5I97A

Structural analysis and inhibition of trae from the pkm101 type iv secretion system
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
TRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSKFKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNAEQRYVNPLGFRVTSYRVNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis and Inhibition of TraE from the pKM101 Type IV Secretion System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
molecule keywords Conjugal transfer protein
total genus 41
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.230 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5i97A00
4KZ1A 5I97A 4O3VA 4AKZA 4LSOA 4MEIA 4AKYA 5JBSA 4NHFA 4JF8A 2BHMA 2CC3A
chains in the Genus database with same CATH superfamily
1I2GA 2XH9A 1M9GA 4OVMA 1YJW3 1CYUA 3RGRA 1BRSA 3KSPA 5IF6A 1RGCA 4KZ1A 4CJNA 3V92A 1B3SA 1Q9EA 3LTCA 7GSPA 2CWTA 5IEOA 4BU4A 1A90A 3MG3A 3LT8A 3CNMA 5AIIA 3A76A 2OCTA 3D4AA 2KF6A 4HM4B 1JZDA 1RHLA 5DRVA 1RCLA 1LNIA 2H0GA 2HMKB 1OACA 4XDVA 1EQKA 3J7Yd 3DGNA 1TRPA 4KT3B 1AR0A 1DYUA 1VQK3 3D5GA 2UGIA 4AKZA 2HMMB 3LH4A 3LTDA 3S67A 1VQP3 1UGHI 1WNHA 1K734 3PCSA 2IUJA 1O7MB 3ZFZA 1RGGA 2Z7AA 1I70A 1ZGXA 3A5EA 1EKMA 3EE1A 4WP5A 2OWPA 1I8VA 3EF8A 3SOYA 1QVG2 1JNQA 3F40A 1FGRA 3D5IA 3X3ZA 1OCVA 3E99A 3NM2A 5AIHA 4L8PA 1DETA 3DM8A 2MC8A 2W6JH 3X40A 4FCMA 1AVKA 4CCVA 1LOXA 2CFDA 4ORLA 3CCL3 5CLKA 1YVSA 1W4NA 3EX9A 3CPW2 3SXXA 1GMPA 1UCKA 2AADA 3LZAA 3KE7A 1CEWI 1TUHA 1VQM3 3IMAB 4HM8B 1FGOA 1FUWA 2HMOB 1VQ73 2P0XA 5LC6A 1RGKA 3Q2PA 2BT3A 1TTOA 2WGOA 1OF5B 4RBNA 1Q814 2PZVA 1UDII 3N9HA 1VQ93 2FXTA 1UUGB 1WTHA 4K61A 1K28A 3X41A 1X1XA 2SARA 3FG1A 3FF2A 4AKYA 4EBGA 1DMMA 1NB3I 2XF3A 1I0XA 2YFJB 3NBBA 3FG3A 3I563 4GHOA 1MOLA 5I97A 1JZOA 3RGAA 