5I8EB

Crystal structure of broadly neutralizing hiv-1 fusion peptide-targeting antibody vrc34.01 fab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
209
structure length
203
Chain Sequence
b'IQLTQSPSFLSASVGDKVTITCRASQGVRNELAWYQQKPGKAPNLLIYYASTLQSGVPSRFSATGSGTHFTLTVSSLQPEDFATYFCQHMSSYPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VRC34.01 Fab heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Fusion peptide of HIV-1 as a site of vulnerability to neutralizing antibody.
pubmed doi rcsb
total genus 35
structure length 203
sequence length 209
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i8eB01
3QISA 2WWMD 3RY5A 2FDBP 4J3SA 3PWNB 2VYRE 5INCB 4CN4A 4M7LL 1KTRL 1EIBA 2C7UB 3WNLA 4FFVC 3B2UD 4D0CA 1YN7B 2B4CH 3JTSB 4YDLC 5GGVH 1VFUA 4NZUL 2QJDA 2R9HC 3OXSB 5EUOE 4FQLL 5HHOD 1JPTH 5C0BD 3RKDC 4CVUA 1JNHB 4JM2B 3DMMC 2YRPA 3PWPB 3U36A 4N8CH 4OM1L 4X7EC 1B4JL 3GHBH 2FX9H 1YY8A 3ORJA 4Z7VE 3AREB 3EHBD 5L2KA 3GMNA 1DVFC 4HMEA 3LZFL 5TH2A 2F19H 2DQIL 3L3JB 4CU8A 2X4RA 1IGMH 2KPNA 4MXWL 4GAYA 3QO0B 5IROC 1YEDB 4S11A 3OX8B 1OP3K 4BH7B 3RPIB 5DHXB 1AI1H 5CKAA 5T3ZL 1IQWH 4QRQB 5DRXA 4HLJA 4JO4H 3QZWA 4UQ2B 2L7UA 1MNUH 1FL6A 4M93B 5DC4B 5AYUH 1EXUB 4XTRC 2W0KA 3RWFB 2EDRA 3G6JE 2DI9A 1RUQH 4F7PB 3KPTA 3EGSB 5JUEL 4WY7L 3V6OC 4K9EC 3S36X 5EDXA 2DB8A 3VXSD 1IKFH 5MEOB 4P5TC 1KJMB 4WI7A 5EFIB 5I1JL 1FFOA 4WHTB 4R2GB 1UA6L 3BRFA 1RHHA 4PG2C 5B38G 3MTRA 3JTSA 1FV1B 1A1MB 3UYRL 4PBWD 5D1XC 3ARYA 1EV2E 5MEPA 4YE4L 4ZQKB 1JI1A 3ARED 4GLRI 1YEEH 3IXTA 1A7BA 4U1MA 4ZPTA 1AR1D 2OQJB 1BD2E 1P84K 5J57B 3ZDYE 4DGIH 2OBGA 4BFBD 4TYUA 2G5BB 4ZNCD 4MDJB 3PWPD 4N0FB 5IFAH 5J12C 3Q5OA 3MGOA 4TULH 1SJVA 4KRPC 1DBML 2DQCL 2F54E 2B8OT 4F7MA 1A6ZB 2NR6C 3GSXB 4JPVL 1VGKA 1CL7H 2ICWJ 5D9SA 3O6LH 1MELA 5EU7C 5BVPH 4JFPA 5GIRB 1FDLL 5KW9L 3QQNA 4C83B 1B3JA 2O5ZH 4YHKH 4DN3H 3RUGA 5CEXB 5J6GB 5LXGL 2VXUL 5IMLA 5I8KH 5SV3A 4WEBH 1A7NL 1K5NA 1U91B 2A74B 4DN4H 1A2YB 5TF0A 1QFWM 3P11H 3L3IA 1QSFE 4P2QE 2GY7B 1HHKB 3MACH 4NQCB 3OKLB 3GM8A 1OVZA 1SY6H 4PRIA 4HBCH 4PGDA 1FIGH 3QIUD 2FHCA 4L4VA 3QHTC 5J1AB 3QULB 1EPFA 4ZODA 3PWJB 1DZBA 4QOKE 3NCYS 1HSAA 4XI5C 5L8JB 1QQDB 1LK2A 4U33A 4LLWB 1OTTC 12E8H 4N5UA 3I6KB 4JG0H 1UJ3A 4P9ML 3F8UB 2V2TB 1MFBL 4LSVL 3BMVA 1JWMA 4HZLB 5T1DL 4GW4A 3QEUA 4J8RA 3NA4A 5MI0C 4ODHL 3U4BL 1B0RB 4P23A 4TOYH 3E8UH 3DMMB 5HHXL 1MI5A 3B8SA 3SGJC 4BKLA 1UG9A 4Z7UE 35C8H 3D6GA 3ZKXC 4LLVB 5ANMA 5CIPH 1R3LB 3QHZH 2BVOA 4M7JH 4G9FD 4OF5A 1ZS8A 1KIRA 3BZEA 4LSPL 5D8JH 5C0GB 2R8SL 2H32A 2R15A 5FO8B 5CP3A 1MCCA 5C0RH 3IGAA 4LLMB 1IAIH 1G0XA 3M07A 5KTEL 1F2XK 4PJIE 1D6VL 3EZ8A 3V4UL 4ZD3L 3BZ4B 5DRNA 4BQ8A 3BFOA 4X6CE 4G9FA 3GSVA 3IFNH 2IFFL 4PJ9C 1ORQA 1NDMA 3TA3A 1ZTXL 4JFQA 2G60L 4ZUVB 5H35B 4FQCH 4MQTB 1PLGH 2I9LA 4NQDE 3EOBB 3P9MA 2HJFB 1DFBL 1CQKA 3UTSD 1XGTB 1A5FH 1P4BH 1SJHB 2VRAA 5DEGB 3SDCC 3D69A 3L95B 2HFEA 4GG8B 4Y5XB 1UCTA 1KPVB 3UC0H 4M6OH 1WZ1L 2F19L 1P7KA 2CUHA 5EU4A 4F7TB 3I75B 3V4PH 5EZJA 5IFJB 2VLKE 5DQDH 5M7QA 4KZEH 5HVHB 4M6MH 3TZVC 4IM8A 3RHWK 4RDQG 4KXZI 5HJ3B 1CXHA 4BUGA 4KKLC 4WWKB 1Y0LB 2ZKHH 4K71C 2NY6D 3LCYA 4PTTB 3H9ZA 1P53A 3IB4A 1YA5A 4Y5YA 1IAMA 6FABH 1AQKH 1DBKH 2W9DL 4KFZC 3T0EE 2JK5B 4KK9C 2CDFB 3OG6B 4NDMA 1YNTB 5JW5B 3D0LB 4GW1B 1MJ7H 1EGJA 4QYOB 2XPGA 4Z9KB 2A9NH 4RMTA 3ARDC 1ZTXH 2VQ1A 2PTVA 5E1AA 3RGVC 5J4MA 3KPQB 2EEBA 1A7RH 4J2XA 4OUUB 4U6VH 3ARGB 3R8QA 3RL1A 5C0FB 5D2LF 1XGPA 1FGNL 4YFLF 3UTQB 1UZ8A 1KCVL 1OAYL 5TGBB 1DBBL 3EYSL 4E41E 1WTGT 3ECBB 2XIDA 4H5SB 3T3PF 3ARBC 1BQSA 4L4JA 2EDOA 4P46C 5L2KE 4P2RA 1AKJA 1Q94A 5HYQB 1LEGB 4TUKH 3KPSE 4WTZA 4R97B 4KTYA 4G6MH 3WFEL 4AEIL 4OBSA 1NBZA 1DFBH 1UWEH 4PRIE 1ND0B 4AK1A 4EI6A 3PL6A 3FO1A 1DBKL 1T20A 5D7SH 5HGGS 4CW1A 3ILQC 4CADB 3MROA 4X6DF 2D0HA 5D1XA 3ARDD 3OJMB 1BZQK 1IGYB 1U6AL 1JGUH 2VISB 3BSZH 2WP3O 4ZTOL 3WIFB 3V7AG 4DCQA 2VDRL 5EC1A 5I71C 5TDOB 3VXUE 1QO3A 3BAEL 4RFOH 5T1LA 4ONFL 5I1HL 4G8IA 4QRSA 4Y1AE 5EO9A 1MVFA 1GGUA 1S7RB 3O2VL 1PQZA 4PJBF 2AKRA 1A22B 3WEXA 4KKLD 2A9NL 1NC4D 2FRGP 3C60C 3RP1A 4TVPL 5FEBA 4HIHA 4HIIA 1BREA 2VAAA 3MNZB 1PEZA 5BS0D 4JQVC 5CMAA 1HEZA 1KGCD 3L7EB 3QIWD 3BVNA 4NJAL 3QJFB 4Y8DC 3LN4A 3ARUA 2EDXA 2AEPL 3T0DA 1S7VB 4HWNA 4K07A 3KLHC 5EO0B 5IB4B 4HK3J 2VITA 4Q9RL 4XMPH 4OFYD 1FSKC 2A0LC 2BVUA 5JIPA 4QF1B 2XI9A 4HS3B 3QUYD 1BJ1H 4WV1A 1A6TA 1G7LB 2V2XA 3QO1A 1IBGH 4HBQA 2C26A 5CEYA 5E5MA 1SM3L 3NZ8B 2CJUH 2YEZB 5FHAL 4CMMB 4IOIB 5I1AB 5D6DA 2D3VA 4LNRB 5E8DH 1DANT 2RQ8A 2X7LB 2UVFA 5KSAD 4LQ1A 2EXYD 4IRZL 4XC3H 5C09A 4RQQB 5J0BA 3P0VL 1YYLH 4S1RH 4Y4FA 4ZD3H 2CO6B 1I9EA 2BVTA 3CDYA 1KB9J 4FZEL 5I8OL 3S88H 3RDTC 2QQNH 3JSSA 2OL3A 1IEHA 2QQLH 3LD8C 1OD9A 2DJ4A 4WJ5B 1RUQL 1UC6A 1YECH 4ISVB 5HHPA 5I1EL 1MEXH 2FGWL 1MFDL 1T5XA 2FZ3B 2V5MA 2W60B 4N8VA 4UINH 3ZSSA 1JHKH 1Y0LA 3LRGA 1P4IH 4EN3B 1U58A 2VLLB 4ZO9A 3CZFB 2BVQB 3DURB 1I9IL 3JV5A 2ZCHL 4DZBB 1IBGL 3HZKA 5HI3C 4JZOB 2DQTH 5C71A 1AY1H 4Q58C 1I85C 5CBEA 3U0PB 5F7DA 4F9PA 3C87A 3ZYOA 2QADB 1MHEA 3FQWA 2CD0A 3KPMA 3QRFM 5ETUA 3PWPE 1NCWL 4U1SA 5DJ8A 1REIA 1OT2A 2P5WD 