5I8EB

Crystal structure of broadly neutralizing hiv-1 fusion peptide-targeting antibody vrc34.01 fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
209
structure length
203
Chain Sequence
IQLTQSPSFLSASVGDKVTITCRASQGVRNELAWYQQKPGKAPNLLIYYASTLQSGVPSRFSATGSGTHFTLTVSSLQPEDFATYFCQHMSSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VRC34.01 Fab heavy chain
total genus 35
structure length 203
sequence length 209
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eB01
4O9HL 4M6MH 1QR1A 1NC2A 3ULUF 5EZLB 1YZZA 3QR2A 4BZ1L 1PYWA 3HB3D 2X4TA 1UXSA 2GJZB 4WHYH 3MV9D 4PJFE 4HUWB 3H3KA 3A6OA 3GSNA 3HUJA 2XZAH 2A83A 4YFEA 1BFTA 2K9UA 3SO3C 2HTLC 5KAQG 1T21B 2VDRH 1YJDH 4Q9QL 3F7VB 2F54D 2GJ6E 4G6JH 1IGFL 3C2AL 1T7XA 3G5ZA 1NLDH 3CVIL 3DURB 5DQ9B 2XIDA 4R4BB 3FQNB 5MHSD 4OCSH 3D3VA 4XCEA 8FABA 4LLDB 4NRZA 4QLRA 3WNPA 4MDIB 4HBCH 4TOYH 1CXIA 4I3SH 1DEEB 1CICB 1HHHB 3VFRA 1INQB 5T1LB 3RGVD 1Q72L 4L8CB 1XGTB 3GSWB 1U58B 2XWBA 1RZGB 2EDBA 2LAAA 4DUVA 3NABH 5T5NG 4OKVA 4YX2L 1JRHH 2HMID 1WUNT 3C8KB 1AGDB 3PV6B 2P43B 4HJGA 5C86A 3ZKMD 4JRXA 2UUDH 3VFMA 2EE9A 1N5AA 3P0YH 4KZDL 1I3GL 5HHPA 1T4KB 2NY2D 3TCXA 3FRUB 3TV3L 1LP9F 4N0CC 4PJ8D 4P9MH 1S9VB 3DV4A 5MHSE 5CBAB 5EU6A 1KN2L 1GC1C 1IC4L 2F19H 1DBBL 3V5DA 4JFZL 5TJWK 5JW5B 5GGSA 4EOWH 4IMKA 3VXTA 5BS0B 4Z7UB 4XHQA 4Y2DA 4LLAA 5KOMC 2A6IA 3BIKB 3HNSH 3U1SL 1P7QB 3LRHA 4R4FL 4L4VB 3FQUB 1JPTH 4UIMB 1YMME 3T09A 3KLHC 2AXHA 5C0BA 2DQTL 1YYLL 1B0GA 4JCLA 4NPYA 1KFAH 1A4KA 1G1CA 2X1WL 3P9MA 5HDQH 3MLSL 3SGKC 1XGRB 4LPUA 2H26A 1X5AA 4GUPB 4XNXH 4DFIA 1GGCL 3MV8E 4Y1AE 2BY2A 4OM0L 1WZKA 4P4KA 1LDPH 3LQZB 2OQJA 3MNZB 3MXVH 3D39A 1OQXA 3DXAD 2E6PA 1MY7A 1SJHB 2WNGA 3RBGA 3JSSA 3QQ3B 3OKEB 5BV7H 3U7YH 5KANI 4POZC 1CGTA 1EUTA 4LLWB 4WFFE 1HQRB 1MIMH 5TGBB 5GS1A 4FQQA 4Q9BA 3VXQB 1SBBA 1T7YA 4FFVC 4LSPL 2OL3A 4QXTA 1TVBA 5AZEL 2XT1B 3VDCA 5KSAD 4GFTB 3VU2A 1A1MA 4IHOB 4JFED 4O4YH 1FAIL 3KPPB 2H9GB 2R56H 3T2NH 2I9LB 1MJJA 4GW5B 4JHZA 1RK1B 2ESVD 4BSVB 5HHNA 2BSRB 4NNYA 1JNLL 2W9DH 1PGRB 4L3ED 4YIQA 1LGVA 5D7LB 5BJTB 1RK0B 2B20A 2CK0L 4XNQB 2JLLA 5JOPD 4N8VA 2OJZH 1JNNH 3ET9F 1N5AB 4BFEA 2MQCA 1MFBH 3RL2A 3VGEA 5F96L 1PBYA 3QQ9C 5GZND 4TPRH 1R5VB 3REWA 3IVKA 2DLIA 1S9VA 5DHXB 2V6HA 4L8DB 1UYWH 4OZIF 3L5WB 2W65A 4E41A 2DTSA 2G60L 2V5MA 4JDTL 1FNHA 3ZDZE 1CXHA 5DO2C 1C16B 1TZIA 3SGEI 5BVPH 5EUOA 4LVHC 3KPRB 3TYGH 1S7RB 4HWNA 4QYOA 3P9MB 4PRID 1NDMA 1AGCA 3BP6A 3DROB 3T1FA 2QQLL 1KIUA 1IGCL 4YBLB 5CAYB 1I8MB 3T4YB 4KDTC 4UQ2B 2DQFB 1R5WA 3HI5H 1T5WA 3G5XA 5MEPA 1JFQH 4GT7A 3UX9B 3OKNB 4N0RA 2UZXB 2A74B 3CXDH 2J8UF 2CKNA 3ARYA 2OZ4A 3PWNA 3QIWD 5KS9E 4K7PX 3BPOC 5IVZA 1IMHC 1XZ0B 2FX9H 1U8MA 5JDJA 2YR3A 3LB6C 4YDJB 2JB6B 5GS1B 2AJUH 5IESL 1I85A 4HK3J 4HKZA 1VDGA 2EKSA 3CFDB 2X41A 3MZTA 3IGAB 3GSNH 3MPCA 1P2CA 4Z6AT 4CJ0A 5GRWA 2CDFA 2EXYD 4MCYA 4CVUA 3S88H 1E28A 3SKOA 3CH1B 2H45A 3IF1B 5IOPB 5HHNB 1T04B 2DI9A 3D0LA 5KAQF 2V5SA 1F11A 1G9MH 3OKDB 3MYJA 4JFDE 5JO5A 2VWEC 3GMQB 3B9KB 4X8XA 5HI4C 5FFLA 2FWOB 3QNXA 1EJOH 4LPXA 5KVFL 4BH8B 3DLQR 2EE3A 3L5WA 3W0WA 3LN4B 3TA3D 1NL0H 4JFEB 4WGVB 2Z31B 3GHBL 3BZ4B 3WKML 3OJDA 4R96A 1OAXH 4X6CB 2J8HA 3DSFL 2UZIL 2IBZY 4WO4D 4HIXH 3EGSA 5HVFB 4NQCA 1MLBB 3C2AH 3SY0B 4JKKA 2DYPB 3MODL 4HBCL 1R5WB 3B9DA 3OWEA 5CSZA 5E00B 1MWAB 3HG1D 4UOW1 4LCCC 1FORH 2B7DT 3GMMA 1UZ8B 3BKYL 4MX7B 2A6JB 3LKNB 2R4SL 4AM0B 4WU5A 5IQ9A 4OB5L 3NABL 1ZT4A 1NCTA 2H32H 3WLBB 4D0BA 4UV4L 1IQDA 1VFAA 4OIIL 4R90L 4EN3C 3JVGA 3UYRH 4FQJL 1QSFE 3ARDC 3TO4C 3VI4E 4Y5YA 2X4UB 3WFDL 4KV5E 3IU4H 4XCFL 1NAMA 1NFDA 3H7LA 1JGDA 4JN2B 2VR9A 2FH8A 2NY3D 3FZUD 2HN7A 4QRTA 3KPRD 1OQOA 1AC6A 3QA3B 3ARBA 1RZKH 3A67H 4P4RA 4EOWL 4JY4B 5AAMA 4Y4KB 5JMRA 1KELH 2Y5TB 4GH7B 1DE4B 1FSKB 3HNSL 3U1SH 4JM2F 1WAAF 3LN5B 4I2XA 3B9KA 5EOCH 3NH7L 1S7WA 1BBJB 1RFDL 5ITBH 4D8PA 1KBGL 1I7UB 1T0MA 2ERJC 1H3PL 3DO7A 2CR3A 4HIIB 3RKDD 4PV8A 3FONB 3U4EB 2ZPKL 1OAZL 3MNWB 1RHHA 2HYMA 1GGCH 1XGUB 1QLRB 1S9XA 4LLVB 5HHMD 3KS0H 2PO6C 1KIQA 4S10A 3KPNA 3RVWC 3MXVL 5D6CA 1MFCL 5EDXA 4EUPB 4F7EA 1YDPB 1AQKH 1FZKB 2YRPA 3NPSC 2W59A 2ZKHL 4KH2A 1HKFA 4XXDA 1EHXA 1FBIH 1MIML 1A7NH 4X5LA 4ENEC 1MI5A 1XGPB 4P9HH 3D0VB 3Q48A 3V6ZA 3WN5A 1NCUA 1TTFA 4RAUB 5MEOB 2VC2H 4J4PC 4E0RA 2R56L 4P59L 3O45B 4ODVH 1FL5B 3UPAA 1EIBA 2W9DL 5D96C 5C0BE 3HE7B 2EH8H 4U6VL 2CK0H 3EHBD 4F37F 1CDUA 2P47B 5IBTH 4XVSL 5TDOB 5E8OA 2D9QB 4D9QE 3LEXA 4W6WB 1F02I 4KY1L 1U41A 4TPRL 1P6AB 2HRLA 4C56D 1L4IA 4O2CB 2P5WB 3IRZA 2X7LB 3UROR 4L4VA 5GGUB 3RY6C 4U1MA 12E8L 5EOTB 3ZYOA 1OAKH 2E5EA 1TQCC 3OPZH 4XWGL 3GIZL 1WITA 3EOYG 3U0WL 1T6VN 4HUNB 3V2AR 4I2XB 3W2DL 4WTXA 3BE1L 4FG6D 3LN9A 3U9PH 4U1IB 1CGSL 3BPOB 2IMNA 3T0AA 2EICA 3QCVH 3H3PH 1A7OL 3DYPA 3JV4B 3NOIA 2QQLH 1A14H 1IGCH 5DHVA 4PLNC 4P4KC 4JQXA 1CICD 4RQQA 1AO7D 1W72H 4NKMB 3VXNA 5FGRA 3MRRA 3RIFF 1M71A 3QH3A 5C6TL 5I6XB 4PBVC 2YD2A 3GSOB 3LKSA 3CXDL 5EBGA 1DQLL 4V1DD 1DBAL 4LCUA 2FX9L 1BQLH 2RCSL 2F58L 3HI1B 3TBTA 1JZ7A 2AJUL 5CUSH 4NQVB 1O0VA 2BC4B 3H9SE 3ARFA 2BX5A 3BZFB 4RNRB 1DFBH 4JRYD 4MLIA 1FVDB 