5I8UA

Crystal structure of the rv1700 (mt adprase) e142q mutant
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
203
structure length
198
Chain Sequence
DFETISSETLHTGAIFALRRDQVRMPGGGIVTREVVEHFGAVAIVAMDDNGNIPMVYQYRHTYGRRLWELPAGLLDVAGEPPHLTAARELREEVGLQASTWQVLVDLDTAPGFSDESVRVYLATGLREVGREQADMTMGWYPIAEAARRVLRGEIVNSIAIAGVLAVHAVTTGFAQPRPLDTEWIDRPTAFAARRAER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribose pyrophosphatase
publication title Kinetic and mutational studies of the adenosine diphosphate ribose hydrolase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Hydrolase
total genus 43
structure length 198
sequence length 203
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.6.1.13: ADP-ribose diphosphatase.
pdb deposition date 2016-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 5i8uA00
5FSKA 1G9QA 3EXQA 2QJTA 1HX3A 3EESA 1V8NA 3A6VA 3FJYA 1V8TA 1RYAA 4C9XA 4K6EA 5GHIA 1SJYA 3FCMA 3CNGA 1Q54A 4V14A 3DUPA 5DDGA 1VHGA 1VCDA 3WHWA 3H95A 4ZG0A 2PNYA 5C7QA 3BAPA 5GHJA 3KVHA 1HZTA 2J8QA 1NQYA 3Q2TA 3O52A 1GA7A 1V8SA 1KTGA 4KG4A 2ICJA 1SOIA 2VNQA 3X0MA 5CFJA 3X0NA 3Q1PA 3MGMA 3SHDA 2O5FA 4HFQA 2DSCA 2B2KA 4N1TA 4N1UA 3ZR1A 1RRSA 1IRYA 1JRKA 1V8MA 2CL3A 1PPXA 4DYWA 5LPGA 3A6TA 3R03A 1PUSA 3O8SA 5HZXA 3I9XA 3P5TA 1X83A 3MDIA 3F13A 4S2VA 4NFXA 1TUMA 1VC8A 3O6ZA 5DD4A 2RRKA 5BS6A 1PUQA 5ANWA 1V8UA 4JZSA 1XSAA 4S2WA 5FSMA 2YVMA 2GT4A 3L85A 4HVYA 3X0RA 5GHMA 2G74A 2YVOA 4C9WA 2PQVA 2YYHA 2A6TA 3OGAA 5DPKA 3I7UA 3FSPA 4JZUA 4YPRA 2XSQA 1Q33A 1V8IA 1K2EA 2QJOA 3A6UA 5ANUA 5ANTA 3X0IA 5ISYA 1JKNA 1V8VA 1PUNA 3X0QA 1X84A 5FSLA 1Q27A 1F3YA 2KDVA 2YVPA 1V8RA 1VRLA 1MP2A 5FSNA 1OW2A 2QKMB 1MQEA 1PPVA 2YVNA 1SU2A 3X0SA 4KTBA 3P6YA 2W4EA 1R67A 5DEQA 5GHPA 3SONA 1V8YA 1MK1A 3N77A 5GHQA 5CFIA 5C8LA 1VK6A 3QSJA 4YPHA 4YOQA 1VHZA 2ICKA 3N9UA 3FK9A 3GZ5A 3O61A 3Q93A 2KDWA 4ILQA 1MR2A 3Q91A 3G0QA 2DSDA 1VC9A 3GZ6A 4JZVA 5GHOA 1KHZA 2A8PA 3Q2SA 1VIUA 5ANSA 1RRQA 1PVFA 2A8SA 2I8UA 2R5WA 2I6KA 2JVBA 3HHJA 4JZTA 1I9AA 