1C08A 5HYJB 1F90L 1L4IA 3BO8A 3CAFA 1C12A 4JFQB 2APVA 4XNQB 1MJUH 4QRSB 2V5YA 2ZUUA 1M05B 3CCHA 1DBMH 4L9DA 4ZUUA 4Y16A 2IBZX 4XVJL 3GBML 3X17A 1FGVH 5KAQG 1FNSH 2NY0C 3RNQA 1TVDA 4O58H 5E4IA 3D18B 1N3NB 2IALA 5D1QB 4LQFH 3VRIB 5GQBA 1WBYA 1F8TH 3IU4L 4MQ7B 3HC0A 5K59F 3QXVA 1NCCL 4OTXL 1LGVA 5I30L 4MD4A 1TZHA 1JHLH 1U3ZA 4OLZH 1JUFA 3VWJD 3V7MA 2XWTB 3NCYP 4P4RB 2JIXD 4U31A 1AP2B 5DJAA 3P4OA 3LN5A 3QDAA 5ITFB 3VXMD 4MNQA 4QXTA 5HHOA 3ARWA 4QOKB 4DEPC 4RFEA 4M43L 5BQ7B 3VXRB 2NY1D 2Y6SC 4XVJH 2NY3D 1XGPB 3CFCH 5CUSH 5HHXH 2AJ3B 1A3LH 2WUBH 4O2FA 2EYRB 3H3KA 1I8IA 4M1CD 4NWUL 2A6DA 2QSVA 2MPAH 4GG6F 5IB5B 4OQ1A 1UQSA 1NUDA 5FOBA 1E4XI 1BD2D 2FB4L 2A6IA 4OFIA 4OCRH 1JWUA 2CGRH 3VFTA 1I9RL 4NQED 2RBLA 2ICEA 5IBTL 2XZZA 4PS4L 2F58H 2XY2A 1YEIH 2P5EB 3BZFB 3X13A 3P30L 3IFPA 4ZMAT 1R5VB 2X1PA 4GRMB 3KPRB 4HKZA 4I18A 4GG6B 4W81A 3OR7A 3MGTA 1S8DB 3EAKA 1M7DA 3AC0A 4PJCF 4JE4B 3MLWL 4HEPG 1XGQA 4O2CB 2OJEB 2DD8L 3LKPB 1NH6A 1E6OH 1H9VA 4GRWH 4Q0XL 4QHNA 15C8L 4JFYB 4TSCL 1A9EA 4NQCE 2C1PB 5D1QD 3AMLA 1CD8A 3GHEH 4XMKL 1OHQA 4YNYB 5GGSA 2I60H 3J7HA 3UTOA 2DWDA 2YN3A 3PGCA 4L3EA 3FB8B 3GMQA 4Q6YA 3CMOH 2BC4B 5LAXB 5E6IC 2UWEE 4G9FB 2EDJA 4OZIF 1UH4A 2IAND 3GIVB 2MKWA 2ZG1A 4JQVA 2DL9A 3UDWC 3IXTB 5J8OA 2VC2H 5I2IA 3G5ZB 4NKIL 3T2QA 2F54B 3L5IA 5FHAH 1AXTH 3WUWG 2CXGA 5HYJD 1OF2B 4JEGB 4HC1A 5DJZA 2DMCA 4GUPB 5D71L 1FV1A 5F93C 2HH0H 5BCAA 4WI6A 1ZV5A 3UEZA 5I18L 2QADD 3O41A 4U1HA 4KPHL 5FM4A 4N9GA 3RWDA 1M71B 3BH9B 4PRPD 4XBEL 3DIFB 1RK0B 1U8MA 5C0CB 5EOCL 3VU2A 4DVRL 4LVOC 1JV5B 4LASL 3D85D 5DDHA 3MCLL 1F3DJ 1CGYA 2X1OA 2X44D 3BXNA 5D1QC 3SDXB 4ONHA 4ZYKB 1MIML 3T0WA 1H15B 4HKBA 3JXAA 3CLFL 2R2BA 4OCWH 3MO1A 5ILTL 1OAYH 1KCVH 3HMWL 3WLWC 3P4MA 5CP7B 4J4PC 3QNYB 1P84J 4JRWA 4U6XA 5JZ7D 2XRAH 2WBWB 5BOPA 1KPUA 3KPRD 5L2KB 3HAEA 5KSAB 4I5BB 4TUKL 3SGJA 3RPKA 3TBVA 3RDTA 5FYLD 2BRRL 3MFFB 4NFCA 2X4UB 3RBGA 4M3KB 4NQDB 4LMQE 2DQDL 5E00A 5E2UH 1Z0NA 4XXDA 1WAAE 2NY1C 5I6XC 1KOAA 3U30B 3CZJA 3D3VE 4D9QD 4F9LC 2NLJB 5LGHL 5CSZA 4BSWB 5LJYH 4ALAL 3BP4A 2GTZA 3RY6A 3JTTB 1PKQE 4KUCD 1HE7A 5IVXE 4M8QA 2ZCKL 1T6VN 1ZMYA 2GITA 5IMOB 2R2EB 1HSBA 2C3XA 4LKXA 3EFFA 3QIWB 5DO2C 3S7GA 4WDIA 5J9PB 5FUCC 4JG1H 2BNQE 1EZVX 2J1KA 3RUGF 4HG4J 2Z4QB 4A6YB 1X4YA 2VLJB 3MC0A 4R3SA 43C9B 1KF9B 3EHBC 4AMKH 3MGTB 3TBYA 1RZ7H 1SHMA 3NGBB 3BKCL 5D2LE 1PGRB 3B9KD 1S7SA 1ZHBB 1TFHA 4K3DH 4JM2F 4P2YA 4LPUA 5I1CL 5EA0L 5DC9B 5SWQA 1JZ7A 1CG9B 1HZHH 3H42L 1TQCB 4QO1A 3KHOA 1A6WL 5HD8D 5CINL 2FBJL 1ZGLM 4JFHE 4WNQB 4OCLC 4OJFH 4U6HA 5KANG 1OM3H 4LAQL 1FYTD 2WBJC 4F7PA 1OAZH 5EOTA 2GTWA 3RY4A 5F71A 1B90A 2E9WA 1WZMA 5ACZA 3MCKA 2ED7A 1U3JA 3DPBA 3WDJA 3ULVE 5DRXB 4PS4H 3ZE2E 3GHBL 3O3BB 1IT9H 4NO5B 5EZLB 2X2YA 3KYAA 3HMXA 2I9TA 1NLBL 4XBGA 4APQD 2AEWA 5HHOB 5IWLC 2R8SH 1MFEL 2YPLE 4I0CC 3QO0A 5E4EC 3T0XA 5EWIL 2B4CC 1CIDA 1HHGA 3KAAA 4CNIB 1MRFL 3EO9H 4PJXB 4OI8A 5CIPB 1OAXL 3GMMB 4F8TA 4M7KH 4CJ1A 2EE3A 2GKIA 1BQHA 4OZIE 3CVHB 4JREC 4Z7WE 3TO4B 4D8PB 1MNUL 4NNXB 5AD0A 3IFNL 3GSOA 5MEQA 2WLZA 4XHQA 5F7KC 2NCMA 4X6CA 2CJUL 4IOSD 5D2NA 4NQUA 3L1OL 4AEHH 2UV3A 3PXHA 1JZ6A 4NHUB 1RJLA 5GRYA 1N6QL 3FQXB 4GKZA 5DMGD 5DUBB 3DARA 1BFVH 4XCNB 3DUSA 1GHFH 2GQHA 3CVIL 1B9ZA 5I1CH 4S1RL 4P5MA 4QRRA 1HHIA 1W72A 4EVNB 3F6LA 1UA6H 4NHCH 4YAQA 3VXNB 2DYPB 4MSWA 2R0WL 4QWWD 1AGBA 3UYOD 4KXZH 4M6ML 2J6EL 3VWKB 1CTOA 4X0KB 5F72S 1EBAA 4YHMH 5DT1L 3EZJB 4X6BB 1YNLH 4OZGB 3NH7H 1FE8L 3JWNC 1EFXA 3UPRB 3V0VA 3QA3B 3VE0B 2P8LA 3FRPA 3QUXA 1IAIM 3GI8L 5TQ0H 1D3CA 3K74B 1KCRL 1RQ5A 1FORH 4OLVL 1RZGB 3QNXA 2FJFB 1JTTA 5DK3A 1PG7H 1T2XA 3WN5A 5GS1B 4JB9H 5C09D 3G5VA 3STLB 1LK3L 5CSGA 2X7LA 3TBTB 5DJ0B 1KJVB 4JPVH 3FO1B 5FYLE 4FTVD 3BE1H 4JQIL 1EHNA 3BUYA 4R0LA 4A2MA 3S5LB 4DAGL 3VGAC 4CMMA 1Y6NR 2H1PL 5IHUL 3ROLB 1IM3A 3MUHL 1LP9B 5D7JB 1QNZH 1Q9LB 1T66C 1Q9WB 2BHZA 4QNPE 5IJVA 4F57H 4UNUA 5LWYH 1R0AH 3W9EA 1RURL 3SKMA 3FQTB 5CKGA 3GZKA 1I3UA 1N0XL 5CD3B 5C0JA 2GFBB 3V8CA 3LSOB 2N1KA 5EU5A 5I17B 5IHZB 3DUSB 2NW3B 1DL7H 3SN6N 3IDNA 5BXFA 2EIEA 4JN1H 1OTUC 5T1DH 1BX2B 1CN4A 2VLRB 3PHSA 4LSVH 3ZT7A 3T8XB 4W4NA 1RZIB 5HDQH 1VEMA 4HAFA 4XP4H 4LHUG 3S9DB 1G84A 3NPSC 3BH8A 4CN6A 2DIJA 2VDLH 3L5XH 5LG1A 3EYUH 4MD0A 3FFCB 3L7EA 3SE8H 1W0WB 2DYPA 3B83A 4Y19D 1QLRB 3S34L 4LU5H 3IAGC 3H8NA 3ALPA 4PV9A 4M7JL 1A7QL 5C0BA 1S7UA 5DXWA 2H26B 1J88A 5BJTA 2DLEA 4EKXA 5GS0C 4P23C 4PJHE 2Z8SA 3QCVH 4HWBA 5BV7L 4C58B 4NM8L 3C5JA 4FQ1H 4POYA 3QQ4A 4URTB 3QWOA 1I8LA 2AKRB 5AD0B 5HI5D 5I75C 1CE6B 4YWGH 1LO0L 3HFML 1BQHB 3S35X 1UFUA 1IGTB 3S8WA 1BVKB 5BZWB 3WIHA 5GRVL 4YUEH 3NAAL 4MAYC 3AVEA 1HINH 3ROLA 3BZDA 1XGRA 1FYHB 3S5LA 1N64H 1BBDL 1OAQL 2IG2L 4LCUB 3RVXD 4GMSL 3HKFA 4UBDD 3GI9L 1MCPL 4NFDA 1BQLL 3PL6B 4TQEL 3BT2H 4W6XB 2LQRA 3WCYA 1UZ8B 1MWAA 4PRPE 3BGMB 4MQSB 1B0GA 3EIFA 4MJ2A 2VDPL 5DJCB 4WW2B 1ES0A 1T7XA 3WIHL 2Z4QA 4G6AD 1UB6B 2CRZA 4KZEL 2IPKA 3FN9A 1FPTL 3SPVA 1LEKB 3IFLH 3S98A 4P9HL 5AZEL 5EOCH 4DVRH 3IVKA 3ECBA 5TE4H 1W8NA 1HKLH 2VXSH 3WUZA 1BM3H 4FFWC 4YAQB 3RX7A 1T03H 3P9LA 3VFGH 3IT8D 5FV2A 4RRPG 3N50A 1F4XL 1A3RH 