5I8EA

Crystal structure of broadly neutralizing hiv-1 fusion peptide-targeting antibody vrc34.01 fab
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
221
structure length
217
Chain Sequence
EVLVQSGAEVKKPGASVKVSCRAFGYTFTGNALHWVRQAPGQGLEWLGWINPHSGDTTTSQKFQGRVYMTRDKSINTAFLDVTRLTSDDTGIYYCARDKYYGNEAVGMDVWGQGTSVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VRC34.01 Fab heavy chain
total genus 37
structure length 217
sequence length 221
chains with identical sequence C
ec nomenclature
pdb deposition date 2016-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eA01
4HEPG 2FECI 3D0VA 2FX9L 2A6IB 3UTPD 1LP9F 2VLRE 3M45A 5JHLL 4G3YH 4JN2B 1CU4L 4XNMB 4RMSA 1YYLL 2XQYK 2HKHH 2P4AB 1Z9OA 4YDJA 2DLEA 1AJ7L 2AK4B 3TBSA 3PQYA 1S7SB 1BAFH 3MA9L 4QHLB 3TO4B 3IDIA 1U3JA 3KYOA 5DEZA 3HPJB 5KSUA 3EYFB 3C60A 8FABB 5CIPB 4YK4C 1OAQH 3K74B 4OLVH 4WWKB 4Y5XA 3O3AB 2DQTH 1QKZH 3WJLA 1A3QA 3VRIB 1RZ8A 1VA9A 3OR7B 3FQXA 1V7NH 4K9EH 1QRKA 3BPCA 1H15B 5ACLA 3CD4A 3D6GA 1ETZA 2BY0A 3Q1SL 2ZOLB 5D7LE 3KPRE 5FYKL 4ZOEA 1I3VA 3QDME 2OR7A 5C07A 4NNYB 5EZJB 4HX1B 3TBVB 4AEIH 5L8LB 4BH8B 3WHE0 5T1KD 5FECB 3TO4D 1CN4A 2FRGP 4ZS7L 2F53A 4ALAL 1FBIH 3L3OB 3UTSE 2OP4H 3MA7B 4HG4J 3N06B 1YUHA 4PV8B 1JWSA 4RFEB 5AD0A 5I2IA 2NY4C 4UILH 1A7QL 1IM9B 1JZ6A 4XT1C 1DR9A 2YPLE 2HVJB 5T3XH 1BGXH 1KIQA 3BWAA 4L8DB 4M93B 1YNTB 1TPXC 3D0LA 4I0PB 1IQDA 1KTLB 3QI9D 3BKCL 2ZKHH 4D3CL 4O5LH 1EVUA 3JZ7A 3DGCR 1AHWA 2HLFC 1R3LB 5JDSA 2DIBA 1B88A 1P2CA 4UB0H 5C0IB 3VFMB 4M5ZL 4KRPB 4HD9A 4IRZH 4HKBB 1OAYL 2RAMA 1PJ9A 3GRWA 1UB5A 4P4KC 1X9QA 1OAKL 3VFNB 3W0WA 1M4KA 5GGUA 2E3VA 3CX5J 5KG9B 1IT9H 2DQGH 2APXA 5FGBA 5F3BB 1UJTA 1DBMH 1O7VA 2HTLC 3IFPB 3D9AH 1P7QD 1Z9SA 4TULL 5F7NC 1KV3A 3RI5F 3KJ4C 4M1DH 4UDUA 4AEHL 5DD1L 4R4BB 3BE1L 4Q9QH 5ACZA 4YO0A 4DUVA 3F7YB 2OLDA 3UTTA 4DGVH 3RPIA 4KPHL 4AIXA 4F58L 2HH0L 1XR9B 4XB8A 2VLJB 2AEPL 3O81A 4OLYL 1A7QH 3MGTB 4NPYB 1ZA6A 5DHYB 4P4RA 4QYOB 4LIQL 3IDXH 3T1FB 2OP4L 2D7TH 2GTZA 3VGHA 1T04A 1A14H 3P11H 3DI2B 4X6EA 1CLOH 2YPLA 4MA7L 3M1BA 5HD8D 4M7JL 3ZDXE 3PWJA 4XP5H 4HIJA 2QBWA 4O00A 3RNQA 1MCLA 2BDNH 3IKKA 5KW9L 1F90L 5HYIA 5I1JH 5GISL 3V4PL 2JTDA 2NY6B 1D9KB 1F4WH 2HN7A 5D7SH 3T3ME 2CDEA 3DUUB 4HJJH 4YHKL 3SKJL 1EIBA 1U91B 3RL2B 5JO5A 2OJZL 3QG6B 3ROLB 4ODXA 5IK3A 1UQSA 1CXFA 4LP4A 1AE6H 3OBAA 1MI5A 3T0EB 4S1RH 2XWBB 5C2UB 3HG1B 1AO7E 4Y4HB 2MCG1 1RJLB 3Q3GB 1FVCA 3CUPB 3DI3B 1MPAL 2CDEB 5BQ7A 1ZVSA 4LLDB 5F97E 1BFTA 4XVUC 2UZXB 1KLUB 1KSRA 4QOKD 1JPFA 4X7TB 4QLRA 3TN0D 4KVCH 4A6YL 4LGSB 1MCDA 1WZLA 3UYOD 4HIJB 1ORQB 3IT8D 2QV2A 2EE9A 4CW1B 3QA3B 5EBMB 5BV7C 1RK0B 4DN4L 1BD2B 1LK2A 4Y1AE 2YPLB 4Y5VC 2P7TB 5TQ0L 5T1MB 4LCCA 2CLRB 4FFYL 5BS0B 3OKNA 4LHUD 3VGDA 3PF2A 5E9DA 4LHUA 3CFKA 1HCFX 4JJ5B 2P24A 5HI4C 1D6VH 2E9BA 1XEDA 3ZSTA 2VRAA 4EDXA 3QB7C 5F7UA 4ZD3L 1IC4L 4R90L 5FYJU 1BMGA 1ZHNB 4M8QA 1CGUA 3IJHA 4U31A 4I3SL 5D9SB 2OJZH 3OKLB 2H9GB 1FV1B 1JGEB 1ODAA 1RURL 5EC2B 4WRLA 4HSQA 2EYTA 2HFEB 3GKZA 1XCQB 5IB5A 5DRXA 3U83A 2CKBB 4YDIH 4MAUL 4WI7A 3BZ4A 3AREC 3EJJX 4OKVB 4K3EL 5HHME 3S36X 1EAPA 2PCPA 5IVXA 2DTMH 3CFEA 3QRGL 3VMNA 3O2VL 3I50H 3N1MC 3QUYD 3V0VA 4JG1H 3S35H 4FQHB 5C09A 4PBXA 3BPNC 4POZD 5TH2B 3T2PA 5F7EL 5TE4L 2F58L 4KKNA 2X4RA 4WO4B 3DO3A 1IQDB 1ULVA 3WD5L 3ARGA 2HYMA 4LLMB 5CLWA 5D71H 4CVZB 4HWZB 5IG7B 4HUWA 4L3AA 5SWZA 5I19H 5JHDB 2X70B 3WCYA 1GHFL 1T2XA 2AABL 2NW2A 4MDJA 4NQSA 4YQXH 4HF5H 4PLJD 4MQXC 1T4KA 1QBML 4A6YB 4FFYH 3R8QA 2V5RA 4XPGH 4Q6IA 5ICZB 5D7IF 4OBRA 1I3UA 3D9AL 1ED3B 4EVNB 3NZHL 4G6KH 4OZHF 3PNWB 4KQ3H 1D5BA 3LKQB 4N1HB 4ETQB 4YUEH 3MRGA 4XPFH 3HAEH 1CGXA 2DJ4A 4XPAL 1HSBA 4WO4D 3T4YA 4NQDD 3HKFA 1QSED 2HRPL 4UUJB 3INUH 3FQUB 4YAQB 2AXGB 2I25N 1DANT 3UP1A 3AMKA 1TJGL 3U4BH 4KUCD 2BSRB 3G5XA 3MOBL 1XGRB 2DIJA 4PB0H 1H3TA 5CIPA 2Z91A 4Y5VB 1JHLL 1K9TA 4ZTOL 1ACYH 1INDH 4XVTH 2AJZB 2V17L 4HIXL 2UWEE 5IEHB 4HWEL 4R2GB 2DICA 3CFCH 3JV4A 4OFYA 2VAJA 2H6PB 1GAFL 4ZUUA 4PUBH 1BHGA 3MLYH 4U05A 5E2VH 4LASH 4I18B 3EYUH 5EIVA 3O6LH 2H26A 5INCA 1AR1D 3QXDB 1TLKA 3CVHL 2X4TA 1AD0B 4HXBH 3L1OL 4N8VB 2GK2A 2Z31B 3AM8A 4PBWD 3QH3B 5HXMA 2NMSA 3BD4A 4MNGA 3L7EA 4JFDE 4ZO8A 4XBPB 4JB9L 1I1AB 2DLTA 3VGEA 3IU4L 3DX6A 1DBJL 2EKSB 3B5GA 5B3JE 5JA9A 1UYWH 2D4DA 4P0DA 3C2AL 4NKMB 1KEMH 4YHIB 3UYRL 1D6EB 5D2LE 2BNQA 4JZNA 3ZL4L 3WJJC 1IM3A 3FB8B 3TT3H 1EEZA 2YA2A 3V0WH 3RWDB 5HD8C 4HULB 3QHFL 1YEGH 2IWGA 2YWZA 2CR3A 4UINL 1KGCD 4XNXL 4YHZL 3DBXA 3A6BL 2ZSWB 3BGMB 1EO8L 3HR5A 3CLFH 4PGZA 5HHQA 4X6DE 3I6KB 1P7HL 2XY2A 1TCMA 4LCUA 3DOSA 2PXYB 4WUUE 1FE8L 4ONFL 2IMNA 4ELMA 4F57L 1FFNA 4MCZA 4OFVA 1IJ9A 1YJDL 3SDCC 5IHZA 3C60D 3GMNB 2VZTA 1A3RL 2UVFA 4OGAC 1P6FA 4JLRA 5LG1A 1WWCA 3X3GL 1IC4H 2UZIL 4S1SH 2VTFA 1S9XB 4O2CB 4JZJA 3KGRA 5DK3A 4KVNH 4P99A 3OKOA 1JF1A 5I71B 4UQ2A 1MCBA 1KTRL 4X99A 1U95B 1BIIA 3BPNB 2C3VB 1G1YA 1OB1A 4HW6A 5I1DA 4ORGB 2P5WD 1QRNA 5E94B 1HHJB 5L0QC 2IF7A 2F54B 5IV2A 5GRJL 4OLXH 4LFHD 1PKQA 4U2YA 1RZJH 3GRWH 1F6AA 3W11D 2XA8L 2HLFD 4YXKL 5E5RB 3MACH 3ZDXF 4ZNEA 3HNVH 1JUFA 5KSBA 4HDIB 2Q3AA 2CUHA 4LOUD 