW3B 2DQEL 4UINL 5E6IA 3JTSA 2A73B 1KTDB 3LH2L 1BEYH 5IHZB 1TJGL 2I26N 2C5DC 2VR9A 3CGTA 1MHEB 5BW7C 1PYWA 1BFOA 2EDOA 3V79C 4W4NA 2IEPA 2Q76A 4BH7A 3FQTB 4ZS7L 1GIGL 1OAZL 2VIRA 2AJVL 4Q9CA 4XXDB 2X70A 3O81A 3EHBD 3KGRA 3CSBA 3MRNA 5DRNA 5JPMA 4FFZL 4NWUH 4JFXB 4XMKH 4EUPA 1CXEA 4JO3L 4GKSB 2LAAA 2WZPD 4M6ML 1KIUA 2AXGA 2IAMB 3SE3C 5L6YL 5IF0A 2JTDA 3KYNB 2WINA 4HWZA 3O4LE 2NYYC 4GUPA 4X7SL 2EH8H 2Q1EA 2DLFH 5F7NC 2XTJE 3EGSA 1RHHB 3TBVA 3M45A 4Z77A 1U3HB 4KDTC 1T1YB 1IGTB 3O6ML 1P7KB 4HC1L 4OZGE 1J8HD 3PDOA 5FYJD 1BD2A 5DHVA 1F4WH 1N4XH 4L8BB 4MHHI 3EOYG 5ALCH 1QYGL 2VXUH 3H2WA 1CGSL 3SN6N 5IVOA 2VZUA 4JREB 4FTVD 1XGQB 4PJ7E 1MFBH 1DZBA 1QFWL 3ZTJG 1NMCC 4HF5H 1PY9A 4LMQE 4X9HA 4D8PB 2CGRL 3CFKB 1JUFA 2A77L 4LU5H 4QTHA 1OB1A 2DI8A 1IC5L 3PWPA 4NNXB 5EUOB 4EI6B 3QDJA 5KTEH 4P3CL 4OCNC 3SE8L 5D2LE 3RHWK 1R0AH 5EU7E 3KJ4C 1E6JL 5J6HA 3TZVD 4PLKD 5D5MF 1HE7A 4YFEA 1P5VA 2FIRT 4PJ8B 4UZGA 3T04D 1T7YA 1INDL 3ROOA 5A2JH 3KJ6H 5CJXA 3CCHB 1LO0L 4CNIA 3PWVB 4M48H 1IM9D 4WUUB 1SBBA 2GCYA 4WEBL 5GS1C 1JGLL 2HFEA 4MQ7A 1H8OA 1K6QL 1PLGL 1FYTA 3C6LD 4NYLB 3QQ4B 1IC1A 1BZ7B 4O2EA 2DDQL 4MA1B 1XGTA 5I1LB 2R2EB 3UYRL 4GS7B 3FTGA 2C9AA 5JXAL 1N6QH 4D2NA 1LDPH 3HZYB 1MJJA 3D39B 4JDTL 1LO4H 1LILA 1YNKH 4IEFB 4ZD3L 5ACLA 1TXKA 2IQAA 2PYEA 2GJZA 4NQDD 5FKAB 3ZE1F 1BP3B 1OAKH 3UBXG 5HHOB 5LWYH 3G5VA 4DQOL 3C2SA 1LO2H 1CDGA 2EYRB 3QIWA 4LAQL 4XNXL 2DMBA 5K59E 3MPCA 1EAPB 3WXWH 4O2FB 1QTYT 1TETH 5DJCB 1MCPL 4KJWC 1RJLA 1G1CA 4F57L 3C8DA 1VKXB 1B2WL 3FT2B 4P3DA 4LLYB 5ICZB 1WFOA 2A6IB 3LS4L 3FQXB 2R29H 3D18B 2UWEA 3DV4B 2Q86A 1HKLL 4PGCA 4UQ2B 3LN4A 2I5YL 1IBGL 2YA0A 1ZHBA 3U36B 3FRUB 1HH6B 1OM3H 3ARPA 4U1LA 5E9DB 3VMPA 4XP4H 4YR6B 2IWGA 1JHTB 1HHKA 3B2VH 3T77A 4NPYB 3WS6C 4MZ2A 5IMOB 1PX3A 4PG2C 5F8QC 4Z5RA 1VACB 5MEPA 1JYXA 4Y4KB 3SBWA 4N0YL 4HGKC 4KKCD 1AIFA 4GMTL 1MCOL 1YEJH 4JZJA 3HAEH 2JCCE 4ODUA 3GNML 1KYOK 1LEGB 3RZCB 1BM3H 5SV3A 4BA8A 4UV7H 1N59B 2EDRA 2ADFL 2EC9U 4NN5C 2OYPA 2RFXA 3R0NA 4HXBL 4MWFB 4IRZH 2AK4D 3LZFL 5DGQA 3MXVL 1OAQH 5JHDA 3BISA 2F53E 3H3PL 5D6CA 2ITDA 4O58L 1IGCH 2B0SH 2VERN 2VZ3A 3QDGE 4XB7A 4J3WA 1CF8L 3EO9H 7FABL 5DVLA 1JMZA 1WF5A 1ZT1B 1L4IA 3MQIA 4S1DC 5C0IA 3CUPA 5T1KD 3OL2A 1MCFA 1S7VB 1M6OB 3VG9C 3WN5C 1IGIH 4KQ4H 3C9NA 5I17B 1A02N 3ESVF 4P59L 4OCYL 5D7IA 5IEHB 1FJ1A 3E8UH 1N64L 4J1UB 4O4YH 1WLHA 4OLYH 3QA3B 3QG6A 3GMNB 5B8CC 2CKBL 4P2QE 2F54B 4IHOA 3DXAB 5DFTA 4HLZG 2VO5A 3CDCA 3FB7A 2W1NA 1YEDA 1N3NA 3S96A 1CG9A 4KMLB 1TQCC 3BQUB 5DQDL 1KB5B 4ZFOL 4DGVH 2ITCB 4TSAL 2VOTA 4KC3B 4Y1AB 2GFBB 1FLRH 4HKXB 4PYHA 4S1QL 4UV4L 2WQRA 4G6KH 3ARXA 2FZ3A 5DD6A 5CLTA 1JRHL 5JZ7D 5TDOA 5D93C 2X1PA 3VXPB 2QADD 4GW1B 3OJDA 4TULH 1ZTXH 4EDWH 4MJ4A 5DURD 3GI8H 2G60L 4L5FH 1U58B 3E0GA 1KIRB 5BQ7B 2EE2A 3HCVB 1MJUH 3JWOL 3O8XA 1WK0A 1T0NB 4Y2DD 