2FSEB 3O8XC 4ZXBC 2NNAA 3K8LA 4JLRB 5DEFA 4GAGH 5EBMB 5GJTL 1VFAB 4DW2H 1J1XH 3LKRA 4OB5L 4LLWA 1UB5A 3EUUA 3BYTA 1XCQB 4PUBH 3ET9F 5DMYA 4R90H 4RWHA 1F6LL 1ZHLA 2AAVA 2FEEI 2ADFL 2DM7A 2PW1A 3R8BB 3QXTA 1GSMA 2MNUA 4NQEE 3ZKND 1NC2D 4NGHL 5JMOC 5DYOB 1U36A 2O5YL 4ZUTA 4G7YH 3QUKB 2UWEF 3AXLB 5CCKL 2EKSA 1ORQB 1MAJA 2VQTA 1CGXA 3RWJB 4GXUM 1OAQH 2GTZB 3NBNA 3BQUD 3OKDB 4FQXB 4M4PA 5GIRA 4I1NB 5CBAB 2F5BL 3JWDL 3DUHA 5KOVC 3WLBB 1FO0H 4GSDL 1UWEL 4FTVE 1EA9C 4P49A 1ZLUH 4F7MB 2AGJL 4CL7A 4R4FH 3VXOA 1G6RB 3L3HB 3O8XD 1NKOA 4PJFF 1L0YA 1DDHA 1NBVH 4OZ4A 5DDHB 2DRUA 2IH3A 5DD3H 1HYSD 2GTWB 1ZLVK 4HGWA 4MDJA 2Y5TA 4L5FL 3GB7B 3U79A 5IVNA 3HAEB 5KSAA 4NZDA 2O26U 3HZMB 3BSZL 3UMTA 1R3KA 2GSGA 4BYHA 1PZ5A 2XN9B 4YXKH 3VDCA 4ODUA 4JJHA 3O4OC 1TETL 4ZFOA 4HWZB 3VXQB 4HG4K 3N1FC 2R4RH 1KN2L 1T6WA 3QZWG 4G6AC 1JFQL 5GGUA 5EU7E 3LPFA 5K9JH 2VZ3A 4N0RA 3EOTH 4J4PD 5JW3H 3FO2B 1C7SA 5DD0L 4EIZC 1T4KA 4CAGA 4ESKA 4F37F 4O5LH 2X89D 4EDXA 1UZ6F 1H5BA 4GW4B 2Z31C 2YPKB 4LLVA 5ANMB 3RZCB 2VN7A 2GI7A 3PDOA 5EUKA 1P4LA 3QNZA 3RWDB 3KG5A 1KLFA 1G6RA 3L3HA 3F7VA 5IR1A 1Z9SA 4JGMA 3TCXA 3IRPX 1C5BH 4YHLL 3DTXB 3FONB 4KK5D 5CJQH 5HVFB 5EO1A 5BV7C 4KZDH 2DLTA 5I1IH 3QIUA 3SJVB 5KVGH 4BH7A 1OB1B 2XQBL 1A9BB 1WISA 4H8WC 1KCUH 4L8CB 1JWMB 4L29B 3UC0L 4K94L 5C07A 1A6VL 1YMHA 4J1UA 4ZUTB 3BKMH 2DIBA 3BMWA 2BOBA 4FXGA 2X09A 1J11A 1OGTB 3IETA 1LE5A 5FGBC 3IDJB 5K9JL 4S1QH 1BVLA 1KULA 2FATL 1LE5B 1L0XA 4LKCA 3FB6B 4MCZA 2ZNWA 3ZKMD 4M7KL 1MHCA 1XCQA 1NMBH 4YXLH 4HF5H 2IANB 4TPRL 5F96H 4F7EA 2NZ9D 2HWZH 1EO5A 1AO7E 2OJEA 4YDLB 5E08H 3TCLA 3C5ZA 5FKPA 4HWBH 3E0GA 3P9LB 1JNLL 3VCLB 4MVBC 4RGMC 4L4TE 3WKNA 1FL5B 1SMAA 5EUOA 1MFAH 4GO6B 5DJDB 3G6JB 3FONA 3DTXA 2H8PB 2GCYA 1KYOJ 1FZMB 4XVTH 5B39A 2M2DA 5AYUL 5ESQB 1DBBH 1NAMA 1RIVH 1WGOA 3DJ9A 1LEKA 3KNBA 4RGOH 1TPXB 2X4TA 4MA3A 3WHXB 1IC1A 3MGOB 1S9WB 4K55A 4FG6C 1F4YL 1ITCA 1NCNA 2R0WH 1ZT1A 3L3DA 3NA9H 5F3HB 2HJKA 1ZLSH 3MZGB 1Q72L 3LS5L 1JUFB 5DLML 3R06B 3WFHA 4Q9BA 2OL3H 4NN7C 4UT7L 4NQEB 4AEIH 3O41B 2D0FA 1HK6A 2B1AH 4C56B 4MHHG 2YS4A 4KUCF 3LAFA 5DD1H 1S7WA 4M62L 1V7MH 1KB5A 3K4DA 3PGDA 4OGXH 4TRPH 5SWSE 4NZTL 1WWAX 3QB7C 5E0QA 1JNLH 4MXQC 1VDGA 1U6AH 3HZMA 2OTPA 2P44B 3KYOB 4K9EH 4X4YA 2HVJB 1YEDA 3I2CH 1FNSL 1N0LA 4HWUA 3MQIA 3O4OB 3IDMB 1T7YA 1CL7I 4N68A 4BQ9A 4UTBL 2P7TB 1F11A 4M3JA 2IQ9L 4MD4B 2R29L 1KCRH 1A6UL 3DI2B 1CT8A 1CDJA 1NFDF 1G7HA 2HTKD 2XN9E 5J1SC 4EXPX 1XAUA 2XFXB 2EDTA 3UTZB 5C0AD 4J23A 3NCJL 1NSNL 1UVQB 2V7HB 5ECJE 4XVTL 4MJID 2ARWA 1W0WA 1TJHH 1QFHA 3IFPB 4X80L 3TBWA 5DHVA 4KRPD 1FZKB 1G1CA 4PJCA 2K3TA 2PW1B 3TT3H 1JWUB 4X4XB 5C0BE 3KPPA 3FOMB 5BRZA 5HYJA 5F1SA 2RAMA 3U36B 4G7VH 5FGSA 1P1ZB 3S36L 5KSVB 3SDDA 1MY5A 5IGXL 1G6RL 4E41B 4JRYD 4E42B 1MHEB 5BO1L 3O45A 1A3LL 1NGYB 4FXLA 4Z7NE 5FM5O 1CXIA 1OPGH 1YN7A 1I3RB 4I2XB 5ENWB 2DQUL 2I26N 2AP2A 3LPGA 3QDJA 3OAUH 1U3HB 4D9QE 4M9PA 3KXFB 5H37G 1H3UA 3W39B 5HI3D 3O8XB 3MBEA 2BMKB 1MREL 5E8DL 3PV7A 1AFVH 5ALCL 3I84A 4JRYA 4APQC 4UTBH 4P5KB 1QR1A 1GH7A 1T7WA 3BP5A 4DQOL 2DQEH 2Y7QB 2CRIA 3Q6GH 4KJQC 2DD8H 3E1F1 2APBA 1ZA3B 3EOAA 3MBED 1SQ2N 1NGZB 2Z92A 3V79C 3OJDA 4S1SL 4LPYA 3VFSB 1HINL 5TPWH 5E8NA 3D18A 4PRNA 3CXDL 4NZJA 1KCUL 3FJTA 1W0VB 2OZ4H 4K94H 5DR5L 4X80H 1D6EB 5DMKB 1TJGL 1A6TB 1G7LA 5BZWA 3RJDA 1YUHB 2OSLB 3F7YB 4AL8H 3DX9A 5DVKA 5IQ9B 4BFIA 2AEIT 3TZVD 1TZIA 5D96B 2B39A 3PHQA 5DMJB 1B4RA 1FNEA 4M93C 4ODVL 4V1DA 4HW6A 2VXVH 3SE4A 1WZ1H 4QY8A 2E8ZA 3RVUC 1BZ9A 5EO9B 3Q5YA 4CDGC 3CDGA 3HZYA 4IHOA 1FC1A 2H26A 4KMLB 4BA8A 3EW3B 3VI4F 1J0ZA 1QLRA 5DRZB 2P5WA 1GAFH 1F4XH 3CD4A 5D1XB 4LASH 3SGKA 1EEZA 3VWKD 3OJDB 1FZOB 4EI5D 1QUNA 4JKMA 5D7IF 3VJ6B 1GOHA 2RJMA 3WIHH 3TF7C 2PO6B 1EEYB 3TPUB 4H25B 3OB0K 3BP5B 3VW3H 5D70H 3FQTA 3FQUB 5FCUL 1BX2A 2VLRA 2ZJSH 3TIEA 1JNJA 3NA9L 3VGDA 4IRJC 1H3PL 1KT2B 1CFNA 5GS0H 1CIUA 1FFNB 1NGQH 4Y2DB 2ITCA 2I9TB 3MBEB 4X6DE 5A2IH 3BDXA 3A67H 3MACL 4HH9B 4PJCE 1ZSDA 4LSTH 2GSIA 1J0HA 4K23L 5DR5H 5TDPB 4RAVB 4XAWH 4HS3A 4WV1B 4Z0BH 2VDOL 3VFOB 2H2SC 2V5RA 3BE1L 4JQIH 3QCTH 3MJ8A 3MRJB 4NO2A 4XCCL 5IM7B 2OR7A 5IT2H 1ZHKB 4NWUH 2FO4A 2V2WA 1AKJB 3I50H 5DHVB 2ORBH 3MRLB 3QUML 3MV8D 3GJFB 4JN2B 1JPTL 4RBPH 5HJ3A 3RBSA 3PP3H 1HEZB 1XH3A 4K3JL 1W72B 5CILH 4PRHA 4R4FL 3P30H 4YDIH 3MYJA 4OLWL 1MFNA 3IF1A 1LO4H 3DUUB 3FT2A 3L95A 1IEBB 1MI5E 1A0QH 1SJHA 5KZCB 5IBLC 1J10A 2JF1A 3RY6C 3RVWC 3B2VL 3UTTA 4N0CD 2QR0A 3FO0H 4ZUVA 5H35A 1R5WB 1FNAA 5TJWK 5C7XH 1NDMB 3OSKA 2YD6A 4IS6B 1UACH 3MJ7A 3RX8A 3REWB 4DKDC 5CSZB 4OI7A 4OJFL 4LSTL 4Z5RB 5C0ND 4YR6B 2P8PA 1OY3B 4M7ZB 5ICZB 3QHFH 4LOUC 1KLGA 4R4BA 1FRGH 3BPCB 1X9QA 4HJ0C 1G7QB 5FO7B 4J3XA 3S4SB 5DQJA 4Y4HC 3BPOB 2FECL 3MRHA 1OTSC 1F58H 2QQKL 3VG0L 5JDJA 5HYSA 5AAWA 4UIKL 2XY1A 2C1OB 2H2PC 1HHGB 3WJJC 1FVEA 2DWEA 3B9DA 3QIBB 3T2NL 3AREC 5I19H 4X99A 2ZPKH 5DK2A 3BN3B 4N90E 1RD6A 4YXLL 3WXVL 2FNBA 5F88B 4AM0A 4G8GB 5GGTA 1CFTA 2H8PA 5F7EH 4ZYKA 3TYFB 3MSPA 4TUJA 2A9MH 3LIZL 4Y4KC 5FO9A 1IARB 4POZD 1DQDH 3BIKB 3FQRA 5DTFB 4PD4K 2E7HA 4PJDE 1UH3A 2V6HA 4NQXB 1URLA 4OF8A 5JW5A 5F96L 3CPLB 