4MPOA 4S2YA 3X0OA 2O5WA 2DHOA 1XSCA 3ID9A 2A8TA 3RH7A 5FSOA 1NFSA 1V8WA 1KT9A 2I8TA 3BM4A 3I7VA 4ICKA 1X51A 2FVVA 2VNPA 2A8QA 3EF5A 4KYXA 2GB5A 1U20A 1NQZA 3ACAA 3EEUA 2G73A 2O1CA 3F6AA 3U53A 2B0VA 5IW5A 3FFUA 2Q9PA 3X0PA 1NFZA 3J7Ye 1XSBA 5BONA 3X0JA 1PPWA 2FKBA 3SMDA 2GT2A 5IW4A 3COUA 2B06A 1MQWA 3GG6A 3Q4IA 5C7TA 2AZWA 1V8LA 1G0SA 4IJXA 3ZR0A 3GRNA 3HYQA 4KG3A 1K26A 3X0LA 3X0KA 5I8UA 3A6SA 4S2XA 1SZ3A 2DUKA 5FSIA 3GZ8A 5ANVA 3MDGA 4NFWA 3MCFA 2DSBA 2FMLA 3AC9A 1VIQA 3BHOA 2A8RA 5GHNA 1MUTA 1QVJA 3O69A 3DKUA 3GWYA 3E57A
chains in the Genus database with same CATH superfamily
5FSKA 1G9QA 3EXQA 2QJTA 1HX3A 3EESA 1V8NA 3A6VA 3FJYA 1V8TA 1RYAA 4C9XA 4K6EA 5GHIA 1SJYA 3FCMA 3CNGA 1Q54A 4V14A 3DUPA 2CZRA 5DDGA 1VHGA 1VCDA 3WHWA 3H95A 4ZG0A 2PNYA 5C7QA 3BAPA 5GHJA 3KVHA 1HZTA 2J8QA 1NQYA 3Q2TA 3O52A 1GA7A 1V8SA 1KTGA 4KG4A 2ICJA 1SOIA 2VNQA 3X0MA 5CFJA 3X0NA 3Q1PA 3MGMA 3SHDA 2O5FA 4HFQA 2DSCA 2B2KA 4N1TA 4N1UA 3ZR1A 1RRSA 1IRYA 1JRKA 1V8MA 2CL3A 1PPXA 4DYWA 5LPGA 3A6TA 3R03A 1PUSA 3O8SA 5HZXA 3I9XA 3P5TA 1X83A 3MDIA 3F13A 4S2VA 4NFXA 1TUMA 1VC8A 3O6ZA 5DD4A 2RRKA 5BS6A 1PUQA 5ANWA 1V8UA 4JZSA 1XSAA 4S2WA 5FSMA 2YVMA 2GT4A 3L85A 4HVYA 3X0RA 5GHMA 2G74A 2YVOA 4C9WA 2PQVA 2YYHA 2A6TA 3OGAA 5DPKA 3I7UA 3FSPA 4JZUA 4YPRA 2XSQA 1Q33A 1V8IA 1K2EA 2QJOA 3A6UA 5ANUA 5ANTA 3X0IA 5ISYA 1JKNA 1V8VA 1PUNA 3X0QA 1X84A 5FSLA 1Q27A 1F3YA 2KDVA 2YVPA 1V8RA 1VRLA 1MP2A 5FSNA 1OW2A 2QKMB 1MQEA 1PPVA 2YVNA 1SU2A 3X0SA 4KTBA 3P6YA 2W4EA 1R67A 5DEQA 5GHPA 3SONA 1V8YA 1MK1A 3N77A 5GHQA 5CFIA 5C8LA 1VK6A 3QSJA 4YPHA 4YOQA 1VHZA 2ICKA 3N9UA 3FK9A 3GZ5A 3O61A 3Q93A 2KDWA 4ILQA 4J7GA 1MR2A 3Q91A 3G0QA 2DSDA 1VC9A 3GZ6A 4JZVA 5GHOA 1KHZA 2A8PA 3Q2SA 1VIUA 5ANSA 1RRQA 1PVFA 2A8SA 2I8UA 2R5WA 2I6KA 2JVBA 3HHJA 4JZTA 1I9AA 4MPOA 4S2YA 3X0OA 2O5WA 2DHOA 1XSCA 3ID9A 2A8TA 3RH7A 4J7HA 5FSOA 1NFSA 1V8WA 1KT9A 2I8TA 3BM4A 3I7VA 4ICKA 1X51A 2FVVA 2VNPA 2A8QA 3EF5A 4KYXA 2GB5A 1U20A 1NQZA 3ACAA 3EEUA 2G73A 2O1CA 3F6AA 3U53A 2B0VA 5IW5A 3FFUA 2Q9PA 3X0PA 