4U1JB 1U8LB 2BVQA 3L1OH 4WJ5B 3L3OA 5FGCE 3VXSB 4OFPA 3O45A 2CRZA 5FA4A 1YEGL 3QRFM 5DEFB 2R23A 1M7XA 3H0TA 1WWCA 3IKCA 1G9ML 3O3AA 4G9DA 4OFDA 1XR8B 4ZG1A 3QXDA 2W65B 5FGBA 5BO1H 1S5HA 2DD8H 1T1ZB 4GLRH 1GOGA 4K8RC 3GSUB 3FRUA 1W8OA 3VXRB 4YK4C 1CFTA 1EJOL 3NFPB 5ICZA 5HGBB 4X8JA 3JWDH 5D2LF 4Y19A 5L9DL 4NFCA 4RGND 5B8CC 3WKMH 4KK9C 2EDJA 1L9NA 1KPUA 4XHJC 2JIXD 3DSFH 3EJJX 4KQ3L 2UZIH 3TYFA 3ULVC 4QY8A 5IW3A 1SYVB 3TT3L 3O6FD 5EA0L 1D5BA 4CNIB 5IB1B 4J3SA 4NO5B 4PJ7E 1T7ZA 5IKCB 2XICA 1IAKB 5AZ2H 1U3HA 4IEFB 1FFNA 2N56A 5F9DC 4HUUA 2A6DB 4LU5L 2DOCA 1OD9A 3B2VH 5KVDH 3BKYH 3LQAC 4LRIA 3O4LD 4X4YA 2X4SA 2VOTA 4NQEA 2ZUSA 1J18A 2R4SH 4AMKH 4ZMAT 4HKXB 4G42A 4U1HA 2EKSB 3BEVB 4OFYD 5C2BL 1FIGL 4OIIH 4R90H 4Y4HA 3VGDA 5IFAL 4F7MA 3UYRL 4FQJH 4HEPG 1J0HA 3SKOB 4LNVA 2XWJA 1MFNA 3WFDH 5F8QC 4GBXB 3IU4L 1XF1A 3HE7C 4JJ5A 1H9VA 3O8XB 3LQMA 2H9GA 2BHZA 4M4PA 1KJVB 3K1KC 3CSGA 1HHGA 4P3DB 1PKQE 1NGQL 3Q6FB 2IH1A 3QIBA 4PRBA 3T3PE 2J5LC 4M61A 4X98B 4M7JL 3SDXF 1KCKA 1PQZB 5FYKH 1IKNA 2LU4A 1U8JA 4JFQA 3SDXA 3GSUA 3RDTD 4XH2A 5IB3A 3REVA 2AXFA 2FX7L 1W72B 2J6EA 1BQHA 4NQCE 1CFTB 3QO1B 1Y6MR 3UTSB 1LK2A 3L5HA 3VWJA 2ITCB 2VL5A 5IHLB 4M02A 1GZQA 1P69B 2ZPKH 4N90D 3KPSE 5D2NB 1BVLA 3TH3T 4LVNB 4GG6F 1C16A 5I1HH 3QUMB 2P8LA 1AQKL 1PZUB 2IPUK 4N9GA 5CGMA 5F7HA 5JA8B 4TVPH 5J9PB 1FBIL 1A7NL 3DVGA 5D1XC 2AVGA 3FB8A 2Q6WB 5CEZD 2IAND 4P9HL 4HXBH 2V2XB 2EE6A 1ADQA 3ILQC 5D70H 1P1ZB 5IB4B 3QDGA 4AZ8A 4MA3B 3O6LL 4I3RL 4XP4L 3MRFA 1TJHH 4XCEB 8FABB 4ODVL 5EZOH 4J2XA 3QIUB 3ES6A 1XF5A 4JG0L 2X42A 5HGDB 2EH8L 5B8CA 4O51B 1KIPA 4MAUH 3IJHA 3RAJL 4R4NC 5GRJH 3FOMA 2MJWA 3BYYA 3E6FA 4KY1H 3KAAA 2CDFB 4G6AD 4U6TA 4KHTL 1JIBA 1WC7A 3AVEA 4N0UE 4WEBL 2F8XC 1FFRA 5CZXC 4XGZA 1WTLA 1LO5A 3PV6A 4JFEE 1UXWA 3MV11 1JZ4A 4XWGH 3KPTA 4AL8L 3TA3A 5T5NF 1VEMA 2RJMA 3EOTH 3QZWA 3U0WH 4PJXE 1MAKA 5HHPB 1T80A 3BE1H 3U9PL 1FFPB 3U4EA 1E6JH 3RRQA 4A6YB 1M7DA 4X7EC 1YNTA 3L3GB 3MO1B 3MNVA 4XVTH 1A14L 4HD9A 4QRRB 3U79A 3BOVA 3C6LD 3BMWA 1UB6A 4YPGB 4FNLL 3FCTB 1Q94B 3MREB 5KSVB 3BX7C 1B4JH 3ARBD 4N9GB 5JHDB 3GMPB 4LLMA 5ACMA 4CU7A 3VRLF 4LLUB 1DBAH 3LD8B 4LCWA 4ZUVA 3VXMB 1BQLL 2RCSH 3DYOA 1EO5A 3WUWA 4D3CL 2XG4A 3MRDA 5EFIA 1P7KA 3HAEH 4HAFA 4PJXF 1DFBL 2J8UB 2ATPB 4D0DB 3SKUD 4N0CD 4D94A 2ITDB 1S7QA 3BDXA 3CLEH 5C70A 5FO8B 3JV0A 5TQ0H 1M7IB 3CDGB 4FN0A 1KEGL 3SO3B 4EZMA 3L3KA 2D0GA 2DLFH 3BAEH 4KMTL 1A22B 4NJAL 4PJGE 2R9HC 1YEGH 3RKPA 5HVHB 2ADFL 3KVQA 3NCCB 4I48A 4LPYA 5FF6B 1IFHH 1G7PA 2KKQA 3MV9A 4OGYL 4LSUL 1VPOL 4HIHA 1F3JB 4HGWA 2VUOA 2PNDA 1FJ1B 2V2WA 4WFHE 4X6BA 3EYFA 3F8UB 3TF7C 3DMMC 4EDXA 4C56B 4I5BB 4YHKL 2AP2A 1K6QH 3QDJB 3HNVL 4Y4KA 4QOKA 1FGVH 5JOFA 4NHCH 5F9WB 4XWOD 4RAVA 3AFLA 3TT3H 1HZHL 2XXCB 1PKQB 4FG6C 4MB5A 5L2KB 4AIOA 2NX5B 2PW1A 3L5XL 4JM2D 4PP1C 3LMJH 3DUHA 4N68A 2H6PA 1Z3GH 1RQ5A 3DO7B 3SJVA 2XRAH 4PV8B 3B3IA 1Q94A 4H88H 1MHPL 2VDQL 1RIVL 3DBXB 3O9WC 1QSED 1N4XH 3CXHK 3B2VL 5HHXL 3TIEA 1UWXK 1SM3L 1NCNA 4MQ7B 1XIWA 5J1TC 4LKXA 4AMKL 4LARH 4KJPC 4NKIL 3SKJH 3L7EA 4JPKL 2UZYB 3A6BL 1ZWIB 5GS0D 3MRDB 5EFIB 5IFAH 3VFNA 4IRSD 1OW0A 4TNVK 1BJMA 1FV1B 2C1PA 2V2TB 1QLFB 4N90E 1I8LC 2AJVH 3O3DA 4HUXB 1T22A 1T2XA 3OKNA 5D7JC 2YD6A 2R23B 5I8EB 3PNWA 4N8CL 1M7IA 3WIIL 4YO0A 2V5YA 3AXLB 1XGQB 3BPCA 5L0QB 3VG0L 1XZ0A 5HI3D 1EGJH 1BFSA 2HT4C 1S7SB 1M1SA 5JZ7D 5L2JA 3MLRL 1X7QA 3EAKA 3RIAK 1NGQH 4OAWA 4J6RH 1MY5A 3H7BB 1OF2A 1V3LA 3K74B 1HI6A 4LSVH 4JEGB 4RX4A 4PRPE 5HXMA 4ZDHA 1WF5A 2FR4B 5FYKL 4ONHA 2FLRT 1QFWI 4YEEA 1HE7A 4BFIA 4CDHA 2FX7H 5DJ2B 1XF3A 4G8IA 4ODXB 1KB5L 4JE4B 1A4JA 4P0DA 2FJGB 1CF8H 3L7FA 2NY0B 1YEEH 3TO4A 2A6KA 4JGJA 3LCYA 2AV7A 5IBUG 1T3FB 2QSCH 3CZFB 4ODSL 1FDLH 2Z31C 1MCBA 1N7ML 5I1HL 2GCYB 4R26H 2HA1A 3EHBC 4WGWB 4ESKA 3H3BC 5CEYA 3KWWB 4F8QA 4HG4J 4LHQB 3F12A 5EN2B 1MHHB 4TVPL 2APTA 3KLHD 2CK2A 2V7HA 4K2UL 2BOCA 3UJJH 1RZKC 3RWIA 3UAJD 3EGSB 3GK8H 1IGJB 1ULVA 3LKSB 2D0FA 3K7UA 4Q9RH 2XZQH 1IAOA 3MOBH 3C5ZB 1Q9OA 5GSRA 4O5LH 5H2BA 4GBXA 5J12C 4JFPA 3VXOB 3WJJA 1CK0H 5BS0E 4FFWD 3CH8A 4O58L 5IR1B 2DLEA 2HFTA 4FQPA 4PREB 5EO0A 4FQXD 3QUMH 2P42B 2H2PC 4CMHC 3P9LA 2R1WB 1ZLUH 2VWEE 5CSBA 3VCLB 3QIBB 4PRBB 1N59A 1OSPL 1S9YB 2EYTA 4HS6B 4EUPG 4PB0L 2OX5A 2UYLB 2QJDA 5KSBF 5D7IA 1WWWX 1XFPA 3QT2A 1IQDB 3E1F1 1SJEB 1DP0A 4GG6A 3BMVA 2ZP0T 5F7UA 2HLAB 3OX8A 3TBWA 4PRAB 4ODWB 4UDTB 4YZFE 5E2TL 3SGDI 3B6SB 4NN6C 3WHE0 2FB4L 3VD5A 4U1KA 4MNQA 2CMRH 2AK1L 3L7FB 4Z8FL 3DRTA 4XVTL 4UINL 3S5LA 1QSFD 1OB1B 3C5ZC 1KULA 5J1AA 3OHXB 1D5ZB 4ALAH 3CZFA 5IV2A 2V17H 4JFFB 2W91A 2H1PH 4Y2DD 5HYJA 3LVEA 1FNAA 2EYRB 1BBJA 5ESQA 3UC0L 1L6ZA 3DX8B 5IB1A 4D8PB 4MAYA 5IKCA 4EN3D 3SDDB 2OQJB 4ZQKA 3SDCD 2WLZA 1RURL 1FL3A 4AIXA 1VGKA 1XEDA 1SJHA 1X6LA 3PG2A 1RHHB 3ARGD 3FFCE 1JRHI 4MNHB 5T1KD 4UTBL 1KTLB 4MD5A 4ZFGL 1OLLA 3MLPA 4U3HA 3CLEL 1GGIL 3VG9B 1P9MC 3WFZA 5TQ0L 4O51A 3MRJA 2K7QA 1G9NC 4PJCA 3ZSSA 4UT7L 5C0ND 4WW2F 4F2MB 2WQ8A 3FT4A 2Y36L 3TCLB 1RK1A 4OQTA 1ZGLP 5D8JL 4LPVA 2VLKA 1JPST 5HBBA 4OGXH 4RAUA 4Z7NF 1VPOH 3DXAA 4QKXB 5KVMC 3S37H 3FTGB 4U3XA 