5KW9H 4XCFH 2Z31A 3FB6A 4MCZB 1Q8MA 1DQMH 2BX5A 5ICXA 1KB9K 4OZFG 2UZIH 4WEBL 1ZLSL 1AE6H 4X9HA 4M1GH 4X9BA 1X5HA 1INDL 2GK2A 4WW1B 2OL3L 1U41A 1G0DA 2WAHA 5E9DA 3WN5C 2YR3A 4JRXE 3DMMA 3HS0A 4ZNEA 1SBBA 2YWYA 2IC2A 3BP7A 3AM8C 5ITBH 3C2AL 4FQLH 3MXVH 4R3SB 3BP4B 1G1YA 4X4MA 4ZUWB 1A1OA 3NABH 2LAAA 4YNYA 1IC5H 3ULVC 4Z95H 2VMFA 3RIAF 1FORL 4R96A 4IIQB 2VZUA 3EOBA 2NY2D 2DDQH 4AH2A 4KI5E 4Q6IA 3SJVD 1Y18B 2MHAB 1JGDA 3DX6B 4KJYA 1DEDA 1CXEA 2O93L 4UV4H 5HYFA 3MRDB 1MPAH 3D0VA 3EYFB 4PGJA 3M1BB 4Z18A 5D93C 3SGKC 3LS4L 2OK0L 1AD9A 2FX8L 4HX1B 4CVWA 2DJSA 4JGUA 3ZKMC 2JJUA 2QADC 2Q1EA 2VTFA 2FLBT 3DV4B 3IGAB 3TESA 4NQDA 2FHBA 3DRQA 4U6VL 4G3YH 4PJ9D 2C3HA 2AI0H 1CFTB 3HPLA 2NYYD 3G04A 5A2KH 5ITBL 2VL5A 1KIRB 2BVEA 4PG2A 4XP6L 3QR2A 1HZHL 3RNKA 4Y4HB 4KI5D 1AXTL 4ZO6A 5TFSH 5I1JH 1IAIL 5IT2L 5T3ZE 1INDH 1EGJL 2JLLA 1AXSB 1BJMA 2EKJA 4KQ4L 1J0KA 4Y89A 5MEPB 4OD3L 4NWTL 5DJYB 1KCSL 4OZFH 5IFHL 3PP4L 3MA7B 3PL6C 4IDJH 2OR9L 4MHHI 5D7SL 2B0SH 5I74B 2X10A 1AD0A 3QEQA 5ISZB 3SY0A 3LEYL 4XP9H 1TPXC 4GS7C 4Z7UA 2XNAB 5EWIH 1A7QH 2AXGA 5F7LB 2JKXA 1S5HB 5ALCH 5J1AA 5T3XE 3DX6A 2GW5A 1R5WA 1YDPB 3MV9E 3S97C 1WBZB 1XGYL 3IJSA 5I1HH 2VABA 1PKQB 3UTTB 5TE7L 4IRSB 3C5SB 5TFSL 4FS0A 3X11A 1T89A 3QCUL 2VXUH 5CD5D 1OP9A 1RUPH 4W6WB 3TVMB 1K5NB 4V1DE 4PTUA 5BW7C 2C7UA 5E2WH 2GK0A 4JKWA 1GJIA 5I8CB 5M95B 4DKEL 1E4XL 4S1DC 3VWJB 3L3JA 5ESAA 1TVHB 2DMKA 1SMOA 1VGKB 4N90D 2HA1A 4JZJA 2HT2D 3F7RA 4G9FE 3D39B 2IG2H 2J8OA 2XZAH 5DQ9B 5EUOF 3RVXC 1MCDA 3Q2CA 5IP4A 3U0PA 3BT2L 1RIHH 4ERSH 2ICWI 1JRHH 4UI2A 5HGDB 2VXVL 5BVJA 1NCAL 1IILE 1XR8B 2V9QA 4Z7VF 3JV4A 3CXDH 1OAKL 4NWTH 1A6AB 4WFED 1IGIH 1BF8A 2CKBA 4NKOB 1TJGH 2YD1A 3PWNA 4L3CA 5INCA 1CE1L 4OT1H 3IDGB 2FO4B 5TQ2L 3UTSA 4IRJB 5C08B 3TYFA 1HKFA 2VERN 1TNMA 3O2WL 1AGCA 1WBXB 2CIKA 4QOKD 1T03L 3C6LB 4X99B 4U1JA 1KN4H 1J5OL 4GAGL 2BP3A 5GJTH 2AABL 5E6ZA 3G6JF 4Z7QF 2DOCA 2UZIL 3T09A 4ZAKC 2OS7A 1ZSDB 4IOIA 3BHBB 2FJHA 4LEOA 2J88H 2BSTB 2E6PA 1C16A 5IOPA 5E6ID 1KC5L 3D48R 1GXEA 4P57B 4LLUB 4KK6C 4QF1A 5CCKH 1KELL 5FYLL 2O5YH 1CGTA 3LKNB 4HT1L 3VH8A 3AAZB 1FZJB 3L5WA 3IAQA 3KXFE 4NC1C 3RVVD 1KENH 43CAB 4H88L 1OTUD 3EFDH 4LEXL 4GSDH 4H1LB 3EBAA 4MQ7A 1INQB 5FDWA 3HCVB 5F1IB 2YK1H 4U1SB 4HCRA 5DD5H 5F6IC 2HKHH 1OAXH 4P99A 2H45A 4BJLA 5GJSL 1I1YA 4X7FC 4KWUA 4KHXH 2PF6A 5EPMB 2O5ZL 2WIMA 3O2DL 5GHWH 1S7UB 4JZOA 3CDGB 3C8DA 1JF6A 5IESH 5I9QB 3ULVF 4N0YL 3QQ3B 3QXDA 4PRNB 3FMGL 4NO3B 5TF1L 2R0ZL 3OPZL 5JXED 2NY1B 3S3SA 3KLDA 4GMTH 3U30C 4OI9A 2EE6A 1U8PB 4P5TB 5IM7A 1JPST 5JW3L 3HZKB 3D3VD 3V2AR 1IEAB 4NN5C 1AR2A 5EIQA 4WUUB 2V9TA 2C3VB 4OIAA 2VLLA 2WBJD 4R0LB 3BPNC 5DHVH 4ORZC 3UPAA 2YD7A 5DT1H 4YHML 3IJHB 1WEJL 2FD6H 3BI9X 3H42H 4XXCA 2JCCE 1DN0A 5IW3A 5EBGA 3RDTD 2VH5L 1RZGA 4JO1H 4OFPA 3MREB 1K4CB 2LU4A 1GZQB 3GRWL 2FLRT 5D6CB 2J7LA 2H3NA 2WUCH 5DA4A 1JYNA 2CK0H 2NX5D 1NLDL 4O02L 4P2RB 4BK4A 1FSKB 1MRDL 4C56D 4QRPA 3G08A 4M48H 4R4NC 3JWOC 4BSVA 4JRYE 1BZ7B 4FOMA 4QRTA 1SEBA 3VJ6A 3WN5B 2FB4H 3TBWB 1MAML 3FZUD 4U3XA 5E99L 3PWUB 3QI9D 5CJOH 1NGYA 4GKOA 3MMEB 4EQ2A 3B3IB 1ZK9A 4OCYH 2ED8A 3KPPB 4X6BA 1DN2A 3UXFA 4OLXL 4X4XA 5D7KE 2FEDC 3CVHH 3SQOL 2XZAL 4N1HB 4JPWL 3MLYH 4P4KC 3BKJL 1A5FL 3VH8B 1AQDA 2X4SB 2V7HA 3NN8B 3RRQA 1MVUA 1U92B 4GRLC 2FO1A 3EDKA 4OTXH 5I30H 2NY4D 1Q72H 1C16B 3FQXA 4GKZB 2GYSA 1D9KA 4HFUL 4UDUA 1JZ8A 3KYNA 4JZNB 2Y23A 3TJEL 2UWEB 3SCMC 2YZ1A 3ZLQC 3WD5H 4PJ8C 4JY5H 4Z8FH 2NY6B 4GW5B 4JQXA 4NT6A 3G5YB 3I85A 2B1AL 2P24B 2EXYC 3T0ED 4HUVA 4EI6B 4KGJA 1SY6A 3C6LA 4CNIA 1QLFB 4JY6B 2BSSA 4J3OC 3D25A 2IH1A 4XP1H 1B2WH 3SE9H 2MKLC 1LK3H 5GISL 5CZVH 1PSKL 2X4TB 3WHXA 3P73A 2VZOA 4G8GE 4X5WA 3K8MA 2MQ0A 1I8KB 3CJJA 3TFKD 4QEGA 5A2LH 1QA9B 3NIGF 4HV8B 4UIMB 1ND0A 1MUJA 1MIMH 4XPFL 3UJIH 3V0AC 3UTSE 1NDGB 3VXSA 2MWCA 3CC5B 2F58L 2OP4L 4AG4L 4PY8I 2AJYH 4NIKB 3KNBB 4F7EB 5JIHA 1MPAL 3D39A 4QTIL 5ESQA 1MHCB 4H5SA 2VDOH 3GMRA 5ESAB 4IBLT 4ZOAA 4QHKI 1HI6B 5IWLA 1I8MA 2YMXL 3EYVA 1F97A 3KWWB 4YHLH 4M5YL 4U2YA 4HDIA 3QXAB 4MZ3A 2RCSL 5FGRA 1N8ZA 3OHXA 1SY6L 5C07B 5IFHH 3HNSL 1NC4A 3C5SA 5F7HA 5B22A 4NM4H 4F33B 1IE5A 5EZJB 3QUXC 5IFJA 2BNUB 3UJTH 4NQVA 4IEFB 3OKMB 3JWOL 5MENE 2FH8A 4WDIB 5J9PA 3ARFD 4W68A 3OPZH 5K9KB 1CLZL 3LQAL 1OSZB 5D4QA 5FHBH 3OL2A 4NRZB 5SX5K 2QSQA 4DGYH 3S37L 1TVHA 5IHLB 1DVFB 3H9SA 4NC2B 2EIDA 3IDMA 3TA3C 4U6XB 4PJBE 4UDTA 3UROR 2AJYL 3U4AA 4QT5B 2YPKA 1JCKA 1E27A 3UTTE 2PKDA 3MO1B 4ZAKB 4I48A 4C4KO 2XTJD 35C8L 5EC2B 1S9VA 1RK1B 5HVHC 3LKQB 5E00B 4L4VD 1QSFB 1UXWB 5L9DH 2YUZA 4LLYB 4HJGA 1GIGH 4LHQB 3RWGA 2WWMC 4ODUB 2GT9A 2D03H 4S0SD 4LLDA 5E2TL 1ZS8B 2CUIA 2UZYB 3L3DB 3D85B 5FYJD 4F58L 4G9DA 3CH1B 3MV8E 1FVCA 2Y1VA 5ADPH 5I1GH 3KJ6H 5T5FL 2LAGB 4PRPB 4UT7H 4KDWA 5HGHB 4XPTL 3LKQA 5IVXA 2O5XL 1V3MA 4PJXE 5MENA 3NH7L 1WUNT 1IAOB 4JFZH 4K7FA 2P1YA 3T3ME 3V0WH 3U7WH 5CBAA 2HRLA 2F54D 4Y19A 5ELIA 2DWEB 4G6FD 4L3EB 5T3ZH 1J1PL 3E3QC 1DVFA 5L8LB 5DYOA 4NRZA 3CFBB 4JFDE 4R8WL 2RHEA 4R96B 1MIEL 2EE9A 4ZOBA 3MBXH 2Z8VC 3PJSB 2YD4A 1J8HB 2EDLA 5E2TH 3P4LA 4J6RH 5ICZA 1S8DA 3TT1H 4F33A 1FBIH 5IEKA 