1NFZA 3J7Ye 1XSBA 5BONA 3X0JA 1PPWA 2FKBA 3SMDA 2GT2A 5IW4A 3COUA 2B06A 1MQWA 3GG6A 3Q4IA 5C7TA 2AZWA 1V8LA 1G0SA 4IJXA 3ZR0A 3GRNA 3HYQA 4KG3A 1K26A 3X0LA 3X0KA 5I8UA 3A6SA 4S2XA 1SZ3A 2DUKA 5FSIA 3GZ8A 5ANVA 3MDGA 4NFWA 3MCFA 2DSBA 2FMLA 3AC9A 1VIQA 3BHOA 2A8RA 5GHNA 1MUTA 1QVJA 3O69A 3DKUA 3GWYA 3E57A
chains in the Genus database with same CATH topology
5FSKA 1G9QA 3EXQA 2QJTA 1HX3A 3EESA 1V8NA 3A6VA 3FJYA 1V8TA 1RYAA 4C9XA 4K6EA 5GHIA 1SJYA 3FCMA 3CNGA 1Q54A 4V14A 3DUPA 2CZRA 5DDGA 1VHGA 1VCDA 3WHWA 3H95A 4ZG0A 2PNYA 5C7QA 3BAPA 5GHJA 3KVHA 1HZTA 2J8QA 1NQYA 3Q2TA 3O52A 1GA7A 1V8SA 1KTGA 4KG4A 2ICJA 1SOIA 2VNQA 3X0MA 5CFJA 3X0NA 3Q1PA 3MGMA 3SHDA 2O5FA 4HFQA 2DSCA 2B2KA 4N1TA 4N1UA 3ZR1A 1RRSA 1IRYA 1JRKA 1V8MA 2CL3A 1PPXA 4DYWA 5LPGA 3A6TA 3R03A 1PUSA 3O8SA 5HZXA 3I9XA 3P5TA 1X83A 3MDIA 3F13A 4S2VA 4NFXA 1TUMA 1VC8A 3O6ZA 5DD4A 2RRKA 5BS6A 1PUQA 5ANWA 1V8UA 4JZSA 1XSAA 4S2WA 5FSMA 2YVMA 2GT4A 3L85A 4HVYA 3X0RA 5GHMA 2G74A 2YVOA 4C9WA 2PQVA 2YYHA 2A6TA 3OGAA 5DPKA 3I7UA 3FSPA 4JZUA 4YPRA 2XSQA 1Q33A 1V8IA 1K2EA 2QJOA 3A6UA 5ANUA 5ANTA 3X0IA 5ISYA 1JKNA 1V8VA 1PUNA 3X0QA 1X84A 5FSLA 1Q27A 1F3YA 2KDVA 2YVPA 1V8RA 1VRLA 1MP2A 5FSNA 1OW2A 2QKMB 1MQEA 1PPVA 2YVNA 1SU2A 3X0SA 4KTBA 3P6YA 2W4EA 1R67A 5DEQA 5GHPA 3SONA 1V8YA 1MK1A 3N77A 5GHQA 5CFIA 5C8LA 1VK6A 3QSJA 4YPHA 4YOQA 1VHZA 2ICKA 3N9UA 3FK9A 3GZ5A 3O61A 3Q93A 2KDWA 4ILQA 4J7GA 1MR2A 3Q91A 3G0QA 2DSDA 1VC9A 3GZ6A 4JZVA 5GHOA 1KHZA 2A8PA 3Q2SA 1VIUA 5ANSA 1RRQA 1PVFA 2A8SA 2I8UA 2R5WA 2I6KA 2JVBA 3HHJA 4JZTA 1I9AA 4MPOA 4S2YA 3X0OA 2O5WA 2DHOA 1XSCA 3ID9A 2A8TA 3RH7A 4J7HA 5FSOA 1NFSA 1V8WA 1KT9A 2I8TA 3BM4A 3I7VA 4ICKA 1X51A 2FVVA 2VNPA 2A8QA 3EF5A 4KYXA 2GB5A 1U20A 1NQZA 3ACAA 3EEUA 2G73A 2O1CA 3F6AA 3U53A 2B0VA 5IW5A 3FFUA 2Q9PA 3X0PA 1NFZA 3J7Ye 1XSBA 5BONA 3X0JA 1PPWA 2FKBA 3SMDA 2GT2A 5IW4A 3COUA 2B06A 1MQWA 3GG6A 3Q4IA 5C7TA 2AZWA 1V8LA 1G0SA 4IJXA 3ZR0A 3GRNA 3HYQA 4KG3A 1K26A 3X0LA 3X0KA 5I8UA 3A6SA 4S2XA 1SZ3A 2DUKA 5FSIA 3GZ8A 5ANVA 3MDGA 4NFWA 