3RHWK 5JUEL 1ZHLB 3P4OB 3MSPA 4J3TA 4XNUL 4HK3N 2HJLB 1H15B 2BNRB 5J89A 1NANI 3B4NA 1PDKA 2IH1B 3OGCB 2EH7H 4DTGH 3PWPA 4H20H 5DI8B 5GGTL 1FGVL 4LSTL 4NHCL 1FIEA 5CSGA 5KJRH 5INCB 1RPQA 3RX5A 2FECI 1QOKA 2P5WA 5F97E 5C0AB 2CDEA 3LS4L 1ITCA 1UC6A 3UTSA 2VR5A 3G6AA 1Z3GL 2IC2A 4GW4B 2XRAL 4YXLH 1S7RA 1NH6A 4OUUB 5E94B 4LLUA 5KVEL 1F4YL 3MFFA 3TN0C 2EXWC 1N4XL 4WFED 2AJYL 4Y4KC 3BSZL 1I8MA 2J88L 4UQ2A 4LVEA 4LARL 2XN9A 3PIQB 3DUSB 4M7KH 1ITBB 3MLXH 4NKIH 5C0CD 3V0VB 5SWSA 3QDGD 3C60B 4WUKH 3HS0A 3VXNB 1MJUH 3SDXE 35C8L 1MCNA 2AV1A 1DR9A 2AJVL 4GKNA 1AD9A 1Z6JT 4IRSA 4NO0B 3WIIH 1KSRA 5DURD 3QDGB 3VH8A 3S37X 3LRSB 4UMGA 5EBLA 4EQ3A 4LFHD 4WTZA 2C3HA 4FQCH 4NQVA 2EIDA 4X6CE 4F9LA 2AS5M 1FCGA 1QFUL 3D25A 2MQ0A 3MRGA 1AKJD 1WQVT 1LQSR 1CE6A 4HJ0C 4WI2A 3M45A 1KB5H 5CP7A 2IBGA 1BZ7B 4JZNB 2H3NA 3V6OA 4Y88A 1YEEL 3MTRA 3RPIA 3O11A 2R69H 1MEXH 2VDLH 1A3RH 3HE6A 3C6SB 3HKFA 4Z7UE 3BUTA 4X7DC 4YZFF 3TBVB 3V5HB 4PTUB 1XR8A 3OSKA 4O02L 4P4KD 1BIHA 5EOCJ 4RMUA 2P49B 1FDLL 4HUMB 4V1DE 1K8IB 2H6PB 1JZ5A 3GJEA 1MOEA 4G43B 1N7MH 2JE8A 4RGMC 2EDYA 3VXMD 4R26L 3DBXA 4QHLA 2NY0C 4HZAA 1M7DB 2YHGA 4H1LG 3TIEB 4I0PB 4IJ3B 1RVFH 1CE1H 4ZD3L 3GMOA 3O41B 1SEQH 1KJ3L 1C5BH 4BUHA 1UA6H 3RVVC 3RZCA 5CHNA 4U6YB 5CZXD 3RA7H 3QG7H 1NCBL 2Q7NA 2C1PB 4Q9RL 2XZQL 4MXWL 4NN5B 3GMPA 1QLFA 3MOBL 3CIQA 3KR3H 2P45B 1EFXD 2RQ8A 4PJGB 2X4NA 1T2QL 3VI3F 5IB5B 3C60A 3V52H 4A2LA 1CK0L 5HGHB 2IQ9H 3SCMB 2QADC 5J06A 3O4LA 1QFHA 4YHYC 1N0LA 2FL5A 3PP3K 1I7RA 2YEZA 1PSKH 3AS2A 1PX4A 3QUML 5IW6A 2E8YA 5F1NB 4IRSB 1TVDA 3WO4B 1S5IH 3O3BA 2X4SB 2IAMA 1FCCA 4G42B 4PRDB 5EBLB 5AWNL 3VXRE 3WL9B 2E9JA 5M7QA 1NMAH 4N0FB 5JIKA 1XF3B 4LSQL 3RWFA 4I48B 4ZTPH 4JZOB 5FF6A 4PJDF 4XPHH 2FHBA 2P8MB 3RWDB 2MTPA 3NFSL 3GFUA 4MA7L 1T3FA 2BSED 3MRQA 3L5JA 3WE6B 1Q38A 4XBGA 1HDMB 3ROOA 2IF7A 4UINH 3WIHA 4NJ9H 3NCFB 5DD6B 4PJCF 1KLGB 4PTUA 3T0EC 2D31B 5JXEA 4UTAL 2AEIT 5EN2A 2DMBA 5ITFB 2VSCA 4MS8D 5FHBH 4OKVB 4UOJA 3DX7A 3RVTC 1A1NA 2W0PA 1JGUL 1OT2A 2G9HA 4M6AA 4ZSOE 2AABH 5HHME 1D9KD 4BZ2H 2BXYA 2Y4SA 3MA7B 1RURH 1SQ2N 5I66A 3BT2L 1LE5A 5B3JE 1MHCB 3RIFK 4S2SA 2KQMA 3C5ZA 4JFOA 2XG5A 2Z35A 4UTBH 4HHAB 5HYSG 4JFPB 5IROA 5GISL 3M17A 4WWKD 5D9SA 1GGIH 3T0VA 2VERN 4HPYH 3ZKQD 4NUGL 2XTLA 5E5RB 3V79C 1BGXL 4M7LT 4PJGA 3CPLB 4QRQB 2R2BA 3QUXB 1ZKAA 4E0RB 5JTWA 2VQ1A 1OAUH 1K3IA 5HDLA 3HZMA 2IPKB 5F1NA 3C9NB 4KDVA 1SMAA 5I2IA 2FEEI 3HE7A 3S37L 3OV6A 5I18H 2J5LB 5JUEH 3VFUB 1U8KB 1CT8B 4NUJA 4B7IA 3BZDA 5KSUA 2E6JA 4M1GL 1MLCA 2W0LA 1XF5B 4KI5E 4OZFA 1OF2B 2VIRB 2EH7L 5KTEH 3IT8D 4DTGL 2V5RA 1FL6B 5DMYA 2EO1A 3BO8B 4NWUH 4NQCD 4DAGL 3KPSB 4NT6A 5TGBA 1D5ZA 3QJFA 4HWZB 5DJ2A 5F88B 4ODBD 3ZHLA 4ZPTB 4DJMA 2BVOB 1MRFH 1WIOA 3S4SB 4P2QE 2Q86A 1EHLL 1JGEA 1DJSA 4LSRH 4DN3H 5LGHH 1QO3B 2PXYD 4LHUB 4ZUTB 2Y25A 3SOBL 4A6YH 1OAYL 1DN2A 3M1BA 3BZEA 3FAWA 4S1DC 2D3VA 2YUWA 3ILQD 4OQTL 5T33H 4PP2B 3STLB 3MRRB 3BUYB 3CFJB 4N0UA 2OYPA 2FGZA 2YKLL 4YBQD 4PJHF 2F8VA 3DXAE 3U46B 1MJUL 2IFFL 3R0NA 2BOBA 4GAGL 3RWIB 5E4EB 3O6ML 1HKLL 1JWSB 5ISZA 3TN0A 3R1GL 2JJSA 4F7PA 1KYOJ 2P1YA 5F70A 2XKSA 1ZXQA 4QWWC 4YR6A 3BRGC 2NXZB 4HC1H 2KZ1B 3O3UN 4RWHA 2JTDA 4Y19E 5J1SC 1RULH 3HPJA 4QRQA 4CN1A 1WZ1H 5H2BB 5DJZB 1UQSB 5HVWA 3E8UH 1KYOK 3QISA 1QFUH 1S7XB 2NY0D 4LP5A 5GS2D 3RNQB 3BP6B 4FQIL 5I1EH 5D1XB 5KW9L 4NM8L 1UM5H 4HF5H 4NUJB 1AR1C 3G5XB 5MEPB 5IMLA 5E2UH 1OM3H 1EEZB 4Y5XC 5FHAH 1MEXL 1U95A 2VDLL 3IYLW 5E56A 3TZVA 4JLRB 4IS6B 1NGPH 4Z0XA 3V8CA 3QXTA 1N0XH 5GGVY 2F15A 5KG9A 5K9QG 1WVZA 1X5LA 2H32B 4MNQB 3LDBB 3TYFB 1CXKA 1YN7B 5JHDE 1V3MA 5FAAA 1VESA 4L8BB 4PJFF 4GLRI 3DX6A 1P2CB 1RVFL 2XN9B 3S98A 1CE1L 4ZD3H 2IEPA 5D1ZD 1PYWB 2BJML 1C5BL 2CIKB 1BQUA 1J86A 4GQPH 1KJMB 3ESUF 3RWEA 3LEYH 4WUUA 5DS8B 1UVQB 5FYLD 5ESQB 4PJ5E 2J12B 4MXWH 5ESVA 3N50A 2B1HL 1YPZE 3PP4H 5K9JL 4ZODA 5HVGB 1EK3A 4LCCA 3SKNB 4HQQH 3HZKA 1FL3B 1HQ4B 4BELD 4M48H 3BEVA 1JPGA 4MDJB 2DLTA 3RUGF 1JWSA 1JP5A 5ISZB 4MDIA 5E1AB 4QTHB 4LLQB 1DTUA 1EVUA 1YEFL 3DURA 5DQ9A 5EC1B 3LIZH 1KTRL 2DKMA 4X6CA 3AMLA 3VWKD 3EJZD 1NMAL 1K5NA 3L3HB 1EAJA 3R4DA 2I07A 4YHPB 1T22B 3UJTH 1D6EB 4TSAH 3LB6D 1XIWC 4RCAA 4MD0B 3ZT5A 1M6OA 2NXYD 3NZHL 4MA7H 1YC7A 4DKEL 3RNKB 2RR3A 3ARGC 1XR9A 5SWZE 2YUXA 1YEJH 4NBZB 4BH7B 5KS9A 3KNBB 1KCSH 4M7LH 2GT9A 1QVOA 3HZVA 2DKUA 1AGDA 2Z8VC 3PWPB 4JPWH 3IETB 1QTYT 5DQDL 5ADPL 2A77H 3PV7A 5FHBL 1NCAL 4X5WA 5E03A 1Z0NA 1Q9KA 2H32A 1X5ZA 3NGBB 1YN7A 3EYVA 3X3GL 1I1FB 1I9EA 1JV5A 4MNGB 3ZDYF 3ILPA 1UWEH 3LDBC 3MRHA 3GMLB 4NPYB 3NPSB 4P2RB 5GS0C 2NW3B 3QIBD 4LHJB 2AXGA 4Z7WE 5GISH 2Q1EA 3NCJL 2P46B 1FRGL 3MLTB 4NUGH 3SDAD 4P4RB 4LSSL 4X9IA 5GRUH 4CMMA 4XMLL 1I1CA 3DHJA 1KJ2A 1CDYA 4NHUB 2V7HB 1MCIA 3W9EB 3VMPA 1OAUL 4MSWA 1HILB 2A9NL 4YXKL 1R3KB 2WIIB 4LPTA 4PJ9D 1RUKL 1MQ8A 4I2XE 3SKMA 4PR5B 1R3IL 3WNNA 1A6UL 5CD3B 5I18L 2H41A 1GAFH 3BN9D 5L8LB 1IC1A 3QUKB 3BPNB 5E70A 2X89A 1F5WA 5IBLD 4NNPH 1ZT7B 4N1EA 5J11C 1UWXH 1U8NB 4QXTB 4ZFZA 5TF1H 2AEPL 4IM8A 4I9WD 5DT1H 1BZ9B 2W1NA 4EN3B 4I0PD 1NEUA 2VDKL 3ZE2E 4DWHA 1FFPA 5FYLL 3FN0H 4LGPB 1TENA 