4Z5RA 3BP7B 5HSFA 3MRMA 4P3DB 4PUBL 1XR9A 4RBPK 4EEEA 3BPLB 1MSPA 4XPGL 3H9SB 2VR9A 3O6ML 4JG1L 3HE7A 1WIOA 3X13B 3K4ZA 3WNMA 4G43A 1XF1A 4C59B 3QDGB 4L8CA 3PDDA 5J1TC 4IMLA 4XMLH 5HPOA 5FOJA 1UM5H 2AJXH 3X3GH 1Z9OA 3NPZB 1IM9D 4UINL 4R7DA 4YHKL 5FDYA 5JR1L 3OXSA 1D5XA 2YA1A 5IKCB 4NZRL 1X6LA 5E24E 1V3JA 3DXAA 3RWIB 1ED3A 2JTDA 1VPOL 5J6GA 1CD9B 2DQTL 4EI5C 2BFVL 1XIWC 4HGMA 4HKZB 4PBVC 2AS5M 2ZOLA 2VXTL 5DSCA 5H94B 1HXMA 2ARJB 4DZ8A 2UUDK 2DI7A 2XA8L 1BAFH 4HUUA 3OAUL 4ZDHB 4NCDA 3RWCA 3VXMA 4BZ2L 3MV7E 5AWNL 4GRWB 1KACB 3T2PA 4PRAA 5DK2B 4DN4L 2KZ1B 2BVYA 4P3CL 3S6CA 1KSRA 2WZPD 4LIQH 3D25B 3P11L 1JWSB 5DJCA 1DUYA 4WU5B 2X1QA 4P2OA 5FM5M 4KKCC 4LLDB 1N5AB 3P2TA 4JKPH 1RIVL 3MJ6A 4U0RC 2R0KH 3L7FB 1MCHA 1F3RB 2C9AA 3BPCA 3EO0B 1LO3L 5IQ7H 4M43H 5ERWA 5JPNB 4JG0L 2D4FA 5EFIA 4G8GA 3HLAB 4E0RA 1DQTA 2XQYG 4K94C 1FFNA 4TTDC 1ADQA 3X14B 1D5IL 4GKNB 2YXFA 4QWWC 5DZLA 3ZT6A 2VXQL 5L0QB 2JCCB 4DUWA 1FIGL 4OD2A 4ORGB 2W59A 5H2BA 3T3PE 4UDTB 5JQ6H 2X1WL 2AJXL 3FQUA 3TIEB 3X3GL 1KG0B 1AQDB 3AB0B 2JB6A 5DGQA 5J3HC 4KAQL 3LEYH 1FNHA 3HI6H 1AJ7L 3MLRH 4O02H 4QLRA 1U3HC 2NXZD 1D5BA 1QRNE 2EDYA 4X7DC 4Y2OA 4Z76B 4JM2D 1KLUB 5KN5B 3T77A 4Y5YC 1IAII 4PJHF 4O00A 4GFTB 3KPSB 2NR6D 4C57C 4MYWB 3GMNB 4D0CB 2HRPH 3FFCA 5ADOH 4OZIA 4HDIB 4PJFB 4U1NB 2B5IC 3LKOB 1BZ7A 4HKJA 4TPRH 2J4WL 4RAUA 1U2HA 5AYQA 3MRJA 3MJ8B 1JNHA 2XG4A 5DVMA 4KJWC 1NEZB 2ITDB 4WGWB 3SE3A 3FT2B 3IDNB 5JQ6L 1YUHA 3F7YA 2OJZL 1BFTA 4I77H 1U0QA 5GGQL 1S9YA 4HIEA 2IEPA 2ZKHL 4QRTB 4UOW1 1EFQA 4LNRA 5B4MC 3F58L 2Z92B 5JORA 2OLDA 2FZ3A 1IGCH 4N8VB 5T1MB 4AIXA 4Y2DA 3G6DH 3H9SE 3FN0H 2X4NA 3RAJH 1F4AA 1X5IA 4LAQH 2E27H 3VFUB 4P5KA 3OAZK 1JPSH 4MDIB 4TQEH 4MD5B 1K4CA 3MNWA 2FIKA 2F74B 4OZGA 5HVWA 2J4WH 3NABL 3TWCL 2NMSA 5C09B 3QJFA 3LQZB 4Y4FD 1V7ML 4NFBA 3ULUF 4DGVL 1HH9B 2AQ1A 3QXDB 5E8OB 1FYTB 5KSUA 2VAAB 5DWUL 5E5MB 3M45A 4WFGD 4YXHL 3TZVB 4HKXA 3BKYL 1DUZB 5EPMA 5CEZD 4S1SH 1EAPA 5F7FA 3MRCB 2VDQH 1NEZA 2ZUQB 4GQPH 1N6UA 2XQYK 5KSVA 3DETD 4ZS6C 1S9KC 2E7CA 2KQMA 3SGDI 3B9EA 3R0NA 3EYOA 1TCMA 3VRLF 4PJFA 4U1NA 1CFVL 4X9GA 1F5WA 1U95A 4LF3A 5HTSA 4PJ7F 4M7ZC 3LB6C 4PLOB 1TJHL 4DCQB 3RVTC 4GBXA 1KLUA 5KN5A 3D9AH 2CK2A 3RGHA 1K6QH 3RQ3A 3F58H 4HIIB 2R2HB 4X6CB 3HZYB 1KXTB 1ULVA 4WTXA 4D8PA 3WL9A 3LD8B 2BRRH 4P46D 2YPLD 4BZYA 1EHLH 3N1GC 1FNEB 1WWCA 2EXWC 7CGTA 3CXHJ 4KI5F 1VKXA 4UB0H 4ONFH 4PV8B 4UBDC 2DM3A 1BP3B 3QUZB 1QO3B 5C6TH 1YPZA 2R4SH 1CLCA 4HHAA 3P4NB 3GJFK 2VSDA 2DQHL 5F9OH 2IPTH 4QHKJ 1FYTA 4QXGH 3MRGB 1X5JA 4G42A 5F89A 3KJ4B 3TO2A 5FCSH 1CF8H 1TJIL 5I0ZA 4LRIA 4ZSOA 1QHOA 3NIGE 1NGZA 3JVGC 3SGDH 4AEEA 4CADA 1EZVY 4P2QB 1UZ6E 2R4RL 3E2HB 1T7ZA 1XT5A 2AJVH 1MHPL 4L4VE 3P77A 2C3VA 3TYGH 5HPMB 1DJSA 1KIUA 4DUVA 1OCWL 4YK4C 2CDFA 2FX7L 3DO3A 4MQXC 1TVBB 4LVOB 3QDJE 4OGYL 3FRUA 4JM4L 2OYPA 4RMRA 3G6JA 5E8PB 4JPKH 5DSCB 1ODAA 2I24N 2FEDD 3UTQA 4K3EH 4RCAA 3T0EA 4B0MM 1MCJA 4Q9QL 1ZVSB 3MRRA 3UX9B 3AS0A 5T5FH 1LDPH 3P3YA 3OQ3B 3WV0A 3C6LD 5IK3A 2NY5H 4YE4H 3TN0C 4RGMB 5D1XD 3TVMA 2K1MA 5L88L 2XPGB 1T0NB 1QFOA 4G7YL 4FXKA 1IKFL 4LKCB 4XXDB 3VGGA 3P9MB 4Z77A 1CE1H 3TGXA 3QUMA 3P0VH 3IJSB 4YDIL 3IDJA 2AVGA 1TTFA 5IVZA 4XH2A 3QFJD 3CVHA 1XF5A 3QDGA 1BFOA 1R24B 4TNWK 1YQVL 4HLZH 3OJVC 3HRZA 2NX5B 3L1OH 4AEHL 5KG9B 4S2SA 1XR9B 2DAVA 2LU3A 1OAUL 4OZHE 1X4XA 4LBEA 3UTZA 2QEJA 4UT9H 5BV7H 5D1ZD 2DKSA 5E2VH 1KPRB 1PKQA 3EDJA 4XBGB 4Y16C 3DVNA 2OTUA 1CDHA 2IGFH 4NHCL 3GJEB 3BHBA 5DEGA 5FFLA 5FCUH 3ROOB 1NCDH 2PXYD 4F8QA 2XT1B 2HJFA 3C6SB 2AXGB 4ONHB 1TETH 3V6ZA 4HJJL 5K93A 1I75A 1MCQA 3SDAA 4M5ZH 3IFOB 2P5EE 2HVJA 4X4YB 1T1WA 4LQFL 3QJHB 2EO1A 4OAWB 5TQ0L 5MENB 3O3DB 3FO2A 2VLKB 2LE9A 3B4NA 3AROA 1AGCB 3T1WA 3SO5A 1AXSA 5DJDA 2EZ0C 3EJJX 1BECA 3IDGA 3Q5TA 4JKLA 5FB8A 1T5WA 5HYSG 4LDOB 2XRAL 4U2ZA 1ACZA 1FVCB 1R3IL 2J6EH 3G9VA 3E8UL 3TH3T 5DFVD 5CZVL 3G5ZA 2VWEE 3D85A 1QBAA 3TCLB 4M03A 3BESR 1FFPA 2D4DA 2HFFA 4OQTH 4YGAB 3U46A 3DIFA 4ZOCA 4Y16D 4UMGA 3QBTB 3TC9A 1K9TA 4A6YA 4X4ME 5JHLL 4Q6IC 1RURH 3DRQB 3OGOE 5JXAL 2VR5A 5KJRH 2ENSA 4J3WA 3ARGC 3VRJB 3EJYC 3T4YA 2A6KA 4QHMA 3B9AA 3RWHA 3GIVA 5HVGB 4O2CA 3VWJC 1A6UH 5IMLB 2LFGA 1EJOL 2P8MB 4YHYC 2CLRB 2FWOB 5IMKA 1FAKT 5J12B 4M5YH 3HC4H 3Q6GL 5IKCA 4JFOB 2Z31D 1KXQE 3DVGA 1MCBA 5E2WL 2ARJQ 1A6ZA 4F2MB 5C0AE 1OSZA 3CFCL 1MCNA 3GMOB 3WJJA 1FH5H 3PWLA 1JPGA 3K0WA 4L4VB 4MVBD 3PDOB 5ICXB 2APXA 4PRIB 4MCYA 4GAFB 3RHWF 1KNOA 4J3TA 2X9XA 4RA0C 4U49A 1RZJC 1LO3H 5IQ7L 1JGLL 3BW9B 4JDTH 1YMHB 3LH2H 1BWWA 5C0CD 3S37H 4XX1E 1NFDB 2GJ6E 3NCCB 3QG6A 1T5WB 3BDBA 4XWOD 4PJBA 3IS1X 4X5LA 1S3KL 2VN4A 1OARL 2VLKA 3F7VB 5IR1B 1PLGL 2IQAB 2XN9A 5FGCE 3MJ9H 3MLSH 5GRJL 3CSGA 3FTGB 3MOBL 1DEEA 5HD8C 2D7NA 3FB7A 5F44A 4WGVB 5GS2D 3LN5B 1H5BB 3MA9H 1TCRA 5CJXC 3BIKA 3FQRB 3HE6C 4R26H 1CZ8H 4OZ4B 1JL8A 1XZ0B 4UIMA 1KN2H 4XMKH 3RUGE 3ZE1E 4LRIC 4LSUH 1JFQH 4ZQKA 5D2LB 1OP5K 5IVXB 3MRFB 1CTNA 4JJ5B 3MLWH 1T2QL 5EB9A 3QPXL 3VXTA 2NW2A 3QDGD 1Z3GL 2Y07H 1AY1L 1ZHNA 3AXLA 5FAAA 5TH2B 1CXKA 4KK6D 2BY0A 4ZUUB 5LAXA 3QUYC 1GC1C 1H3XA 3RWGB 3MXWL 4ZOEA 1XIWD 4JRXB 5FYKU 4YX2L 