5I8FA

Crystal structure of st. john's wort hyp-1 protein in complex with melatonin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
164
structure length
164
Chain Sequence
IDPFTMAAYTIVKEEESPIAPHRLFKALVLERHQVLVKAQPHVFKSGEIIEGDGGVGTVTKITFVDGHPLTYMLHKFDEIDAANFYCKYTLFEGDVLRDNIEKVVYEVKLEAVGGGSKGKITVTYHPKPGCTVNEEEVKIGEKKAYEFYKQVEEYLAANPEVFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenolic oxidative coupling protein
publication title Crystal Structure of Hyp-1, a Hypericum perforatum PR-10 Protein, in Complex with Melatonin.
pubmed doi rcsb
source organism Hypericum perforatum
molecule tags Plant protein
total genus 46
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2016-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00407 Bet_v_1 Pathogenesis-related protein Bet v I family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.530.20 Alpha Beta 2-Layer Sandwich Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 5i8fA00
3W9KA 2LIOA 2E3OA 2BK0A 5AMWA 3TVQA 4GY9A 1E09A 1XFSA 2VNEA 1EM2A 4BKDA 1Z94A 2N4BA 4FPWA 4IGYA 1LN3A 3KDJA 2KEWA 2KCZA 3IJTA 2MOUA 3KL1A 3Q6AA 4A85A 1QMRA 2I9YA 2LUZA 2IL5A 3ELIA 2E3NA 4RYVA 1B6FA 1XUVA 4XRWA 3KB3A 1XN5A 2RERA 1FM4A 4C94A 5E4MA 1JSSA 4Q0KA 4R7KA 3H3TA 4DSCA 3OH8A 2L65A 3QSZA 3CNWA 3UIDA 2LAKA 3RT2A 3QN1A 2M89A 2R55A 4A81A 5I8FA 5JNNA 4A80A 4JHGA 3JRQB 3OJIA 5JO1A 1T27A 3UJLA 2E3PA 1UW5A 2KTEA 3PUTA 2EJXA 2Q3QA 3IE5A 5C9YA 2KF2A 3NEGA 5JO2A 2GKDA 1KCMA 4LG5A 2LEQA 4PSBA 2Z9YA 5BRLA 4A88A 1XN6A 3E85A 2E3QA 3NMNA 2E3RA 3H3RA 2K7HA 3KLXA 4REIA 4OICA 2PSOA 4IHRA 2L9PA 5E4BA 3TVRA 2E3SA 1VJHA 1XDFA 3ZVUA 2WQLA 3KAZA 4IGWA 3NMHA 3FO5A 1ICXA 1X53A 4N3EA 4A84A 4A8GA 4MNSA 2FLHA 4JDAA 1LN2A 4M9WA 3KAYA 3H3SA 3NR4A 4C9IA 2Z9ZA 2M47A 4A83A 1IFVA 3NJOA 3R6PA 3GGNA 4A8UA 4JHHA 2NS9A 4XRTA 3P0LA 4BKCA 3K90A 1BV1A 3KDIA 4LA7A 2QPVA 4BK6A 3C0VA 3Q64A 3TL1A 1H2OA 2E3MA 4WVOA 4BK7A 3F08A 4IH2A 5I9JA 3P51A 4REHA 4A86A 1BTVA 1LLTA 3H3QA 3NEFA 3K3KA 3NMTA 3P9VA 4N0GC 3RT0C 3PU2A 3OQUA 2LGHA 3NJ0A 2LCGA 4IH0A 4JHIA 3RD6A 1LN1A 4A8VA 4IGXA 4LGBA 3Q63A 1T17A 2D4RA 2FFSA 2REZA 2VQ5A 4IGVA 4JDLA 4MA6A 4REJA 1TXCA 4MAPA 1TW0A 2LDKA 5E46A 3NS2A 4B9RA 4DSBA 3NMVA 4BTZA 3KB0A 2A1LA 2NN5A 2QIMA 3KDHA 3NI8A 3OTLA 2K5GA 3W9RA 4LGAA 1FSKA 1ZXFA 4Y31A 2LPXA 2RESA 4DS8A 3UQHA 2L8OA 3TFZA 3JRSA 5E4DA 3NMPA 2N4AA 4C9CA 4QIPA 2LF2A 4Z3LA 3WG8A 4A87A 4M9BA 2PCSA 3NJ1A 2LE1A