3MCFA 2DSBA 2FMLA 3AC9A 1VIQA 3BHOA 2A8RA 5GHNA 1MUTA 1QVJA 3O69A 3DKUA 3GWYA 3E57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSK A;  1G9Q A;  3EXQ A;  2QJT A;  1HX3 A;  3EES A;  1V8N A;  3A6V A;  3FJY A;  1V8T A;  1RYA A;  4C9X A;  4K6E A;  5GHI A;  1SJY A;  3FCM A;  3CNG A;  1Q54 A;  4V14 A;  3DUP A;  5DDG A;  1VHG A;  1VCD A;  3WHW A;  3H95 A;  4ZG0 A;  2PNY A;  5C7Q A;  3BAP A;  5GHJ A;  3KVH A;  1HZT A;  2J8Q A;  1NQY A;  3Q2T A;  3O52 A;  1GA7 A;  1V8S A;  1KTG A;  4KG4 A;  2ICJ A;  1SOI A;  2VNQ A;  3X0M A;  5CFJ A;  3X0N A;  3Q1P A;  3MGM A;  3SHD A;  2O5F A;  4HFQ A;  2DSC A;  2B2K A;  4N1T A;  4N1U A;  3ZR1 A;  1RRS A;  1IRY A;  1JRK A;  1V8M A;  2CL3 A;  1PPX A;  4DYW A;  5LPG A;  3A6T A;  3R03 A;  1PUS A;  3O8S A;  5HZX A;  3I9X A;  3P5T A;  1X83 A;  3MDI A;  3F13 A;  4S2V A;  4NFX A;  1TUM A;  1VC8 A;  3O6Z A;  5DD4 A;  2RRK A;  5BS6 A;  1PUQ A;  5ANW A;  1V8U A;  4JZS A;  1XSA A;  4S2W A;  5FSM A;  2YVM A;  2GT4 A;  3L85 A;  4HVY A;  3X0R A;  5GHM A;  2G74 A;  2YVO A;  4C9W A;  2PQV A;  2YYH A;  2A6T A;  3OGA A;  5DPK A;  3I7U A;  3FSP A;  4JZU A;  4YPR A;  2XSQ A;  1Q33 A;  1V8I A;  1K2E A;  2QJO A;  3A6U A;  5ANU A;  5ANT A;  3X0I A;  5ISY A;  1JKN A;  1V8V A;  1PUN A;  3X0Q A;  1X84 A;  5FSL A;  1Q27 A;  1F3Y A;  2KDV A;  2YVP A;  1V8R A;  1VRL A;  1MP2 A;  5FSN A;  1OW2 A;  2QKM B;  1MQE A;  1PPV A;  2YVN A;  1SU2 A;  3X0S A;  4KTB A;  3P6Y A;  2W4E A;  1R67 A;  5DEQ A;  5GHP A;  3SON A;  1V8Y A;  1MK1 A;  3N77 A;  5GHQ A;  5CFI A;  5C8L A;  1VK6 A;  3QSJ A;  4YPH A;  4YOQ A;  1VHZ A;  2ICK A;  3N9U A;  3FK9 A;  3GZ5 A;  3O61 A;  3Q93 A;  2KDW A;  4ILQ A;  1MR2 A;  3Q91 A;  3G0Q A;  2DSD A;  1VC9 A;  3GZ6 A;  4JZV A;  5GHO A;  1KHZ A;  2A8P A;  3Q2S A;  1VIU A;  5ANS A;  1RRQ A;  1PVF A;  2A8S A;  2I8U A;  2R5W A;  2I6K A;  2JVB A;  3HHJ A;  4JZT A;  1I9A A;  4MPO A;  4S2Y A;  3X0O A;  2O5W A;  2DHO A;  1XSC A;  3ID9 A;  2A8T A;  3RH7 A;  5FSO A;  1NFS A;  1V8W A;  1KT9 A;  2I8T A;  