5I1DB 3REWB 1AH1A 3QCTL 3S6CA 3VFVA 4OZIE 3WIIL 3PV6A 2R69H 1U95A 3WFCL 4BFGA 4UB0L 3U7YL 3H3KA 3M07A 1ZLWK 4G6JL 4QF1B 5LXGH 1F6LL 4DVRH 1G7HB 2X4PB 3QQ9D 3O3DB 5F7WC 1M1SA 5FKPA 2E8ZA 1J86A 3TZVC 2FBJH 5IKCA 5TDPB 2BVTA 4FQQA 2VUOA 3WE6B 5EPMA 4RRPG 3GMNA 4X7SH 1GHFH 2AABH 4PJ7B 1AP2B 4PJ8A 3U2SA 5JPNB 1A4JA 1FE8H 3E6FA 4E41E 1DVFA 4IOFD 3Q1SH 1S9VA 1GOFA 2CO7B 2VISB 2BOCA 1A3RH 3Q5YA 4JM2D 4EQ3A 3Q6GL 5DRZB 2XA3A 2UWEF 1TMCB 3GFUA 4PJ9A 1ADQH 4UT9L 4J6RH 3VA6A 4NO2B 1J05A 3VFVB 4TNWK 1QQDA 1EEZB 5I1KH 4P59H 2FWOB 4WFEE 4AIZA 3MV11 3O3EB 2NXZB 1Z5LA 5BS0E 4P9ML 4DZBA 4NHCH 1G9NH 5GJSL 4LPCA 5C0FB 3H3PH 4Q9RH 5IWLA 3RUGE 3DV6A 1R3JA 1LE5B 4G80A 4Z76A 3EYSL 1CL7I 1DBKL 5DK2B 3I3BA 2AEIT 1VADA 3V6BR 5GZND 4A2MA 1H8NA 5HYSG 1MHHA 1QLFA 2BVOB 4BUGA 4OZHE 1MCRA 2Y36L 5I1CL 5KOVC 1FNLA 5SWSD 4PRDB 5DF0A 3BISA 1HQRB 1G6RL 3BDYL 5CILL 5TGBA 1N6QH 3JV4B 2IANE 3W9EA 1DUZB 2F8XC 3FHQA 1OSZA 4EDWH 5GPRA 5IHZB 4FQ1H 4R8WH 4I0PD 5TFSL 3BWUC 1A6ZA 3TIDA 4PTTA 2IMMA 4X4XA 5DQDH 4ELMB 1N3NB 4Y5VA 4TULH 4U4BA 2ESVD 4HV8A 5DVKA 5DFVC 3G5XB 4P46A 1MAKA 1P7QB 5FXCH 3BT2H 1I7TB 2C3HA 2I60H 2BSRA 2WWKO 3NMEA 4OM0L 4PJAE 1NJ9B 4P59L 5L6YH 4OV5B 4P2OA 3W11C 1OTSC 3RVVD 1MFEL 2A77H 3T4YB 1KULA 5F7DA 2GFBA 5I1EH 4QCIA 1D6EA 3VW3H 3QNYB 3GKWL 3SE4A 3O6KH 4YHZH 4OFDA 1BVLB 3E0GA 5CJQL 3KLHD 4P3WA 3GMRB 1LO5A 4EVNA 2MQ3A 1I7ZB 4HH9A 2M26A 4QGTA 3L7FA 3NFNA 4ZXBC 2Y9RT 1T0NB 3MR9A 4Z0BL 3DJ9A 4LAQH 1DZBA 4KJQD 3RGVB 3WXWL 3IJSA 2JJVA 1HHIB 1D7FA 4ZUTB 4ONGL 3B9KC 4MJ6B 3D39A 5HPOA 1HILA 3ARFB 1ZHLB 4KZDH 4OAWB 5FYLD 2R2CA 2BSED 1WLHA 1C5BL 5BO1L 2VYRE 4LRIA 1LP9A 1I4FA 2VXTL 1D9KD 4HS3A 2I9TB 1WAAA 1BVKA 3I3EA 3NA9H 3PABB 3MJ8A 4WY7H 2Z8VC 1MIMH 4WCYH 4RBPK 2GCYA 1NBZB 1L9NA 3ARGC 4Z6AT 1N2RA 4N0FB 4JFEA 3GBML 4NFCA 1QTYT 4FABH 2XNAA 4NHUA 1TENA 5CGMA 4M7KL 4Y16D 3HG1D 4NKOB 3RGVD 3NH7H 5DK0B 3VWJD 4M3KB 3QHZL 4OGYL 4Q6IC 3SGJA 1MOEA 4PIRF 1YMMD 3EYVA 3UO1H 5F6HI 1A3LL 4DN3H 3VFUB 3MRGB 4NQEA 3NAAL 4EOWL 5L2KA 3VD3A 3UJJH 1RV6X 4P2RE 3QIUD 5GS1B 4YBLC 1WFTA 3LOWA 1A4KB 2YD7A 3IYLW 3CH8A 2WBJB 1YYMH 4ZPVA 4GXUM 3CCHA 5EIQA 2FGWL 2QQKH 5AYUH 2AKRA 2XZZA 4TYUA 2BVEA 2BVYA 5E9DB 1U3HA 2BP3A 2AQ2A 3EYQC 5C0RL 3DRTA 1L6ZA 1KIPB 3EFDH 4P57A 5KANI 4BA8A 3NZHH 4Y4KC 3OG6B 4M5YH 3FN3A 3P0YL 2FIKA 1JPGB 2HFTA 1E0OB 2W92A 1YMMA 3QUZB 1UM6L 2WW8A 5K9QG 3GSOB 4UIMA 1GRWA 5I8EA 1K2DB 1WF5A 2FR4B 1S7TB 4LHUG 1RUAL 2HTKC 3MFFB 1M7DA 5CD3B 2ZG1A 4D0DB 4J4PC 1PGRB 4IRJC 1ZVSB 4LLDA 4NO0D 3BIAX 3W82A 4Y2DC 2BNRE 4MS8D 1M7DB 5CD3A 4P9MH 4JVWA 5J1TC 1FZKA 4H8WC 3BKML 2K3TA 2Y07L 5BVPH 1VPOL 4UIMB 1EFQA 1BQHG 3HLAB 3T65A 4CVUA 1YY9D 5KVEL 3Q5OA 2HFEA 3RBGA 1FNFA 5JXEC 3UBXG 2IAMC 5DS8B 3ROLA 2D2OA 3F6IA 4QHNB 4FXGA 5CLTA 4PJ7E 3LSOB 3EYUL 2D7NA 1LHZA 1P4IH 5JDJA 4LPXA 2V2XB 1FVDA 4JFDA 5FYKD 1INQA 4KHTL 3THML 1P1ZA 4WI3A 4HK3N 2JCCB 4KKCD 4GJTB 2VL5A 2W65B 3OAYK 3SJVD 3KR3H 5JHDD 4QRRE 4YE4L 3ARVA 1BFOA 3F7PC 2EE3A 5DO2C 3T0AA 1EBPA 4PJ5E 5E4IA 1RK1A 4ZD3H 4QCIB 3HE7C 2H1PH 2P7TA 3VFUA 3WBDA 4NCDA 3T1FA 1LK2B 4DK6A 4LLQB 1A0QL 4K7FA 5F7HA 1KELL 3HE7D 4EZMA 5LCVH 2X5PA 4NZRH 3SE8L 4QRTA 4OQTA 2AJVL 5DUML 2XNAB 4NHUB 2PYFB 5E6IA 3SDAC 4P46B 1HZHL 3HAEG 4NKIL 4X6DF 5J13C 1ZSDA 1MCPL 4WW2C 4R7NA 3ZT7A 4U6HB 1LO5B 4EN3B 1NGXA 4EIGB 5D7LB 2XWBA 1G7LA 3G04B 4ZTOH 4XPHL 5ILTH 5D2LF 4RISH 5DD6B 1L9MA 2AJSL 2YD1A 1KLGA 1FG2B 3EKCA 1QFWL 1ZE3C 5J8OA 4TQEL 2F8VA 3SCMC 4GQ9L 3ECBA 4HUKB 1AY1H 5FK9B 4P46D 3NFNB 1AHWB 5T1DH 5C0CD 1EPFA 4XMLH 5IQ7H 4JKKA 4L3ED 2AJ3B 5E7BA 3L3IB 1HEZA 5GHWL 4EN3D 4JY6A 4YFDB 1HSAB 4AMKL 3D3VB 5E7FA 1EEYA 3LPFA 3F12A 4J3SA 1WIOA 5TGBB 5TF1L 3VI3F 2XTJC 3W0WD 5CBAA 3K3QA 4P4RB 4QYOA 1IE5A 3QT2A 4JFFB 3MX0A 1CLOL 2DD8H 2J8UF 4MA7H 2BVOA 1YNLL 4YPJA 1NANH 2EYSA 4L4JA 3GO1L 3PWNB 1OGAE 4Q0XL 4HJGB 2FLBT 2J5LB 2A38A 2E7MA 5LCVL 3TVMA 1KJ2B 5ERWB 3RPIB 5DSCA 5E2UH 5JW5A 1JNLL 4YO0B 4OLZH 4PTTB 4X4XB 4JHWL 5HDQL 5B3NA 2DLFL 5J3HD 4JDVB 4LCIH 5K9JL 5GZOC 3BKCH 1JGDB 5MEPB 3H9SB 2VLLA 1C1EL 3AUVA 3QWOA 5F9JA 2NY1B 3OR7A 5FB8A 2P8MB 3TCXA 3W81A 1S5HA 5DZLA 4NQCB 5ICXB 1UB5B 2NTSP 3EYFA 4HS8H 1FBIL 4JO2L 2F9BT 1QACA 3HNSH 1NC4D 3SCMD 3FN0L 2KPNA 3VD5A 9CGTA 4FQIH 3HE6A 1AHWC 4OCSH 4GBXB 4JY5H 3BEWA 3EO9L 4Z7UA 2E6JA 2K1MA 2HT2D 1MEXL 4QHKJ 4KKLD 3IGAA 5FO8B 5JHLH 3D0LB 4M5ZH 5A3IC 1Q72L 1CDHA 3RZCB 3IXTB 4QXGH 1SJEA 1SM3H 2OR8A 2ZCLH 3ALXA 1R5IA 1RZJL 4OV6F 1RZGB 1I8KB 2L0DA 3MRHB 5DQJB 2BJMH 2X4NB 3F7RA 4I77H 1REIA 1BIIB 1G7HA 1UWEH 1DP0A 2WUBH 4PJ9B 1KACB 3ZE2E 4B7LA 4NQCD 2CDGB 1S9YB 4L29A 3REWA 1NL0L 2X1PA 3PJSB 4XMLL 5C9JB 2NY0B 5BMFH 3GMPB 5DXWA 3JWDH 4FMFA 4OQTL 2Z8WC 1DVFB 4Z8FH 3BZEA 3LMJL 3C5SA 3IGAB 1FFNB 1IGFL 4Z7VA 4N5ED 4LAJH 4XPGL 5I73C 5M7QA 1GPOL 1CU4H 4GBXA 4PD4J 4JO3H 1QRND 3GI8H 2UVEA 1TVHB 1B9ZA 3FN9A 4I4WB 5D1XB 1MRDH 3O3AA 3QEGL 5F21B 3VFRA 2R4SL 2V9RA 3QJFA 4LCWA 4GAGL 1CD1A 3PWVA 4DKEH 5EWIH 3NABH 3ARSA 1BOGA 3QI9C 2WLYA 5E8PB 5HHMB 3OV6A 4W4OC 3X13B 1BQHA 1ZS8B 4ZO7A 4UNVA 3RX5A 5DJDB 3D69B 1JGUL 1PKQB 2DQDH 1QBAA 5I75C 2IAMD 2Y07H 4YHYB 5IV2B 3WLBB 