chains in the Genus database with same CATH superfamily
3W9KA 2LIOA 2E3OA 2BK0A 5AMWA 4QDDA 3TVQA 4GY9A 1E09A 1XFSA 2VNEA 1EM2A 4BKDA 1Z94A 2N4BA 3HM9A 4FPWA 4IGYA 1LN3A 3KDJA 2KEWA 2KCZA 3IJTA 2MOUA 3KL1A 3GTEA 4NCAA 3Q6AA 4A85A 1QMRA 2I9YA 2LUZA 2IL5A 3ELIA 2E3NA 3GOBA 4RYVA 1B6FA 1XUVA 3HVRA 4XRWA 3KB3A 1XN5A 2RERA 1FM4A 4C94A 5E4MA 1JSSA 4Q0KA 4R7KA 3H3TA 4DSCA 3OH8A 2L65A 3QSZA 3CNWA 3UIDA 2LAKA 3RT2A 3F73A 3QN1A 2M89A 2R55A 4A81A 5I8FA 5JNNA 4A80A 3GB4A 4N41A 4JHGA 3JRQB 3OJIA 4JHYA 5JO1A 1T27A 3UJLA 4E6FA 2E3PA 1UW5A 2KTEA 3PUTA 3TGOC 2EJXA 2Q3QA 3IE5A 5C9YA 2KF2A 2LAFA 3NEGA 5JO2A 2GKDA 1KCMA 4LG5A 2LEQA 4PSBA 2Z9YA 5BRLA 2ZYLA 1XN6A 3E85A 4A88A 2E3QA 3NMNA 2E3RA 3H3RA 2K7HA 3GL2A 3KLXA 4REIA 4N76A 4OICA 2PSOA 4IHRA 2L9PA 5E4BA 3TVRA 2E3SA 1VJHA 1XDFA 3ZVUA 2WQLA 3KAZA 4IGWA 3NMHA 3FO5A 1ICXA 1X53A 4N3EA 4A84A 4QDFA 4A8GA 4MNSA 2FLHA 4JDAA 1LN2A 4M9WA 3GKEA 3KAYA 3H3SA 3NQNA 3HXMA 3DLHA 3HO1A 3NR4A 4C9IA 2Z9ZA 2M47A 4A83A 1IFVA 3NJOA 3R6PA 3GGNA 4A8UA 4JHHA 2NS9A 4XRTA 3P0LA 4BKCA 3K90A 1BV1A 3HJFA 3KDIA 4LA7A 2QPVA 4BK6A 3C0VA 3Q64A 3TL1A 4Z3LA 1H2OA 2E3MA 4WVOA 4BK7A 3F08A 4IH2A 5I9JA 3P51A 4REHA 4A86A 1BTVA 1LLTA 3H3QA 3NEFA 3K3KA 3NMTA 3P9VA 4N0GC 3RT0C 3GL0A 3PU2A 3OQUA 2LGHA 3NJ0A 2LCGA 4IH0A 3DLBA 4JHIA 3RD6A 1LN1A 4A8VA 4IGXA 4LGBA 3Q63A 1T17A 2D4RA 2FFSA 2REZA 2VQ5A 4IGVA 4JDLA 4MA6A 4QDFB 4REJA 1TXCA 4MAPA 1TW0A 2LDKA 5E46A 3NS2A 4KPYA 4N47A 4B9RA 4DSBA 3NMVA 4BTZA 3KB0A 2A1LA 2NN5A 2QIMA 3KDHA 3NI8A 3OTLA 2K5GA 4QDCA 3W9RA 4LGAA 1FSKA 2YH6A 1ZXFA 3GTSA 4Y31A 5EKQC 2LPXA 2RESA 4DS8A 3UQHA 2L8OA 3TFZA 3HK2A 3JRSA 5E4DA 3NMPA 2N4AA 4NCBA 4C9CA 4QIPA 2LF2A 4QCKA 3WG8A 4A87A 4M9BA 2PCSA 3NJ1A 2LE1A
chains in the Genus database with same CATH topology