4OZ4A 5LGHL 3D39E 3BN3B 4L8DA 4KTDH 5FECA 3IJSA 4S1SH 4D9RE 2YD3A 3JBG7 5E5MB 5BZWA 4H25A 1I8LA 1OAYH 1G6VK 5T3ZH 5KSAC 3PDOA 1URLA 1G6RA 1RZJC 4KTEL 3MRIB 5LKNA 1J88A 3MUY1 2YKLH 5IMMB 5DRWB 5JPMB 2R2CA 2YD5A 5DJ8B 4P2RA 4C59B 1XH3B 1PX3A 1IBGL 1AGCB 2P7TA 2I27N 2EYRA 1HKLH 5DMIH 2VXVL 3JTSB 2QHRL 4Z7OE 1T5WB 5D71L 1ZAGA 1MRDH 4D9LL 3HG1E 1J7VR 3RHWF 5L7XL 4FOMA 1WZ1L 1S7QB 3C09B 5IB5A 1FLTX 3ZMRA 3O4LB 4KJPD 3BGMB 3PUCA 1Q8MA 1V3JA 4PRIA 1P5UA 4GXUN 3B9KC 1DUYB 4DQOH 2PYFA 4HLJA 1CDJA 2AK4A 4QXUH 4UQ3A 3V4VH 4Y16D 5DJ0B 1WTGT 1GZPB 4NM8H 3DO3A 1JN6B 1UM5L 4HF5L 3S3JA 1LNUB 2ID5A 1NGXB 1OM3L 2QV2A 3QPQC 4WU7B 1FJ1A 3EJYC 4PYHA 2VZTA 2I60H 2X44D 3FQXA 4LQFH 4OLYL 4EBQH 1N0XL 4QCIA 4EUPH 4M6OL 4FQXA 2H2SD 4XHJD 3ULVD 5AD0B 4KKCC 3UTSE 4PJ8A 5JO5B 3SE9L 4NOFA 5C0AD 4BJLA 3T8XA 3ROOB 5T3ZD 5IEHA 1X5YA 4OZ4B 5C0IA 4ZXBC 2IADB 2OLDA 5E6YA 4H0GA 4Z76B 3N06B 3NCEB 1PZ5B 4BYHA 5TE6H 4BSWA 5T3ZE 3WIFB 2EDTA 3CX5K 5E5MA 5F6IC 4JFEA 4RBPK 3KYOB 1J0ZA 3V6FA 5I1GH 4PV9B 2NY5H 3GUTB 4L8SA 3PP4L 2PKDA 4KJWD 1R0AH 4YDLC 3A0OA 1Q0XL 1EUUA 3OBAA 5SWQB 4FRWA 1N64L 3PWVB 4GMSL 1ZWIA 5EBMB 2P5EE 3QEHB 2QKIB 1MLBA 5I1IL 5E00A 1YEFH 3UAJC 1C7TA 4WW2A 2OP4L 3D18B 4RGNE 3VFWB 3KPMB 4WEMB 3C08L 4WU5B 3OQ3B 5IQ9B 1U8OA 3TBSB 3MCKA 2O61B 4EDWH 1S7SA 4OGZA 4ZUWA 4OAWB 4TSAL 3UTPE 3NZHH 1QLEH 4DKEH 2XQYG 5D5MF 5I1JH 4R7NA 2VN4A 4K3EH 4LEOB 1MCFA 5B4MC 3V95A 3O3EB 2MMXA 4M93C 1JGDB 4X4YB 3PDGA 4RZCA 4PLKD 3D85B 1AD0A 4JPWL 3D25B 2CLVA 4QOKE 3QQNA 4DGVH 5DQDH 5ADPH 2X4UA 4QCIB 2A77L 4EQ2A 4LMQE 1JTPA 4OLWL 1F3DJ 4F3FB 4LLYB 4UIKH 1F2QA 5FYJE 2B4CC 3H9SD 5LAXB 4YBHA 3T8XB 3X3GH 5IEHB 2MHAA 5J13C 1UWEL 1S7WB 2MKWA 5IP4A 1OT1A 4Z76A 2EKJA 4Y16B 2GCYA 1JHTA 5EBWA 2VAJA 1U58A 2HH0L 4JY4A 4HKJA 1INEL 1CQKA 1YA5A 1K8IA 2BK8A 2Y5TA 2ESVE 3DTXB 1QBLL 4WWKA 1WT5C 3ZTJG 4PJDE 5DUML 3NCJH 3MXWH 3HR5B 3FT2A 4NM4L 1FRGH 1MUJB 4PJHE 5EC2B 5GGVL 4LSSH 5GRUL 3U9UB 4F7CA 4WW2C 3C09C 3RI5F 1IGJA 3IDXL 4WUUE 4FXKB 2EO9A 1U2HA 2ZSWB 4WO4C 1OSZA 3KLAA 1TZGH 4NQXA 5IWLA 2A9NH 1OTSC 5FXCH 5HDOA 3O4OC 4R3SA 1CYGA 2HFGH 3NCYS 1KLUA 3CDFA 4NO2A 4OLUL 3VDBA 5CJQH 3S36L 5JW5A 5GRVK 5IG7A 4J3XA 2L7JA 2OSLA 4R2GC 3RBSA 4QHNB 1F58H 4P2OA 1XF2B 3FQUA 4UIMA 1PVHA 4Y5YC 1AXIB 4ZO6A 1G7JA 2Y07H 4J3OC 3VXSD 4ZFOL 2IBBA 3ARUA 1QYGL 4XNMA 2OMNA 1FH5H 5CEXB 1EFXA 4KRPC 3FB8B 2Q6WA 5CKGA 1SJVA 4JPIA 3QUYA 3TNMA 3C60C 3AM8C 2HKHH 2VDKH 1MCCA 4RMSA 1I1YB 5FYLH 4N0FA 5FYJU 3FN0L 4YHMH 4BKLA 1FSKC 3BJLA 3MJ7A 5I30L 2YZ8A 1C1EL 2OBGA 3JWNC 3W9DB 5DZNA 3TFKC 2PYEA 5F3HB 1OCWL 1RAMA 3DRTB 5DQJA 2IAMD 3QFDB 5I8OL 5BRZA 4PG2C 4XAKE 4U1MB 1CICC 4P46C 4X4ZA 1BIIA 1R5IB 5CINL 4I8DA 3CFBA 1HDMA 1OPGH 3VA6A 4TUOA 3H6JA 1JYWA 4QRUA 3MR9B 4P3CH 5IF0B 3FOLB 4M00A 1CFBA 4KI5F 1DQJB 3VFSA 1MJ7L 5DJAB 5AUMB 5HJ3A 4K07A 3VXUE 4OCNC 1IGMH 4IIQB 5ANME 4R7DA 1MRDL 4HGKC 4YIQB 3QPQD 4D9LH 2XNAA 4YUEH 3TA3B 4ZAKC 5CLWA 5GZOD 5F6IB 3VFGH 5A3ID 4MDJA 3V6OE 3MO1A 5DK0A 2PCPB 2QLVB 4QRPD 3T0EE 4QXUL 1KG0B 4XP6L 3WHE1 1UT9A 5LWYH 5DO2D 3KPQA 2NR6D 2OSLB 3VJ6B 1V7MH 5ESAA 1HXMB 4DVBA 3BHBA 2FO4B 1IL1B 1M05B 3L3HA 2JELL 4EN3A 4XCCH 3QIWB 3FO1A 2BSTA 1H15A 3FZUC 2W0FA 2V5TA 3S96A 5DRZA 5K9OB 4RMRA 5CD5D 4PY7A 3DNKA 1CFVH 3TNMB 3CC5B 3SE9H 2CLZA 1SEBA 4P5TC 4RIRA 1PJ9A 3CDGA 1CL7H 2XFXB 4ODUA 5DRWA 5JPMA 4E41D 1EMTL 2IANA 1ZA6B 1BIIB 1TETH 5E2WL 4GO6B 4KAQL 2IAMC 3CCHB 3D87B 3F7YA 2NY5L 1V05A 3RVWD 4UT9L 1J8HD 3QZWG 3RDTB 3JTSA 1JF6A 2JJVA 3R0MA 1X5XA 1HH9A 1Q0XH 1PFCA 4NO5A 3CX5J 1LEIB 3I6KB 2AI0L 4LMQI 5IGXH 3PWPD 5D6DC 4GMSH 3G04A 4L3EA 5IOPA 5CP3A 3TH4T 2X4OA 3CFCL 2GJ6B 2O26U 4MXQC 3CFJA 4OZFH 5I1IH 3E2HC 2WW8A 2VITA 4CMMB 5IJVA 3M8OH 1OOAA 3C08H 1ZS8B 2BVTA 2HT4D 2FX8L 1ZEAH 4X9HA 1UH3A 1WEJH 4LRNH 32C2A 5ANMA 1WJ3A 5JW4Q 5CJ5A 5A3IC 3SHSA 3Q5OA 1J0YA 3TJHC 5DR5H 2P48B 5I1JL 3BHBB 1HSAB 1BQHG 1J05A 1E4WL 1G7HA 4OSUH 2PXYC 3EKCA 1YEIH 3NPZB 5JPNA 3WHXA 3VXPA 1AI1H 2PR4H 4OLWH 4NZTL 4NZUH 3GZKA 3ZT7A 3GBNH 1PQZA 3CMGA 5HY9A 3S34H 5I19H 4WY7H 5E95B 4YAQA 3AY4A 2QSTA 3B8SA 4P2QD 4U6XB 1FO0A 4MA8H 4GRMB 4E9LA 4ZUUA 1ZSDB 1TIUA 3L5IA 3PDOB 4RGNC 4YHIB 3QBTB 2IPTL 4MNQD 1OARH 3CK0L 5C9JA 3WIHH 2ZG3A 5I15H 3GBML 2DQHL 5ACLA 3IDXH 2QQQA 5TE7H 3GBLA 4OZHF 1TDQA 3WKNA 1MQKH 3ULUH 2ATKA 1KENH 3KYMA 5F72S 3UTZB 4DKAA 4RDQF 5IW1B 4RDQG 2J4WL 3H9ZA 2B2XL 2X1OA 1KCVL 3NCBB 2EDDA 1HXYB 3S36H 5C0FB 2C1OB 1H3TA 1HN1A 1PG7X 2B39A 4RFOH 3TFKD 2F53B 4NO3B 2B8OT 5D93C 1UH2A 1DE4A 1NBQA 2DDQH 2VXTH 4XCYB 5BCAA 1UGNA 2X9WA 3PDDA 4YGVB 1UM4L 3KYNB 3KXFD 2Y07L 4HULB 1YECH 2DQEH 15C8H 1MCRA 1OTTD 5ANMB 3F7RA 1FH5L 3WD5L 1U92B 4XZUA 2X4PA 2AGJL 3PWUA 1HSBB 5H94A 4L3EE 4MNQE 2J7LA 4YHML 1HQRA 2A38A 1YDPA 1BFVL 1C1EH 3BQUB 3OKMA 5D7LE 1T6WA 5JPNB 4HFUH 4Z7UF 3M07A 3IDJB 1Q9OB 2XQBL 2YBRB 1ZLVH 4U7MA 2R39A 5J6HA 2HWZL 4U0QB 1NMBL 2KH2B 3T0BA 3E6FB 5ID1A 2XXMB 1PW3A 5CINH 3ALPA 5GRYA 5I71C 3UTTD 2AJSL 4F9PA 1LO3H 1QBAA 3DETC 3AROA 5T5FH 1IGTA 1A1NB 2CUMA 4KROC 3QI9B 2NZIA 4P3CL 1MUJA 5EC2A 1VFOA 5ALBL 4LGRB 1XCTB 1S7TB 3DIFA 4U6XA 5J7CC 3AREA 3UPRA 