1A14L 1MELA 3RVWC 4D9RE 2EYSB 3U4AA 1AGEA 5CBAA 1XF4B 3ZE2F 3JV0A 3LKRB 1RZKC 3RDTB 1JK8A 3FB5A 1UG9A 1U92B 1JPGB 4LPCA 2V17L 3O11B 4G7YL 5CSBA 5DT1H 1MWAH 4RCAA 5JMRA 1L7IL 3EOAA 3VWKB 4KTDH 4C4KT 2AS5M 3TBTB 4G6FB 2R4SL 3K8LA 5C0CD 1JIBA 2BOCB 1CLYH 4U6XB 4YHLH 3RIFF 3C2AL 4NZRL 3LVEA 3QDMB 4FQPA 1BOGA 3TEUA 1E4KA 5DUPH 1SM3L 3LD8B 4ZNEE 4DFHA 3WXVH 2WBKA 5I19L 3I2CH 5I16A 2HT4D 1IILE 1AC6A 4JFFD 2NX5A 1TZIA 1ORSA 3EDEA 4ZO8A 3MA9H 3LEYH 3IDIA 4OLUH 2IQ9L 4BQ6A 3R06B 2IANA 3GIVA 1U8NB 4RBPK 1U8HA 4GG6F 3SKMB 3ARTA 2PR4L 4WWKC 4RISH 4X5WA 1A9EA 5EG6C 4PJBB 1JPFA 2B5IC 2GKIA 3QDHA 4Z7UE 1GGBL 2AGJL 3X14B 1AQKH 3V4VL 4KTEL 3MLTB 5BRZE 2NY5C 5D1QA 4L29B 4ZTPH 2Z8VC 4RAVB 2NMSA 3C5JA 4HXAH 4RMVA 1LD9B 4AENA 5CJBA 2CK0L 3SE9H 3BOVA 2CSPA 4YGAB 4RZCB 4HGMA 5C3LD 4EI5D 1RURH 2DWEA 2HKHH 4YHZL 4AEIH 2WWKT 3V6FB 3QUXD 2CXKA 5ADOH 2OK0H 3PWUA 4TRPH 4Y16C 3T0XA 1T03H 4PJ5D 4NRZA 1QRND 4DGYL 4IJ3B 3V7MA 4NN7B 5T3ZD 4JGMA 1C08A 3GKZA 4XPHL 4PJAF 4HKZB 4NBXB 2HH0L 1RU9H 1MHPL 3DGGA 3UJJL 4CRPA 5E5MA 5F70A 2WLYA 5KN5B 5I18H 3HNSH 3SKOB 2DQFA 1NBQA 1WCBB 5L8LB 1MJ7L 4I1NB 3T0BA 3CVIL 3NIFE 5KSBA 3VDCA 3O2DA 2ZCLL 1X4XA 1ZHNB 2YSSA 3RX5A 3W9EB 3LKQA 3MCKB 1BJ8A 2WSKA 1TCRA 1SHMA 3HG1B 3K80A 5A16B 4QXUH 1BEYL 3NIGE 1FE8H 4NWTH 3LEXB 5C09E 1TFHA 5CGYC 4CVZB 4HDIA 5D2NB 3KPLB 4S11A 4GRWE 4HZAA 3KS0H 1CK0H 4OB5H 4QRRD 4EJ1C 3UBXI 5GSVA 4KI5D 2X4PA 5JNYA 5JW5A 4JFEB 5I0DA 4NWUL 5FK9A 3PWLA 4XMKL 1WWWX 4D0DB 2GAZB 3SKNB 3AU1A 1T66D 5HJ3B 2IAMC 5ETUB 4R7NA 2W0LA 2EH8L 3HMXH 1P6AB 2UYLA 2DLFL 4XX1G 5B39G 1WWBX 3WJLC 2V7NA 4PRHA 2AVGA 3ELAT 5I74B 1U3HC 5J1TC 1S78C 2HTKD 2VQ1B 3FT3B 1JWMA 1T83A 3GHEL 4Z95H 3KLAA 4BSVA 1KSRA 1F4WL 4XGZA 1N4XL 1JZ4A 5MI0B 4Q2ZB 1DP0A 3OZ9H 1W0WA 3ULUE 5ALCL 2OTWB 5FYLE 2QHRL 5AAMA 3O9WA 5EZLB 3CDFA 4AIXA 4YX2H 1KPVB 3FB6B 2YD5A 4JREC 4UIKH 1HH9A 5IB3A 5FA4A 1X44A 4HF5L 5FUOH 4D9LH 5C0AE 4Z7NF 3MTRA 5IQ7H 1KBGH 1WQVT 2AAVA 2YK1L 2FL5B 1ZXQA 4QCIA 5D1XD 3C6LB 3QUMB 1UENA 4GKOA 3QIBA 2FSEB 5H35A 1R0AL 3OAYK 4JCLA 4X83A 3WKMH 1YN7A 4N0UE 1U8MA 5C0FB 4Y5XA 3STLA 3BKYL 5GZND 4PJ8C 2VN7A 2AJ3B 4RFOH 3I9GH 3VGFA 3QT2A 1IGYB 4M48L 3BZEA 3RPIB 2GJ6A 3U4EA 4HIJB 4U1KB 1AP2A 4HQQL 1HDMB 1JNHB 3HZMB 5HYFA 5EBGA 5JIHA 4ODWB 1YEIH 4HZLB 1CICB 3KPPA 4N9GB 3VFNB 5I66A 2E9IA 3WJJC 1EFQA 2OMNA 3IVKA 4X80H 5FYJU 4P46A 3U83A 3UP1A 1CXKA 3QDGA 1ZLVH 5T1LD 3RUGA 4POZD 2P24B 3QFJE 4MA1C 3W81A 3NGBB 3BKJH 3KPRD 4GS7C 3MRHA 3RGVD 1N6QL 4G5ZL 1LO4L 1YNKL 3G5XA 2D7MA 4POYA 1FVDA 4F7EA 5FECA 4TSCH 4C83A 3QYCA 4R26H 5F7KC 1Q38A 4APQD 4ORGA 3MRIA 1OAKL 1E28B 1IGML 4ISVA 5LWYL 2FLBT 4FFYH 3K0WA 1HQ4B 5FV1L 1LO2L 4CAGA 5K9JH 3TYGH 3RWCA 1QOKA 1TETL 4HWEH 3IU4H 4L8CA 2APFA 2WP3T 1PAMA 5JHLH 1UXWA 1QNZH 5E6YA 5H94B 5F72S 3JUYA 1R3KB 4HV8B 5ICYA 3SJVE 2H3NB 1LMKA 5AUMB 