3W9KA 2LIOA 2E3OA 2BK0A 5AMWA 4QDDA 3TVQA 4GY9A 1E09A 1XFSA 2VNEA 1EM2A 4BKDA 1Z94A 2N4BA 3HM9A 4FPWA 4IGYA 1LN3A 3KDJA 2KEWA 2KCZA 3IJTA 2MOUA 3KL1A 3GTEA 4NCAA 3Q6AA 4A85A 1QMRA 2I9YA 2LUZA 2IL5A 3ELIA 2E3NA 3GOBA 4RYVA 1B6FA 1XUVA 3HVRA 4XRWA 3KB3A 1XN5A 2RERA 1FM4A 4C94A 5E4MA 1JSSA 4Q0KA 4R7KA 3H3TA 4DSCA 3OH8A 2L65A 3QSZA 3CNWA 3UIDA 2LAKA 3RT2A 3F73A 3QN1A 2M89A 2R55A 4A81A 5I8FA 5JNNA 4A80A 3GB4A 4N41A 4JHGA 3JRQB 3OJIA 4JHYA 5JO1A 1T27A 3UJLA 4E6FA 2E3PA 1UW5A 2KTEA 3PUTA 3TGOC 2EJXA 2Q3QA 3IE5A 5C9YA 2KF2A 2LAFA 3NEGA 5JO2A 2GKDA 1KCMA 4LG5A 2LEQA 4PSBA 2Z9YA 5BRLA 2ZYLA 1XN6A 3E85A 4A88A 2E3QA 3NMNA 2E3RA 3H3RA 2K7HA 3GL2A 3KLXA 4REIA 4N76A 4OICA 2PSOA 4IHRA 2L9PA 5E4BA 3TVRA 2E3SA 1VJHA 1XDFA 3ZVUA 2WQLA 3KAZA 4IGWA 3NMHA 3FO5A 1ICXA 1X53A 4N3EA 4A84A 4QDFA 4A8GA 4MNSA 2FLHA 4JDAA 1LN2A 4M9WA 3GKEA 3KAYA 3H3SA 3NQNA 3HXMA 3DLHA 3HO1A 3NR4A 4C9IA 2Z9ZA 2M47A 4A83A 1IFVA 3NJOA 3R6PA 3GGNA 4A8UA 4JHHA 2NS9A 4XRTA 3P0LA 4BKCA 3K90A 1BV1A 3HJFA 3KDIA 4LA7A 2QPVA 4BK6A 3C0VA 3Q64A 3TL1A 4Z3LA 1H2OA 2E3MA 4WVOA 4BK7A 3F08A 4IH2A 5I9JA 3P51A 4REHA 4A86A 1BTVA 1LLTA 3H3QA 3NEFA 3K3KA 3NMTA 3P9VA 4N0GC 3RT0C 3GL0A 3PU2A 3OQUA 2LGHA 3NJ0A 2LCGA 4IH0A 3DLBA 4JHIA 3RD6A 1LN1A 4A8VA 4IGXA 4LGBA 3Q63A 1T17A 2D4RA 2FFSA 2REZA 2VQ5A 4IGVA 4JDLA 4MA6A 4QDFB 4REJA 1TXCA 4MAPA 1TW0A 2LDKA 5E46A 3NS2A 4KPYA 4N47A 4B9RA 4DSBA 3NMVA 4BTZA 3KB0A 2A1LA 2NN5A 2QIMA 3KDHA 3NI8A 3OTLA 2K5GA 4QDCA 3W9RA 4LGAA 1FSKA 2YH6A 1ZXFA 3GTSA 4Y31A 5EKQC 2LPXA 2RESA 4DS8A 3UQHA 2L8OA 3TFZA 3HK2A 3JRSA 5E4DA 3NMPA 2N4AA 4NCBA 4C9CA 4QIPA 2LF2A 4QCKA 3WG8A 4A87A 4M9BA 2PCSA 3NJ1A 2LE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W9K A;  2LIO A;  2E3O A;  2BK0 A;  5AMW A;  3TVQ A;  4GY9 A;  1E09 A;  1XFS A;  2VNE A;  1EM2 A;  4BKD A;  1Z94 A;  2N4B A;  4FPW A;  4IGY A;  1LN3 A;  3KDJ A;  2KEW A;  2KCZ A;  3IJT A;  2MOU A;  3KL1 A;  3Q6A A;  4A85 A;  1QMR A;  2I9Y A;  2LUZ A;  2IL5 A;  3ELI A;  2E3N A;  4RYV A;  1B6F A;  1XUV A;  4XRW A;  3KB3 A;  1XN5 A;  2RER A;  1FM4 A;  4C94 A;  5E4M A;  1JSS A;  4Q0K A;  4R7K A;  3H3T A;  4DSC A;  3OH8 A;  2L65 A;  3QSZ A;  3CNW A;  3UID A;  2LAK A;  3RT2 A;  3QN1 A;  2M89 A;  2R55 A;  4A81 A;  5I8F A;  5JNN A;  4A80 A;  4JHG A;  3JRQ B;  3OJI A;  5JO1 A;  1T27 A;  3UJL A;  2E3P A;  1UW5 A;  2KTE A;  3PUT A;  2EJX A;  2Q3Q A;  3IE5 A;  5C9Y