4U1GB 1A64A 3T08A 5I75B 4HIEA 5JXED 4FTVD 3GBNH 1Q0XL 2H2SD 3MRIB 4LRIC 5E94A 1ZKAA 1X4XA 4LCUB 3OXRB 5AEAA 1AJ7H 1RZFL 1QSEE 1T20B 4JDZA 2ZUTA 1PD6A 4BUHA 4RFOH 1FH5L 5EZOL 4UQ2B 4XC1H 4U1LA 3WDHA 3FONA 3LS5L 4XRCB 5C0AA 1T83C 4PS4H 3QHTC 5D4QA 1HXMB 1OM3H 3ZT6A 2Y6SD 4ZUUB 5D70L 4IRJB 4ENEC 2IEPA 3GSNH 5FYKH 5HI3C 1HSAA 1FPTL 4P2YA 1C08A 3QO1A 3NBNA 1DBML 5HVWA 2AJZA 4H8WL 4U33A 2NXYB 4YJZL 3L95B 1TXKA 2BFVH 1JGVH 4HBCH 1LE9B 3C6LC 3A67H 2ZKHL 3U9PL 2FGZA 3MRFB 3CH1B 1KJ3L 4XP9L 3HI5L 2LAGB 4H0GA 3BGMA 5HBBA 4NQVB 1LQSR 3FB6B 3CZJA 4WW1A 5GRYA 4JM2C 4CJ1A 2GW5A 2BVUA 3Q6FB 1H3PL 2EDRA 2R29L 3RVTD 1AGBA 4D9RD 3T04D 4JZNB 3UO1L 4EIZC 2WBJC 4NKMA 3O2WL 5FV1L 1G7LB 3RL1B 5C7XH 5IB3A 3BKJL 2D3VA 3PNWA 3CDGB 1IL1B 4TVPH 5F9AC 3RKDC 1BM3L 4APQD 1I75A 4YHYC 1SBSH 2VN7A 4JFOB 3N85H 2NXYD 1FNAA 2ORBL 3VRJA 2HVKA 5CJQH 5E99L 3BKYL 4A6YA 4MNGB 1CGVA 3S5LA 4QRPD 2RFXA 2PYFA 5A2KH 1T22B 3IRZA 3QXDA 2C1PB 5FYJL 1Z3GL 2GSIB 3BUYA 5GS0L 4L9LC 4JRXB 3AFLA 2X4RB 4WO4A 3FQWA 3LS5H 1FFPA 3S9DB 1D9KC 3IDGB 3UTQB 4JM2F 4MNQD 4K3GA 1FFRA 3KPPB 1H8OA 3DPBA 1FYTB 2LE9A 2ZUVA 3B2VL 1U8NA 4NO5A 1WFNA 2JCCA 3L3HB 3L6FB 1ZT4A 2CSPA 5DD5H 3U1SH 1H9VA 3CSYA 4J3UA 5E24E 3BIBX 3BDBA 5EC1B 1ZVYA 1KENH 4N8VG 4QRPB 4L8CA 4YFEA 4MCYB 5IB5B 4G7YH 1BAFL 2UUDH 4F3FB 3QDMB 4PJ9C 5F7EH 4WFFE 5DHXB 1U9KA 3MCLL 2H9GA 3GMLB 1OAQL 3OF6A 4JHAL 1U92A 3BPLC 4KK6D 2Q7NA 4KPHH 4F58H 1Y6NR 4DTGL 2ID5A 3HAEB 4LSQH 4QRRA 3DIFA 5B38B 5F88A 1S5IL 5D7IE 4CADA 3KJ6L 2H1PL 1A6TA 4KZDL 2AI0H 3SDAA 5I76B 3WNPA 4HUWB 5JHDA 2VXQL 1EHLH 1RUML 1OCWL 2AS5M 3GI8L 3WV0A 3BDXA 5IJVA 4N0RA 2BCKA 4JY4B 2FIKB 4M7LT 3KDMA 1KIPA 4KDVA 2Y5TA 4UOW1 4MAYB 1LD9A 1EH9A 1MF2H 3L3JB 3WYRA 5CEXB 3F7QA 3W2DL 3CCHB 4ZPVB 1O5DT 1EAPB 4XPHH 3V79C 1RJLA 2J8UE 1KGCE 2WIMA 1NUFA 3SO5A 2A6DA 5HDBF 4M03A 1GGBL 3BHBB 3CLEH 5E9DD 1MI5D 1WTGT 1JGLL 3T0EA 4LEXH 4PJXB 3SKOB 1CVSC 1MCEA 2EYTB 2CLRA 4LCCB 5IP4A 4NQEB 1UJ3B 4U1JA 2VIRA 4WUUD 2LVEA 3QUZD 5JO5B 2YUWA 3CXHK 4P23C 5EBMA 4JR9L 5D7KE 1YN7B 2OBGA 4XPTH 3VI4E 3OZ9L 2NQCA 3DUSA 3PWLB 3GSXA 4PB9H 5C1MB 4MNHB 1YC8A 2PYEB 3VXUA 4JFYA 5MEND 4H1LB 2DQJL 1WCBB 1BVZA 1IGMH 1W72L 2JF1A 3IDMA 2YD4A 4MZ3A 1WT5A 4MAYD 1OTTC 4OCWL 1N2RB 5KS9B 2GJZA 2YPKB 3WSQH 3H42L 2AI0L 1J1XL 4NO0B 1R6VA 4WU7A 4QXTB 3VXPB 1RUPL 3JV5A 3OAZK 2G60H 4Y4HA 4GUPB 3BN3B 4JQXA 4KAQL 1NFDE 1MI5B 5I74C 5T1MA 2H41A 1MIEL 5C08E 2GSGA 4HLZG 2NY3D 4HHAA 5HHOB 4KQ3L 5I9QC 2EIBA 4F15B 3QA3A 2APWA 3K1KC 5GJTL 3EW3B 2UZIH 4S1SL 1U91A 4MNQA 4OZGB 3DUUA 1YDPB 4FQXB 1I1YA 3QULB 1HNFA 1AXTH 3ARBC 1OLLA 5E2UL 1G9NL 5L2KD 3T8XA 2FX7H 1JPFB 4X7TA 1RULH 1ZANH 3RNQB 3WIHL 1QSEB 5HYJB 4UMGA 5KN5B 5C71A 5T5NG 2BVQB 4YFLF 5BOPA 2L4OA 1QYGH 1MFCL 5EO1A 5IESH 4WGWB 2OK0H 3ZSSA 4FQ2L 2O5YH 1BVLA 3D2UA 4PJHE 1T04B 2ZSVA 1KPVB 3QO0B 1JPSL 3NGBB 3L5XL 3MV8E 4NBXB 4HBQA 4PJIE 3ZTNH 4WHYG 3BZFA 3FRPG 4Y88A 2VDNH 3CMOL 5A16B 1FO0A 4P23D 5DD1H 4OI9A 1P2CB 2R0WH 4P5KB 2YUZA 4LU5H 2IH3B 3FO9A 4WI9A 4POYA 2LTQC 3MLXL 3ISWA 3SN6N 3RJQB 1N3NA 4X6CE 3ILQC 4PGEB 2D0FA 3O41B 2A83B 4ZYKA 2FD6L 4EBQH 2DJSA 5F1SA 4NO3A 4Z8FL 2Z92B 4PYHA 4ZNCD 4LRNL 3W9EB 4L8DA 2HVJA 1UFUA 2GTZB 1EO7A 2HP4A 3P0VL 2V17H 1NKRA 4HIXH 1GPOH 1WZ1H 2JB5L 1PAMA 2W9EL 1MVFA 4Y19D 3FQRB 3QDHA 3IVKA 3MA7A 3WUWG 1D5MB 5EFIB 5SV3A 2G9HB 1MHHB 3U7WL 1X5KA 2MQCA 3CFJA 5DGRA 3UJTL 4GBXC 5IMLA 3FOLA 2VLJA 1VADB 3QHFH 3NCJL 5KAQG 2CKBH 2HT2C 2R56H 4NNYA 4XVTL 5EZJA 1QLRA 1XF1A 5MEOA 3MNZA 2HJLA 3DV6B 1BGXL 4AEIL 4UV7H 1PKOA 3QFJE 4DZBB 5J06A 1YPZA 5CJOL 4HKJB 4JKPH 5HSFA 4L4TE 1KIQB 3BWAB 2XZQH 3X12A 4PYGA 3WFDH 3GM0A 1CVRA 3JBG7 5C0DB 3EJYD 1UZ8B 4FZ8H 3ZYJA 5JXEA 4Z7WA 3RDTD 4KK6C 5EBGA 2B5IB 4RFEA 1T2JA 2IPTH 3WUWB 2X4SB 1N6UA 1YQVH 3I75A 2KBGA 5DRZA 3EFFB 3OGCA 1FN4B 3EOAA 1FNHA 3VG9C 1MAMH 1U8HB 5T1KA 1S9VB 2MHAA 1G6RH 3WEXA 4GW5A 4J1UA 1T5WA 2DQHH 2DQUH 2FEDD 2HJKA 4G6FD 1OD7A 5IVNA 4KK8C 3SDXE 4G7YL 4M1CD 4JN2A 2LQRA 5IGXH 4NJ9L 4JFPB 3GHEL 3VD4A 4HLJA 1TVDA 4K7PH 3SY0B 3C08H 4PTUA 5DC9B 3VI4F 5C6TL 1YUHB 4PV8A 4JZOA 3SO3C 1OHQA 4JDTH 1S9WB 5GRZA 1I8IB 4ODSH 4O58L 3PV6B 3SGEH 4NN5B 3DWTA 4JGMA 3R8BB 1OTUC 5EU6D 2Q8AH 1GYAA 5JW3L 1A7OH 1NEZG 2AK4A 4DGVL 5TE6H 3RVUD 4YLQT 3UZEA 3TWCL 2ICWJ 3KXFA 4Z7QF 1NSNL 4M6ML 3MRMA 4TVPE 4ZUWA 3BAEL 4G6FB 5IVXF 3HZYA 4K94H 1BIHA 5CP7B 3MO1B 3LKPB 2B2XH 4ZUSB 5A2FA 2B0SH 1FZMA 1RUPH 1MCOL 1JWMB 5HHXH 5CGTA 1VHPA 4BH7A 4FMKA 1J1PL 3SKMB 4UDTB 4M62H 4AEFA 4BSWA 2QSVA 5HGDA 4G43B 1YN6A 1DDHA 4HH8A 4O2CA 2WIIA 1DQDH 2YMXH 3IDIB 3VFSB 3GK8H 4MXQC 1WISA 2P47B 4G42B 4MVBC 4MD4B 3FFCB 2NW3A 4TUKL 2FX7L 1KFAL 3BKYH 3ZDZF 5KSVA 3FFDA 3O45A 2J6EH 4XXCC 4M1GL 3P4NB 2PXYA 2CD0A 2R69L 3MBED 3DVGA 4LARL 1E6JH 3UYPA 3X17A 3I6KA 2XZAL 3K8KA 4OFIA 2ZSWA 5T3ZH 2OZ4A 1AD9A 2G75B 5CJXC 4HQQL 4LKCB 4BFBD 1L7TL 3S4SA 1JHTB 3S36H 2VZUA 3RWDA 1FL5A 4BQ8A 3NA9L 5FHAL 5HVHC 1MEXH 2A9ML 1X7QA 2C26A 3KXFD 2E8YA 3O4LD 4NRXA 4YNYB 1SJHA 3TH2T 4AENB 4DFHA 4X6FA 1P5UA 5FYLH 4HCRA 1MNUL 4CMMA 4XBPA 1KJVB 4XNUH 4MJ5B 5F9DC 2EXWD 1JV5B 3C09B 3QYCA 5GRVL 1HHGB 4ODTL 3SDCA 