4X5LA 2SEBB 1MY5A 1OM3L 2AK4B 3ZT7A 4XP4L 1UJ3A 5CSZB 4S1SH 5D6DC 3B2VL 5HHNB 1JWUB 1OGTB 3V6OC 4Z0XB 4ZO7A 3HS0A 2YPVH 3B6SA 5FYKD 2ORBH 1CR9H 4Q0XL 3ULVH 1UH4A 4OFYD 1CD1A 4Y4KC 5DMIH 1CD8A 4X5XA 1YEJL 5F3HA 1MAMH 3VG0H 2PW2B 4L9LB 3GMRB 1N0LA 4WO4B 1JN6B 1BM3L 2ZOLA 1ZS8B 3RZCC 1WAAF 1XIWD 4JDZA 4PP1C 4U31A 2FEDD 2GITB 3ULSA 1MAKA 1PKOA 1OAQL 3MREB 2XXCB 3GFUA 2Q8AH 3SGEH 1IGCL 2B0SL 3BJLA 4UNUA 3EO9L 3BEVB 3SCMD 1BVKB 1ORQA 3NFNB 3WHE1 2X4SA 4QT5A 5E00B 4NQVA 4MNQE 4NC0B 5EOCL 1CE1H 1IGIL 3HI5H 4KQ4L 2FECI 3DYMA 1J8HE 3IU3A 4OFDA 4FFWD 5FYJE 4PRAB 3C08L 3DUUB 4R0LB 3MNWB 3DX6B 3IAPA 2OL3L 4OGXL 4LAJH 4OLYL 4P5TA 4C56B 4FTVE 1WEJH 2VE6B 4EKXA 3BN9D 5EUKB 5ENWB 2EIDA 2CJUH 4ZUUB 2FGWH 2A83B 3KDMA 4FQHB 2DQCH 4KK9D 4DGVL 3BQUC 4PJ9D 4Y2DB 4WV1B 4PJGF 2UZIH 3MNZB 5BXFB 3IB4A 2XQYG 1AQDA 1FLRL 5E0QA 1FO0H 4MCZB 3TIEB 1AD9A 5BRZA 4G6KL 5TF1L 3GSNH 4JANA 1T89A 1EO8L 1WFTA 1M71A 5IFJA 3OKKA 2XZAH 2AXHA 4TULL 1ZTXL 3FN9A 1EBAA 4I9WD 4EDWL 3B9KB 2H2PC 3GI8L 5D9SB 2MOVA 1T3FB 4L5FL 3W9DA 3IJSA 2QQQA 1UB5A 3SDDD 3ZKND 1DBBH 3MACH 3I85A 1XF3B 1QSED 3QNYB 4O51B 3EIFA 2HFFA 3MRJA 2XFXB 3IKCA 1RJYB 3T0DA 2Y72A 3I6KB 3RDTC 4L4TE 3PWJA 1HI6B 1HXYA 1B4RA 1I3UA 4URTB 5KANI 2QR0B 2YUZA 3N1PC 4G9DB 2B8OT 2FYYB 2WAHA 3C8HA 3PHQA 4NQDE 1PKQE 3ZYZA 4PP2A 1GL4B 4DOHB 1NCDH 4KTDL 5C86A 2UZYB 3VWKC 2F74A 1SEBB 2YXMA 4QXGL 2BHZA 1CLYL 4J4PA 4YHLL 2EXWC 4NQED 4CN1A 1S7TA 5DUPL 4OM0H 1YMHB 2FJFA 2AXFB 3LD8C 3WXVL 3RVVD 2A6KB 3CD4A 2ICEB 4OT1H 4LEOB 3I2CL 1S9YB 3AY4A 3ARFD 1KJMB 1YZZA 3IXTA 4G8FA 1KT2A 3KLDA 4LCCA 4TSBH 1EV2E 3VH8A 4P48A 5MEND 3LEYL 4OLUL 1DQML 1AXSA 3QO0B 4ZUVB 4KJQD 2QLVB 1A6PA 1U41A 2MQ0A 4RISL 4QRTA 5JR1H 1DVFD 3GSRA 2Z31B 2Y9RT 3ARSA 5KSUA 4GQPH 2Y7QB 4K7PX 1QRNB 4HX1A 3VMOA 4ZTPL 4FQCL 2BRRL 3CK0H 4HXAL 3G6AA 4G8EA 1MVUA 3SE9L 5I1JL 3WLWC 3RL2A 3S34H 4C59B 1FVCA 3QO1B 4JQXA 4G9FD 4MLSA 3NZ8B 3VA6A 1I7TB 4WU5B 4PS4L 1FFPB 4XBPA 4DCQB 5ADOL 3V5KA 2OK0L 2H32A 2C26A 4TRPL 1A2YA 5DJ0A 4K07A 4MD0A 1T03L 1WT5A 4ZAKA 4GSDL 4QGYA 3MLSH 4IJ3C 4NN7C 4AIZB 4KAQH 4WI2A 3V9FA 1J87A 4BSWB 1I1FB 5E70A 5K9OA 3EFFA 4PUBH 4WIQA 5FOBB 5C0AA 3ULVD 4JY6B 1WIUA 1ZHKA 3E6FA 3BP7A 3O6LH 3C60B 1QR1B 5I18L 4NKDB 3TGXA 4YGVB 3VCLA 3HNSL 2VL5A 3MRMA 4OZGF 3QUZB 5AYUL 5HDBE 4OF7A 1KLFA 3HE7D 4N0UA 5FEBA 4UDTA 1QP1A 5F7MC 1KCVH 4L8DA 4MJIA 5CMAA 2BVTA 4PJ7F 4KDVA 4Y89A 2G2RA 2XQBH 3WS3B 4F33B 2C4FT 4QXUL 3LV3B 3CFCH 1FE8L 4R90H 4NWTL 3H0TA 1FZKA 3RTQA 4NRXB 5D2LF 3BI9X 4MA3B 4ZSOB 2XT1B 1LHZA 3D87B 5D2NC 4DZBB 2O5YH 3F62A 4K7FA 3SE4C 3VFSB 2HYMA 2B39A 1CK0L 4OB5L 1DBAL 2XG4A 3QFJA 4YO0B 3RVUC 3WUWG 5BOPA 1EEYB 1RJCA 4QHNA 1NLDH 4YDIH 1PDKA 2BY3A 2Z35A 3UROR 3PGCB 2NTFB 2VLMD 3VWJB 3HMXL 4HD9A 1VERA 1H3PH 2XZQH 1ZHLA 5I74C 2ZSWA 2DMCA 5INDA 5A3ID 2OJEB 4FS0A 2C3VA 3CC5A 5EU4B 