A;  2KF2 A;  3NEG A;  5JO2 A;  2GKD A;  1KCM A;  4LG5 A;  2LEQ A;  4PSB A;  2Z9Y A;  5BRL A;  4A88 A;  1XN6 A;  3E85 A;  2E3Q A;  3NMN A;  2E3R A;  3H3R A;  2K7H A;  3KLX A;  4REI A;  4OIC A;  2PSO A;  4IHR A;  2L9P A;  5E4B A;  3TVR A;  2E3S A;  1VJH A;  1XDF A;  3ZVU A;  2WQL A;  3KAZ A;  4IGW A;  3NMH A;  3FO5 A;  1ICX A;  1X53 A;  4N3E A;  4A84 A;  4A8G A;  4MNS A;  2FLH A;  4JDA A;  1LN2 A;  4M9W A;  3KAY A;  3H3S A;  3NR4 A;  4C9I A;  2Z9Z A;  2M47 A;  4A83 A;  1IFV A;  3NJO A;  3R6P A;  3GGN A;  4A8U A;  4JHH A;  2NS9 A;  4XRT A;  3P0L A;  4BKC A;  3K90 A;  1BV1 A;  3KDI A;  4LA7 A;  2QPV A;  4BK6 A;  3C0V A;  3Q64 A;  3TL1 A;  1H2O A;  2E3M A;  4WVO A;  4BK7 A;  3F08 A;  4IH2 A;  5I9J A;  3P51 A;  4REH A;  4A86 A;  1BTV A;  1LLT A;  3H3Q A;  3NEF A;  3K3K A;  3NMT A;  3P9V A;  4N0G C;  3RT0 C;  3PU2 A;  3OQU A;  2LGH A;  3NJ0 A;  2LCG A;  4IH0 A;  4JHI A;  3RD6 A;  1LN1 A;  4A8V A;  4IGX A;  4LGB A;  3Q63 A;  1T17 A;  2D4R A;  2FFS A;  2REZ A;  2VQ5 A;  4IGV A;  4JDL A;  4MA6 A;  4REJ A;  1TXC A;  4MAP A;  1TW0 A;  2LDK A;  5E46 A;  3NS2 A;  4B9R A;  4DSB A;  3NMV A;  4BTZ A;  3KB0 A;  2A1L A;  2NN5 A;  2QIM A;  3KDH A;  3NI8 A;  3OTL A;  2K5G A;  3W9R A;  4LGA A;  1FSK A;  1ZXF A;  4Y31 A;  2LPX A;  2RES A;  4DS8 A;  3UQH A;  2L8O A;  3TFZ A;  3JRS A;  5E4D A;  3NMP A;  2N4A A;  4C9C A;  4QIP A;  2LF2 A;  4Z3L A;  3WG8 A;  4A87 A;  4M9B A;  2PCS A;  3NJ1 A;  2LE1 A; 
#chains in the Genus database with same CATH topology
 3W9K A;  2LIO A;  2E3O A;  2BK0 A;  5AMW A;  4QDD A;  3TVQ A;  4GY9 A;  1E09 A;  1XFS A;  2VNE A;  1EM2 A;  4BKD A;  1Z94 A;  2N4B A;  3HM9 A;  4FPW A;  4IGY A;  1LN3 A;  3KDJ A;  2KEW A;  2KCZ A;  3IJT A;  2MOU A;  3KL1 A;  3GTE A;  4NCA A;  3Q6A A;  4A85 A;  1QMR A;  2I9Y A;  2LUZ A;  2IL5 A;  3ELI A;  2E3N A;  3GOB A;  4RYV A;  1B6F A;  1XUV A;  3HVR A;  4XRW A;  3KB3 A;  1XN5 A;  2RER A;  1FM4 A;  4C94 A;  5E4M A;  1JSS A;  4Q0K A;  4R7K A;  3H3T A;  4DSC A;  3OH8 A;  2L65 A;  3QSZ A;  3CNW A;  3UID A;  2LAK A;  3RT2 A;  3F73 A;  3QN1 A;  2M89 A;  2R55 A;  4A81 A;  5I8F A;  5JNN A;  4A80 A;  3GB4 A;  4N41 A;  4JHG A;  3JRQ B;  3OJI A;  