1UW1A 1WMPA 1F8NA 4Q53A 3H3HA 2HMNB 4MMZB 5G1KA 4LEHA 4R9KA 3ECFA 4N6NB 3SEDA 1STDA 3F7SA 3RNTA 4HVNA 3Q3FA 2O9UX 4KFFA 2WO0A 3ALAA 3SX1A 1RMSA 2XFSA 8RNTA 3BNBA 1W2ZA 1A2KA 1I3FA 3LTAA 1G0TA 2C11A 3T8NA 2WOHA 1KSIA 2L1SA 1YI23 2F5MA 2RNTA 4HM6B 1QAFA 2UX0A 3K0ZA 2A15A 3DMCA 4GSPA 4EW5A 3WHOA 1BAOA 3DGMA 3GWRA 2RCDA 2W56B 1X1UA 3CD63 3LTBA 1HU9A 3KN4A 5ELUA 4XBYA 3G713 1Q42A 1O7PB 1MNLA 3BLZA 4FCZA 2QIYA 4NREA 1YGWA 1BGSA 3FKAA 4LMIA 2CFKA 1EEJA 3KZTA 1JBSA 3DH2A 1IQYA 1RGFA 4XB5A 3OV4A 1BUQA 3UB1A 3L0RA 1IYYA 1UI7A 1S5AA 3H51A 5G2GA 1ROAA 1MWUA 1FGMA 2SBLA 3LXUX 3WMDA 5IW9A 1IK3A 4FMDA 3B8LA 3LOYA 1NNVA 4I4KA 2ZA4A 1YNVX 4NHFA 1X1YA 1OHPA 1BSCA 3GZYB 1BNIA 2XEPA 1T5YA 1TIJA 4WHAA 1PY3A 3URPA 4N6TA 1NDOB 1V57A 1TFKA 1X1WA 1A67A 3FF0A 1I2FA 3X42A 2RBIA 4R1KA 5DREA 3B4PA 1KWIA 1GY5A 3CCM3 3EBYA 1OPYA 3EHCA 3BB9A 1GMRA 1FA3A 3OWYA 1LOVA 2P05A 2KF4A 4N6MA 1DMNA 1B2UA 1EA2A 2P09A 3Q90A 1UCIA 4KVHA 4XBXA 1VQN3 1OHSA 1Z1SA 1VQ53 4R80A 4FMAA 5G1LA 2I9WA 2GBWB 4STDA 1GD3A 3BNDA 1FW7A 1N9EA 2R4IA 2XRXB 4EXRA 3WA2X 8CHOA 1BNGA 5CXOA 3VGNA 1RKYA 1N8QA 3CME3 3CNXA 3EQQB 1JBRA 3IJEB 2OTL3 2GU3A 1GY7A 4OK0A 3ROBA 3S27A 1SJWA 2CG0A 1ASKA 1KD14 1BRNL 3DGOA 1B2MA 5HGRA 2P38A 3CMA3 3G6E3 3OWUA 4IT7A 4N6OB 1IT8A 2XSHB 4HM3B 1EG9B 1L5GB 1R4CA 5LC7A 3WOEB 3FSDA 2H0IA 4X2OA 6RNTA 2KAAA 2Y74A 1DVDA 3JUOA 5BVBA 1U5OA 4N6V0 1IV9A 3K5TA 2ZDJA 4G1MB 3U1WA 1BU4A 1BNJA 2IYJA 4FR9A 4RNTA 3EC9A 5HOHA 2XGLA 5IERA 3F7XA 1YIJ3 3NQZA 4O2HA 2K0MA 2K54A 4RZMA 3WDGB 2GEYA 5AYSC 1RSNA 2YX9A 3PCRA 3ZG0A 4L7KA 1V74A 1HYFA 1G02A 4HM7B 3AMOA 4N3VA 1BSEA 2BMRB 2IMJA 1RRHA 1BIRA 3NM7A 5JPUA 3CC43 5AEWB 1QAKA 3AMOB 1VQ83 1RGEA 2LYXA 2Z6BA 2P0MA 3FG4A 1B2XA 4WYKA 1GS3A 1GYBA 1JKGA 2D1WA 3GAXA 5AI1A 4FCJA 4ZM8A 