4YFDB 1BJ1J 3EFDL 1N3NA 5JLZA 4YBLB 4JZNA 5I6XB 1H8NA 3FQWB 1LO2H 1KJ2L 4XTRD 3SEPA 4R26L 2XKNA 4M1DL 3N1MC 4RGNE 5C09E 2YD2A 2FSEA 4LLAA 3QFJB 4KHXL 1RI8A 3BO8B 4JFXB 1G6RH 3T04D 4LPTA 1G9EA 3DRTA 3IVKB 3QPQC 2WP3T 4WW1A 2LABA 3MNVB 1OSPL 1EVTC 1DQQB 3HMWH 4OLYH 1S9XB 4WFFE 1ITBB 4X6FA 4XPBH 3HI5L 2OX5A 3O6MH 1P2CB 4ISVA 1ZHLB 5FYKH 1D6VH 4M4RA 5IBUG 3NOIA 1ES0B 3CPLA 1LO5B 2WINA 1B0GB 4RWYH 3OHXB 4KMQA 4YHIB 5C0IA 4CGTA 2X41A 3M17B 5A2JH 4P2QA 1F4HA 4PJAE 4DK6A 5BV7B 4AZ8A 3B2VH 5JOPE 3BEVB 5EULV 2KDGA 1T1ZB 5GRVK 5E7FA 3VI3F 2Q8AL 4K3HA 3QDME 5KVMC 5AEAA 5IF0A 3F5WA 4F15B 4PGEB 4WW2C 3MBEC 1SJEB 4KJQD 1WAAF 5HHQB 4ZAKD 1GPOL 5F6HJ 2C4XA 1ETZA 1L9MA 4DGIL 1XF3A 4FQJL 1CE6A 2IADA 2F5BH 5JOFA 5GZND 1S7VA 4HV8A 1QA9A 2VIRB 4UQ3B 4H25A 1SYVB 4GRLD 5A2FA 3QSKB 2HTLD 4NPYB 4TSBL 5FO7A 4JN1L 4JO3H 1CLZH 1JN6B 4U6YA 4H1LG 4PLKD 1OLZA 5J11C 5CMAB 1RY7B 4I3GA 4RMQA 1FN4A 1ZEAH 3LHPL 5C2BL 3CFKA 1KEMH 1RZJL 2AXFB 4K3JH 4IHOB 5C07D 4XPAH 5B8CC 2ICCA 1WFUA 3BQUB 4FQXD 1EO7A 3TPUA 3SKOB 3MLUL 4NUGL 4XNQA 1Z9LA 3GKWH 3QDJD 4QXWA 5IV2A 4XGZA 1Q0YL 4V1DB 2DICA 2UWEA 5BS0B 3RIFK 1FNFA 4CMHB 3D5OF 4NYLB 4LSSH 3NCJH 1I9JH 3H7BB 3LH2L 1C1EH 4PBXA 5EC1B 1EJ6A 1UT9A 1EX0A 2H41A 5B39G 2Z91A 3EYQC 2ZUWA 3D87B 1HH9A 1DBAH 4OFVA 3VFSA 1JPFA 1A8JH 3GNML 2DBLL 1AHWB 4ERSL 3RTQC 3TJHC 2R1XA 3N85L 5CZXD 3ZDXF 2D7OA 3FO9B 1OAZL 1ZHKA 4U7MA 4DK3A 5DMKA 1M7XA 4DWHA 2OI9B 4NKMB 5F8RC 1UM4L 3MODH 3V4VL 1MOEA 3C6SA 3A6CL 1PYWA 4U6YB 5IOPB 3DX7B 4Y4FB 2BMKA 3MROB 1EUTA 5EZLA 4R8WH 2RFXA 4ONGH 2ERJB 1VEPA 4Z7OF 3LRSA 5D7LA 5DURD 3GIZL 3JV6B 1BFVL 1OGAD 2R2CA 2XXCB 3QFDB 4Z7UF 2X4OB 4PJDF 1VGEH 2V7NB 1R24A 1VFOA 1BIIB 2WBKA 1DR9A 3UPRA 1F3JA 3DYOA 5I15L 2BK8A 4G5ZL 3QQ9D 3OGCB 4ODWB 4HJ0D 4E42A 2MCPL 4JREB 1E0OB 4GW1A 1GZQA 3MXWH 1SYSB 5KVFL 1ERNA 4MSWB 4NQSA 5DGRA 1T1ZA 3F6IA 4G3YL 5TGBA 3ESVF 5DF0A 3QDJB 1HHIB 3G5VB 1P4BL 2NZ9C 1P7QD 3K2UL 3KDMB 5C0FA 1F4WH 5FYLH 2ICWA 1ZVSA 3MRRB 3KPSA 5SWZA 1MRDH 3PUCA 4NZTH 4E41A 12E8L 1B6UA 3G6AB 3D0LA 4LCYB 2G9HA 43C9A 1QR4A 3VFNB 3U82B 3FT4B 3CX2A 2NXYD 3SDXF 4AJ0A 3HZVA 4PJIA 4HC1L 3FT4A 1QSEA 4WRLA 3UJTL 4X8JB 1M7IA 1IC5L 3SDYL 1F11B 2DM2A 1PQZB 4Z95L 5CIPA 1BGXL 4M8QB 4PJAF 1NGXB 1BHGA 3GJFH 4KY1L 3JUYA 3GSVB 2W91A 4GKNA 4LIQL 2D9QB 4XCNA 5F70A 1W0VA 1P6AB 5GS1C 1CDIA 1TENA 2ZSWA 5D2NB 1S7WB 2PXYC 4G42B 1WF5A 4LARL 1DQLL 1VCAA 2AJUL 3F7PC 4MWFB 4OKVB 1I7TA 5DVLA 3MFFA 3IKKA 1T1XB 5EU6B 5I75B 4NUJA 3OR6A 3OZ9H 1WCBB 2CDGB 2Z8WC 4GKSB 3CFEB 2E7LC 3JV6A 4WNQA 3GKZA 5C0AB 3SY0B 3DVFA 3QCVL 1WEJH 4HQQH 5KBNC 1MCOL 1SEQH 4LLMA 3D3VB 4KJPD 3DHJA 3DX7A 5EOQH 3QUXD 3UO1H 2R23A 4LU5L 3S34H 3TT3L 2F8VA 3O9WD 4RMVA 4IRJD 5C08D 2X9WA 1GYAA 3BXNB 3SDXA 4QXGL 3OKNA 4D3CH 4RAHA 3BIBX 2HJKB 4HXAL 4U4BA 2GJ6B 5BZDA 1YPZF 2CK0L 3SDCA 3CX5K 1H8SA 5C9JA 1KEML 4N1CA 3FTGA 4XCCH 2ATKB 5TDNB 4FMFA 5I1IL 4G8EA 3K2MC 4LPVA 1BEYH 2YC1B 1MCPH 3VGFA 1G7MA 1X5KA 1EAJA 4P48A 4QTHB 1Q1JH 4PGBA 1IAKA 1HQRA 1I1AC 4KTEH 5FYKE 2B7DT 4Y5VA 2A6JA 1IM9B 2ESVA 5I2IB 4WWKA 4HX1A 4OF6A 3P40A 3HG1D 5DRWB 3TBYB 2QL1A 1Y6MR 1EEUA 4OLEA 3FB8A 4P59L 4O9HL 3PGCB 2BZDA 3QULA 4HUWA 3SDAC 5IEHA 3QIUB 3SJVA 4PGDB 2YKLH 1JPGB 4RX4D 2DBLH 4LCWB 1ZVYA 4PJ9B 2C1PA 3FO0L 4DVBB 2QHRH 3O6KL 1U93B 2HJLA 4JFYA 4HWBL 4JFOA 4J1UB 2Y06H 5HXMA 1J1XL 4OB5H 4PR5A 1XCTB 2G2RA 3ILQD 5GRUH 3WFBL 4UUJA 3WSQH 4YGVA 3D39E 4PTUB 4OLVH 3BP6A 5FECA 1SYVA 5HI4D 3BZ4A 5DRNB 2YWZA 1P7HL 3T4YB 1VACA 3HI1A 5HHVL 4R7NB 3EKCA 1Z3GH 2Y07L 4JFDD 1CDCA 2HLAB 3MRPB 4JFFA 1BAFL 5LVEA 1F13A 1FC2D 1N59B 5IB5A 4F3FA 1EEQA 4G9DB 4NO0D 2MMXA 2FJGA 1QG3A 2NXZB 2W9EL 4Z7UB 4XP1L 5E2UL 2E6QA 1FAIH 1FFPB 4I3SL 1INEL 3VD3A 4XB7A 3PP4H 4KUZL 5E95B 4WFFD 3SDDC 2YKLL 3P0GB 4TSCH 5D5MA 3WJLC 3PQYB 4M1DH 5E94A 1CL7L 3K81A 1WICA 3P0YH 4XBPB 2BNQA 5JUEH 2AABH 4HWZA 3VXQA 1GC1L 4QRQA 3SKNB 1FZMA 3WUWB 1A7RL 3T77B 1HH6A 5F88A 1LO5A 5BMFL 4HUKB 4D0BA 1QSFD 3PGFL 3L5JA 2R39A 4UUJB 1JV5A 3AB0C 1T22A 4MA1B 4TVPH 4GAYB 1TIUA 2XTJB 2BOCB 1AP2A 2Q8AH 2EIBA 3I6KA 4XPTH 3GO1L 3MNVA 2EICA 5GGSB 2XWTA 3WDHA 1II4E 2P43B 4PRHD 3UJJL 5J11B 1RU9L 1NCWH 3ALWA 5CGTA 4YDJA 3LOWA 1D9KC 5JIKA 3ZTNL 5IEHB 4JFED 3K1DA 2CSPA 3OKKA 1MQKL 5KS9E 1CVRA 1QPPA 4HK0B 1RZFH 3QUKA 1VFAA 4HPYL 1JBJA 2I07A 3L5HA 3WFZA 4L29A 3RUGB 1HQRB 4QGYA 2E8YA 2ZG2A 2DQGL 1HIML 1HI6A 1PY9A 5JMRA 1G7MB 4AH2B 5D9SB 2R1WA 4G6ML 5DJ8B 4JM2A 4G8EB 4PY8J 1T0NA 4YXKL 2IPKB 1QPXA 3CSBA 3QEQD 4ZUWA 3TVMC 4O2FB 1ZA6B 3IAPA 1NDGA 3VXSB 3DO7B 4LSPH 4PJ7E 5D8JL 2G5BA 2FEEL 2M8XA 3VXMB 1IC7L 3OR7B 2LV4A 4HUUB 3S88L 1WVZA 3HS0B 1MRCL 3RGVB 4X6CF 4YFLI 4I9WD 4Y8AA 2ID5A 3GJFA 4ZPTB 4KRLB 4LGRB 1FO0B 2X9YA 3RJQB 1VHPA 1DLFL 4ELME 2ICEB 2DS4A 3QXUA 1XF4B 1ORSB 3L3GB 4TSAL 1MJJA 1OTSD 3BX7C 2W0FB 3LV3A 3WHE1 5J6HA 5FUOH 4DQOH 2DQEL 1QLFA 4JY6A 4XB8A 1J8HD 4YDKL 4R7DB 4P4RA 5I76A 1R3KB 2GSGB 3RAJL 5IG7A 5HPMA 1CLYH 4L8BB 2V9RA 4LCWE 2J88L 5E03A 1NAKL 3EGSA 3BWUC 4X98A 4NUJB 4P9HH 3MRBB 5I66A 2VXSL 1R3JA 1R5IB 3SGEH 3TEUA 3QQ4B 1XGRB 4NO0B 5K59E 2CO7B 4L3EE 3PNWB 4UDUB 3ZSTA 3HUJE 1YY9D 4D9LL 1AH1A 