4JHY A;  5JO1 A;  1T27 A;  3UJL A;  4E6F A;  2E3P A;  1UW5 A;  2KTE A;  3PUT A;  3TGO C;  2EJX A;  2Q3Q A;  3IE5 A;  5C9Y A;  2KF2 A;  2LAF A;  3NEG A;  5JO2 A;  2GKD A;  1KCM A;  4LG5 A;  2LEQ A;  4PSB A;  2Z9Y A;  5BRL A;  2ZYL A;  1XN6 A;  3E85 A;  4A88 A;  2E3Q A;  3NMN A;  2E3R A;  3H3R A;  2K7H A;  3GL2 A;  3KLX A;  4REI A;  4N76 A;  4OIC A;  2PSO A;  4IHR A;  2L9P A;  5E4B A;  3TVR A;  2E3S A;  1VJH A;  1XDF A;  3ZVU A;  2WQL A;  3KAZ A;  4IGW A;  3NMH A;  3FO5 A;  1ICX A;  1X53 A;  4N3E A;  4A84 A;  4QDF A;  4A8G A;  4MNS A;  2FLH A;  4JDA A;  1LN2 A;  4M9W A;  3GKE A;  3KAY A;  3H3S A;  3NQN A;  3HXM A;  3DLH A;  3HO1 A;  3NR4 A;  4C9I A;  2Z9Z A;  2M47 A;  4A83 A;  1IFV A;  3NJO A;  3R6P A;  3GGN A;  4A8U A;  4JHH A;  2NS9 A;  4XRT A;  3P0L A;  4BKC A;  3K90 A;  1BV1 A;  3HJF A;  3KDI A;  4LA7 A;  2QPV A;  4BK6 A;  3C0V A;  3Q64 A;  3TL1 A;  4Z3L A;  1H2O A;  2E3M A;  4WVO A;  4BK7 A;  3F08 A;  4IH2 A;  5I9J A;  3P51 A;  4REH A;  4A86 A;  1BTV A;  1LLT A;  3H3Q A;  3NEF A;  3K3K A;  3NMT A;  3P9V A;  4N0G C;  3RT0 C;  3GL0 A;  3PU2 A;  3OQU A;  2LGH A;  3NJ0 A;  2LCG A;  4IH0 A;  3DLB A;  4JHI A;  3RD6 A;  1LN1 A;  4A8V A;  4IGX A;  4LGB A;  3Q63 A;  1T17 A;  2D4R A;  2FFS A;  2REZ A;  2VQ5 A;  4IGV A;  4JDL A;  4MA6 A;  4QDF B;  4REJ A;  1TXC A;  4MAP A;  1TW0 A;  2LDK A;  5E46 A;  3NS2 A;  4KPY A;  4N47 A;  4B9R A;  4DSB A;  3NMV A;  4BTZ A;  3KB0 A;  2A1L A;  2NN5 A;  2QIM A;  3KDH A;  3NI8 A;  3OTL A;  2K5G A;  4QDC A;  3W9R A;  4LGA A;  1FSK A;  2YH6 A;  1ZXF A;  3GTS A;  4Y31 A;  5EKQ C;  2LPX A;  2RES A;  4DS8 A;  3UQH A;  2L8O A;  3TFZ A;  3HK2 A;  3JRS A;  5E4D A;  3NMP A;  2N4A A;  4NCB A;  4C9C A;  4QIP A;  2LF2 A;  4QCK A;  3WG8 A;  4A87 A;  4M9B A;  2PCS A;  3NJ1 A;  2LE1 A; 
#chains in the Genus database with same CATH homology
 3W9K A;  2LIO A;  2E3O A;  2BK0 A;  5AMW A;  4QDD A;  3TVQ A;  4GY9 A;  1E09 A;  1XFS A;  2VNE A;  1EM2 A;  4BKD A;  1Z94 A;  2N4B A;  3HM9 A;  4FPW A;  4IGY A;  1LN3 A;  3KDJ A;  2KEW A;  2KCZ A;  3IJT A;  2MOU A;  3KL1 A;  3GTE A;  4NCA A;  3Q6A A;  4A85 A;  1QMR A;  2I9Y A;  2LUZ A;  2IL5 A;  3ELI A;  2E3N A;  3GOB