2V5SA 2Z31A 1UM4H 5LJYH 2OS7A 5TQ2H 4R3SA 4PRBA 1T80A 3BPOC 3S96B 2AP2A 2R2EA 3HC3H 1QVOB 2QLVB 4KZEH 1X5FA 2W91A 3PL6A 2O5XH 4I18A 3GEWB 4JHAH 5J11B 4MS8C 3R0NA 4XP4H 4R0LA 4HIHB 4IRJD 4IOIA 1MJJB 5GS1C 3W5MA 3QEHA 5EULV 4MX7A 4ZQKB 3WXVL 1NCTA 1UEMA 1JPST 4FP8H 1QBLL 1XF3B 4X6DB 3FJTA 3OB8A 2XZAH 4OT1L 5IIEA 1E6OH 5IVOA 4X5WB 4LLUB 2J6EL 2XI9A 2ARJQ 5AG8A 4M62L 3MRQB 4CUCA 4AIOA 2HFGL 1TQBC 4GW4A 4NOBA 3RDTA 1NUDA 3ULUC 4YXLH 3P4OA 2YR3A 2ERJB 4XCEB 2FH8A 5ESVA 2QKIB 1KG0A 3SJVE 4RDQF 3EZJB 3LV3B 2P5EB 3BXNA 1A9BA 2P5WE 3UTZA 2WINA 2BNUB 1YEFH 3I9GH 2YD3A 1V8HA 2JCCF 1NGYA 3WS3B 1BX2B 4IRZL 4O02H 1DBAH 4NBZB 1OPGH 4GLRI 4KXZI 1D5IL 4RNRB 1KBGL 3NN8B 3BGAA 3TPKA 3CU1A 4X80H 4HJ0C 4O4YH 1IQWL 4Z9KB 5I1HL 4A6YH 3HI1A 1AGCB 1OSPL 3TT1L 4OSUH 1NBYB 4R4FH 2VZ1A 4P5TC 5DEFA 4Y4HC 3WN5B 4HUMB 3KYAA 2ADGB 4L8SA 4XC3L 2P5ED 2BVPB 1A1NB 2DMKA 3PGCA 1ZEAH 4ZFOB 1AQKL 1LGVA 5C0NC 3DV4B 3GMOA 5DURD 1T03L 4KJPC 3MV7E 3UZQA 3BQUC 3BZ4B 5FYJH 3QIUB 3QUML 5BXFA 2DL2A 4Q74A 4OIBA 2IPTL 3B8SA 3TNMA 2PTVA 3EDJA 3UAJD 1U3ZA 1RZJC 5JPMA 3SKNA 2JELL 2BC4B 3OSKA 2E27H 4MDIA 2LV4A 2VLRB 1JGEA 3QDJB 4KDTC 3NACL 3HN3A 2KQNA 4OZHB 4XX1E 3VXOA 3G9AB 1OD9A 2JE8A 1EGJL 1Q38A 3HNVL 3KPLA 3VXRB 4GKSA 4R6UA 3RQ3A 3TH3T 4K55A 4MHHG 4UQ3B 5L88L 3X14B 4G9FD 1UT9A 1U8MA 3MRDA 4PJFE 4EN3C 4D0CB 2DI7A 4PRIB 3TN0B 1NAML 5E8OB 1IFHH 3MC0A 4U6YB 1Z3GH 5MERB 1W0YT 2B5IC 2J5LC 4LSVL 4NZDA 5DQ9B 5I15L 3MROB 3PDOA 4P46C 3D85A 2GKIA 5ECJE 1UCTA 3P2TA 1VPOH 4RGMB 3B3IB 2VXVH 3FCTB 4PR5A 5IW3A 1I9IH 3LKNA 5IB1B 1R5WA 1HINH 1NUGA 2ZUWA 3NZ8A 3ET9F 4P3CL 3X3FH 2R9HD 5I1LA 4K9EC 4JHBA 5CCKH 1ITCA 1J87A 1P5VA 1VFAB 1F3RB 3NCEB 4O02L 6CGTA 3HB3D 5FYKU 2EDKA 1CE1H 5AYQA 3PV7A 3EFDL 5FO9A 2ZWLT 3BP5A 2PYED 3HG1A 5IQ7L 4LL9A 1EHLL 5GS2D 4ODWB 3MV9A 3QEUA 1SVZA 4I8DA 1ZHBB 3LQAL 3KLAB 4YGAB 2B39A 4TSBH 1KIRB 2HFFB 4J3XA 3RVTC 4KJWC 2DL9A 4WUUB 5E5MB 1OCWH 4FFWD 4HPYH 4HKZA 1IMHC 4O5LL 7CGTA 3OJVC 2MNUA 2EDBA 3ZYZA 1A2YB 1RQ5A 2YZ1A 1PZUB 4FG6D 5HGAA 3DYOA 1MY5A 4PJ5B 2VSCA 3U46B 3QWRA 2MJWA 4YHPA 5DRNB 5JOFA 5DJXB 4U6YA 4W4NA 2O26U 1XF5A 2RQ8A 3WIFB 2DQHL 2HWZH 1IKFH 1U8MB 3FT4B 3MRDB 4DQOL 3T3PE 1DSFL 1NEZB 2DWDB 1IEHA 4XVSL 3HC0A 4PS4L 1WFUA 2XKNA 5IVZB 1IRAY 2F19L 5DJ8A 2X42A 5I66A 4YE4H 4PGDB 1FORL 4WGVB 5JXAL 5HHNA 1HH9B 3V5HB 4JREB 4FXLA 2ATKA 1M71B 2D7QA 1AXIB 1EJOH 4DFIA 2VLRA 4WHTA 2OTUB 4HS8L 4MDIB 5ID0A 5FYLL 3UTTB 2ZOKA 5D2LA 3L5JA 4BJLA 1RHHA 4LSTH 4PJ5D 4IIQA 1E4JA 2C3GA 3AVEA 4KAQH 1ZGLA 4JKWA 4P23B 1HDMB 4UTAL 1DLHB 4JEGB 3NGBC 5H35A 1AO7D 4XWGH 4POUB 1F13A 1VEPA 2VDOL 1G0YR 3K81A 3PWPB 4HZLB 3REVB 3TJHC 3FRPA 4V2BA 1WZKA 2FIRT 3RTQB 2ADGA 2UV3A 2CJUH 1J1OH 4C54A 1DL7L 5DEFB 3B83A 5L2JB 5JQ6L 3DVNB 3QJHB 2Z4QA 3ULVF 2DDQL 1U8LA 5DRWB 1JNHB 3F58H 4OQTH 5F72S 1PFCA 3HZVA 1LO0H 2P8LB 3PG2A 2F5AH 1B0RB 3V4UH 5CEZH 4KK9D 1VGEL 2F53E 4MD0A 1OQOA 4YGVA 4W4OA 4XMKL 4KJWD 4M6NH 4DGIL 2F5BL 2FZ3B 1FIGH 5IFJB 1CDYA 4R7DA 4F2MB 4HUVA 1YEDB 2VN4A 1RJYA 3H9SD 2PXYC 1PKQE 4OUUB 5I1AA 5JZ7C 1UM6H 3MLXH 2GJ6B 5FECA 2JKXA 4JANA 5D1ZC 2XWTA 5E4EB 2Y7QB 4OD1H 1A1MA 3O2DH 5C07B 2C1OB 5J9PB 4FQ2H 2R0WL 4FNLH 1QEWB 1KPUA 3O6FD 5IMKB 4WEBH 5GSVB 1S3KH 3MLSL 4ONFH 4H8WH 3EO1B 4HT1L 3BD3A 5CZKA 1FH5H 3K8MA 2EDQA 1VENA 4CRPA 1UB6B 3WMSA 1JZ5A 4Q0XH 4X9IA 3VD9A 4ESKA 4H88H 3HPJA 3GSVA 5KSUB 4LLWA 1FDLH 1HKFA 3ZE0E 3ARBA 2IBZY 4E41A 3MBEA 1OARH 4S0TD 2DLFH 2PXYD 3IFLH 4LLYA 1OW0C 5TE7H 4BZ2L 1MJ8H 5ETUA 1QVOA 2R2EB 2J1KA 4NKDA 1BZ9B 1F42A 2Z35A 2XN9E 4XNMA 1KCKA 4Q2ZA 3O6FB 3V0WL 1ZTXL 1BREA 4L9LB 4ZXBD 4E42B 3MJGX 4KK9C 3KHQA 4PJFB 3RWFA 3BJ91 1CF8L 3KLHC 2VDQH 1UG9A 2ZUUA 4JO3L 2Y4SA 4JRYA 5IW1A 5IHBA 2AQ1A 2SEBA 5H2BB 1G0XA 3IF1B 5JORA 2FSEB 4QRQB 5CHNB 5SX5K 1GZQB 5GIRB 4NC0B 2RBLA 2JLLA 3FTGA 5ANME 1OAUL 4OGZA 2YBRA 4JREC 1CLCA 1CICC 5DUMH 5EU3B 4LAQL 3QAZC 5C7XL 3HRZA 1H3XA 1A1OB 3ARWA 3AY4A 3FHAA 1GZPB 3MLWL 5T3XE 5MHSE 4L9LA 4E42A 4RBPH 1AFVL 5ID1B 3HRZB 1FZOB 4S1QL 1I9IL 3O2DA 1SM3L 4NQTA 3MCG1 3WXWH 2NW3B 5E6YA 2KUTA 1MAJA 2CXKA 2R0KH 5FM8A 3LIZL 4LLYB 4MA1B 2CXGA 1A21A 3RKDD 2FSEA 1UVQA 1HHKA 2YSSA 3BP6B 1P9MC 1CE6B 2EH7H 3DMMB 4MJ4A 5IW1B 4PJGE 3AC0A 4J8RB 1XR8B 1RAMA 1IGYB 3CFBA 3IU3B 2WUCH 4KVCL 1BWMA 4ZUSA 1GVIA 2ICCA 4P5TA 1NGWB 5H8DA 2BNQD 4FFVD 3HZYB 3QWQB 4U1HA 4RMRA 3EO1A 5TDOA 5T1LA 1JGVL 3KXFB 1T03H 5IMKA 1R3HA 3C6LD 4XCYB 3G6JB 3S4SG 5C86A 1G9MC 2XG5A 3FO1A 2XXMB 5DQDL 2JIXA 1LO3L 1SEQL 2H32A 4X7CC 4WHDA 3IF1A 43C9B 3KVQA 2OI9C 2R23B 2NX5B 5CUSH 3GMMB 1IAIL 4JZOB 5DD3L 3OJ2C 5ANMA 4Z5RB 1YZZA 2I27N 3L5WB 1G6RB 3T2NH 2P8PA 3O4LB 4HK0A 2CGRH 3RWFB 3NCMA 4JFPA 2YD2A 1QNZL 3HUJF 3ARDC 1Z0NA 5D2NA 3UJIH 5JOEA 4FP8L 3O6FA 4KRPD 4XP5L 4PREB 3MXWL 1D5XB 3TFKC 4U3XA 1HNGA 2IANB 5IB2A 3VDBA 4YIQB 5F3HA 3VFOA 1KJMB 1KT2B 3QIBA 1KUMA 1JBJA 2C1OA 4GSDH 5J56B 2ZNWA 1IGIH 4HEME 1I8MB 5E00A 4F9PA 4I48B 4N8PA 5CSZB 4DOHB 1U8JA 5BRZE 3LY6A 2EXWC 1YEDA 1KXQE 3GSVB 5E03A 3C8DA 5EA0L 3DHJA 2VZVA 2VLKA 4Q58C 5JQHC 4EI5A 2WWKT 4OGXH 1RMFL 3GSUB 3E2HC 4NQDA 2C5DC 3MRLB 1MHPL 4B41A 1RUAH 2QJDA 1U8IB 