5C0DA 1OP5H 5I0ZA 1NFIA 1NC2B 1KTKE 1R3IH 5D7JA 1EO7A 1VB9A 4PLKC 4WTWA 5MI0C 5C0CE 1EXUB 4YX2L 4UIKL 3SJVA 1PEWA 4XNUH 5FUOL 2GT9A 3KYOB 2P5WE 5EU6B 4D9LL 4GLRH 1KBGL 1N5YL 3QIUD 2XV6B 5HGBA 3S35X 5K59F 5EC1B 3C6LC 1OTTC 1T80A 2ICCA 3DV6B 4JFFE 3UJTH 2X40A 2HMIC 3MLVL 4YHYB 5FO9B 2X4UA 1BZQK 1WV7T 5IBLC 1XR9A 1LEKA 3QULB 3OB0K 2FEEL 4ZOAA 1O7SA 4RFOL 2FDBP 4K3DH 4UB0L 3VFWA 2MPAL 3I9GL 5BOZG 5C0NC 1OW0A 1DE4B 1N5AA 2AEQH 2CDGA 2H26A 2XA8H 3ZSTA 5HYSG 1GOHA 1YEIL 5D1ZD 4DVBB 2CR3A 1CICC 5JXEA 4X7FC 1OD7A 3HPLB 4L3AA 5CCKL 4U0RB 2P5EB 3TA3A 4XAWH 5SWQB 3IETA 3ARDB 5FGBA 2CKBA 2BERA 1I3GH 5B21A 2JCCF 3MCLL 1S7QB 3BKJL 3ESUF 4CVXA 3NGBC 4EN3A 3TN0D 2X89A 3UPCA 4MNQA 5I8EB 1BQHG 3TP4A 4JN1H 4TSCL 5F1NB 5ACZB 3PXHA 1YNLH 4PJ5E 4FFYL 2BFVH 2PTVA 2GQHA 5HDLA 3CFEB 3NCCB 3QNXB 5K9JL 3MLYL 4ETQA 2BSRA 2VL4A 3L3KA 4LSVH 1QBML 3CXHK 4TPRH 4OBRA 3OR6A 3DRTA 5IWLC 5GGUB 3PXJA 1FAIL 1NDMA 4HWEL 3IU4L 4DK3A 5AEAA 5I1HH 3QUMH 4KKCC 5IESL 5JDSB 4W68A 5JHLL 1QNZL 1UZ8B 1AR1D 1NGWA 2EZ0D 3U7WH 3DX7A 3CDYA 5JO5B 4QOKE 3PL6D 1YPZB 3HRZB 5ICXA 2VZOA 1U9KA 3HE6A 4Y4FD 1U6AH 4KMTL 3GMQB 4HULB 2EXYD 1EGJH 4HS3A 3OAZH 2QKIA 5BVPL 1QSFB 3CDGA 4BZ2L 2YPVL 5EO1B 4PY8I 1A4JB 1RZGB 5ANME 2ORBL 4HJGA 4PD4J 2R1YB 2AJXL 2XWJB 1H3XA 5DMIL 1Q0XL 4F9PA 2LABA 1UH3A 4L9LC 4M93B 3NFPB 5HHPA 2OR9H 4P2RE 4WO4C 4PR5A 2W07A 2WW8A 4NCDA 4QRRE 4AQOA 3P9LA 43CAB 1OAXH 3BD5A 3C8KB 4KI5E 3QRGH 5IBTH 4YDVA 4L4TA 5F1SA 3VFVB 4OZHE 2Q8AL 1OF2B 4AT6B 3VA2C 4OZFG 4KZEL 2D4DA 1AGDB 1GAFH 3GZKA 3SHSA 3L5JA 1FG2A 4OZIE 4CN6A 4O5LL 2DJ4A 4LHUD 3VFUB 5FFLA 1JV5B 3MV8E 5B3JE 2DWDA 4JJ5A 3IDXH 3K7UA 4U1MB 1CE1L 3HI5L 3Q1SL 5DTFB 1YEEH 1HQRA 5F96L 1AKJD 3EYFA 4R0LC 3OKNA 4JFQA 1FPTL 5FYKU 1MCJA 5D72H 4HWBL 4CVWA 5L2JA 1WEJL 2E9WA 3MJ9L 4WY7L 4TNVK 3T0VA 5EO9A 1NKRA 2ICWA 2CJUL 4EBQL 3BIBX 4OF3A 5IOPB 3O3EB 2DQCL 3ZKMC 1CFSB 2JB5H 1FFRA 1MCEA 2NY3D 2UZIL 4Y2DC 3D2UD 4WV1C 4I48A 1F6LL 2R0ZH 1FO0L 5DC9B 2R1XA 4PRPD 2RJMA 3SO5A 3KXFB 1NUDA 3CFDB 3GSNL 4NQUA 5IR1A 2OXGA 4YXHH 2JF1A 4JFHD 4HGWB 5BVJA 2XZAL 2P49B 1A1NA 1N8ZB 4OLXL 5F71A 5IW3A 2G5BA 4HWNA 4ODHL 4YPJA 2V2XA 3B9KC 4RQQB 1G6RB 1QR4A 1XR8A 2ESVE 3EJZC 1JWSA 3MRCA 4L3EB 2I9LA 3HI1B 2AW2A 1LO3H 3RNQB 5J7CC 4OGAC 1FFOA 3FN3A 2BNRA 3ZTNH 4DN4L 2H2SD 4Z7UF 3MACL 4JKPL 1NC4A 4JDVB 1S9KC 2CLRA 1ZLSH 3ARQA 2HN7A 5BV7B 1F90H 4GBXA 4LQFH 2GIYA 3L9RA 4LOUD 5GGVY 3A0OA 4NZUL 5B38G 4JRXD 1OSPL 3K81A 3KPRE 3TVMB 1WUNT 3L7EB 1B0GB 1U8OA 3MLRH 4PLNC 2HT4C 4UU9B 4TNWK 3TO2A 4JQIH 1X5HA 4PJEE 1T5XB 2P7TA 3PWNB 1AO7A 4HSQA 1NCDL 2CRMA 3O6FA 4PTTB 4R97B 5CGMA 3CSGA 2J8HA 3ES6A 5DQJB 2YEZA 1CGYA 2DD8L 1MNUH 3OX8B 4OM0L 2E7MA 2VH5H 3WHXB 1JZ2A 2ADGA 4OT1L 3MV9D 1KB5L 4DKDC 3REWB 5EOQH 4QRUB 3MGTB 4PV9A 3MFFB 4TSBL 4RMTA 4TTDC 3IF1A 4JFOB 2GSGB 3LB6C 3L3OB 4YDKH 4KKLC 