3BM4 A;  3I7V A;  4ICK A;  1X51 A;  2FVV A;  2VNP A;  2A8Q A;  3EF5 A;  4KYX A;  2GB5 A;  1U20 A;  1NQZ A;  3ACA A;  3EEU A;  2G73 A;  2O1C A;  3F6A A;  3U53 A;  2B0V A;  5IW5 A;  3FFU A;  2Q9P A;  3X0P A;  1NFZ A;  3J7Y e;  1XSB A;  5BON A;  3X0J A;  1PPW A;  2FKB A;  3SMD A;  2GT2 A;  5IW4 A;  3COU A;  2B06 A;  1MQW A;  3GG6 A;  3Q4I A;  5C7T A;  2AZW A;  1V8L A;  1G0S A;  4IJX A;  3ZR0 A;  3GRN A;  3HYQ A;  4KG3 A;  1K26 A;  3X0L A;  3X0K A;  5I8U A;  3A6S A;  4S2X A;  1SZ3 A;  2DUK A;  5FSI A;  3GZ8 A;  5ANV A;  3MDG A;  4NFW A;  3MCF A;  2DSB A;  2FML A;  3AC9 A;  1VIQ A;  3BHO A;  2A8R A;  5GHN A;  1MUT A;  1QVJ A;  3O69 A;  3DKU A;  3GWY A;  3E57 A; 
#chains in the Genus database with same CATH topology
 5FSK A;  1G9Q A;  3EXQ A;  2QJT A;  1HX3 A;  3EES A;  1V8N A;  3A6V A;  3FJY A;  1V8T A;  1RYA A;  4C9X A;  4K6E A;  5GHI A;  1SJY A;  3FCM A;  3CNG A;  1Q54 A;  4V14 A;  3DUP A;  2CZR A;  5DDG A;  1VHG A;  1VCD A;  3WHW A;  3H95 A;  4ZG0 A;  2PNY A;  5C7Q A;  3BAP A;  5GHJ A;  3KVH A;  1HZT A;  2J8Q A;  1NQY A;  3Q2T A;  3O52 A;  1GA7 A;  1V8S A;  1KTG A;  4KG4 A;  2ICJ A;  1SOI A;  2VNQ A;  3X0M A;  5CFJ A;  3X0N A;  3Q1P A;  3MGM A;  3SHD A;  2O5F A;  4HFQ A;  2DSC A;  2B2K A;  4N1T A;  4N1U A;  3ZR1 A;  1RRS A;  1IRY A;  1JRK A;  1V8M A;  2CL3 A;  1PPX A;  4DYW A;  5LPG A;  3A6T A;  3R03 A;  1PUS A;  3O8S A;  5HZX A;  3I9X A;  3P5T A;  1X83 A;  3MDI A;  3F13 A;  4S2V A;  4NFX A;  1TUM A;  1VC8 A;  3O6Z A;  5DD4 A;  2RRK A;  5BS6 A;  1PUQ A;  5ANW A;  1V8U A;  4JZS A;  1XSA A;  4S2W A;  5FSM A;  2YVM A;  2GT4 A;  3L85 A;  4HVY A;  3X0R A;  5GHM A;  2G74 A;  2YVO A;  4C9W A;  2PQV A;  2YYH A;  2A6T A;  3OGA A;  5DPK A;  3I7U A;  3FSP A;  4JZU A;  4YPR A;  2XSQ A;  1Q33 A;  1V8I A;  1K2E A;  2QJO A;  3A6U A;  5ANU A;  5ANT A;  3X0I A;  5ISY A;  1JKN A;  1V8V A;  1PUN A;  3X0Q A;  1X84 A;  5FSL A;  1Q27 A;  1F3Y A;  2KDV A;  2YVP A;  1V8R A;  1VRL A;  1MP2 A;  5FSN A;  1OW2 A;  2QKM B;  1MQE A;  1PPV A;  