4MD0B 3MCKB 12E8L 4WENB 3X12B 2VNCA 4OB5H 2R1WB 4OBSA 5CD5C 3HZVB 4C59B 1FSKC 1S7UB 2EXYD 5L2KE 2G60L 5KOMC 5IR1A 4Y5YA 4CAGA 1MHCB 1LWRA 5J9PA 3DVNA 5FGCE 1A1MB 5KANG 4N5EC 2BJML 2EH7L 3U9UA 3LN9A 4R7DB 2MMXA 5CWSB 4F2MA 1DBBL 5IFJA 3DX8B 1A7RL 1UA6L 4XBEH 1ROWA 4GRMB 4PV9A 4YGVB 1F58H 1MFBH 3MV8D 5GRUH 4N9GB 4K94C 2DRUA 5IFAL 2GUOB 4L5FL 3ESVF 4MXQD 5JIKA 1ZLVK 5L9DL 4KJPD 4CMHB 4ONGH 1AXSB 3WKNA 2DKSA 5DURB 4P5KA 1ZA3A 4U1KB 2EH8L 3IDJB 2AK1H 2JJTA 1IEAA 3HCVA 4I5BB 2HT3D 2YEZB 3ULSB 3M8OH 3UPAA 3BZFB 4Y4HD 3QG7H 3SDDC 4HZLA 3REVA 4NZUH 3RWIA 5L7XH 1QA9A 1VFUA 2G2RA 2VJXA 5IVZA 4I0KA 4ZAKB 1E27A 3CPLA 4XBGB 2FX8H 2VWEE 1RFDL 2BXZA 4LPUA 3ULUF 1NCCH 3OGOE 3KPRD 2AEWA 1F4XL 4ODWA 3I50L 1TZIB 4GSDL 3BMWA 5KSAC 4ODVL 3ULVH 1ZGLB 3ZHKA 4U2ZA 3V95A 1JCKA 1ORSB 3MMEA 2YD5A 3BKMH 4Q9BA 1IAOA 3LD8C 3TNNB 5I16A 1U93A 4XC3H 4PRID 1DQML 1YC7A 5I1LB 1NCWL 1PLGL 2GY5A 5BS0D 1VSCA 1UA6H 1YEGL 4UT6L 1YDPA 4FQXA 2XN9B 3I9GL 4YDKL 3JTSA 3ES6A 3MCLH 2ATKB 5BVPL 2VKXA 4P2QA 5DD5L 5FA3B 5CZVH 3ULUD 5CBEB 3OXSA 5C0BE 3FT2A 1XH3B 5FGRA 2NZ9C 1MHEA 4HUUA 2DS4A 2BNQE 5E6ZA 1ZXQA 3H42H 5IBUG 2IGFH 4WU7B 3JWOL 2E5EA 3OKEB 3CPLB 5J12B 1EAJA 2LABA 2DI8A 4LPVA 5J1AA 2PO6B 3RDTC 3MLUL 4EUPB 1WCBA 2DLHA 1S7XB 4DGYL 4JFYB 4NNPL 4HKZB 1UH3A 2EDNA 1MLCA 1RHFA 5GJSH 1IEAB 3HCVB 5FFLA 1FIGL 2EEBA 1HKLH 1F02I 4UBDD 4OZFG 4EUPA 4WO4C 3EBAA 5DT1H 3D85D 4LVNB 4OZIF 4XP4L 4GXUN 1FJ1A 2ICES 3LDBC 5ACMA 2X89D 3CVHB 1BM3H 4HGMA 5BXFB 3PUCA 3QEQD 4G8IA 5GGVL 3IETB 3TYFB 5MI0C 1R24A 2J88L 4KQ4L 3TV3L 4S10A 4F7MA 5CS7A 4GG6F 5ELIA 2C4FU 4ERSL 5KVMC 4QXUL 5FA3A 2WMPA 1KC5L 1QG3A 2VITA 3TO4C 4NKIH 4PJEA 5H37G 1MQKH 1OGTA 3ES6B 3JTSB 5CFHA 4KDWA 4L8SB 2YD9A 3H2WA 5JOPE 4BYHA 4XPBL 5IJVB 3NIGE 3B3IA 3VH8G 4GG6A 1NEUA 3D85B 3HS0A 1QFPA 3ILQD 3PDOB 3MMEB 4P49A 5IR1B 4WDIA 2CLVB 2E9JA 5F9WB 4ODTH 4BFEA 4YHOL 3QIUA 1BFSA 1FNGB 2NNAA 1F3JA 2FEEL 2JCCE 3RZWA 5F88B 2R1WA 5L8KB 3MBEC 4ZO6A 5M95B 4OZIA 4NSKA 1U8IA 3I2CL 2ARJA 1NGYB 4M6OH 3NVQA 3KPLB 2N7BA 3RNKA 4W81A 1R3IH 3HE7B 2AJXH 1DANU 1SEBA 3AS1A 3D1MC 1AGDB 1A9BB 2UYLA 4WU5A 3KPNB 1NMBL 4MZ2A 1GJIA 3IFOA 3U7WH 1X44A 4FQCH 3CJJA 5SV4A 3BRDA 3G9VA 4GQPH 4LIQE 4YDLB 4XVSH 4J7RA 1JF6A 4HMEA 1UXWB 4LLUA 1K8DA 3U4EB 2DD8L 4TNVK 4F33A 3CDCA 3C9NB 5HDQH 3QSKB 3ARTA 5HI4D 1YA5A 5I74B 3DX9A 4GRLC 3GGWA 1XF3A 4NWUL 4CN6A 1LEGB 3X11A 2B2XL 3T0EC 5DHVH 3IKCA 3MLTA 4AK1A 3DX8A 2P5EA 5ESQA 2J12B 4M6NL 1OAUH 1ZT1B 1N0XH 3O4OC 1MUJB 3U9UB 1MHPH 2GSIA 5C0BB 5ICYB 3QZWG 3RDTB 3HI1B 3G5ZA 1PG7L 3P40A 3X3GH 3T0XA 3G6JA 1AY1L 1VDGA 4H25A 1CLZL 1OTTD 5DLML 4N8CH 3QBTB 3EO0A 3GJEA 5EG6C 1ZLSL 2WM0A 4YHML 3I02A 3EUUA 2JK5B 4FNLL 1DVFC 2AJSH 3MCKA 4CMMB 3VRLF 4DZ8A 2W60B 2FATH 2HT4D 4MQ7A 3CFBB 1NMCC 3T3PF 5FOBB 2NLJB 3CDGA 4M8VA 5C0JB 3QDGB 4MSWA 1N5AB 1NLBH 3CX5K 4NWTH 4TTDC 1PX4A 4I77L 3ULUL 1X5GA 4UINH 1NFDB 2R1YA 4FQLL 3Q6FA 4ODBD 5E1AA 4QXGL 3L5HA 4PRPE 4L8BA 3ME0A 3QIBB 1KT2A 3KAAA 1HE7A 3G6JF 3O3BA 2HRLA 3OAUH 3WFBL 3RZCC 1RZKL 3SDCD 3V4UL 5CEZL 3MRQA 4FQCL 2BSSA 4UNTA 3MRFA 4LCWE 3IRPX 5D8JH 4TUJA 3PL6C 4K2UH 1V3JA 4X6FB 2XXCB 4PFEA 2E27L 5B39G 1Q72H 4KMTH 4M6AA 1EUTA 2X40A 3GSWA 4HC1A 4MA8H 1UKSA 1DLFL 4IOIB 3V0AC 1EZVY 1DN0A 4U0RB 3LEXA 4ZMAT 3O6FC 3BRFA 1JHTA 3AROA 5JORB 1IC1A 2ZCHL 4GBXD 2ZUQC 4UAOB 4U1LB 3GJFK 4U1NB 5DVMA 5BZWA 2GAZA 2DLIA 3QNXB 5D1ZD 1HHGA 2NZIA 3S97C 3SDCB 3MREB 1MY7A 5BOZG 2D7OA 3RZCD 1NCDL 3LKPA 4YHKH 2VZOA 2A73A 3MRMB 3H0TA 1SJHB 1NMCB 4PJ9D 1BZ9A 5J13B 1N59B 1OT1A 1AFVH 5DJ0A 1ZS8A 1AR1C 5EU6E 3U7YH 2ADFH 3VFSA 3CK0L 5T3ZL 1FAKT 1PG7W 4OFKA 3G08B 3H7BB 4S2SA 5HGDB 1Y18A 3MODL 1S7VA 1XGPB 1DVFD 4U1SB 4IRSA 1M6OB 4JFQB 4P4KD 4X6BA 1IEBA 1NGPH 3PIQA 3QFDB 4RFNB 5EO9A 5EUKA 4BZYA 1NMAL 2IALB 1OWWA 1OAXH 4G8FA 1I85C 1K85A 4RWHA 3DMMD 5DGQA 1KLFA 4NNXB 2DMCA 2VAAA 4ZXBA 1S5IH 4Z7VB 3K4DA 5FF6A 5C0RH 1LEKB 5DFVD 1JHKH 1WBXB 2PUQT 3U4AA 2APBA 1SBBA 5DUPH 4WHCA 3NFSL 2DWEA 5T33H 3BE1H 4QHUA 2NY2D 4WWID 4I9WE 5DA0B 4HFUH 3MUHL 1S7WB 4GRLD 3EFFA 3OGCB 5D1ZA 4P9HH 4ZFZA 3K0WA 4XAKD 5FHBH 3UJJL 4LDEB 3MUY1 4PJGF 1Q9OB 5GS0D 3IDNB 3FB7A 1R5IB 1FCCA 4U49A 2IH1B 4WNQB 3LH2H 3O2VH 4PLNC 2QQKL 4K3HA 1YPZB 2OTWB 2XFXA 2F54E 3LPWA 4MQXD 3QZWB 5D6DA 3ZTNL 1VKXB 1CFQB 2MPAL 1JNHA 5IBTH 2DWEB 5T5NF 1MCJA 4Z7UB 1YEIH 3WEXB 1IFHL 3MNZB 1CGWA 2Z4QB 5DVLA 1B4JL 2YC1B 4D0BB 3ZTJH 2YUVA 1ZT7A 3QXAA 4N0UA 1WBXA 1U8HA 2OI9B 5EU6A 3TIEA 4JFHE 2Q76B 2DQDL 1ND0A 4NJAH 2F5BH 5IMLB 3CFJB 1VESA 1GOGA 1SHMA 2DOCA 1NCDH 3R0MA 1UZ8A 1TTGA 4NBYB 1P84K 4K3EH 4RMWA 1NAMH 4S1DD 1IVLA 1UENA 2B1AH 2VDKH 4X6BB 5EO9B 1IM9D 4KMQA 4QT5B 3J8F7 3H9ZA 2D7PA 3B9EA 4CGTA 1X5JA 1R3IL 1S3KL 3MLSH 1VFMA 1IAMA 4M4PA 2B7DT 1RHHB 3RGHA 5DMGC 3WDJA 3GIVB 4GW5B 5FKAA 2KKQA 5GS0C 5ID0B 4JANB 3MUGB 2AGJH 2OTUA 4PG9B 3H0TB 3BW9B 4AJ0A 3UBXI 1DEEA 3V8CA 5DC0A 3WNMA 4IHOB 2C4XA 4DVRL 3O6ML 4JR9H 4LMQE 4Y19A 5E1HB 1UACL 5HYJE 1CWVA 5BJTB 5BMFL 5C0DA 4OLUH 5FHBL 5DJ8B 4HAFA 2YHGA 2BHYA 3KWWB 3FT4A 5D1QC 3RWJB 3T77A 2Z92A 3Q5TA 4NO3B 5FGCB 3SGDI 4ZFOL 5DI8A 2DM7A 3ARDB 4IM8A 2HJLB 3FB5A 