3CPLB 1MFAL 2EDNA 5EULV 1I9JH 4EI5C 4LSDA 1VFBB 3NIFF 4IRSD 4KRMB 5JR1L 3DMMA 3MOQA 4G6AC 3RU8H 2Z31C 3E6HB 1P1ZB 2B2XH 2WLZA 4JPWH 3EOBA 4WEUD 1A6WH 4OSUL 2HLFD 2J8UA 3HNTH 3NIGF 4P49A 3T3PE 3CK0L 4M03A 3LHPH 2P1YA 1LEIA 1U3ZA 1OVZA 4FHBD 5EO0B 1AGFA 4LSUL 1LE9B 4PJDE 1QLRA 4GRWF 5SWZD 5A2KH 1GH7A 3KVQA 2YA2A 1S9XB 5JIPA 5E2TH 3UBXB 4NQXB 5BW7A 5FV2A 1I1AB 2XKNB 2IGFH 4DTGH 1VGEH 4V1DB 3ARVA 1FNGB 5KOVC 5C0CA 1FL3B 3MLSL 4OD1H 3F7VA 4FA8A 2FIKA 3EFDH 4KAQL 1IQDA 1PY4A 3JV6B 5EU5A 1A6TB 2EDWA 3GJFA 3GMPB 4PUBL 3W2DH 1AHWA 2P5WA 2XQYK 5JLZB 3VRJB 4X4ME 2HTLD 3C60C 2VWEE 2AI0L 4PRNB 4W6YB 3W0WE 4JR9H 1MFCH 3QI9B 3QUZC 3MJGX 3ULUF 5IMKA 1HSBB 2DICA 4G6JL 5KVDH 1AXTH 4FNLH 4S1RH 7CGTA 1T1XA 2J3SA 1KCVL 1IKNC 4YHPA 4KDTA 3ZL4H 2C1PB 3RWFA 4BQ8A 2XQBL 5IVZA 2JIXB 3MJ7A 3CFCL 2IADA 4R90L 3V52L 1B4JL 3QZWA 1X5GA 5M94B 1SBSH 4F7TB 3V5DB 1S8DA 3RWJA 1VESA 2EDFA 2BC4B 1IEAB 4I9WE 3V4PL 2IH1A 5SWSB 1H5BB 4NO0B 2CIKA 1NGXA 3B5HA 1DEDA 2G75B 3WL9A 3LQAH 1BZ9B 4ELKA 2Z92B 1NLDL 1RZ8A 4YDIL 1GC1C 4QHLA 2OJZH 1OOAA 1QSEE 5F89A 1Y0LA 2H8PB 1RPQA 2COQA 3VWJC 4CGTA 4KTYA 1H3PL 1G7JA 2Y36H 1PGRB 1K5NA 4PRID 3EYOA 8FABB 5GS1A 2ARJB 1R3IL 3X11B 4M8VA 4DUVA 4K7PH 1ZVSA 1DBKH 4NQEE 4Q6IB 4QOKA 5DFVC 4Z7WA 3RWEB 1GRWA 1X5IA 4OLZH 4XNUL 5LJYH 3FFDA 1FBIH 2MHAA 4U6HB 1I7UA 3U7YL 4PJIB 2FX8H 1ITBB 5L8JB 5J6GA 4YK4B 3IAGC 4PJXB 2MQ3A 4MAYD 3VXUB 5MENE 1FP5A 4H8WH 1D5IL 4YHYC 2G5RA 4CDHA 4YPGA 4NUJB 3HC3H 4RWHA 2OM5A 2AQ1A 3OKLB 5SX5K 4XBGB 4PB9H 3LOWA 1MHCA 3TN0B 4P2RA 3LRSB 2P8PA 1JNNL 1DLFH 1DUZB 2AEQL 3MV01 2XA8L 3U1SL 1LP9B 4I0CC 2EEAA 4N8VG 3ZSSA 3T08A 2OL3A 4GRMB 4NO5A 4KJYA 4U3XA 4MJ5A 4U0RC 4P23D 1GGIL 4YIQA 2Q3ZA 3RX7A 1OLLA 1I3GL 1QBLH 3H9HB 3SDXB 1N0XH 2W91A 3WS6A 1ZMYA 4LSPL 3V6ZB 4PGJA 4G9FE 5JTWA 4PG2A 4Y4HB 1UJTA 3MV8A 3U46B 1K4DB 1ZA6A 4HIEB 4JN1L 2WIMA 3NACH 2PXYB 1YNLL 2EDHA 1HILA 2BFVL 2YBRB 3CZFA 4JN2B 3CFIC 2VABB 5FUZH 4FFVD 4P5MB 3ULVE 3SGDH 1DFBL 1RUQH 5I1HL 3QUML 3TIDA 1JCKA 4IS6B 1VEMA 2VXQL 3K8KA 4UIMA 3U7WL 3U0TB 3MRFB 2DI9A 5I8CB 3QNZB 1TPXB 3LN9A 5ESQA 2HFGH 5EBMA 3GRWH 2VTFA 4LLDA 4ZYKB 3PDDA 4X6FB 1G7QA 3D25A 3UTSB 3WN5A 4P2OD 4GMSH 4LDEB 2ESVA 1EZVX 3VRLE 4DUXA 4M9OA 4U33A 3QWOB 3RWGA 3WSQH 2FD6H 5B8CA 4R96A 5KG9A 2OR9L 4M93C 1OARH 5EFIB 5DJZB 1OAXL 4FFWC 4X6DE 3QRGL 5IBTL 2VXVL 1XMWA 5IV2B 4LDOB 4ZUTB 2VLME 1NSNL 1V3JA 3QEHA 2BSTB 5C2BH 4LARH 3FFCD 1GAFL 4WHTA 2APWA 4U1HA 2I9TA 2VYRE 3ILPB 2OQJB 2NY3B 5HVGB 2ICWJ 1TVBB 5D7LD 3IDXL 2V7HA 1N7MH 4MD5B 3H9SD 4PPTA 3W39A 3NCFB 1MCRA 1PJ9A 5F7YC 1EDQA 1NEZG 1QO3A 5D72L 2GTWA 3KNBA 4PGBA 5HGHA 5C6TH 3LQMA 4WW1B 4L1HA 3WFEH 3AS3A 3RAJH 1HHGB 5ADPH 3L6FA 1A8JH 3ZKNC 4HCRH 1TZHB 1A1MA 2JB5L 1S3KH 1ZV5A 3QWRD 5M95B 4RRPA 1EPFA 5GGTA 1XH3B 4HIXH 1B6UA 2R0ZL 4JPIA 1MI5A 3OAYH 4JRXB 3O3AB 1KTLB 