2XGNA 1IV7A 4MMYB 5EQLA 5RNTA 2RFRA 1RTUA 3T8UA 1MGWA 3HIGA 5ELJA 1O7HB 2CIUA 2F4YA 1UI8A 1BNFA 5BU4A 1RLSA 1I2EA 2B24B 3STDA 3CCJ3 1KQS2 3HI7A 3OW22 1FUTA 5IG0A 3SVAA 2LQVA 1K41A 2WOFA 3MWZA 1NB5I 2BMOB 3NV0A 3SYUA 3X3XA 3ZG5A 2BNGA 4L8OA 1Y4KA 1RGHA 7STDA 4KFEA 1M904 3S29A 2GXFA 3MG2A 2M7OA 2Q07A 4WWUC 3UL5A 3CU3A 1US1A 1I3IA 1E3VA 1UUWB 5AIGA 1I0VA 3HZPA 1W6YA 2CH9A 4HZ9B 1MWTA 3NXJA 1GMQA 3K7CA 1VQO3 1IVXA 3OX9A 9RNTA 1ROVA 3IPTA 4J9AA 1TFOA 3M8CA 1RNBA 2C4BA 3AGNA 2IY2A 4J8TA 2KF5A 1Q7HA 3FGYA 1LRAA 1GOVA 3BIRA 1CQSA 3EN1B 3DY5A 3AHWA 3HOHA 4LYLB 1N8R4 3F9SA 3GZRA 4BTXA 4JRFA 2CWUA 3CPOA 2W03A 4ILFA 1BRHA 1QMAA 1O7GB 1ULIB 3CCS3 1WMOA 2XSOB 1RCKA 4MJDA 1BUJA 1KC84 1Q864 3PXMA 1VZZA 3V99A 1ZO2A 4XM4A 1GY6A 3TDGA 3WR2A 1C54A 3F8HA 3KSED 2MF7A 1WMNA 4EYCA 1G96A 2ML6A 2OOVC 1B27A 1M1XB 5D83A 3GZBA 3QK9A 2CHCA 5JBSA 3EB8A 1JB4A 2KF3A 4N6UA 1RN4A 1WQLB 4IIAA 5M1AA 4J5KA 2E2TA 5GSPA 1W6CA 1HKXA 3GSPA 2CWVA 3DGYA 1W2B2 3NBJA 4WFOA 1A2VA 4U13A 3FZWA 1SARA 1ZX2A 1DE3A 3LYGA 1RGAA 4DKIA 1RRLA 2BO9B 1LOWA 4LZIA 5D82A 3SOAA 3G16A 1IQXA 5FGOA 3NQYA 3MPHA 1W5ZA 1W00A 4K90B 2HMJB 5M19A 1E3RA 1MWSA 1D6YA 1ULJB 1RJOA 5CF2A 4BL3A 1QJGA 5BIRA 2CFWA 4IPBA 2Y73A 1YGEA 2XR8B 3KCHA 4AEQA 2QGUA 4I5QA 1Q40A 3NUVA 2E2VA 1VQ43 3UJMA 2YFLB 2OQEA 5M18A 1DMQA 3DZLA 3EBTA 4LSOA 1QALA 4GB5A 4HBRA 4MEIA 3MSOA 1MGRA 2CX1A 1GOUA 3KKGA 2PNCA 2W56A 1Q7Y4 7RNTA 4CPKA 1PU4A 3Q1CA 3SLUA 4BL2A 1JV2B 1EUIC 4HKVB 4XDWA 1YJN3 4H3UA 1JB5A 4XBTA 5AIFA 5IG5A 1AV4A 2Z76A 1N5HA 1U8CB 1OHOA 3CCQ3 3S5CA 2FNQA 4HM1B 4HM0B 5BXQA 2R41A 1BRGA 1GSPA 1OGZA 1AQZA 1O7NB 1JB2A 2H0HA 1D6UA 2STDA 2XFTA 4WYKB 5CK6A 3VSYA 3MG1A 1ZS7A 1C7HA 2W2CA 2ZL8A 1OH0A 3BU4A 4LGQA 1IT7A 1FGQA 1LQGC 3CCV3 3PS8A 5IENA 1JJ22 1LXEA 3T0UA 4HZBB 