2YVN A;  1SU2 A;  3X0S A;  4KTB A;  3P6Y A;  2W4E A;  1R67 A;  5DEQ A;  5GHP A;  3SON A;  1V8Y A;  1MK1 A;  3N77 A;  5GHQ A;  5CFI A;  5C8L A;  1VK6 A;  3QSJ A;  4YPH A;  4YOQ A;  1VHZ A;  2ICK A;  3N9U A;  3FK9 A;  3GZ5 A;  3O61 A;  3Q93 A;  2KDW A;  4ILQ A;  4J7G A;  1MR2 A;  3Q91 A;  3G0Q A;  2DSD A;  1VC9 A;  3GZ6 A;  4JZV A;  5GHO A;  1KHZ A;  2A8P A;  3Q2S A;  1VIU A;  5ANS A;  1RRQ A;  1PVF A;  2A8S A;  2I8U A;  2R5W A;  2I6K A;  2JVB A;  3HHJ A;  4JZT A;  1I9A A;  4MPO A;  4S2Y A;  3X0O A;  2O5W A;  2DHO A;  1XSC A;  3ID9 A;  2A8T A;  3RH7 A;  4J7H A;  5FSO A;  1NFS A;  1V8W A;  1KT9 A;  2I8T A;  3BM4 A;  3I7V A;  4ICK A;  1X51 A;  2FVV A;  2VNP A;  2A8Q A;  3EF5 A;  4KYX A;  2GB5 A;  1U20 A;  1NQZ A;  3ACA A;  3EEU A;  2G73 A;  2O1C A;  3F6A A;  3U53 A;  2B0V A;  5IW5 A;  3FFU A;  2Q9P A;  3X0P A;  1NFZ A;  3J7Y e;  1XSB A;  5BON A;  3X0J A;  1PPW A;  2FKB A;  3SMD A;  2GT2 A;  5IW4 A;  3COU A;  2B06 A;  1MQW A;  3GG6 A;  3Q4I A;  5C7T A;  2AZW A;  1V8L A;  1G0S A;  4IJX A;  3ZR0 A;  3GRN A;  3HYQ A;  4KG3 A;  1K26 A;  3X0L A;  3X0K A;  5I8U A;  3A6S A;  4S2X A;  1SZ3 A;  2DUK A;  5FSI A;  3GZ8 A;  5ANV A;  3MDG A;  4NFW A;  3MCF A;  2DSB A;  2FML A;  3AC9 A;  1VIQ A;  3BHO A;  2A8R A;  5GHN A;  1MUT A;  1QVJ A;  3O69 A;  3DKU A;  3GWY A;  3E57 A; 
#chains in the Genus database with same CATH homology
 5FSK A;  1G9Q A;  3EXQ A;  2QJT A;  1HX3 A;  3EES A;  1V8N A;  3A6V A;  3FJY A;  1V8T A;  1RYA A;  4C9X A;  4K6E A;  5GHI A;  1SJY A;  3FCM A;  3CNG A;  1Q54 A;  4V14 A;  3DUP A;  2CZR A;  5DDG A;  1VHG A;  1VCD A;  3WHW A;  3H95 A;  4ZG0 A;  2PNY A;  5C7Q A;  3BAP A;  5GHJ A;  3KVH A;  1HZT A;  2J8Q A;  1NQY A;  3Q2T A;  3O52 A;  1GA7 A;  1V8S A;  1KTG A;  4KG4 A;  2ICJ A;  1SOI A;  2VNQ A;  3X0M A;  5CFJ A;  3X0N A;  3Q1P A;  3MGM A;  3SHD A;  2O5F A;  4HFQ A;  2DSC A;  2B2K A;  4N1T A;  4N1U A;  3ZR1 A;  1RRS A;  1IRY A;  1JRK A;  1V8M A;  2CL3 A;  1PPX A;  4DYW A;  5LPG A;  3A6T A;  3R03 A;  1PUS