4LSTH 2V9RA 5F7WC 4RMQA 4YXHL 1RFDH 1JP5A 1KC5H 5EBWB 4JAMB 3EDKA 2ERJB 4MMXC 1YECH 4NJAL 1DQDH 1DBML 1S7SB 4HIHB 2IBGA 3ECBB 1LO3L 1MCDA 1K2DB 3ZTNL 2V5YA 3HUJA 1QUNA 4HW6A 3LAFA 1AGBA 5E7FA 4LQFL 5BV7C 4CKVX 3B5GA 1WJ3A 2CQVA 5B39B 1TTGA 1DQJB 4WWKA 1BJMA 3RVVC 1YMMB 2XNAB 3OTTA 1BFTA 2VB5A 3ARFC 5EWIH 4JQIL 3IDNB 3T0ED 4OIBA 4NKIH 4I2XA 3QUKB 4QY8B 4R97C 3VXSD 1VSCA 2O61A 3TFKC 5ESVA 3W0WA 1T7ZA 3QEUB 4N1EA 4MNHA 3SPVA 1UWXK 5FHAL 2NY1B 2E7HA 4G8GB 4HUXB 2VH5L 4N5EC 1J1PH 4ZDHB 4LBEB 2ICES 3DX9B 4LRIC 3WFBH 1E4XL 1L0YA 5EOQL 2X4NA 3VXRB 4Y16A 2A9NH 4WW2B 5F6IB 4P9HH 5DF0A 1AGCB 5HGDA 4WJ5B 4YDKL 4E5XA 5DA0B 5GRWA 1RULH 4B53A 1EHLH 5HDBF 2Q7NA 2DQIL 5FA3B 5LGJA 3FO9A 5EPMA 4JY4A 5IVXE 4KQ3H 1K8DA 1NFDA 2AKRA 1TIUA 1G6RH 3AM8C 3RVXC 3UXFA 4BH8A 4HUWB 3RU8L 5DXWA 4H0IA 2B2XL 2EDTA 1T21B 5I8OH 4MD4A 3RIFK 2H41A 2E3VA 1K3IA 5DO2D 5E24E 1KELH 4MQXD 1R3JA 1TJHH 5I75B 2X41A 3OKDB 3GK8L 1IZKA 2CIIB 3FZUC 3OKYA 2NW3A 4YFDB 2A73A 1KTDA 2YPLD 5DHXB 3VRIB 1B9ZA 2NZ9D 4ETYA 5IHZA 3KLHD 4KK8D 4YBLB 5HVHB 5K9QG 1MHEA 1I1AC 2IGFL 4PJCB 4DTGL 1VGEL 3S36H 3HKFA 3O41B 3FQTA 1VENA 1CTNA 4H1LG 3EFDL 5J3HD 2OXHA 4XXDA 1QQDB 1J1XH 3SDCB 3W2DL 4XTRD 2ZKHL 3AREB 4CJ0A 4JFXA 1C8PA 1GSMA 3TJEH 4GKSA 5F9JB 3UPAA 4HBQA 2IAMA 4JM2D 3BIKA 4JR9L 1MFCL 3KYNA 3QI9C 32C2A 3DROB 1Y6MR 5KVDL 4J3XA 4S1RL 5K33A 3WJLA 4B0MM 3QXTA 4MDJB 1RHHA 3PJSB 3SY0B 1T1ZB 1U3HA 3ZL4L 1T1YA 4Y5VB 3GB7B 1IGTA 2PW1B 3VD5A 4NM8L 1P7KA 2UZXB 4J6RH 4U6TA 2PTTB 3FOMB 4L8BA 4PRPE 4RIRA 2NXZB 4S2SB 1J9CT 1SBSL 2YUVA 4EUPH 4ENED 3OGOE 4JFHE 3FQNB 1I4FB 1GZQB 4RAUA 1XGQA 4YH6A 4PRIB 1BWWA 1CE6B 4N9OB 5HI4C 1H5BC 1M7XA 4D8PA 3CFKA 4WHCA 3LQAL 2VZ1A 4NNXA 4IDJH 5EUOA 4OF6A 1J05B 2OJZL 4Q9RL 5DC4B 4AY0A 5IIEB 2EDLA 1PBYA 4FQLL 4P2CG 5DHVH 3INUL 2Y07H 1ZLUH 3FONB 5EA0H 3UDWC 2HT2D 4F7CB 4OZ4B 4PJ8A 3PQYB 5CZKA 1S9WB 4E42B 1Q9WB 3G6JE 3HG1E 3CCHA 5T1MA 3RL1B 3L3GB 2Y36L 1A6ZA 3NCJL 4WUUA 3JVGC 4S0SD 2IPTH 2VNCA 2IJ0C 4X7CC 4FN0A 4K7PL 3WJJA 1DUYA 4NYLA 1DBKL 2FATH 5FO8A 3QQ4A 2RCSH 4FG6C 4EOWH 2VLKB 2BCKA 4Q6IC 1DL7H 5GHWH 4GW5B 4OLZL 5I1LA 1FBIL 4BQ9A 3AAZB 3HZYA 1CU4L 3D39A 3MV9E 2VDLH 4KKBC 2FX8L 5LGKA 1YQ2A 5EOCJ 1FC1A 4LCWD 4YK4C 2JJVA 1T20B 4R4ND 5FKAA 5H8DA 5HHOA 4H8WL 2QQLH 4WHYH 1TENA 2YZ1A 2NY0B 3VXOB 3X13B 4KJPC 2EYRA 4UTBL 3TN0C 4OM1H 4WHDA 1EAPA 1DLFL 2CUIA 4O2FA 1GC1L 3EJYC 4I0PD 3MOBH 5HYJB 4X6DA 1YEFH 3RWIB 3FT2A 2G9HB 5IT2H 2EDXA 2CR6A 4LLYA 1PSKH 2A6IA 2HRLA 3FQXA 2P8LB 3D18A 4LHJB 1K4CB 3DV4A 4HWBA 4UQ2A 2APTA 3J7HA 2DBJA 3MJ9A 3U36A 1QBLL 4JFDB 1JGUH 5E9DA 4YR6A 3VXMD 2NXYB 5SWZE 1JHTA 5LKNA 4NPYA 3V6OA 5IMOA 4Y4HC 4X9FA 2YD1A 1VACA 2EDQA 4KI5F 3NACL 2D0GA 4Y4KA 5CIPB 2PXYC 3UTPD 1W0YT 5BS0B 3B2UD 4PJFB 3BUYB 2OTPA 3MCG1 5A2FA 2VUYA 4LLUB 4OZHF 4JHZA 5C08E 2APBA 2EDEA 5DJDB 4XH2B 1GXEA 