3BH9A 1FL5A 1OSZB 3KLAB 1KF9B 4JDZA 1Q9KB 4RWYL 1SJEA 1MNUH 1OVZA 4M1DH 4WV1B 4YPGA 5C09A 3SN6N 3UPCA 2YD7A 1MFEH 3ILPB 3MNVB 4LBEB 4HJJH 4RGNB 3OAYH 3EJZC 5EU6D 4X0KB 1W0YT 4JO3H 2Z91A 4RISL 4ONGL 3HC0B 3FCTA 1YMMD 4KHXH 5CIPH 1XF2A 3T2QA 1MWAL 4XP6H 1HXYA 3MJ9A 1OB1A 2P5WE 1FLRH 3G08B 4P2QB 1JGLH 3BGFB 2EECA 4N8VG 2PW2A 2YMXH 2ITDA 3RJQB 5E6IB 2OI9B 3VFWA 5SWZB 3IDUA 2ENYA 4LCWD 2F54B 3QEQD 3K1DA 4S0TD 3CLFH 3L3DB 1QBML 1CD9B 5F6HI 3PWPE 3RVVD 2CUHA 5FIEA 3WYRA 3QUKA 4U0RC 1CFVL 3BEWA 1HSBA 3DI2B 3L3KB 3MLWH 3U0TB 3PQYD 2NNAB 5CEZL 4QRPB 1X44A 4G6MH 5DHYB 4OD3L 3WS6C 2FEDD 1N3NA 3CX2A 5EZJA 3OF6A 1NANH 5D2LE 3RY4A 1AH1A 1FZMA 2R8SL 1TETL 2YN3A 1ACYL 4QF1A 3FT4B 2DMKA 1AO7B 4HXAH 5D7IF 5BRZE 3IF1A 5K33A 5F89B 4XT1C 3QRGL 1FVDA 1GHFL 3M1BB 5DRXA 4OCXL 4KK6D 4Z9KB 2XNAB 3DIFB 5E4EC 3QDJA 2NX5A 1XMWA 1YMHA 3OR6B 2RAMA 1PKOA 2BXZA 4P23C 3SGKA 3CFCH 2DIBA 5KZCD 2NLJA 2OJEA 1HNGA 4ZAKA 3OGCA 2FWOA 2QSVA 4XCNA 4XB7A 3LY6A 5DJYA 4JKPL 5IBLC 4G3YH 2FX8H 3MJ8B 1QRNE 2WMPA 2VXQL 1WEJL 4JQVC 2AAVA 1KEML 4YFLI 1M05A 1VKXB 3IXTA 1CVSC 4NO2B 5FYLE 5HPOA 3NBNA 1UADC 4I18C 2XKUA 1JNHB 1ORSB 1ORQB 3HFML 5FK9A 4I0PC 4OSUL 2NYYD 2DL2A 1GIGL 5HDBF 4NP4H 1YEIL 3BPCB 4Y5VB 1X5HA 5KN5A 4HPOH 4GG6E 5JHLL 3GB7B 1YEHH 3QEGL 3TJEL 1U91A 2Y7QB 3D39B 4HUXA 5BW7C 4K9EL 2A6JA 4XBPB 2BHUA 4X7FC 3CU7A 5F9JB 4HWBA 2R0ZH 5TE4H 3LZFL 5EIIB 4OCYH 5I19L 1F6LL 4KGJA 4HDIB 1F8TH 5TPWH 4U7SA 3MBXH 2VZOA 4HKXA 2Q76B 2YPKB 1N3NB 5C07B 1LO4H 4LVNC 1T0NB 1BP3B 3WLWC 5A2LH 4MA8L 3FL7A 1A1MB 4IHOA 4L8BA 1MJ8H 1EXUA 5GRVL 2VDNL 1NJ9A 3PHOB 3CK0H 4L3EB 2BY3A 3GJFB 1YMMB 4YWGH 1UB5B 2F5BL 3GBMH 4KRNA 1NSNL 4FABL 2APWA 2HN7B 4QRTB 2X05A 3UTQA 5HSFA 2D2OA 4FXLA 2R29H 1AGFA 1KENL 5FUOL 2Z8RA 2Q7YA 1VGEL 2E7CA 3OR6A 3UTSD 2YD4A 4JFXA 4Y5XB 2AJ3A 1CDBA 1D5IH 3EO1B 1U8IB 2R2HB 3QFJA 4HMDA 1J5OH 3ECBA 4KDTA 2MCPL 2LVCA 2DDQL 2VXTL 3QIUD 5F1IB 1W8NA 1F45A 1U8JB 4MHHG 1CDGA 4GMTH 4P5MB 3MNWA 1U8PB 1LE9B 1E4XH 5HHOD 5EBMA 1IM3B 1LK2B 3QXWA 1VADB 3V5KB 3IXTB 4QYOB 1CG9B 3MRPA 3FO0H 3G6JA 3L6FB 4WUUD 1QBBA 2H2SC 4K71B 1I4FB 4X6DE 3RTQB 4DOHB 2BNRE 3EYQD 4Y5VA 1T20A 4BZYA 2OR8A 2ICWI 5DEZA 4HFUL 3K2UL 5DA0B 2XQBH 1EBAA 2VDOH 2HWZH 3OAYK 2ICWB 2ZUTA 2NY7L 4E41E 1CR9L 1QA9B 4LNRB 1SMOA 4XC3H 1JPSL 4JY5L 4LKCA 3IETA 1G7QB 2W9EL 4R2GB 2AJSH 3B6SA 1KTDB 4GRMA 1HHJB 3GI9H 3HPLA 1Q9WA 3GMRA 2NY1D 1EO7A 2VABB 4X5XB 5FGBC 2DTMH 5C9JB 2NY2B 1EEYA 3OX8B 3HRZB 5JNYA 3VGFA 1G7LB 5D5MB 1Q0YL 1SBSH 4RWYH 1A6ZA 3GO1L 4LLYA 4M1DL 1YNKH 5B8CB 1B2WH 1T89C 3EFFB 1HEZB 2GK0A 3D39D 1T04A 3KG5A 4KKLC 1ERNA 3ARDA 3QDMA 4MQSB 2DM3A 1LEIA 3DJ9A 1E4XI 3GSXA 5F3BB 4ONGH 3VG9C 4JFXB 5I1CH 2AQ1A 2JK5B 1KLGA 5MP6H 3QCUL 2D4DA 4WWID 2FIKB 4P5MA 5F1SA 1RI8A 1WFNA 3U4BH 1AXSA 4V1DA 4HK0A 4UNVA 2B0SH 3CLFL 3TEUA 2NPLX 2AEQL 2CIIB 1UJ3C 5GZOC 5JORB 4JN1H 3QH3B 3SBWC 2EDNA 3IFPB 5ACZA 5LGKA 4W70A 3WFCL 5GGQH 3MROA 5JDSB 4PJ8C 5FGCB 2FHFA 1RZFH 1U8NA 2VISB 3D85D 3VGAC 2WLYA 5A16A 1F6AB 5DDHA 5DD0H 3M17B 1UENA 5T1MA 1T20B 5CSZB 1DQQA 3C5SA 4OCWL 3BRDA 2XZCH 1O5DT 2VLKB 1FE8L 1IEBB 4ZUSA 4IDJL 2ESVB 1ACYH 4LNRA 4W4OC 5DC0A 3NACL 3H9HA 4WJ5A 3QSKB 2ICCA 4HXAL 1ZHLA 2AEWA 1JL8A 4PG9A 1I1YA 4KKAC 2CR6A 1RJZB 2E8ZA 1GHFH 3H0TB 3VRIA 1IKNC 4CVXB 1RUMH 4DW2H 4NRYB 2ZCHL 2M26A 4NC0B 4YE4H 1UACL 5K93A 4IRZL 3HC0A 1FL6A 5F8RC 5HGBA 4JKPH 4G3YL 5ALCH 5HI5C 2ATKB 3UTZA 5I75B 5E94A 4CADB 1XGRA 5ETUB 5SWZD 5EZIL 4C4KT 4JHWH 1KEMH 1SYVA 3BGAA 3DVNA 5FV1L 4K94H 1A7BA 1OTUD 3CMOL 3RY6A 3X14A 3JZ7A 5C92A 5J56B 1E27B 3INUH 3BGFC 2VQUA 3ARTA 1RUPL 1U3HB 3OMZA 2UWEB 5E2VH 4L9DA 4JPVL 5JHLH 1MCQA 4UBDD 1YEHL 2PW1B 4TUKL 4WWKC 3KPQB 1BLNA 3RJDA 1U92A 2R0ZL 1H3GA 2VKWA 3HUJF 4WV1C 1BWWA 4PJBF 4G6KL 5TPWL 3MBXL 2I9LA 5EUOF 4F7MB 1G9NH 2EC9T 5CGYD 3U6RB 1LD9A 2MFNA 1C5DA 4D9RD 1MVUB 4MJ6B 1Z5LB 4PJ9C 3L3IA 2R4RL 3WFEH 1INQA 5T1LA 3UO1L 1BFOB 3WSQL 2HJFB 2EEDA 3H42L 1XGTA 3D9AH 3GSWA 5DZLA 1ACZA 4BSWB 1AHWA 1TLKA 3LHPL 1IEHA 1UZ6E 1A6VL 1VFBA 3AS0A 4YWGL 5C0RL 4DOHE 5CS7A 4KK8D 4MMXC 1K8DB 2OJEB 4PJEF 3TA3C 3ARBC 3EDEA 4CVXA 2I25N 3CAFA 4LIQE 5D72H 4X98A 3G5YB 1VGEH 4L8SB 5JXAH 3HZYB 4EI5B 4E41B 1YN6A 3BH9B 1SY6L 1PAMA 1D5IL 3BDYH 5E8DH 1XGYH 2ILLA 4WIQA 2ADIB 5E8NA 3ZDXF 1J5OL 4WCYL 3VGGA 3E6HA 3SE4C 3RTQC 2DWDA 3DV4B 5GGUA 5ADOL 3QWRD 4Y4KD 4OCRL 5D1ZA 4AQ1B 1JNHA 1W2KT 3CDCA 4G7VL 4Y2DB 3QAZB 4X4XA 4GAFB 4PRHE 3JUYA 4KJQC 1U8OB 3O0RH 1HHKA 3QPXH 2CGRH 1I1RA 2P5WD 4XMKL 5I8CB 1JUFB 2X40A 5DWUH 4ELME 2MPAL 4GXVH 1S3KH 3I50H 2O93L 4M5YH 3K2UH 3ULVL 4NQTA 4PJ9A 3TPKA 3DVIA 1F90L 3O3BB 5DJXB 1CR9H 4XC3L 2DQUL 3MRFB 2NZ9C 4PJFB 4Q0XL 4FQQB 1VERA 2WWMD 3QEQB 4HWBL 3MLVH 4LAJH 4MXQD 1PG7W 3WNLA 4AG4H 2FATL 3VXPB 1BMGA 2P8MA 3FOMB 2HJKA 5B39B 5IR1A 1CXEA 1SBSL 1FZMB 3GO1H 1YNKL 3O2DH 1GGTA 3DTXA 3TN0D 4WO4B 3GKWL 4TYUA 4X9FA 3P9LB 5C08B 4OD2A 3VMOA 2BSRA 4NNYB 2ZNWA 3P73A 5EO9A 4Z5RA 3KJ6H 3RVUC 3U9UA 1UJ3B 2NTFB 4WENB 1A9EB 4M03A 5FM5O 4NN7B 3RY5A 2ORBH 2BFVL 1YMHB 4BH7A 1Y0LA 3CVHL 4P5TB 1FO0H 4QHUA 4MB3A 1G6RL 5MENB 5K59E 2CRIA 4IRJD 3QCUH 