A;  3O8S A;  5HZX A;  3I9X A;  3P5T A;  1X83 A;  3MDI A;  3F13 A;  4S2V A;  4NFX A;  1TUM A;  1VC8 A;  3O6Z A;  5DD4 A;  2RRK A;  5BS6 A;  1PUQ A;  5ANW A;  1V8U A;  4JZS A;  1XSA A;  4S2W A;  5FSM A;  2YVM A;  2GT4 A;  3L85 A;  4HVY A;  3X0R A;  5GHM A;  2G74 A;  2YVO A;  4C9W A;  2PQV A;  2YYH A;  2A6T A;  3OGA A;  5DPK A;  3I7U A;  3FSP A;  4JZU A;  4YPR A;  2XSQ A;  1Q33 A;  1V8I A;  1K2E A;  2QJO A;  3A6U A;  5ANU A;  5ANT A;  3X0I A;  5ISY A;  1JKN A;  1V8V A;  1PUN A;  3X0Q A;  1X84 A;  5FSL A;  1Q27 A;  1F3Y A;  2KDV A;  2YVP A;  1V8R A;  1VRL A;  1MP2 A;  5FSN A;  1OW2 A;  2QKM B;  1MQE A;  1PPV A;  2YVN A;  1SU2 A;  3X0S A;  4KTB A;  3P6Y A;  2W4E A;  1R67 A;  5DEQ A;  5GHP A;  3SON A;  1V8Y A;  1MK1 A;  3N77 A;  5GHQ A;  5CFI A;  5C8L A;  1VK6 A;  3QSJ A;  4YPH A;  4YOQ A;  1VHZ A;  2ICK A;  3N9U A;  3FK9 A;  3GZ5 A;  3O61 A;  3Q93 A;  2KDW A;  4ILQ A;  4J7G A;  1MR2 A;  3Q91 A;  3G0Q A;  2DSD A;  1VC9 A;  3GZ6 A;  4JZV A;  5GHO A;  1KHZ A;  2A8P A;  3Q2S A;  1VIU A;  5ANS A;  1RRQ A;  1PVF A;  2A8S A;  2I8U A;  2R5W A;  2I6K A;  2JVB A;  3HHJ A;  4JZT A;  1I9A A;  4MPO A;  4S2Y A;  3X0O A;  2O5W A;  2DHO A;  1XSC A;  3ID9 A;  2A8T A;  3RH7 A;  4J7H A;  5FSO A;  1NFS A;  1V8W A;  1KT9 A;  2I8T A;  3BM4 A;  3I7V A;  4ICK A;  1X51 A;  2FVV A;  2VNP A;  2A8Q A;  3EF5 A;  4KYX A;  2GB5 A;  1U20 A;  1NQZ A;  3ACA A;  3EEU A;  2G73 A;  2O1C A;  3F6A A;  3U53 A;  2B0V A;  5IW5 A;  3FFU A;  2Q9P A;  3X0P A;  1NFZ A;  3J7Y e;  1XSB A;  5BON A;  3X0J A;  1PPW A;  2FKB A;  3SMD A;  2GT2 A;  5IW4 A;  3COU A;  2B06 A;  1MQW A;  3GG6 A;  3Q4I A;  5C7T A;  2AZW A;  1V8L A;  1G0S A;  4IJX A;  3ZR0 A;  3GRN A;  3HYQ A;  4KG3 A;  1K26 A;  3X0L A;  3X0K A;  5I8U A;  3A6S A;  4S2X A;  1SZ3 A;  2DUK A;  5FSI A;  3GZ8 A;  5ANV A;  3MDG A;  4NFW A;  3MCF A;  2DSB A;  2FML A;  3AC9 A;  1VIQ A;  3BHO A;  2A8R A;  5GHN A;  1MUT A;  1QVJ A;  3O69 A;  3DKU A;  3GWY A;  3E57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...