1NJ9A 4LSSH 2R23B 4FQXB 1LEGA 5FUZL 3RZCA 5H2BB 4OZIF 3U48A 1N59A 4NQCB 1KEGH 1XCTB 4P4RB 5JORA 5B3JF 1RUQL 1PD6A 1XAUA 5AZEH 3ZYIA 5FAAA 3SQBA 1NEUA 1NANI 4XWOD 1MREH 1P9MC 1KB9J 2VAJA 1WGOA 2HFGL 1XZ0B 2DYPD 1TPXC 1ZT1A 2NY6D 3QUYA 1T4KB 3TO4B 4KV5F 4F9LC 4GMSL 5L2KB 4HJJH 1EFXD 2VXSH 4PREA 5I76B 5I17A 5ITFB 4TUJB 4ALAL 1EIBA 2C4FU 3WSQL 4J1UA 4G8IB 3T1FB 4HS8H 3QA3A 4Z8FH 4GRLB 5DMJB 3T0AA 4C4KO 4O9HH 1HOCB 3DXAA 3H9SB 3UYPA 1EBPA 3F12B 2WNGA 1G9NH 1CT8B 2FHCA 3ARUA 5TDNB 1X5FA 3BQUA 1KB5A 5E6ID 3IDYB 4LFHG 3VGGA 4J23A 1UWEH 4PLJD 4Y1AA 4ZOEA 2GFBA 5IB1B 1D5MB 1HHJB 5C2BL 4LARL 3TBSA 4FQJH 1QZ1A 3S5LG 3VXPA 4WI7A 2F5AH 1L0QA 4XXCC 4ONOA 3MLWH 2NY3C 4AH2B 1BGXH 2VDKH 4PGEB 1NUFA 1N7ML 1U58A 1KIRA 3KWWB 5BQ7A 4ODVL 5MEQB 3HCVA 1CFNB 4PJEF 3QCUL 3TJHD 2CLZB 3L5WA 4TYUA 1F11B 1IT9L 1EJ6A 3BE1H 5D5MB 1T0NA 4QRSB 3BT2H 2EYSA 2FO4B 5C6TL 4X4YB 1XF4A 3VMNA 4I18B 3LKRA 3RDTA 3RAJL 4JHBA 5DFWH 5ADPL 4Y4FA 5ACMA 2GJJA 2H2SC 1U92A 3BZ4B 4HCRL 1JPGA 5EU3B 1OY3B 1YY8B 3O11A 4OV6F 5KSAA 1S3KL 1ZGLP 3GMOA 1C7SA 1SJVA 3VFPB 3JV5A 2W92A 2WWKO 4HKJB 1BD2D 3DVFA 4LSTL 3TBWB 3GJEB 2BOCA 4U6XA 4FQ1H 4Z76B 3QDMA 1OWRM 5CJOH 43C9A 2ERJC 1MVFA 1IC7H 1YECL 3MR9B 1D9KB 1DQDL 1I1CA 3WUWB 1KULA 2EIZB 3QDAA 4RGOL 2X9WA 3U2SA 4A6YB 2MMXA 4MNGB 3BGMB 3PWPD 3QDJD 2AJZB 1LO5B 4HJ0D 1T6WA 2R15A 3R06A 3I6GB 4HPOH 1GOFA 2IBBA 3S6CA 1GGYA 3HRPA 3SKMA 3TH2T 3GGWB 5DMGD 3PUCA 1X5LA 5EWIL 4QRPD 2BVQB 3KS0J 5BZDB 4KKNA 4NKOB 4PJDF 3X14A 4NKIL 1F4YL 3RJDA 2EO1A 1QLFB 3FOLB 4L29A 4L4VB 4RAVA 5C71A 1JZ5A 1H8NA 1FYTD 4HHAB 3VJ6B 2NY4D 4KRPD 4B5EA 1CGXA 5CGTA 3FMGL 4FQQB 2NY1C 3BRGC 3R1GH 4RZCA 1GHFH 2DKSA 3QJFB 1J1PL 1S5IH 4MAUH 4WI3A 3HFMH 1RD6A 3WFBL 3V6FA 2HLFC 3CSYB 5HY9B 1W72H 2PYED 2A9NL 5GS2H 4P9HL 4WW2C 5F6IC 4NO3B 5D7SH 4GQ9H 1RULL 3QHZH 4XBEH 4Y19B 2YPLB 2CRYA 1J0JA 4WFHE 1G6RL 3QIWD 2BVPB 4HKZA 2O5ZH 1PQZB 4LGPB 1FORL 1EZVY 1MF2H 3WE6B 5HYSB 4R4FH 2DAVA 1UWGH 2DB8A 5I8OL 3VFTB 4LLVB 1I7RB 3SKOA 4JQVA 3FAWA 1IL1B 1WCBA 1OTUD 5GRUL 4YE4H 2OTUB 3OPZL 1KELL 1CFBA 5FB8B 1TJHL 2EE6A 3FO0H 1ZHNA 1A9BB 5I75C 1MLCB 3W9EA 3IFOA 3MCKA 2HT3D 5CP3A 3HG1A 1BQHB 2H45A 5A16A 4NZTL 4QWWC 1E27B 3LEXA 4YHIB 4YBLC 5CZVH 5HVHC 1YN6B 3FFCE 4XCYB 4CVZA 2IC2A 5D2NA 3F58H 3KPLA 3EOTL 3IRZA 5MERB 2E6QA 3SE4A 1G9EA 2NY7H 3BHBB 5D7LE 4UNVA 2AV7B 3O2DH 2VITA 1J1XL 3BW9B 3SDCC 1AFVL 3DETC 3QFDB 3AREC 3G6DH 4JFEA 5EIVA 4ZXBB 5JHDD 2GAZA 3FJTA 3SKNA 1XF5B 3FRPA 4JB9H 1JJUA 5HJ3A 4KKAC 5ETUA 3X17A 3I75B 1A1OB 4NKMB 1WCQA 4RNRB 2Q6WB 1J0ZA 4CL7A 3U7AA 5I9QB 1T5WA 4TOYH 3FT3A 2VQ1A 4Y5VC 4QRQA 4RGND 3T2QA 3BD4A 4J6RL 1GOGA 3P9MB 1OSZA 3IJHB 4HWUA 4PBXA 4Q2ZA 3LS5L 2OTWA 2NXZC 5EZLA 3GO1H 4NNPH 4ODSH 1MIEH 3FB6A 3PHOB 3F8UB 2AK1H 5CEZH 5ALBH 2Y5TB 4TVSa 3N1MC 3H7BA 5KVEH 2X4RB 2XRAH 2FL5A 5I1GH 5A1AA 5KW9H 