4UDTA 5D9SB 5FCUH 4Y19B 3WMSA 3MACH 5CJOH 4X4ME 4QRRA 3F62A 1GPOH 4I18B 3NIGE 2LAGB 4X7TA 4OTXL 2O5XL 1FQ9C 4HHAA 4QY8B 4MNGA 3DUUA 1D5BB 4Y0GA 4CNIA 3WFCH 1CD0A 1G7JB 4HG4K 5C0EB 1S78C 3UEZA 1IZKA 3HC3H 2E7LC 4OQ1A 4AT6B 3GMMB 5I2IB 4ZUVB 3T1FB 3VXMA 5CBEA 1FFNB 5DD0L 5CEXA 1NEZA 3CFKA 3WUWB 3ARFD 2WBJD 5KSUB 2IQAA 3OR7A 4PRPA 5DSCB 4TSCH 4IDJH 2X4PB 3FQNA 3NACH 4XPGH 3X12B 1LO0L 4G8FA 2DQGL 1FAKT 3PL6B 5FA3A 1DCLA 1CWVA 3I75B 4JN2A 5EB9A 4DW2L 5HPMA 5J8OA 1TTUA 2RGSA 1N5YL 3BYTA 4XMPL 4CN4A 5K9KB 4YE4L 5ID1B 2RBLA 1ZTXH 1EBPA 4K7FA 1A64A 1RZGA 4LHUA 1WWBX 3QUZD 3GNMH 2L0DA 2A73A 2BDNL 4JR9H 1QSEA 1I1AA 1T7WA 3FO2A 1IGTB 3EYFB 3WXVL 3EO0B 1YPZB 4NSKB 3BKJH 5GS3A 3C8KA 3UTQB 3C6LB 4JZJA 25C8L 3STLA 1U2CA 4OZHE 1AJ7H 5ALCL 4PB9H 4PD4J 5EZIH 3QDJD 4JGUA 1W72A 1OP5H 1SJXA 4LHUG 4FZ8H 3P4LA 1TTGA 3BUYA 4PFEA 3QIBC 4PD4K 5F1IA 3G5VA 3IKKA 4HV8B 3S6CA 3SJVB 3TVMA 4P23A 2APFA 3GJFH 4PTTA 1U8PA 4WFGE 3V4PL 4OM1H 1IC7L 4MAYD 3T1WA 1OAQH 5D2NC 3BFOA 4GRLB 4M6NL 2PTUA 4KROD 3QIWA 3RNQA 3LKRB 3EDKA 2VMFA 2P7TB 4MJ2A 1JVKA 4IIQC 4YC2B 2BRRH 2Y06H 1NEZG 3OR7B 4PRPB 1NUFA 1JHKH 4PGJA 4B5EA 1EEZA 3O3DB 1MWAA 4NQDD 2R4RH 1YEDB 4Z7OF 3MLYH 5DMGD 1JTTA 2YPVH 3UO1H 3WSQH 3D9AL 4XP1H 3X12A 3BGMA 3D48R 4H26A 5TDOA 2GW5A 5E08H 5C0RH 3MA9L 2AKRB 1MSPA 3SDAA 2EDEA 5FKAA 1L9MA 3PGDB 4RGOH 5HGAB 3WEXB 3UBXG 2VH5H 4KKLD 2UVFA 2ZCLL 3QNZB 2C26A 4ZDHB 2C4XA 3STZB 3IFLL 1SY6H 4Z0XB 3T65B 3KPPA 5D5MA 4JY6A 3BDYL 1XGYL 4QF1B 2I24N 3DRQB 4WCYH 4FA8A 5DA4A 4CU8A 1A7PL 4AK1A 5ADOH 5DRXB 4OCRH 4ONFH 2ICES 1LDSA 1QRNA 3UBXI 1WIPA 4G7VH 1UCTA 1TNMA 5F7KC 1HH6B 4YBQC 5DHVB 3REWB 2X9XA 3O0RL 4RQQB 4NZRL 3PJSA 4LHUD 2OTPA 4RFEA 5C08E 4JM2A 4JRYE 5F1OB 5DWUL 3JTTA 4JKLA 2MPAH 4P23B 1S3KL 4JO2L 3B9EA 2EDQA 1RJCA 1ETZA 5JIPA 3Q0HA 3N9GH 5J11B 5F7MC 1I85C 3U6RA 2GTWB 1BVZA 3L3IB 1UCBL 3EFDH 1AO7E 4LASL 4PGCB 1KNOB 1NBYA 3WS6A 2QEJA 5D7KD 2I07B 2ATPA 2C3WA 3C5SB 2FATH 4YHPA 3WS3B 3ZKSD 1KN4H 4WHTA 1JTOA 1UKQA 3QO0A 1S9YA 4HS6A 2PETA 7CGTA 2UWEF 3O2DL 4G9DB 4Y4HD 1I7RB 3NA4A 2VLRE 3MCKB 2O61A 3QEUA 1GRWA 1EHNA 4OF3A 1DSFH 4U0RB 3O6FB 3PHQA 1DBJH 2VXSH 3AC0A 3X13A 1A7QH 2GIYA 3KJ6L 3F65A 3QNZA 2YPKA 3HZVB 5C07A 3EDFA 4X80L 2E7HA 1FYTA 1WLHA 1A6AA 3I9GL 1I9IH 5DJDB 1FO0L 3GSRB 3DYMA 3V0AC 1BX2B 2KUTA 1G6RH 3LKOA 4DKFL 2AW2A 5D1ZC 1RD6A 3OL2A 4MGXA 2VO5A 5FCUL 1GPOL 1HHIA 2HLFC 4DVRH 3DMMD 4OTXH 1UFUA 1CDCA 1CTOA 1RZ8B 4OV5B 2FZ3A 3LS5H 3WDJA 1KCRH 5JMOC 3GMQA 3EO1A 3HNTH 4PPTA 3S97C 1GH7A 4W68A 5L2KA 2IJ0C 4L9LB 4QRRD 1FNGA 3ZKND 1UG9A 1EGJA 1HWGB 1KJ2B 4ODTH 1R24A 3B2UD 3E2HB 3Q5YA 5AAWA 3ARVA 4I0KA 4JM4L 4KPHL 4XPBH 1L7IH 1M71B 4NQCB 4LKXB 4QNPE 4ZSOA 3U2SA 4WW1A 1HHHA 3IRPX 1MCSA 1I3RB 4R3SB 2VE6B 5B39A 4U49A 2G5BB 3UJIL 5DYOA 1KNOA 1OP5K 1DANT 3X3FH 2D4FA 1CTNA 1NMCB 1OTUC 1YPZF 1HHGB 4P3DA 5HTSA 4K3DH 4URTB 1JBJA 4JRXE 1MVUA 1I7TB 4MXVF 5TDPB 3TPUB 4F7TB 1HOCB 1ZT4B 2YN5A 5CLTA 5LXGH 3GNML 4UILL 1K2DB 5IMOA 2Q87A 1ZHBA 3WXVH 2HJLA 4X6FB 3H7BA 4PJBB 3QJHA 4TRPH 5JQHC 3O2VL 2VABA 4X5XA 3O3AB 1NAKL 2OR9L 4Y5YB 3G5YA 1CGUA 3HMXA 3RU8H 1A6AB 4K3JH 4FS0A 2OZ4L 1A6ZB 4I18A 1T66C 3VXTB 4FZ8L 2IBZX 3LKOB 1G6RB 4Y8AA 2Q8BL 2GSIA 4FFZH 4WHCA 4LCIH 5D1ZB 2LVEA 3UTPD 4ELMB 2FZ3B 2PW2B 3EO9L 1IC7H 1U93B 2WP3T 3CU1A 5LBSH 2IMMA 4OLVH 3U83A 4M6NH 3OB0H 5B21A 4L9LA 3QHFL 3QDGE 4OGAC 4XVJL 2NY1C 4Z18A 4HH8A 4HIIA 1YNLL 4XX1E 1TJGL 4HLZH 2BOCB 1P4BL 3IJYB 1JN6A 5JR1H 2CLRB 3HS0B 2QQNH 5JORA 4ZXBD 1JHKL 1B6UA 3VFVB 2WBJB 3WBDA 3HN3A 4RMQA 3U7WH 4GAJH 3H8NA 4NQEB 1MCHA 4LK4A 4NQSB 2O5ZH 2NY1B 2DAVA 5EG6C 1QQDA 1F6AA 4XVUC 5DDHB 4NC1E 4OLEA 5I74C 2DM4A 2ZCLH 3SBWA 5DRNA 4NSKA 1KIRA 1N59B 1T0PB 4MD4B 3BP4A 3RX8A 4MWFA 5C7XL 4TNWK 3KPLB 2VDMH 4PJAF 4JFDD 2ZUQC 2FIRT 4PJBA 2W0FB 2NLJB 1KC5L 4M6ML 5I1AB 4GG6B 3BD3A 3SDAC 1C12A 3H9SB 3MLUH 4NRYA 3G6DL 3RIAF 3NIDE 1YUHB 2EXWD 2FBOJ 1DQMH 3FFDA 4NKOB 1OGAD 1ZMYA 2NW2A 1REIA 5EUKB 4NZRH 2VUYA 5DK2A 4CVWA 1MAML 2VDRL 2XFXA 2AJZB 2A1WH 1YJDL 5BVJA 2GSIB 1GL4B 3S5LB 1ZLSH 4OBRA 1IGFH 5F7DA 5H35B 4GRLA 1FVCA 4OLZH 2SEBB 1GZQB 3CVIH 5DTFA 3UTOA 1WCBB 4JO2H 5D1XD 4XBEL 1GC1L 2ZCKL 3HMWH 2NY3B 2VL4A 4P46A 4AEHL 4KRMB 3T4YA 1X5IA 2WBKA 4MAYB 5C0EA 4I3SL 3PABB 2WUBH 3QDME 2DKSA 1XF4A 1UCBH 3UBXA 2A74A 2OL3L 4ODHH 5FOJA 2IH3A 1U0QA 3DVGB 3P40A 1HYSC 1CLCA 4MNHA 2HFEA 3SDCC 5MERA 3HAEG 3SQBA 1KTLA 3ULSA 1PD6A 1JRHL 3TC9A 2I5YH 2C4FU 2Y6SD 3HI1A 4PRDA 3STZA 3PL6A 4KZDH 2VXSL 1I3GH 4M9OA 5HGDA 2FRGP 3TV3H 3VFTB 4V2CB 3V7AG 4JZOA 2DJSA 4AIZA 4P9ML 4X80H 1XT5A 4UV7H 4JCMA 3N1FC 1WFUA 4Y16A 3IXAA 3I9GH 5DEGA 4JFZH 3CVHB 4TSBL 3LKPB 2VN7A 1A6TA 3RWCB 3Q6GH 4DKFH 4ZPVA 4U4BA 1HH6A 2BHYA 2P5EA 2L4OA 4JVPA 3EO0A 1U8IA 5DD6A 1OGTB 4I9WE 5IQ7H 2DQTH 3OKLB 3FQWA 4L5FL 1KPRB 3HUJE 4EI5D 5FEBA 1KCRL 3O6KL 3FFCB 4NKOA 2FH6A 2GT9B 1NKOA 3E6HB 3FT2B 4N8PA 4MAYC 4XNXL 2XV6B 2AJZA 1JYNA 1KLUB 1LDPL 3W0WD 4BQBA 2QQKH 3BWUC 4ODTL 2ZSWA 1MHCA 2HTLD 5L88L 4P2YA 3U36B 2OTWA 2KQNA 4JM4H 4KPHH 5BV7L 4XPBL 1L7IL 4JO4L 1A9BA 1I8KA 1PLGL 1JZ6A 3UTTB 3ARWA 3UZVB 2DM2A 5JLZA 3V0VA 