4MHHI 5JNYB 2IH3A 3FO9B 4JKMA 1QLRB 3JWDC 2EZ0D 1FL3A 1MCOH 4KQ4H 2R8SL 3VJ6B 3JTTB 4OFYD 1K4DA 4Y2OA 2BNRA 2G9HA 1X5YA 1G0DA 1FG2A 3BP7B 3JV6B 3PHOB 1KCUH 4JN1H 4M3JA 4HS6B 1I9JL 4M4RA 4DJMA 3QPQC 3T0EE 4XP1H 1KBGH 1J88A 3D2UD 3OKYA 3QUXC 4DQOH 2CRMA 5INDB 3K8LA 1PYWA 2OQJB 1H0DA 4KHXL 4NQXA 2OJEB 5EUOE 4EJ1C 5J89A 4YBLB 2BVQA 4HWUA 2NY5L 3MOQA 3BH9A 4FHBD 1QSEA 1KENL 5KS9A 5EBLB 4UT7H 3LQZA 3QDGA 1QFWM 4MSWB 5GXBB 1OAZL 1VFAA 3NPSC 4ELKA 5I15H 4W68A 1KPRA 3L5XH 1ZEAL 3PGFH 2MKWA 4QRTB 4QOKE 1YN7A 2FJHB 2AJYH 1N6VA 3LKNB 5IB1A 4EOWH 1CDCA 4R26L 5IROA 4Y19E 4C57C 4K7FB 5LBSL 1CR9L 4WVRA 3RUGB 3IXAA 2VIRB 4U1JB 3CXDL 3MV7D 3MROA 4IS6A 4IDLA 2XKNB 2I07A 1YEJL 4MMZC 4X80L 1CGTA 4HCRH 1ADQL 4UT9H 1XF5B 4Z7VF 4LSUH 1BOYA 1FVEB 4JO4H 4QRUB 3C6SA 4EXPX 3VXRA 1P1ZB 2AEPH 2VXUH 1RJZA 1MFDH 3WSQL 2B20A 4Y4FB 1U8PB 5SWSE 4OZGA 2AK1L 2G5BA 4YWGL 3DURA 4WUUA 2F74B 4G8GA 1TVBA 2AJUL 1BQLL 4HHAB 4PJGB 5HHOA 3KLAA 3AB0C 2F5AL 3NA4A 1ZHBA 3L3DA 3HLAA 4GMSH 3VXNB 1PEWA 1NAMB 4WEMB 4GRWF 4OCWH 5E8DH 2CIKB 5C8JA 4HQQH 1TZHB 5SWQA 5EUOA 1HXYA 1WIUA 5FO9B 2UYLB 2K7PA 3LIZH 1OP5H 4NRZB 1GGBH 3CLEL 2X1WL 3TC9A 2YK1H 2RB8A 5AZEL 4HG4K 5KS9E 4QTHB 2GTWA 2PO6D 3NACH 3VWJA 4FZEH 2FR4A 2BVPA 3TPUB 2C4FT 3ZMRA 2X7LB 3C5JA 2OMNA 2GT9B 5DMIL 5BCAA 1CIUA 3QEQA 4ETYA 1NC2B 5DLMH 2Q6WA 3WHE1 5JHDE 2ICEA 1UJ3A 3N1FC 1Q9WB 5DQ9A 4ZUVA 3SDAB 4ZNEE 3TJEL 4JGJA 5EC1A 3Q2CA 4XI5C 1FHGA 4PRIA 4DWHA 4OTXL 1QHOA 3O8XD 2OTPA 2AKRB 32C2A 1P4BH 3ABZA 2W9DH 3TPUA 2AXHA 4OIIH 4DUXA 2CRYA 2B0SL 2Z93B 4PJEB 4ZS7H 2J2ZA 3QUYB 5DEGB 4M7ZC 5FM5O 3IFLL 3BVNB 1V3MA 2GEEA 4JY4A 4Z95H 1AO7B 3T2NL 3TYFA 1DLFH 5ESVB 2MTPA 1K4CA 1QD0A 4G8IB 4X98B 3T0WA 3BUYB 3UYRH 4KRPC 1NAMA 4HK3J 1CLYH 5CMAA 5HYJD 3B9AA 1XCTA 1U58A 2VL4A 4ONHA 1H8SA 3RTQD 3EOTL 1WITA 4QGYA 4LSUL 5IBTL 3SDAD 3FAWA 3L6FA 1HWGB 3VXSD 5F8QC 5JUEH 5KSAA 2XT1B 3GMOB 5D7IA 1DBKH 1RJZB 3VE0B 3CSBA 1F97A 5IB3B 2QQQA 1CDGA 1CICA 1WJ3A 4NT6A 1EEUA 1ZMYA 4PJFF 1SMAA 5DO2D 3KPRA 3ARED 3EYOA 4TQEH 4Y2DB 1AGCA 3QDMA 1FAIH 1XH3A 3RTQC 1IGCL 4JPKL 1JYVA 5GGSA 4R3SB 4F9LA 3RJDA 4LSPL 3LCYA 4QRPA 3O2DL 4NGHH 5L7XL 3RA7H 1JV5A 4PJIF 4KJYB 1V3KA 1A6VL 3LKOA 3W39B 5A3ID 4GAJH 3GSNB 3E3QE 4YNYA 3T1WA 1U93B 1KB5L 3WKMH 3WLWD 3UTZB 1BQSA 2E7BA 3RL1A 5EBLA 1TJIL 3MGAA 4P3DB 4R2GD 3VDCA 3UPCA 2EC9T 3ZE0F 4OD3H 1DUYB 4PPTA 4XCEA 2O5XL 1FL5B 2R0KL 4DOHE 5BRZB 3U6RA 3RVUC 4Y2DD 4XVJL 2R56L 3C8KA 1IC5L 4QHMB 1OTUD 4MWFB 2Z31D 1FO0L 2Z0BA 3CXHJ 4XAWL 1HHHA 4WFGD 1LEIB 3ZYOA 4OCXH 1K4DB 1BJMA 1E6OL 4PJAA 1BWWA 5F96L 3QIBD 1F45A 3TN0C 3WLBA 3JUYA 1ZA3B 4U1KA 3N50A 2EECA 4CNIB 1E4WH 2NZ9D 3NCJH 1NMBH 4L1DA 1OVZA 3FB5B 1F2XK 2W0KA 1GGYA 4RDQG 4RQQB 5AUMB 5I71C 2HRPH 3EYQD 4RMUA 2X05A 1QFUL 5EOCL 5FYLE 5D2NC 5E08L 3S96A 1MCFA 1UH4A 1FZMB 2DQIL 3QIUC 2E6QA 5KVEH 3VFWB 3NIFE 5J6GA 4FZ8L 5DR5L 3VDAA 5CP7A 5DZNA 2EEAA 4KTDL 3FO2A 4Q9RL 4IHOA 4F7CA 2B1AL 5IT2H 3C6LA 3EJYC 4ZTPH 3C5SB 3ARQA 2MPAH 4Y5YB 2YRZA 3DO7A 4XCFL 5DHVB 5KZCD 4XC1L 4PLKC 1BOGB 4J6RL 3EJZD 4H88L 4HMCA 2LFGA 1HXMA 3OAYH 4QT5A 1S9WA 3DETC 3O0RH 3VGGA 1TETH 3LQMA 4FABL 3RIAK 3HPLB 1D5IH 4X9GA 1VFOA 1TQCC 4PJDF 3SY0A 1I8KA 2WSKA 2DM3A 4EI5B 2OL3H 5AZ2H 3FMGH 1UXSA 1ND0B 3RBSA 4H0HB 12E8H 4HIEB 4GT7A 5K9QI 5JPNA 3TJEH 3C2AH 4M1GH 3HI6L 4RRPA 5GGTH 4UZGA 2HJKB 5FCUL 4UTBH 1LO2L 1T1ZB 3OKMA 4U7MA 3HC4L 2I24N 5E8PA 1S9YA 1U42A 3RWCA 3NFSH 5F93C 1HIMH 3IFNH 3P3YA 4XXDB 3VFRB 2P8MA 3GSQA 4I3SH 3MGOA 4TNVF 2QSCH 5C0CE 4DEPC 4YC2C 1IGJB 1OP5K 1DJSA 4LQFH 4OLUL 1QBLH 5D7KD 2R29H 1S7WA 2EXYC 3EZ8A 1A6UL 5KVGL 1T3FA 3MLWH 1SJVA 2BY3A 1DQTA 5CD5D 1R5VB 1A5FL 3BZEB 1WAAF 1BF8A 1DN2A 4G9FE 4ZSOE 3QFJD 1J7VR 5JW5B 3QUXA 1XGYH 2AVGA 1VACA 4J23A 4LSVH 5C9KA 1R3HB 4LEOB 3SGKA 1RD6A 4HJGA 4Z7NF 2DKUA 1A7PH 4E9LA 4KZEL 2EYSB 4G9DB 3ZDZE 5IFHH 1UCBL 1NGWA 5FA4A 4Y89A 4UTAH 1S9XA 1FPTH 5EUKB 3MRBB 1T1XB 5EA0H 5F7KC 5F9JB 1RZGA 1G7PA 1PY4A 5D93B 3D3VA 1HYSC 3B2UC 4RAUA 3BYYA 2DYPD 4YK4B 4HBCL 3H7BA 4K8RH 4LSPH 1GC1L 4D2NA 4MCZB 1GIGH 3KG5A 5FUOL 5I1JL 2J8HA 5J0BA 3UMTA 3KYMB 5DSCB 5FHAH 1P4IL 1FL6A 2CKBL 2HKFL 1EMTH 5DMGD 4JO4L 4F7PA 4OLZL 1WC7B 2R2HB 4OCMC 1GZPA 3JWOC 2VC2L 3MOAH 4D9LH 3P77A 4APQB 4DW2H 1S5HB 3DX7A 1EFXA 2B1HH 5FB8B 3MOBH 1IAIH 1EVTC 2HMIC 2X4QB 3CSPA 1HIML 1IQWH 1KPVA 5I1HH 4GKZB 5JMRA 1L0YA 2VSDA 3H9SA 3QIWA 1E4KC 5IQ9A 4IJ3C 1JGDA 3MJ9H 1YEIL 5D7LA 3OL2A 1F58L 5CHNA 1MWAL 5EORH 4R7NB 5C3TA 2EDDA 3VA2C 3D18B 3MUJA 4S11A 3BUTA 2B8OT 5JMOC 3H6JA 3CVHH 4OLXL 1D5MA 4PJFA 5EFIA 3SBWC 4MNQB 5KBNC 1H3UA 1LNUA 1WSST 3FQRA 2R39A 3RU8H 4NNPH 5HHOE 1FYTD 1G9NC 4GQ9H 2BSSB 4HT1H 4QXWA 2OL3A 1JNNL 5EOTB 4DKAA 2P44B 1IILE 3VWJC 4Y4KB 4DCQA 1NLDH 5KSBE 4J3OC 2FLRT 3OQ3B 25C8L 3ZKXC 4RFNC 3F62A 4RISL 5E1AB 1YY8B 3TZVD 3C5ZD 1BQUA 1JI2A 1QYGL 2LAAA 4KH2A 4U6HA 4QXTA 1KB5A 5IHUH 2DQEL 2FJFA 3O41A 4Q7DA 2J8OA 2YD6A 3PWUB 1ZSDB 4JQXC 3AU1B 3LN5B 3NIDE 4S1QH 4PD4K 3JWDL 1FCGA 3IDMB 3BP4B 1DEDA 1SY6A 5L88H 3R1GL 4MNHA 3TWCH 1A7BA 3W0WE 2J7LA 3LSOA 4YAQA 5ENWB 4PY7B 3HG1E 4I1NB 1ZV5A 4QHNA 2UWEA 4LFHG 5TF0A 5DS8A 1Q0YH 