4CDLA 5EEOA 1FGTA 1BRJA 3GZXB 1A2PA 5A0OB 3LT9A 2GSPA 1YHQ3 4O8SA 1AY7A 3NBRA 3BNCA 2BHMA 1BSDA 4TX4A 3CCE3 2GEXA 3F8XA 1IVUA 4KFDA 1B2SA 1FZUA 4R4KA 3I553 3UL6A 3FCSB 4HYZA 3KFQC 1Q40B 2RGQA 4RNZA 2QA43 1GOYA 5IEPA 1IVVA 3JUNA 4NPBA 4X2HA 4HJLB 2F98A 1E97A 2JQ5A 4BTYA 1B2ZA 5KP4A 3U97A 3K9MC 4OUQA 3G8ZA 2CC3A 4H61A 4GL6A 5KP3A 5IG4A 3HIIA 3D9RA 1T3BA 2CW9A 2KRTA 3EN8A 1N5PA 1BSAA 3HX8A 5AYRB 2OQEC 2CK3H 4HAAA 4O3VA 4BIRA 3WA3A 2W04A 1S723 2OOVA 1K9M4 2OTJ3 3UNLA 2UUGC 4HM5B 3LMLA 4K1VA 2L4VA 1RN7A 1UUVB 6GSPA 1CH0A 1TRQA 2WGQA 1N9JA 3OWSA 1YVBI 3JUMA 3WODG 1JN5B 1LNHA 1SQWA 2BMQB 2C10A 4R9LA 3MYTA 4EV5A 1W02A 5AEUB 1Q824 2F86B 2O3OA 3CCR3 3CCU3 1NJI4 2RSXA 4FMBA 1JKGB 3K63A 4JF8A 1LQMB 1OF5A 1NO3A 2INXA 1UGIA 3NX0A 1BNRA 2QEX3 3QRDA 3CC23 1IU7A 1FYSA 3AGOA 1NWWA 3N8BA 3ER7A 1J2BA 1V58A 1TP6A 2HOHA 1W6GA 2W9QA 1M1K4 1SIIA 2ZHXB 3B4OA 5TGNA 1RN1A 2IUKA 3N54B 1W7CA 3CXC2 3DGLA 3WOFB 2YFIB 1PFPA 2K3DA 4HOHA 2IA7A 2F5WA 3D3LA 5FW5A 1R4YA 1BNEA 1BNSA 1CYVA 1RNTA 1B21A 1BOXA 1BRKA 4O02B 1TU5A 3DUKA 3CC73 2JDIH 1QVF2 1RGLA 1W01A 1T2HA 3RDEA 1D6ZA 3EJVA 1BVIA 3B7CA 2BIRA 2CFLA 1OUNA 1VQQA 2BU4A 4K1UA 3MHEA 2CG1A 2KXGA 1TJDA 3DXOA 2CX0A 2CKFB 4PEJA 1VQL3 3X3YA 3PZWA 4EC6A 5EVHA 4HM2B 6STDA 5JPPA 2E2UA 1T2IA 1BSBA 1OGXA 1STFI 2J8XB 5D81A 3BNEA 5IG3A 1SPUA 3JVCA 2F99A 1DVCA 3OXAA 1JN5A 5CF1A 1VQ63 5STDA 4BTWA 1B20A 1UCJA 1ISKA 1IDPA 3HK4A 3PGBA 3AHSA 3FLJA 1YIT3 1MWRA 1LOYA 1HZ1A 4J5GA 1K8A4 1LVNA 1BANA 1RDSA 3VF1A 1JBTA 1BRIA 2ML5A 3PYJA 2FGTA 2CFGA 1GD4A 3G0KA 3MKIA 4RNYA 3NHXA 4FMCA 3D79A 3F14A 2Z77A 3G4S3 2KCDA 4QWTA 2V1LA 1NU3A 1PYLA 1O7WB 4EV2A 2B1XB 1FUSA 2W0QA 1UCLA 2D42A 2HMLB 1SIHA 3V98A 2F56A 2GBXB 3FH1A 3JUQA 4N6LA 5KP1A 3KIIA 1YJ93 2AAEA 1JRQA 3NV0B 1IQ8A 3GRDA 3O8YA 2W9PA 1IVWA 3S28A 1AVLA 3JUPA 4MMXB 3I0YA 2GU1A