5AZEH 1G0YR 4P46D 1H8SA 1RUAL 2AXGB 4KC3B 5FM5M 4D0CB 2R9HD 4R0LC 4O4YL 1T83A 2C9AA 2AV1B 1P7KB 2C1OA 5EZLA 3HZMB 4HT1L 3MGTA 4OT1H 4N0YH 1JNLH 2AJXL 3RTQD 5CZVH 3W9DA 3W9EA 2ZUWA 2A83B 5GIRB 5DJCA 4U05A 4TRPL 1QKZH 5IEKA 3ZO0A 2VIRA 3FQRB 4PJEE 1NAKH 4JDVB 4ZS7L 4ZO7A 2KZWA 3CVHA 2BMKB 4U2YA 1JF1B 2G60H 5LJYH 4Y2OA 5IF0A 2X5PA 1ZGLB 1MCLA 3ZHKA 2EZ0C 4WO4A 4Z78B 3HHRB 4TUOB 3IDJA 2ZSVB 3HE6B 2HTKC 2WWKT 4KQ4L 1BZ9A 5TH2B 4G9FD 1QRNB 5F71A 4AEIL 4JRWA 4GOSA 3EOBB 4EIZC 2W92A 1P5VA 1JF5A 3AU1B 3HI5L 1QLRA 1S9XB 3WNKA 1S7TA 4XVJH 5DJ6B 3SGJC 4KK5C 2BP3A 4K8RH 3UZQA 3VFMB 5M95B 4PJAA 1CDIA 5JDSA 1P4BH 4X7TB 1OP3K 1N6VA 4DZBB 3KPOA 3P4NA 1MI5E 4M1CD 4LCWE 1BM3L 1DLFH 4NZJA 2A2QT 3TP4A 4RSVA 5IVXA 2CUIA 3ULUD 1J1OL 5BS0A 2R1WA 1HIML 2JIXB 1IEBA 4ENED 4MJ5B 3GSNL 5DJZA 1WFTA 4J8RA 3NIFF 2D9CA 4DCQB 3CSPA 4MJ4A 1QSVA 4HCRL 1IL1A 4HAGA 3CC5A 4WFGD 3S88L 5D7IB 3I02B 1ONQB 5TQ2H 1D5XB 3SQOL 4PG9B 1A4KB 1B90A 3KXFA 4KK6C 2YRZA 3BD5A 3EZ8A 1TJIL 5C7XH 3AXLA 4GRWE 4F8TA 2F54A 4L4TE 1CD1A 2BVYA 3LQAH 2R0KL 4LVOC 1A6PA 4NCC2 5DMJB 5L8KB 3QDJE 1F3RB 3RWFB 1HI6B 3SCMD 5EO1B 4HIJA 3F58H 5K9KA 1JE6A 1LNUA 1NL0L 1U3JA 3MRQB 3GHBH 3UDWA 5KG9B 1F4XL 3GHEH 2BNUA 5ETUA 1MAMH 2A1WL 1YY8A 5I1KH 3B43A 1ZLSL 5EZJB 2XACC 1KJ2L 2AV7B 2NX5D 5IFJB 4GSDH 4ACPA 4AEHH 3MODH 1EX0A 3I6LE 2G9HB 4UT6L 3KDMA 2BNQA 1BJ8A 3THML 4GRLD 2WUBL 4NZDA 4XPTH 5I66B 1LE5B 1MHHA 3Q3GB 4FTVB 3RQ3A 2OL3H 1BLNB 3K8LA 4ODHL 4LCCB 3VGBA 1P84J 3GSVA 4D2NA 1IC5H 4PJCB 1J05B 3RVXC 2MCG1 4UV4H 1WIUA 1WZMA 4YHZH 4R4ND 3FN9A 2APXA 4LLMB 2I5YL 5T1DL 3VWJC 4AENA 4APQC 1S9WA 1MF2H 2HJFA 4XAWL 4KV5F 3HTLX 5GJSL 2QKIA 1VA9A 3KPLA 1ZLVK 4WI8A 1ONQA 2UY7A 3KPRA 5LG1A 4UV7L 1FN4A 2VZVA 4FQ2H 4RX4D 3MOQA 5I1AA 4YQXL 4TSBH 1B9ZA 1R6VA 1KELL 4XP5H 3Q6GL 2GI7A 1MREH 4TUJA 3SDDC 1T1ZA 5EOCL 2E7LA 3NH7H 3FB5B 5IQ7L 3ARGB 5C9KA 1RFDH 4F33B 3ZE1F 1KTKE 1KBGH 1ZVSB 4G6FB 4HIHB 1RZ7L 1H3PH 4X99A 2DQDL 5EWIL 2GFBB 1I3VA 3OJVC 5IW1A 2IALB 1KPUB 1AD0B 1NQBA 3FMGL 3I6GB 4PGEA 4IDLA 3MRHB 4NRXB 5JOFB 5SWSB 3UBXB 3H9YA 2MKLC 4HSQA 1PLGH 5L6YH 1FFQA 5H37H 3MMEB 3SE8L 4HUUB 2R15A 1IAIH 1MH5A 2ARJQ 2E7MA 1WBZB 5E1HB 4ELKA 4HKJB 3ZL4L 4WI7A 4L29A 3BD4A 4F37K 1EZVX 3OJMB 5CFHA 2DBJA 2VC2L 3QG6A 5HHVL 4P59H 1ETZB 4HT1H 3ECBB 4WDIA 2AJXH 3NVQA 5CD3A 1DBKL 3RVXD 4U6VH 2PTTA 1BD2E 4QHKI 2GTWA 5EUOE 5FDYA 2UUDK 1U3ZA 1LE9A 2R0LL 4L8CA 3QULA 1H8NA 2DBLH 1FV1A 1J11A 2KL6A 4NIKB 3TESA 1N8ZA 3TCLA 4ZPVB 1S7XA 1LEGB 3S35H 2BNQE 1FHGA 3QO0B 4ETYA 1MPAH 1OAKL 1BEYL 3FTGA 3OPZL 1Y18A 1RMFL 2VTFA 3P4OA 1QPPA 3BISA 4HJ0D 2FYYA 3W2DH 3D69A 4WTWA 4XNZC 1CGSH 3QI9A 4KQ4H 2X70A 3V7AE 4AEIH 3QCVL 1KPVA 3IJSB 1LO2L 1C8PA 4HUVA 2VL5B 2X9YA 3FQTB 3FFDB 4B50A 4PJIF 1Q9WB 3GMRB 4GRWB 2EE2A 1W72L 1J1PL 3HR6A 2BCKB 4TNVF 4D9QD 2A6IB 3BIKA 5DMKA 4PJIA 1DQTA 4L4TD 5C6TH 2A6KB 4K8RL 3LRGA 5BVJB 5CHNB 3HRZA 4UAOC 5C0BD 3MC0A 4GW4A 4NRXA 4P2QA 4XTRD 1DQLH 5F9OH 5I73C 3MV01 4LGSB 5CCKL 2F9BT 3CFBB 1LK3L 1T89A 4IRJB 4AT6A 2Z91B 1E4KA 1P7QD 5SWZA 4D0CA 1DLFL 1FPTH 5HI4D 3KYKL 2P24B 2DQJH 1N2RB 5L8JB 2B4CH 2Z8WC 5I8KL 5IVOA 2PTVA 1XF4B 3GI8H 4BA8A 3VW3H 3L1OL 2HG5A 1NBZB 2HT2D 4QXWA 1SVCP 1CN4A 5TQ2L 2WUCL 5C09E 4QRPA 3BQUC 4JKMA 1BOYA 1DVFD 3IDNB 4JANA 3VWKB 3UYPA 1IAMA 2EDKA 4KKNA 3JWOL 5GSRB 4OCMC 3CSBA 4HK0B 1U3HD 2EYSB 3T77B 2DI8A 2VXUL 2DD8L 3F7PC 4O9HH 1KG0A 4XBGB 1IAII 4AIZB 1DN0B 2XN9E 1YPZA 3JWDL 1M6OB 1LO5B 2FO4A 1CBVH 1RV6X 1F4XH 3CFEA 3GHEL 1XGPA 3RL2B 4KQ3H 4Q9QH 5I1KL 3SGDH 1X4ZA 3MJGX 5F6HJ 5F89A 4WTZG 2VAAB 1CFSA 5EA0H 1KJ2H 2FDBP 4CJ1A 5K9OA 2HLAA 2OXHA 4GSDL 4OCSL 5F9WC 5AZ2L 1EDQA 2Z92B 3LH2L 4OFKA 2J6EL 4TOYL 4JFOB 3QXAA 3C8DA 1BECA 5CJ8A 2ZJSL 3F5WA 4XPTL 4EXPX 1OTTC 4ZOBA 2QHLA 5J1AB 1IEAA 4JG1L 4KRPD 4YH6A 3T3ME 2QADD 3DVFA 3N0PB 5SWQA 5C2BH 4X6EB 4YHZL 4YX2H 4DCQA 4UNTA 3RZCB 3UTTA 4U6YA 5EOTA 4JQXC 5ENWB 3QQ9D 5GZNC 4ZFOB 5T1DH 3QDMD 4MQXC 3LKQB 1M4KA 2X4NB 1MF2L 4XAWH 5GJSH 3LV3A 1H0DA 2G75A 4K3HA 4PS4L 3AAZA 4YHLL 5IUSA 2B1AH 3MGTB 5GHWH 5I75C 1IC4H 2F19L 1DBBH 3ZTJH 2VDPH 5C1MB 1J8HB 4TVPD 4YQXH 2AXJA 1HCVA 5I76A 4XP5L 4HIJB 3MV9B 2GY5A 5GIRA 1OWRM 5F9JA 2BZDA 3VD7A 4PYGA 5FDWB 4R4FH 1ZT7A 1DUZB 3GSOA 4LF3A 1YYLH 4I13B 3FRPA 5HDQL 1YY8B 5J3HC 5MEND 3RWDA 1BJ1J 1RZ7H 2DQDH 4EI6B 1FP5A 5EWIH 2YRLA 2P44B 4YGAB 4QO1A 4OM0H 3QNYA 3FMGH 3BW9B 4OGAD 4KJWC 3OXRA 1D9KC 1S7VA 1GGUA 1C12B 1S8DA 3H9SA 4J12A 2BNQB 3L3OB 3VXSA 4QOKD 4XWOC 1AHWB 2X1QA 1K85A 3WO4C 4JREB 3S7GA 5L6YL 2MOVA 3QXAB 5C0AA 4R96B 2BOBB 1IGYB 2BY0A 1BWMA 5IMMA 4AY0A 7FABL 4BK5A 4Z0BH 5F7DB 5H35A 1FO0B 2ADJB 5TF0A 5DTFB 3MBEC 5D7JB 4S2SB 5HHVH 5HI5D 3ZLQC 5D7IE 4G8EA 1TJHL 2EXYC 3L7EB 3FO9B 2BNRD 1UKSA 3FFCD 1TNNA 2VRAA 3CSYA 5EU7E 4ZNEE 4MAUL 5IG7B 4A2MA 3RAJH 2OJZL 2M2DA 1JNNL 3L6FA 3G6JB 4IJ3C 1QEWA 1MFBL 2IH3B 3N1GC 3GRWA 1H0DB 2DBLL 4LKCB 5GGRY 4F15C 3S9DB 1OHQA 3ULSB 1AD9B 2V9QA 5EU4B 4N9OB 2VLME 1UXSB 4WEBH 5KVGL 4UQ3B 1BHGA 4Q6IB 4CAGA 4LDLB 5CMAB 4XNMB 1GZPA 1BEYH 2PYED 2DYPD 5C0DB 4AL8H 2YUVA 4QT5A 4JDTH 1T83C 2G2RB 3ZYZA 3LAFA 4PJ9B 1MFDL 2A9ML 