2BRQA 2PETA 3EGSA 3LKQA 3JVGC 1D5BB 3HR6A 1OGAD 1NCAL 4WTWA 3G5ZB 2CO6B 1J9CT 1TETL 2QSTA 4KUZL 4NRYA 3GJFB 3MRKB 3SJVA 4HGKC 3C5ZB 2GJ6A 4P2RD 5ESQB 3FRUA 3ELAT 3UTTE 5KN5A 3U0PA 4U6XA 1UEYA 2CJUL 4G5ZH 1G7QA 1JVKA 5MP6H 3FT3B 4LSRH 4MNGE 4MAYA 5TQ2L 2Y5TB 5E6IB 2Q86B 1S7TA 5HHPA 4NQSB 3DX9B 7FABL 4KXZH 2GQHA 1OP3H 4XCCL 4PBVC 1FFQA 5MENA 1UWXH 5AG9A 1SMOA 4OZ4B 2BCKB 4F9PC 1XF4A 3DTXA 1GH7A 4LLQA 4HIIA 4AL8H 1OTSD 1YMMB 3QUZA 5B4MD 3GKWH 2OZ4L 3RVVC 5JLZB 3HUJB 2VDRH 1TFHA 2R4RL 2HG5A 2EDJA 5ALCL 5I76A 1L0QA 1RIHH 4GUPA 1MJUH 3DRTB 1RU9L 3LKRB 3R06B 1GGCL 2EIZA 3F5WA 2Q3ZA 5KW9H 1T7VA 1IKFL 2WBJA 3WFDL 3EHBC 4LEXL 3RX8A 1N8ZB 5F6HJ 1BEYH 3WIIH 4LK4A 5E70A 2X10A 3DUSB 5DRXB 1XCQA 5B8CC 4WJ5A 2XA8H 2HH0H 1FC2D 4Y8AA 2QQLH 4LHQB 3QWRD 5E2WH 4F3FA 4HUNB 4R26H 1T0MB 4P57B 5DT1L 5IM7B 1ZHNA 3IU4H 4M8QB 4QNPE 4HMDA 2ERJC 4WHTB 1WQVT 4EDXB 4TTDD 4WI5A 4D0DA 4BFIA 5D7JB 3L3JA 5C0EA 1LD9B 5FGSA 3LKRA 4RMQA 1XGUB 3V6FA 2X1XR 2YKLH 3PHQB 4HS3B 4KTEL 4BK5A 5L2KB 2VDPH 1FZJA 4D9QE 3OF6D 4NN7B 5LVEA 3FQWB 3HUJA 4LGRB 1DFBH 3UPRA 3PHSA 2X4OB 3HMWH 4PRHB 1Z9MA 4OAWA 2L7JA 5DK0A 4OZ4A 1JPGA 5DRNA 4QRSA 3VH8B 5JQ6H 4QWWD 4D3CH 4MJ6A 3ZHDA 4EEEA 5HGAB 2RFXB 1Y0LB 4OD2B 3JUZA 1IGFH 3FT3A 3MR9B 3T4AA 1G7QB 3GSRA 4YHNA 4YXLL 3MV7A 5JW4N 4L4VB 2HVKB 5EZIH 1S7XA 5E5MA 3Q3GA 1TPXB 3DROB 3GJFA 1IL1A 1URLA 3MRKA 3SJVB 3SOBH 4IMKA 2ARWA 5MHSD 3GMLA 1AQDA 1KTDB 3B8YA 3BSZH 2O5ZH 3QCVL 3BIKB 3MV9B 3KS0H 1AGBB 1KYOK 2R4RH 5F7DB 3GIZH 2CMRL 5ALCH 1ZLUK 3FB6A 4WW1B 4PRHD 4PY7A 5EUOF 5F9WC 1S8DA 4NKOA 1HHIA 1LO4L 4Y16A 5EO0B 5BV7B 2IG2H 3OR6B 1LE9A 1RIVH 1QO3A 4FZEL 3VXSB 3RAJL 3L95A 4FQIL 4FXKA 3FCTA 5D96C 5ALBH 2OSLA 3OJDA 1X3DA 1OSZB 2DBJA 4IRSC 5EZOH 2DMBA 3GRWL 1AQKH 5MERA 4NUJA 1D6VL 4XMPL 4JRXA 3FKUS 2CLZA 3CFIC 43CAA 1G84A 2OL3B 4FG6C 5SWZE 3S36L 1UADC 3HUJE 3MA9H 4P2OD 3MJ7A 4PJHA 2XZCH 4ZFGL 1BD2E 4U7KA 2C1PA 1P4LA 3X14A 1LNUB 3AS2A 2GY7B 3QDGD 5JW4M 3V6OA 1OARL 1U3YA 5I8OH 3RWIB 2WUBL 2CDFA 2RR3A 4Q97A 3S5LB 2APTA 4XHQA 1BBDL 3VG9B 5IW6A 3OXRA 3D18A 4OZHA 1IC5H 3R4DA 4XXCA 2ED8A 4BQ6A 4G80B 6FABL 3C60C 4OF5A 4XH2A 1OQXA 1MFAH 3ILPB 5CGYD 5F89B 1I8LC 2M1KA 2VDLH 3FQTA 5DMJB 5GGVY 1AXSA 1Z5LB 5JPMB 4YUEL 4OI7A 2VDQL 1BQHB 1I9JH 2FWOA 3KYNA 3Q0HA 1JNNH 1BLNA 1WK0A 2R9HC 4JQIL 4P2OB 4XP6H 4LCWB 1CT8A 4FS0A 4IBLT 5IBLC 3SDYL 2FO4A 5HHXL 3Q48A 4GAYA 1A1NA 1R3LA 1JZ2A 4LKXB 2CGRL 4HAGA 3WHXA 4GAFB 1LE5A 5BVJA 4M6MH 4NCC2 3PGDA 1MVUA 2R0ZL 1NBYA 3LZFL 4WTZG 4PJ7A 1GGIH 4QO1A 3O3EA 1GXEA 1DUZA 3WE6A 3H3PL 4ZFGH 2DM2A 4ZTPL 4DN4H 5C9JA 5GZOD 1NGZB 1S7UA 2PTTA 4O58H 1EMTL 4DKEL 2NY7L 2RGSA 2XIDA 3FONB 1QLFB 3VGAB 4LCWD 4NDMB 2VC2H 1KB9J 2RHEA 2BOCB 3MRHA 2FHCA 5HYSA 4KC3B 2VLKB 1DBJH 1VACB 4K3DH 3BEVA 4PJ8D 2P5WB 3EIFA 4EKXA 1O7SA 4ZOAA 1U6AL 2E9WA 1VGKA 2PR4H 4CU7A 1T3FB 1X4YA 1IAKB 1VERA 1SYSA 4XCCH 1KNOA 2AJVH 4OCLC 3DGGA 2KQMA 1HHJA 2VH5H 4GRLA 3S3PA 1G6VK 4D9LL 1H3GA 5HVFB 3WL9A 1JHKL 5FKPB 5EBWB 2C3VA 4WV1B 1J05B 4XXDA 1CD1B 1YECH 4NQCA 4URTB 3VWKC 3QJFB 3O4LA 4HK0B 1V7ML 2QADB 2P8PB 3I6LE 3WNNA 2EDHA 2VISA 2NY2B 3GNMH 1MELA 3QEHB 4UI2A 4NUGH 4MJIA 4GRLB 3NOIA 4KKAC 2VLLB 4HJ0D 2NY0D 3KYKL 4RAVB 1Z2KA 2XG4A 3E6FB 4YDJB 4C56D 2WNGA 2P5WA 4WUKH 1UXSB 3EDFA 1AC6A 2A6IA 5E9DE 4UNUA 3D0VB 4L29B 3VFTA 2VXVL 3HR5B 5ADPH 1I7RA 4JFZH 5D5MA 1TJHL 1MFNA 4N90E 1JF1B 4HF5L 1EA9C 2DQFB 2NCMA 2VZ3A 4I2XA 3SKJH 3G5VB 4GFTB 1Z9LA 5GRJH 4RGOL 3RZCA 4YHIA 4ZPTB 2YSSB 1MNUH 1ONQB 3V4VH 1NFIA 1MCWW 2OR9L 3C6LB 3L3IA 1C12B 5LGHL 2IAMB 1CTNA 3BEWB 5SX4I 2IADA 1UM5H 4LKXA 1AD9B 2G75A 2QQNL 1GCFA 5FCUH 4WI8A 1JZ8A 4OZFB 4XTRC 3QH3A 2DB8A 5DMKB 4B53A 3EDKA 1RZ7H 1PLGH 1KLGB 2H45A 3K2MC 2H26B 5DMYA 4JZJB 3BX7C 2AJYL 5EU3A 1RUQH 3QWOB 1EHAA 3LRGA 4WHYH 3ZDYE 2HJFB 4WY7L 1WWBX 3T2OA 4CNIA 4EN3A 5DUPL 2QHRH 5H2BA 1DDHB 4W6XB 4NC2B 1I1AA 3MJ9L 1ZGLM 3TVMB 3DYMA 1RULL 4O51B 2BSTA 4KY1H 2D9QB 4PRAB 4QY8B 2NTFB 4LVNC 1QRNE 1CG9A 2FB4L 1A3LH 5J6HA 1ZWIA 3A0OA 2FCBA 5HVGB 3MO1A 3ARDD 2A1WL 7FABH 5C6PB 4JPIB 1N5YH 4PJHB 4WFGE 3MLZH 1C5DA 3GUTA 3WO4C 2Z9TA 1J8HB 5ABDE 2ENSA 2KL6A 3TEUA 2K7QA 4J3TA 4QXUH 2PO6C 4PP2B 5GRWA 3KPSA 2VERN 4XVUD 5GRUL 2Z91B 4K8RL 4ZDHB 3QUMH 4Y4KD 5FK9A 5LGHH 3O6LL 3OPZH 4MDJB 2IBGA 3RIFK 3LB6D 1NCBH 4MVBD 4R97C 4FFVC 2VDMH 1PSKH 4B5EA 4F37K 1J10A 2MCPH 1JGLH 3MV9E 1T5WB 4AQOA 1KTDA 1AQDB 2AERT 2F15A 1T2QH 1Q9KB 3G04A 4JRXD 4JHZA 2BHZA 3V6ZB 5T1KB 2XWTB 1FZKB 2ZUQB 1GGUA 3L9RA 3WFHA 1XFPA 3C87A 3VE0A 3CIQA 1NAKH 4G7VH 3L3KA 1JRHL 2XOTA 5ICZA 1GSMA 1WIPA 3MV7B 5KSAB 3T4AB 4NN7C 4ZFFA 3OG4B 4TUOA 5DA4A 1LMKA 1U6AH 1A9EA 2RCSL 4CKVX 3GJFH 1MFEH 2A77L 2IFFL 2YKLL 4LF3A 1JNJA 2EE6A 4PRHA 3BZDA 4H1LH 5I8CB 2DBLL 5F1KC 2W38A 1FV1A 4Y4FD 4G8EB 4RFOL 3PHQA 1OGAB 3WIHA 1E28B 1XGUA 3V6FB 5L2JA 1TZGH 3MLZL 3QUYA 5DEGA 2Z93A 3TCLA 3HNTH 3ULVL 1B6DA 4BSVB 5JUEL 2V9TA 5HDLA 1INQB 3JWOH 5GS1A 4GRWH 2X70A 5LBSH 3SPVB 2PF6A 2IPKA 4ELME 1TTFA 3VG0H 2XN9D 2V7HA 3OKNB 4K23L 4F9LC 1J0JA 4JPWL 3ARGB 1MI5E 1N64H 5I6XB 1BPVA 4AZ8A 5C08B 5E0QA 1AXTL 3UC0L 1W8NA 1PVHA 2A83A 2BMKA 1ZGLP 3OKLA 