4I3SH 4IDJL 1N6VA 4D3CH 3QUMA 2FSEA 4M7JH 1NBVH 1CFVH 4OZFB 4MXWH 4M00A 2Y07L 5C0FA 5EA0L 4E0RB 4LF3B 1G0DA 2KZWA 3VFMB 5IM7B 2PYFB 5C08A 1DDHA 4ZFFB 1NQBA 5F9OL 4IOIB 3RPIA 1YA5A 3QEGH 4HIJA 4U1KA 3HZMA 1JNHA 4ODWA 4WUKH 3VXSE 4Z0BH 5B4MD 3OKMB 1CICA 4HZLA 4N9GA 4OLVH 2FATL 1G7IB 4H5SB 2RCSL 3BUTA 4GG6B 3O8XD 2EIEA 4EIZC 2D7QA 3QQ9C 1DL7L 5KOMC 1R3LA 2P24A 2MSPA 2KDGA 2R69H 2AJUH 2VISB 1C1EH 5CJQL 2BZDA 3KPSB 4YEFA 5J89A 3ULVF 2X1QA 3N9GH 3UAJD 1U91B 1ONQB 1E28A 3GSOA 4W6WB 1RUPH 3AMKA 4YLQT 3NA4A 1HQ4A 3VXMB 1OQOA 1VCAA 2NY0C 3K2MC 4OM1L 4YDJB 5KSVB 1KCKA 4NDMB 5IWLA 4Y5YB 4MA8H 3FO1B 2AEWA 3EYUH 3MRLA 4X7TB 1X9QA 5IJKC 3ZMRA 2B4CC 4K3HA 5IT2L 5H94A 1IAIM 3VRLF 2NLJB 5HHMB 5A40E 4HV8A 2NX5D 4YZFE 1H3GA 1MCCA 3LRHA 4YEEA 5TQ0H 1ZE3C 5B38B 5AUMA 1C16B 2RHEA 2SEBA 1OT1A 1JGUL 2IAND 3P11H 5CSZA 2NXYC 4K9EC 5HHNA 3SDAB 1JWUA 1I1RA 1NDGB 4Z0XA 1C5BH 4IIQB 5D96B 4JRYB 4X6DF 5GS2D 3NFSH 5F3BB 1MAJA 3MA7B 3V0VB 4M5ZH 5F6HJ 2PW2A 5D1QD 3SOBH 4YXKL 2QEJA 5DRWB 3GMRA 4WO4A 1MRFH 4JZNB 1JN6A 1BBDL 4JO4H 4FQXC 1ZS8A 4X6BB 3V2AR 2RR3A 1K8IA 2GITA 2YWZA 3JWNC 5AZEL 3MREA 4YHOH 2YA1A 1HSAA 1YC8A 1MREL 2GK0B 1A7NH 4GH7B 2DRUA 1BF8A 3BEVA 1QD0A 1BVKA 4OQTH 2Y1VA 2D0FA 4U1GB 3P30H 3NFNA 1NKOA 3D69B 5DC0A 5E00A 5E6IB 3DTXA 3TO4C 1F2XK 2BRQA 2XICA 3IGAA 4HJJL 2VXSL 5HXMA 4BSJA 4PRAA 1BFOB 4R8WH 4WFFD 3DUUA 2D2OA 4CN4A 4R0LA 3MNWA 3DX6A 3KYKL 1QFWI 1QKZH 5HGGS 1UB6B 1FC2D 4HS8L 4PYGA 4BQCA 1CDCA 4Z8FL 4C56A 1JPTH 2M1KA 4GRLC 2VE6A 5J0BA 1NGPH 5EUKA 5ENWA 5C0BB 4ZUUA 5EN2B 1E4JA 1P4IL 2A83A 4FQHA 5FGRA 4FZEL 3P4MB 4WV1A 3UTQB 1OAYL 3IDYC 3MNZA 5BXFA 1UWEL 3MV11 4X0KB 4HWZB 3TIEA 3B3IB 2BVOB 1Q0YL 2FX7H 2Q7YB 5GRVK 1XF1A 4FQJL 1QEWB 1PG7X 4Z77B 2F5AL 4M7ZB 3CMOH 3B43A 1L7TH 3B9KA 3MLWL 1P6FA 4UBDD 5D9SA 1BGXL 1T3FA 2VDKL 3WIHH 4X8JB 1CDUA 2QQKH 2YD7A 3C5ZB 4KROB 2FECL 3QNYA 5IGXH 2HLAA 3BE1L 2X4TB 4Y7MA 5I30H 4O51A 4Q97A 5C8JB 2XFXA 1HZHL 1OGAB 1RJYA 4BKLB 2JJWA 1BLNB 3I6KA 4I18C 3K1DA 1WTGT 4PRHD 3PWPB 1HI6A 1MCNA 1ADQH 2QR0A 4DKEH 4LCWE 4G9DA 2FYYA 4PGZA 2W9EH 3RY5A 4P9MH 3MODL 1SEBA 3GSVB 3ARWA 3O9WD 3HI6H 1BIHA 3BZFB 1JZ7A 4LKXB 4PD4K 3T0EC 2XWTB 4X6CE 5EB9A 1IC7L 5MP6H 2AXFA 1D9KC 5IVXF 2FRGP 2A6KA 3DUHA 4MQ7B 2ICEA 3WUZA 4LEOA 4F7MB 1JI1A 1FCCA 1S9YA 4MS8D 4H26B 4CADB 1KJMA 3WKNA 2DQEH 4UINH 1X5JA 4G43B 3NABL 3JWDC 3QIBD 1D5XB 4XWGH 1HYSD 2DS4A 5ISZB 3LH2H 4N0RA 4AMKH 4HPOL 2ZSVB 4ZUVA 1L9NA 3H8NA 3RY6C 3O3UN 1MJJB 5J13C 2JK5A 4RDQG 1GIGH 2OZ4L 2Z31A 4RX4A 1DLHB 2VRAA 4RFEB 2DQHL 2GJ6D 4JJHA 1NMAL 1I8LA 3UTPE 5GS0H 2BX5A 1UQSB 4NZDA 1NAKH 4FFZH 4JO3H 1NBYB 4KVCH 4I3GA 4KRLB 5T3XH 3STBA 4P46D 3CVHB 3QDGD 3R1GL 1GHFL 4HK3N 1HK6A 2D9CA 1MHHB 1S5IL 4MAUL 3HFML 3NZ8A 1KXQE 1I7TA 5I6XB 4WU5A 1FFPA 4DCQA 4F58H 3JTTB 1W72L 2QQNH 2X9YA 4LCYB 3MBEB 5JPNB 3OBAA 1ACZA