3VD3A 4EIGB 3MRBA 4IRJC 2Z93B 4M8QA 3MJ7B 3TYGL 1HINL 4U1GB 43C9A 3EYQC 3MRGB 4Z7VF 1T1YB 1A6TB 4KUZH 3PWLA 1JFQL 43CAA 5T1LD 4L4VE 2NTSP 1KJMA 3FB7A 5JOPE 5E6ID 4GRLC 4TNWF 5CIPA 5HD8C 4QRUB 1B4JL 2Y72A 2WWKO 3QDMB 1CS6A 5F9OL 1WBZA 4ELKB 1QO3A 1UWGH 5CCKH 1CQYA 1LK3H 1BZQK 4KXZH 5SX4H 1YC8A 3RX7A 1U3HC 3ARDD 2A0LD 1NUNB 3OKKA 5IESH 5C07D 1GCFA 2UVEA 4CUCA 1FPTL 3DOSA 5IBUB 2WANA 2B4CL 3JUZA 3U0PA 3GI8L 5I71B 3U46A 5D7JA 3REVB 3IDYC 2E27H 5MENA 1T1XB 1KEGH 2DLFL 3BAEL 4Z7VE 3NCMA 1QHPA 4L3AA 3BJ91 4M62L 4MZ2A 3V7MA 2ADFH 3TN0B 4F7PB 4P57A 1DQQB 1IFHL 3JWOH 3LD8C 5F7LB 4QGYA 3T4AA 5GXBB 4OGYH 2XA8L 2VISA 4LSUH 1S9WB 5FM4A 3TBSA 1A0QH 3I2CH 3ULUC 4Z7WB 2BVPA 5J57B 5KVFH 2FYYB 3ZYIA 1BQSA 2DN7A 4I3GA 1QVOB 3ARZA 1CBVL 4PGBA 3TBYB 3TBWB 2CKBA 4BQ6A 1C08A 1OAXL 3H9HB 3WL9A 2APBA 1JHLL 3MV7E 3O3EA 4HIXL 4TUJB 5DSCA 1HZHH 4KKBC 5HHOA 4U1LB 1DLHA 4IRSC 3QQ3A 3EYVB 4H1LH 3SE3C 3L5XH 2AK4E 1ZVSA 2NMSA 1TITA 3LMJL 3R8BB 3LH2H 3ES6B 3OHXA 4OKDA 2J6EH 5INDA 3LPWA 4UZGA 4H88L 1MHPH 2VDQH 4JRYB 1RIVH 4F57H 5IHBA 2ZJSH 1FORL 3FKUS 1X5FA 4JG1H 2Z4QA 4OB5H 1UZ6F 1MCDA 4J4PD 3PGFH 4WWKB 3SKJL 4JPKH 4OIBA 2B5IC 2QBWA 3QWQB 4LP4A 3TO2A 4ZFFA 2X4OB 1ED3B 1U8HA 4Y16C 4JZJB 2YSSA 3VFVA 4JFYA 1VACA 2XY2A 5IIEB 4XCFH 1JWUB 3QI9D 3ZDXE 1QFWM 1T1XA 4PS4H 2JJTA 2Z35B 4J3WA 1NLBH 4HS3B 5D1QB 1EGJL 5MEQA 2YPLD 3QEQE 4YHLH 4NN7C 2B1AL 5GHWL 3MLRH 2VDPL 4N5ED 4YHNA 4LLQA 1RZKL 3A67L 4HW6A 3TVMB 3T4AB 5FO9B 1UB6B 4OF6A 1F2XK 1A2YB 3KHQA 1S7UB 2BVPB 4M4RA 5ITBL 5JHDA 1RJYB 3D2UA 1ORSA 1IM9B 1NDMB 5EU6E 1Z5LA 1KT2A 2GUOA 3FB6B 4JVWA 4UBDC 3BIBX 4R0LB 1OAZH 3PE9A 4GJTB 1U36A 4WFHD 4H25B 1MFCH 5JW4N 5FO8A 4GXUM 1R3LB 2ZKHH 2CDEB 3BO8A 1IQWL 4RMVA 3EOAA 5HGAA 1CLOL 4ZUUB 3IAQA 4MJIE 3L95B 2VLLA 4HIEB 2ADIA 2IGFL 4ZPTA 5E8NB 1QNZL 3O2WH 2VLRB 1CGYA 5DMKB 4CW1A 7FABH 4NQUA 4Z0BL 3GK8L 2PO6A 4FHBD 4IOFD 4K23H 4OI8A 2X1XR 1R3JB 5DFTA 5GSVB 1EAPA 2NZ9D 4NQDE 3BIAX 1H3XA 5I8CA 5AUMA 5HJ3B 5I17B 4C56A 4QNPF 1MCEA 1V8HA 3D0LB 4JFHE 2OI9C 5IBTL 5C0CA 1H5BC 4XVSH 5FM8A 1NGWB 4ORGA 4XCYA 2OK0H 5FCSH 5JXEC 4QTIL 4PB0H 3GSNB 3HUJB 2R2HA 2DICA 4MSWB 1DANU 2YD8A 4J4PA 4PJFA 1T21A 2R1XA 2ARJA 4WI4A 3RWGB 4PJIE 5BV7C 5KVGH 12E8H 3VJ6A 1OW0C 3GIZH 2VR4A 2X2YA 1QFWL 5IB2A 5D93B 1TCRB 3MRLB 5JIHA 3SGEH 4OD1L 1CXFA 1IKFH 1EH9A 1MFDH 2A9MH 5JOEA 1VADA 2VB5A 3F6IA 4OV6F 3WJLA 3WNOA 2HKFL 1AKJB 1QSZA 1HINH 3OKMB 5DHVH 2H3NB 2FBJL 2P5EB 1LEKB 4Z8FH 3H3PL 1CICA 1A7OH 5C0IB 3T0XA 4KK8C 2HJKB 2YK1L 3MFGB 5D1XA 1A9EA 4KUZL 3MUGB 1B3JA 4MNGE 4PRNA 1ZV5A 1WAAA 1UZ8A 2W0KA 2EC9U 2EEAA 3QO1A 4DK6A 1KB5A 1UWGL 4X99B 2F58H 5BZWB 3U30B 2E9BA 5D7LD 5CUSL 4RMTA 3MRMB 4U1SB 4G80B 3ZE2F 3U36A 3KGRA 3I6GA 4ZFGH 2BRQA 5B38A 4IMLA 1Y6NR 1CCZA 3SEPA 2E27L 4OZIA 2ZUVA 5J9PA 4M62H 3O9WB 3TO4B 5HYSB 5IW6B 4FQ1L 1D3CA 3MV9E 3OAZK 3NCYP 1DDHA 2XA8H 4OGXL 3TIDB 5BO1L 3G9AB 1A0QL 3I2CL 1NEZB 3CFKB 3C8HA 4P2RE 4FQHB 4LEOA 4WHDA 1B4RA 4OZIE 4XNUH 1D9KB 5DUPH 5I1LA 5I73B 4CL7A 1NGZB 5L9DH 2HFFA 4H5SB 5IB2B 3OXSB 1TCRA 3K4ZA 5GGTH 1BJ1H 3WCYA 3T0WA 1JHLH 3QUZA 3QP3A 5DFVD 5KJRL 1JF1A 2C5DC 3P9WB 3C2SA 4F7EB 3DARA 2N7BA 4S1QL 3I75A 4LF3B 1FFOB 3OKYA 3W11D 3NIDF 3LS4H 4YDLB 4CKVX 5JIIA 1JHTB 2XA3A 3HI6H 3RNKA 4YXLL 2QSQA 2XPGA 4GS7C 5KVEH 3S36X 1KV3A 3KYAA 4LU5H 4F57L 4IBLT 1ZA3B 2Z0BA 4WRLA 4PRHA 1AO7A 1GJIA 2DWEA 5KVDL 4EKXA 3V6ZB 2YS4A 3VCLA 4WFFD 5JQ6L 4YAQB 4M7KL 5DXWA 4K3GA 3ZZ1A 1G7MA 3PGFL 1NC4D 1EHAA 4KXZI 1INDL 1FIGH 3CXHJ 3D3VE 3JV6A 4WUKL 1KGCE 4U1SA 1T5XB 4DZBA 2JF1A 4PJ7A 1JV5B 1FVEA 1L0XA 3O4LE 3KYMB 3CJJA 2JJWA 4E42B 2B5IB 1NLBL 4O2CA 3F7QA 4QHNA 4GKSB 1ZVYA 1T2JA 3BVNA 4YDKH 3E3QC 2ENSA 1BREA 4M43L 1EEQA 1NC2B 3W39A 1KOAA 5E7FA 4M7JH 4S0SD 4APQB 3CDYA 2HVJB 2WZPD 2C4FT 4YGVA 4YPJA 1FNSH 5J0BA 2Q8AH 1G0XA 1OGAB 3K8KA 2AKRA 1I75A 4ZQKB 4OZFB 4Y8DC 2CJUH 2Q20A 2R69L 3BP7A 4OZGF 3IFOB 5F7EH 4LPWA 3IJYA 3MBED 3HG1B 4NQDA 5DQJB 2FJFA 3MRKA 2ZG2A 1HCFX 3EYSL 1U8MB 1BPVA 5EIIA 1U8QA 3PGDA 4RZCB 3UXFA 4FQXC 1AC0A 4NQSA 4NFDA 2Q76A 4I5BA 1DL7H 1IQWH 1WK0A 2GQHA 1CLOH 4M3JA 3KJ4C 2Z4QB 5DK3A 5DMGC 2IGFH 3PF2A 1QNZH 3O2WL 1SEQL 3PHOA 4HXBL 4PJ5B 4Q58C 2OTUA 1ES0A 2D03H 5D70L 5CIPB 1U8HB 4K23L 4XAKD 4YEFA 5HYEA 1NCBH 4MWFB 5IROC 1LWRA 4NGHH 3O6LH 1BF8A 4I3RH 4XP4H 5EZOL 1VACB 5E24E 2FGWH 1P4LA 2IQ9L 4JG0H 5C09B 1CXLA 1ZT1B 1PSKL 2CDGB 3F5WB 3IS0X 5GRJL 3V4UH 3OG6B 4JM2B 2HMIC 2OK0L 1P9MA 2YUZA 4QTIH 3MV8A 4Y1AA 5FO9A 1H8OA 4KHTH 5E8PA 2DWDB 4JFHD 4FTVD 2VZUA 3HB3C 4ZO8A 2EDOA 3G6AB 3V5KA 4YDVB 2GAZB 3QDAA 4LSQH 1I8IB 1TCMA 1ZANH 3O6FC 3JV5A 1QFWH 3EOTL 1MHEA 4OD1H 4GRWF 4XB8A 1IKFL 4OF7A 3C60D 1I4FA 1E6JL 2HKFH 4PGCA 4PJBE 5F7YC 1HHKB 5BMFH 3B9AA 2FBJH 5DZOA 3BESR 3E3QE 3BP7B 4HUWA 1VEPA 4HMEA 1A5FH 2IPUG 2YK1H 1AR1D 4P49A 4PBWD 4PGBB 4V2BA 4FNLH 2A6DA 4XC1L 4ODUB 3U0TA 4KROB 4ISVA 4PBXA 1JGUH 3H2WA 1PY9A 1HNFA 3FHAA 3KJ4B 2D7QA 2VLRA 5GGSY 2AABL 3PXJA 4GBXC 5GRXG 1WBXB 2ZOKB 4K9EC 4NRZB 3FRPG 4FQXB 4D3CH 2NY6C 1LVEA 1R5IA 2HRPL 1FNLA 3AUVA 4P99A 4WUUB 3GSQB 4XI5C 1QR4A 4GAYA 5FYKE 3MR9A 4HPYL 4TTGA 1PZ5A