A;  4RYV A;  1B6F A;  1XUV A;  3HVR A;  4XRW A;  3KB3 A;  1XN5 A;  2RER A;  1FM4 A;  4C94 A;  5E4M A;  1JSS A;  4Q0K A;  4R7K A;  3H3T A;  4DSC A;  3OH8 A;  2L65 A;  3QSZ A;  3CNW A;  3UID A;  2LAK A;  3RT2 A;  3F73 A;  3QN1 A;  2M89 A;  2R55 A;  4A81 A;  5I8F A;  5JNN A;  4A80 A;  3GB4 A;  4N41 A;  4JHG A;  3JRQ B;  3OJI A;  4JHY A;  5JO1 A;  1T27 A;  3UJL A;  4E6F A;  2E3P A;  1UW5 A;  2KTE A;  3PUT A;  3TGO C;  2EJX A;  2Q3Q A;  3IE5 A;  5C9Y A;  2KF2 A;  2LAF A;  3NEG A;  5JO2 A;  2GKD A;  1KCM A;  4LG5 A;  2LEQ A;  4PSB A;  2Z9Y A;  5BRL A;  2ZYL A;  1XN6 A;  3E85 A;  4A88 A;  2E3Q A;  3NMN A;  2E3R A;  3H3R A;  2K7H A;  3GL2 A;  3KLX A;  4REI A;  4N76 A;  4OIC A;  2PSO A;  4IHR A;  2L9P A;  5E4B A;  3TVR A;  2E3S A;  1VJH A;  1XDF A;  3ZVU A;  2WQL A;  3KAZ A;  4IGW A;  3NMH A;  3FO5 A;  1ICX A;  1X53 A;  4N3E A;  4A84 A;  4QDF A;  4A8G A;  4MNS A;  2FLH A;  4JDA A;  1LN2 A;  4M9W A;  3GKE A;  3KAY A;  3H3S A;  3NQN A;  3HXM A;  3DLH A;  3HO1 A;  3NR4 A;  4C9I A;  2Z9Z A;  2M47 A;  4A83 A;  1IFV A;  3NJO A;  3R6P A;  3GGN A;  4A8U A;  4JHH A;  2NS9 A;  4XRT A;  3P0L A;  4BKC A;  3K90 A;  1BV1 A;  3HJF A;  3KDI A;  4LA7 A;  2QPV A;  4BK6 A;  3C0V A;  3Q64 A;  3TL1 A;  4Z3L A;  1H2O A;  2E3M A;  4WVO A;  4BK7 A;  3F08 A;  4IH2 A;  5I9J A;  3P51 A;  4REH A;  4A86 A;  1BTV A;  1LLT A;  3H3Q A;  3NEF A;  3K3K A;  3NMT A;  3P9V A;  4N0G C;  3RT0 C;  3GL0 A;  3PU2 A;  3OQU A;  2LGH A;  3NJ0 A;  2LCG A;  4IH0 A;  3DLB A;  4JHI A;  3RD6 A;  1LN1 A;  4A8V A;  4IGX A;  4LGB A;  3Q63 A;  1T17 A;  2D4R A;  2FFS A;  2REZ A;  2VQ5 A;  4IGV A;  4JDL A;  4MA6 A;  4QDF B;  4REJ A;  1TXC A;  4MAP A;  1TW0 A;  2LDK A;  5E46 A;  3NS2 A;  4KPY A;  4N47 A;  4B9R A;  4DSB A;  3NMV A;  4BTZ A;  3KB0 A;  2A1L A;  2NN5 A;  2QIM A;  3KDH A;  3NI8 A;  3OTL A;  2K5G A;  4QDC A;  3W9R A;  4LGA A;  1FSK A;  2YH6 A;  1ZXF A;  3GTS A;  4Y31 A;  5EKQ C;  2LPX A;  2RES A;  4DS8 A;  3UQH A;  2L8O A;  3TFZ A;  3HK2 A;  3JRS A;  5E4D A;  3NMP A;  2N4A A;  4NCB A;  4C9C A;  4QIP A;  2LF2 A;  4QCK A;  3WG8 A;  4A87 A;  4M9B A;  2PCS A;  3NJ1 A;  2LE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...