1VB9A 1IC7H 1J1PH 1EVUA 4QKXB 4UNTA 2Y36L 1BOGA 1T80A 4MNQB 4QXTB 5LKNA 1X44A 3RA7H 5KVEL 3IXAB 3WIIH 5DJ2B 1LDSA 1GGIH 3K8KA 5D5ME 2X5PA 4F2MA 3Q6FB 1X5ZA 4MA1C 5HYSB 3TPKA 4TSAH 4O51A 3S37X 2IWGA 4G5ZH 3KPMB 4XVSH 2VZVA 5L7XL 3FAXA 2P8MA 3GUTA 1RZIA 5DD6B 1RULH 1T1YA 1J0IA 2AK4D 5HGBB 4D0BB 1G9MC 3MMEA 4PV9B 5BJTB 4QHMB 1RUKL 3WUWA 2C4FU 4F7CB 4L8SB 5HGHA 1RZKC 1JZ3A 5GXBB 2NNAB 4IMKA 4Y19E 1DLHB 2H2SD 2R29H 3LSOA 2MTPA 5D7KD 5HHMB 3FZUC 3HG1B 4NQSB 1C08B 3QUZC 3O6FC 5F9WC 4D0DB 4B7IA 1S7RA 2DL2A 4JKKA 1NGPL 3K7UA 1J8KA 3DUUA 3O81A 3TV3H 1RJCA 3SE8L 3WIFA 3MV7D 1IM3B 1FG9C 1RK1A 2FX8H 1PVHA 1XH3B 3QFDA 2YPLA 4JPIB 1JK8B 1MFCH 4M62H 4OAWA 4GLRH 5HY9A 1PJ9A 4Y4KB 5KJRL 1KIQA 2NY0B 4PD4J 1T5XB 5I9QC 2OJZH 2CRMA 4P23D 2FIKB 2VLRD 1FGNH 4OD1L 1Q9WA 3LRHA 4H0GA 2FHFA 2IANE 1UM6H 3KVQA 1IEAA 1EJOH 4MLSA 3T0VA 2P8LB 3QUXB 3ARDA 5EO0A 4WI5A 3U7YL 1IC4H 1JI2A 1HQ4A 2X4NB 2OTUB 4DN3L 2V17H 4HWEL 1I4FA 2P4AB 5JORB 1RMFH 5K9OA 4B41A 1GPOH 4FABL 4F37K 2M1KA 2D31B 4KK9D 4QTIH 4JM4H 2PO6D 3VXME 5FUZL 4KTDH 1RZKH 4OUUA 5KANI 4XH2B 5IW1A 2ICES 3QI9A 1KT2A 3NZHH 1I1YB 4JPWH 3RI5F 3V5DB 1BF2A 2EDEA 3HE6A 3O4LB 3ARPA 3WE6A 4R6UA 5IB4A 3RL2A 3L3KA 4XGZB 5CHNB 1YJDC 5C0NC 5FDWB 2WWKO 3I02A 4PRBB 4HQQL 1CDBA 4HXBH 4PJCB 5I1KL 3K46A 2AV7A 1QFWH 5DD5L 3H6JA 3MR9B 4C56E 2UUDH 2BSRA 43CAA 5BZDB 3KJ4C 3L5WB 4XAKD 4NUGH 4PGCB 2BNRE 5AZEH 3BYYA 4K71B 4NBYB 3IDYC 1JHTB 3ILPB 4HWEH 1MRCH 4LLUA 3V6BR 2J12B 1G7HB 3X3FH 1F6AA 1VFMA 4LCCB 4GG8A 4Y5XA 1JZ2A 2UYLA 1E4XH 4BQBA 5JPMA 4QRUA 3C60A 2ZOKA 2NTFB 3MLZH 1EBPA 4OFKA 3HUJA 4KTDL 4YPJA 1AC6A 2WQRA 3WDIA 5FUOL 4GKSA 2YPVL 2VE6A 1EERB 1RIHL 1YMME 1IGJA 4HUXA 4ZSOB 4GJTB 1L6ZA 2YZ8A 3W0WE 2G5RA 4JAMB 1AGDB 2JB5L 3KYNB 3VRLE 4WO4B 4I4WA 1AGDA 1P4IL 5E4EB 3UBXG 1N4XH 3W5NA 4KI5C 3P4NA 1TNNA 4YQXL 3A6CH 1AGEB 5TE6H 2CKBB 4PJ8D 3M17A 3R06A 3WFHB 4D9LH 1LO2L 1NMAL 3QNXB 1N5AA 1MFEH 1BVZA 5I76B 5F3HA 4X8XA 3ZMRA 1BQHG 3QA3A 1KFAH 1H8OA 1NL0L 4H1LH 3INUH 2JK5A 4HIXH 4NRYB 4Q9CA 2R56L 2EDFA 4YO0B 4XPHH 4YHOH 3KYKH 4JM2C 2GY5A 2WMPA 1OWWA 1JIBA 3ZE1F 4EI5A 3OKOA 5EUOB 1OSPH 2R2EA 5DS8B 1H0DA 1FO0L 3PWUA 1IFHL 2D2OA 4KVCH 4Z7QE 1S7TA 1NGQL 2MCG1 1ED3B 2OXHA 3C5ZB 5FKPB 3I75A 1YEHL 2XYCA 4NCC2 4BSWA 4G6JL 5CGYD 2N4IA 1E4WH 1TITA 1GZPA 4LLQB 3QXWA 1X5FA 4U3CA 5DC0A 5T5NF 4EUPG 4IRSA 5FF6A 1JHLL 1YMMD 3MRCA 4OZHB 5CD5C 4CDHA 1PG7W 2X4UA 4ZTPH 3HE7C 2N7AA 3FT3A 1QKZH 1Q0XH 3TZVA 1OGTA 3MCLH 2DTSA 3U0WL 2ED9A 3QAZB 2XNAA 1MWAL 3MV9D 2NLJA 4PJXA 1V5JA 4K2UH 4Y2DC 3VDBA 5L9DL 2PW2A 3ARTA 4JR9L 3QEQB 3LQZA 2CR6A 5DD0H 4U0RB 2AW2A 2RFXB 3HHRB 2XFXA 1BGXH 1RFDL 5SWSB 1MQKH 1I3GL 1UWGL 3FRPG 5CJBA 5TE4L 1EHLL 2HMID 4YDJB 1MY7A 1A6VH 2N56A 3GSXA 1D5ZA 4HKBB 4FFZL 2R0ZH 3ZKSD 5DHYB 2A73B 2EDQA 3BPOC 4PB0H 5DJ6A 4YHZL 3U9PL 3LQMA 1U8PA 2QHLA 5ISZD 4N0FA 1DQJA 4X7SL 3ULUD 3IU3B 2JE8A 3P4MB 5CP7A 1S78C 4Y4KA 1YJDH 4U6HB 1T4KB 5CAYB 3TH2T 1NCDL 3NPSB 5DUML 3ZYJA 4U05A 3QQ3A 4W4OC 1U8KB 2G75A 3PWVB 2BNQB 4HIEB 4D9RD 1IKNA 4KK8D 4ELKB 4PRID 3GSWA 4XP9L 1KGCE 1WQVT 4TVPD 3GKWL 2F54A 2F53B 4PJGE 1MCWW 2J5LC 4BUHA 1PZ5B 1DLFH 4D0DA 1QVOB 3NFPA 1U8NB 4XZUB 4JFFB 3SCMB 2AV1A 4OZIB 5KSBB 1RIUL 4MA3B 4Q6IB 3ZZ1A 2P49B 4WI9A 3PWLB 4AT6A 2J6EA 1HHKA 5E2JA 3IKCB 3LKPA 4ZSOE 1WIUA 2NY5L 4KAQH 3VCLA 1V7NL 1KEGH 1W72H 3RU8H 1E27B 1NFIB 5GGVL 2ZUVA 1LMKA 4OV5A 4OZFB 3V4VH 2X1XR 4QT5A 4L3ED 4ODTH 5JW4Q 3KPRA 4I18B 4GG6A 2A2QT 1WIPA 2NY2B 1A6WH 2Q86A 5M94B 1KG0A 1T04A 1F00I 5K9KA 1WK0A 1XF3B 1QYGH 2EDHA 5E7BA 1NCBH 4MAYB 1Z9MA 2E6JA 2P42B 4X7SH 3U9UB 4YWGL 2ZPKL 1OAKH 4H20L 3GIZH 4NKDA 5I0DA 5T33H 4R0LC 3L9RB 2QHRL 2OQJA 5EBMA 3MRQB 2X89A 2IGFL 1G0YR 1RULL 3QWRD 1G6VK 2ADJB 1HYRC 1ZLVH 5D2NC 5F3BB 1S78D 1DTUA 3TNNB 4I3RH 3IDIB 2PCPA 5CZXC 5KVFH 4P4KA 1AGFA 4WI2A 1MJ8L 3OTTA 4HIJA 3S5LG 5GSRB 4QGTA 5BVJB 5TDNA 1CFQA 4DEPB 1HNGA 1LP9E 2DQJH 5C9JB 5ESVA 3QIBA 1ORSA 1P2CA 3L3GA 5DMGC 5I8KL 1K4DA 4GXVH 3IFOA 4P2OD 2K9UA 1AE6L 1RK0A 1U8MB 5C0CA 1MUJB 2Q86B 2D7PA 3DRTB 5ADPL 1IZKA 5I1GL 2YSSB 4ENEC 1DE4B 3TJEH 2EDDA 1I1AD 1UXSA 1TZGH 4LCUA 1INEH 4QOKA 2D9CA 3FB5A 1WBYB 1ZA6A 4MNHA 2IALB 4LVNC 5D1QA 1WZLA 4LBEB 4ZFOB 1A3RL 1WCQA 4M9OA 2BHYA 4OLWH 4ETQB 5CGYC 1HHHB 1ZANH 2X4RB 3ZDYF 4S2SB 2EDKA 4JFEE 5ID1A 3ZHLA 1CGSL 2VABB 4LSRH 1TZHB 2WV3A 1C7TA 4BK5A 3FN3A 1YNLL 3VGEA 1FGVL 4G43B 4PJEE 3W2DH 4KRMB 3QFJE 3QDMD 4HEME 4UQ2A 2AJUH 4P3DA 2E9IA 1TTUA 5IEKB 3OZ9L 2Q7YB 1SVZA 3C2SA 1RMFL 3IRZA 3U0TA 4OLZL 3U1SH 2O61A 2RCSH 2HFGH 1K8IA 1A02N 1U58B 3QDMA 4JY4A 2OMBA 3BZFA 5AUMA 1MLBB 2RIKA 4N8CL 3MJ9A 1MI5D 1TVBA 3G9AB 2V2WB 3U7YH 4PJGA 4ZFZA 4I8DA 2EECA 1A64A 4N5ED 4FQIH 1UQSB 3O4LE 1RJZA 3N85H 3WXWL 2OL3B 1UB5B 3GSRB 3LKRB 4JO2H 4WI3A 4DKEH 1IGML 2YA0A 4K8RL 4BFEA 3KS0J 1CGWA 4Q9RH 2ICWB 1TZGL 5I16A 1A7PH 3PIQA 4U1IA 3QG6B 5CEZH 2QSCH 2ADJA 4CKVX 2BXYA 3ARBB 3FCTA 1LNUA 5DO2D 5IIEA 5CGMA 1B4JH 5C0JB 1E6JL 4Z7VB 5CD3A 5H8DA 3DV6A 5D72H 3LQAH 5I1LA 3BKCH 2Q8BH 5CEYB 3KLSA 4YC2B 4YHNA 5ICYB 2J8UF 4WO4D 4M48L 3WFCH 2YOCA 1HOCB 4OCMC 4E9LA 4F80A 5EC2A 2YPVH 5TQ2H 4M61B 3FAWA 2E9JA 