5GGQL 3OAUL 1YEFL 3WFBH 5CEZE 5C09B 3B2VH 5CKAA 4QTHA 1N8ZA 2ZUYA 4JFEE 4MB4A 4RGND 2HAZA 2GIYA 4YDIL 3RIFF 3DXAB 3TO2A 1FVCB 1HH9A 2FEEI 4DK3A 2W9DL 1K2DA 2NX5E 4YX2H 4ZAKC 1U8OB 3O8XB 1U41A 3L1OH 4PJCB 2VDNL 3CMOH 3GHBL 4YXHL 1BD2A 4KI5D 4HIIB 4NQED 1XF4B 4ODXB 5IK3B 1MCQA 3C5ZC 3IJYB 1QFUH 5EOCH 3RL2A 3P4LA 5EC2A 4YHPB 4XAWH 1YEEH 5D9SA 5HHPB 1KCVH 2HFGH 2IPUK 5I30L 3IJHB 3IJSB 3QXVA 1B0GB 3MYJA 4YHLH 5LWYH 1CI5A 1NSNH 4U6XB 4LNRB 1BBDH 3TP4A 1I7ZA 4JRYE 3NCBB 3CFKB 5GZNC 2VZSA 4YWGH 5ADPL 1CD8A 3QUMB 4JO1L 2FDBP 4NWUH 1NH6A 1BEYL 2CUIA 5LAXB 5ITBH 1JWUA 2AEQH 5J7CC 4IS6B 4NP4H 3KNBB 3IXAB 3QG6A 3EYVB 5CEYA 4HFWA 1ZA6B 3VXPA 2AXFB 4OV5A 3V5KB 4OCYL 2ZCHH 2YPKA 2HN7B 4JCMA 1YEHH 4R8WL 4QOKB 2QTEA 2HMID 4LSTL 4TPRL 2IQ9H 4H1LA 1NLDL 3NZ8B 2DQCL 5HI3D 3PWLA 1XGTA 5BQ7B 5ACZB 4L4VD 2MOVA 3PWPD 1A6ZB 3TIDB 1RZFH 4N68A 4UDUB 1WGOA 1BVKB 3O4OB 4NQXB 1SJXA 2EEDA 3KNBA 2VXSH 3TA3C 3GHBH 3QPXH 1I4FB 2MSPA 5LAXA 2PNDA 4PJXA 4RX4D 3SKOA 4BELD 1JMXA 5K59F 3SPVA 1OM3L 3S35X 2A6DB 2BFVL 4XCFH 3RY4A 4NPYA 5GGQH 4UT6H 4EQ2A 3MGTA 3ULVD 4XX1G 2NY7H 4GLRH 5L0QB 3MXVL 4K3DL 4BZ2H 2D0HA 3ZYIA 5CEXA 4YC2B 1CTOA 2QHRL 3EOTH 4ODSL 4KK5D 4OLYH 4YDLC 3SE4C 1YMHA 5BRZD 3GBLA 1G7MB 3TA3D 3AY4C 5C0FA 5T33L 1EV2E 2I60L 3ORJA 1PW3A 3M1BB 4KGLA 1NBVL 3P9MB 4M7ZB 4X6EB 2GJ6D 4NZUL 4XNQB 3T0DA 5C0BD 3S88L 4P2CG 4NO2A 3W0WB 2ADJB 1MREL 2Z8SA 4NGHL 5FUCE 5SWSA 1NJ9A 5B38A 4Y19B 4W6WB 1XIWC 3NFPA 3L3OA 1MRDL 1P9MA 3QEGH 4O9HH 2R2HA 1FAIL 1J1PH 4JFHD 4YBQC 4F7PB 5D93C 2NY5H 2GITB 4MJIE 4PG9A 4X7SL 1JZ7A 1JHLH 5TE6L 1U0QA 3OWEA 5JDSB 2EKJA 3V6ZA 1KCRH 1UKQA 2X9XA 2PYEE 3PP3K 1A4JB 4R4BA 4YH6A 5F9OL 3QQ4B 1CQKA 1KTLA 2M2DA 2VDML 4OGAD 1ETZB 4IDJL 1MCCA 4MCYA 4DN3L 4HXBL 4PRDA 2EDWA 5TQ0H 1T1WA 5KG9A 2NY1D 4OD3L 1QSZA 2X1QA 4NZJA 1VEOA 2ICWA 5DJ6B 1CK0H 1ZT4B 3QEQE 4ZDHA 3VXTB 2Q76A 2DM4A 4FOMA 2HLAA 2X44D 1IZKA 4TSCH 3KPPA 1NAKL 4F8QA 2P5EE 1NDGA 3SGEI 3DVIA 4G8EA 2CIIB 5DYOA 4V1DA 4GKOA 4E5XA 5TDNB 2QADC 2VXSL 4HUXB 4PLKD 2NPLX 4PY8J 2EDLA 1WV7T 1OT2A 4EI5D 2Q1EA 1P69B 5J12C 1V5JA 1Z6JT 1CG9B 1ZK9A 2JELH 5EIIB 4OF8A 2AJXL 3GSQB 2NTFA 1OWRM 3MRRA 4TUOB 1JK8A 1RVFH 5IEKA 4PRNB 4DKFH 4X6DA 3LHPH 5E08H 1F11A 5L9DH 4QHUB 5EN2B 4L3EE 2X2YA 1S7SA 3UBXB 3TBSB 1Q9KA 1EX0A 1T1ZA 2OX5A 1ZLVH 1KCVL 5I30H 4K9EL 5FF6B 3MYZA 3DNKA 4GKNA 4P5MB 4Z0XA 1BZ7A 2DQEH 5DVNA 1FGVH 1MCNA 1A5FH 1RZ8B 3HRPA 5ADOH 1IZJA 5DJZA 4QF1A 3VFPB 3S8WA 5J1SC 3QFDA 5CP3H 1X5HA 4H5SA 4MXVE 3R1GH 2C3XA 4NM4H 2ED7A 1QZ1A 3H3BC 5ITBL 3QFJB 2IAMA 5C0ND 4AENA 2DF3A 3G08A 3RU8L 1S7RA 3V7MA 1T1YB 2FNBA 1J0KA 2BNQB 2EC8A 1X7QB 1YYLH 3WFEH 4ZPTA 3GUTB 1J11A 3VFGH 5F8RC 1S7RB 4RWYL 2V2WA 2NYYC 3KLDA 4C56B 2A74A 4YBHA 4YEFA 3KS0J 3AS3A 2W0PA 4JPIA 3S4SB 1I8LA 3FO2B 4XRCA 1WFOA 4R9HA 5C6WH 3OJMB 2VLME 1TTUA 2Q8BL 1V05A 4JDTL 2Q7YA 4PJXF 1VCAA 2CK0L 4P2QE 2X4TB 1JIBA 4JVPA 4MD5B 1YEJH 2UY7A 1Q1JH 3FMGL 3HE6D 1A7OL 2A74B 2Q8AL 3KYKH 2V2WB 3FL7A 4X0KA 1QNZH 5IEHA 3WN5C 3SGJC 4GG8A 3KPMA 4FA8A 2ADIA 4PJAB 4BSWB 4K71B 1FGVL 1CBVH 5HI5C 4M93C 5DJZB 3VFPA 4HWBH 5GGRA 4WV1A 4U0QB 1CFTB 1JWMA 1ZANL 5DMKA 1ACZA 4H1LG 1TVHA 1FSKB 5K9KA 3QUYC 1BJ1H 3DBXB 2AXGA 4KU1A 3NABL 2RJMA 4C55A 1NANI 4ENED 2F54D 4PJCF 1CFVH 4U6VH 1R3KA 4K23H 1SYSB 4C56A 4G6MH 3TVMD 4HUXA 4KROD 1KEGH 1GAFH 1NFDA 4F15C 1I3RA 1CDUA 3CGTA 3NTCH 4MJID 4GRWB 2XQYG 5EN2A 5FOBA 3PJSA 1A6AB 3DX6B 1CS6A 3GSNA 4FQJL 4XHJC 1ED3A 3KPOA 1IC7L 4MA1C 1TZGL 1HYSD 4H5SB 5IEKB 1J8HD 3VFTB 5E8NA 4MXVF 3TZVB 2N7AA 4PJHF 3I3DA 1L7TH 1SJEB 1J12A 4HWZA 5HPMA 4CVZA 1BZ7B 4Z0XB 4J4PA 5INCB 1VFBA 1CIDA 4Y2DA 1W0WB 5FCSH 4J1UB 4KRLB 4NT6B 3WHXB 5TH2A 4AEHH 3O11A 2R15A 4MJIB 2Y25A 5ITFA 4FTVE 5FUZH 4EBQL 3BGFB 1F11B 1LEGA 3X11B 3EOAB 2HLAB 4ELMF 5B38G 2ZCKH 2AGJL 4AMKH 4HXAH 5D7IB 4KTEH 3WNKA 3CFEB 2BHUA 1JK8B 3SGDH 3JSSA 4W6YB 4X4ME 1XGRA 3CX2A 3HI6H 5EB9A 5GGTL 2ICWI 1SYVB 1BLNB 5EBWA 2NY6C 3MZTA 4XNQA 3ZE1F 1KFAH 3MFGB 5B3JF 1MCHA 5MEPA 1F4HA 1KNOB 4TNWF 3FQTB 2XY1A 4PGCB 3QDMD 3EOBB 4E5XB 2XKSA 3CFDB 4YXHH 1N5YL 3BEVB 3UZVB 5GGRY 5T5FL 3B9VA 2J4WL 3HE7A 3K2UH 2VO5A 2GITA 3PWNA 2YN5A 2CDFB 3HE6C 3RNKB 3FOLB 1GGTA 3PP4H 1F90H 5DDHB 1WEJH 4Q6IB 3NFPB 3MQIA 1D5ZA 2ICWB 5DJ6A 3SE3C 3LPGA 5SWSB 5F71A 3H8NA 3GSNL 5KSAD 2ADJA 1T4KB 1F3JB 3D39E 3NCCB 2PTTB 2LVCA 43CAB 2CLZB 1UZ6F 1FNEA 4LPWA 5SWZB 1Q9WA 5DJYA 1JPTH 3UROR 4YPGA 3RGVC 2ICEB 1L0XA 1DSFH 2Q6WB 3P30L 3QQ4A 1LP9E 2BRRL 2VR9A 3SQOH 4NJ9H 4WW2F 2FO1A 5FIEA 3PGDB 3STZB 2ESVB 1N64L 1UM4L 4M02A 3ZKXB 3MLVH 5I1GH 1WTLA 4FQHA 1A6WL 4WI6A 4WI4A 1EO5A 2N56A 1FO0B 5GHWH 1CXKA 1OAZH 2UY6A 4RGOH 1QSFA 4NRZA 2FO4B 1N7ML 4Z7OF 5IVXB 1FIEA 3OX8B 1GC1H 5CEYB 3NH7L 4OKVA 5F96H 3Q6GH 3QO0A 4AEEA 3KYNB 4H20L 4F8TA 2PW2B 3P9WB 4YHOH 2HKFH 4RGNB 1MQKL 3SE9L 1QFWH 4KK8D 4LLVB 1U2CA 2BY2A 4OTXH 3DROA 1NGXB 2FEDC 3N1PC 4X4YB 3C8HA 5HYJA 1XGQB 5IB4B 4L4VA 5TPWL 3T0BA 4U1IA 1EUUA 3ZTJG 3TBYB 1KCLA 1B0GA 3MYJB 4LPTA 4KMTL 1J1OL 2IC2A 2PO6A 4H0IA 4QOKA 3C6SB 3OKEA 1LDPH 3V5KA 4XNYL 1X5IA 2XZQL 2P48B 3MJ7B 1DE4B 2JJSC 4PJCA 1MH5B 1JWUB 1CL7H 1JZ4A 3O8XA