1OCWH 5D7LD 2MCPH 1BOYA 1MAKA 4WUUE 2VNCA 3RVTD 5FA4B 4U1LB 1NUFA 3MV11 2CLRA 2FWOA 3KJ6L 4P0DA 1NFIA 3SKJH 5JQHC 3UP1A 3V7AE 1IKNC 3CK0H 3DETC 4JFHD 1N4XL 4ZS6D 4DOHB 3OKOB 3T0BA 2ZCLL 4EI5B 4QHUA 2NY7L 2XTJC 1X7QB 2Q3AA 1BVKA 4OUOA 3CCHB 3OXRB 4OIIL 4B50A 2CRYA 5EZIH 3RWEB 5AZ2H 4U1KB 5HHVH 2Y36H 3TBSA 3B6SA 4QY8B 2Q8BL 1MLCB 4MMXC 2HT4D 4KRNA 5ETUB 1KELH 4RNRA 2Z91B 1YEEL 2HH0L 1IM9A 2ESVB 1QRNA 2QSTA 5BVPL 3DX9B 3GGWA 4RGND 5IQ9A 3NTCL 3GSWB 4JDVA 1DUZA 4A6YL 2AJZA 2VDKL 2W9EH 1CWVA 4OT1L 4PPTA 3B9VA 1CR9H 4KQ3H 2HT2C 2VISA 5ID0A 3VFRA 4TULL 3Q1SL 3V5HB 3RKDD 4DKAA 2ADGA 5IV2B 4ONOA 4UOJA 4NNXA 4LHJB 4FFWD 2XV6B 2Y7QA 3JV0A 2DQJL 4UV7L 2WBJB 2DMBA 1YEKL 3LKNA 1J0YA 5DHYA 2BY2A 1A7NH 2NTSP 2CDEA 4CU6A 4P57A 3GJEA 1HILA 5JPMB 1WFTA 2V5SA 4X7TB 1JN6A 4ODVH 3PHOA 1JVKA 5B38B 2R1YA 4XC1H 1HILB 5C0DB 3CH8A 3LEVH 1IQDA 4XMLL 4ACPA 2P8PB 1KCSH 4ZPVA 4UQ3A 2NY5C 2VDNL 4KHTL 3I6LD 4KKBC 3BWAB 3TFKC 3WBDA 1MFCL 5GGVY 5C6PB 2A83B 3HB3C 4D3CL 1T1XA 4N1EA 4PRBA 3ELAT 4HFWA 4LSQH 4YHZH 4JPKL 4Y5XC 4LSRL 2QR0B 4QYOA 1IGFL 3V5HA 1LP9A 4OLUL 5D7JA 3BJLA 1F45A 2YD5A 5KOMC 3SO3B 4IRJA 5C08A 4UU9B 3ARXA 1KJVA 3BGFC 3PG2A 3V95A 4LGPB 2ZCKH 2C4FT 5IK3B 3O0RL 2HKFL 5HDOA 3RVWD 1A6AA 2V5TA 3OF6A 1S7SB 1ZHBA 5SX4I 1NGXA 3JV4B 4XPAL 1EFXD 3B6SB 3MLUH 2JIXA 4DUXA 2WNGA 2VLJA 1F6FB 5FHBL 5EU4B 3E6FA 4O2EB 3ZE0F 2UZXB 1XF2B 3MGAA 5F9JA 2FR4A 1S9XA 3ZDXE 3R0MA 5FGBA 3DROB 3QIWA 4JZJB 3HC4L 3L3OA 4J7RA 1E6OL 1HSBB 4K3DL 2NZIA 2JB6B 4KROC 5CWSB 5ACLA 1B88A 3NFSL 8FABB 15C8H 2B2XL 3P77B 1T2QH 2X4QB 3H0TA 3A6BH 4PB9L 3QFJA 2W65A 2F8OA 3JTTA 1YN6A 1WC7A 4OLUH 3BPNB 1U8OA 2H2PD 4JHWH 3ZYZA 2YD8A 2FYYB 2IAMC 5KAQF 3QEQE 2IJ0C 3MOQA 1CFBA 3U83A 4GT7A 4FQPA 3MRGA 1YECL 2J8UE 5HI4C 4LP4A 1M6OB 3EO0A 4APQB 4GAJL 4X7TA 4JRXA 4XCFL 4FTVB 3V52L 4ODHH 3U4BH 4XMPL 3CLEH 5C0GA 1KJ2H 3RKPA 5C3TA 1AFVL 3MREA 3FFDB 4NM8H 2BRQA 3VXTB 2HT3C 5ISZA 1FPTH 3MUGA 3QUYB 1LNUB 1ZWIB 1GGIL 3ULSA 2PYFB 1BM3L 2BY1A 2DI8A 3IJHA 3MA7A 1TJIH 4XCYA 1NUNB 3C2AH 2ADGB 4BKLB 1U8HB 3O3BA 4NO5A 4WCYH 1O7VA 1NANH 4GOSA 5BW7A 5FYKL 3W0WA 1CS6A 2DYPD 1WV7T 4PJGB 4ZFZB 3GUTB 4C54A 3FB7B 3SE9L 1JPFB 1TMCB 2X40A 4MAUL 1D5XB 4M6AA 2AK1L 3KYMB 1HSAB 2UY7A 4YBHA 3PE9A 1OP3H 4FFYL 1G9NH 1U42A 1YEJH 5IJKC 3K2UH 3GO1H 5ANME 4U1KA 6CGTA 4OF7A 1G7IA 1NBYA 3QH3A 5FKAA 3WFDH 3U0TB 5CLTA 3KPOA 2H9GB 4FZ8H 3X12A 4IMLB 2HKHL 4J8RB 3GGWB 2PUQT 4NOBA 4AIOA 2MSPA 2OM5A 5IMMA 3BGFB 1BD2A 3W0WD 3EYQD 3IDXH 1Q9OA 4TNVK 1N7MH 3M1BA 5MP6H 2W07A 3WXVH 3TBSB 3BD3A 3KXFD 3VD5A 4KDVA 4EOWH 5JHDA 1YNKH 3GMPB 4HPYH 4MCYB 4PJHB 3ULVL 3PJSA 1JGEA 1T2JA 2AXFA 3D69B 3MLPA 4XNXL 5IG7B 4GBXD 5A16B 4QHUB 1QR1B 1P5UA 3T1FB 1P4LB 3MUJA 3EJZC 3QNZB 3VFUA 1I7UB 5L6YH 3ULUL 1XGQB 3HR6A 4NZUH 2KH2B 4ODBD 4ZTOH 5DWUH 1L7IL 3O8XA 1IMHC 4PLNC 1F42A 4EDXB 1AO7B 2Z35B 1DE4A 3W39A 3SCMD 3AMKA 4P4KD 4AMKL 3MLSL 2IADB 5GRJH 4XI5D 3U4EB 4PJIF 4PJDA 4NN6B 4NP4H 3CDFA 4PRHE 4K9EL 3UBXI 1UKTA 3DO7A 4FNLL 5F7UA 5FOBB 3TBVB 1SJEA 2YN5A 2H32B 2F53D 3VFVB 1LQSR 1EMTH 1EK3A 4MAUH 5LCVH 4Z0BL 3DV6B 4FFYH 1BFSA 2EYRA 1NLDH 4XHJD 4ZFGL 1AO7D 2GT9B 3GB7A 4HKJB 4LPCA 3RGVD 3FQNB 5F3BA 3NZHL 4YZFE 1QBLH 1HNFA 4U1IB 2P46B 4Q0XH 1WFOA 4JANB 3U2SA 2VLJD 3VFWA 4HULB 3VXRA 5HGAB 1HYSC 1UGNA 5CUSL 5DVNA 2VXQH 2EYSB 3KPLB 3O3AB 1RJZB 2O61B 3IS0X 5DMIL 1QFWL 3QPQD 3OX8A 3NMEA 5E8EB 1T21A 3GSQA 3JZ7A 5HHNA 5D7JC 3EO1A 3N0PB 2HVKA 3WNNA 1MCFA 5GZOC 2MQCA 4Q97A 3VWJA 4OCNC 4U1HB 3E3QE 3V4PL 1OW0C 2N7BA 1H5BC 5DFVC 1G7QA 1RUMH 3SE4C 3VMNA 3BJ91 4UILH 3RPIA 4R2GD 3X14A 3D39D 4LHUB 1P9MC 3U48A 4OKDA 5DZOA 3AS3A 3L3IB 4GRWE 4ZFFB 1Q0YH 3MRNB 1U8QB 1N8ZB 3BPLC 5C86A 1YDPA 3HNTH 3QYCA 1J18A 1LD9B 3QIWC 4G80A 2APWA 2BSED 3GSNA 5I1EH 1FRGL 1MEXL 2FGWH 7FABL 4PYGA 3CLFH 2Q6WB 1S7QA 1DUYB 4ZFGH 3LV3B 3E6HA 3RVUD 2R69L 4MNHB 3VA6A 3MPCA 1NJ9A 1NMAH 2CH8A 4OBRA 5DJYA 2YXMA 4MQXD 2C3GA 1KFAL 1NL0H 2EEDA 4N5EC 2PCPB 3WLWD 4F9LA 5E8PA 4Y1AA 2X4PA 5L2JA 4JFZL 5F7EL 1S3KH 3VFTB 4UZGA 5IESL 1HHJA 4O4YL 1BMGA 1UJ3C 3KYKL 1XIWA 4HPOH 3L9RA 4WJ5A 1QRKA 3C8HA 2ORBL 3H9HA 5EIIA 2OR8A 4Y4FC 4JDZA 3UBXB 1NMCC 4HCRL 1C5DA 4PJBB 4PLKC 2BCKA 4MAYA 3QDHA 1KJ2A 2BXZA 4YBQC 4IIQC 3CSPA 4LSUL 1T04B 3ESUF 3STZA 5E56A 4GW5A 4RZCB 2GSIB 5I1AA 2Q76A 1RAMA 3BKYH 4M1GL 3MRMB 3TO4C 5EU6D 1N2RB 2GUOB 4OZFA 5DLMH 3QO1B 2V2XB 3LEVL 3N9GL 2APTA 4NGHH 4MXQD 1AIFB 3ZHDA 3MCG1 2YC1A 1MCOH 1SEQL 3O11B 3KHQA 7FABH 1GGBL 4XHJC 4S10A 1UWGH 3O6FA 4LVEA 1YEKH 3EO1B 4LDEB 5GSVA 3VXRE 1FP5A 5IJKA 4AY0A 3RZCA 4P3CH 3MV8B 4E5XB 2ZNXA 3UZVB 1U2CA 4XZUA 3SCMA 5B3NA 5J7CC 4UNVA 1FLRH 1CICC 1QRND 4OV5B 4Y19B 1U8NA 2AXJA 3RA7L 3WNKA 4HC1H 3VRIA 1WT5C 5I8EA 1QD0A 1T3FB 2BFVH 5T1KB 4U7SA 3WO4C 5FUCE 4DTGH 4GBXB 1PDKA 2A6KB 3VRJA 1I3VA 2VH5H 5A40E 3ARFB 3LS4H 4MA7H 4Q74A 5BXFB 4EDWL 5DK0A 3VXUA 2NXYB 4XBPA 2H9GA 3X12B 4Y16B 4L5FH 1V3LA 5I17A 5IHZA 5GS3A 2MPAL 5CJOL 1V05A 2AV1B 3PWVA 1SEBB 3D2UB 5SWSD 3F12A 4OV6F 3ES6A 4U7KA 4H26A 3FL7A 5A1AA 2HFFB 3PHQB 3V9FA 4KK8C 2JJTA 1CXFA 2FJGB 4YH6A 1EAPB 5E9DE 2Y5TB 3LIZH 5FXCH 5D5MF 2VLKD 5CBEB 4D9RE