chains in the Genus database with same CATH topology
2XH9A 1M9GA 4OVMA 1YJW3 1CYUA 3RGRA 3KSPA 5IF6A 4KZ1A 3V92A 3LTCA 2CWTA 5IEOA 1A90A 3MG3A 3LT8A 3CNMA 5AIIA 3A76A 2OCTA 4HM4B 5DRVA 2HMKB 1OACA 4XDVA 1EQKA 3J7Yd 3DGNA 1AR0A 1DYUA 1VQK3 4AKZA 2HMMB 3LH4A 3LTDA 3S67A 1VQP3 1WNHA 1K734 3PCSA 2IUJA 1O7MB 2Z7AA 4WP5A 3EE1A 1EKMA 2OWPA 3EF8A 3SOYA 1QVG2 1JNQA 3F40A 1FGRA 3X3ZA 1OCVA 3E99A 3NM2A 5AIHA 4L8PA 3DM8A 2MC8A 2W6JH 3X40A 4FCMA 1AVKA 4CCVA 1LOXA 2CFDA 4ORLA 3CCL3 5CLKA 1W4NA 3EX9A 3CPW2 3SXXA 3LZAA 3KE7A 1CEWI 1TUHA 1VQM3 3IMAB 4HM8B 1FGOA 1FUWA 2HMOB 1VQ73 2P0XA 5LC6A 3Q2PA 2BT3A 2WGOA 4RBNA 1OF5B 1Q814 2PZVA 3N9HA 1VQ93 2FXTA 4K61A 1WTHA 1K28A 3X41A 3FG1A 3FF2A 4AKYA 4EBGA 1DMMA 1NB3I 2XF3A 2YFJB 3NBBA 3FG3A 3I563 1MOLA 5I97A 3RGAA 1UW1A 1WMPA 1F8NA 4Q53A 3H3HA 2HMNB 4MMZB 4LEHA 4R9KA 3ECFA 4N6NB 3SEDA 1STDA 3F7SA 4HVNA 2O9UX 4KFFA 2WO0A 3ALAA 3SX1A 2XFSA 3BNBA 1W2ZA 1A2KA 3LTAA 2C11A 3T8NA 2WOHA 1KSIA 1YI23 4HM6B 1QAFA 2UX0A 3K0ZA 2A15A 3DMCA 3DGMA 3GWRA 2RCDA 2W56B 3CD63 3LTBA 1HU9A 3KN4A 5ELUA 4XBYA 3G713 1Q42A 1O7PB 1MNLA 3BLZA 4FCZA 2QIYA 4NREA 3FKAA 4LMIA 2CFKA 3KZTA 1IQYA 4XB5A 3OV4A 1BUQA 3UB1A 3L0RA 1UI7A 1S5AA 3H51A 5G2GA 1ROAA 1FGMA 2SBLA 3LXUX 3WMDA 5IW9A 1IK3A 4FMDA 3B8LA 3LOYA 4I4KA 4NHFA 1OHPA 3GZYB 2XEPA 1T5YA 1TIJA 4WHAA 4N6TA 1NDOB 1TFKA 1A67A 3FF0A 3X42A 4R1KA 5DREA 3B4PA 1KWIA 1GY5A 3CCM3 3EBYA 1OPYA 3EHCA 3BB9A 1FA3A 3OWYA 2P05A 4N6MA 1DMNA 1EA2A 2P09A 3Q90A 4KVHA 4XBXA 1VQN3 1OHSA 1Z1SA 1VQ53 4R80A 4FMAA 2I9WA 2GBWB 4STDA 1GD3A 3BNDA 1N9EA 2R4IA 2XRXB 4EXRA 3WA2X 8CHOA 1RKYA 5CXOA 3VGNA 3CME3 1N8QA 3CNXA 3EQQB 3IJEB 2OTL3 2GU3A 1GY7A 4OK0A 3ROBA 3S27A 1SJWA 2CG0A 1ASKA 1KD14 3DGOA 5HGRA 2P38A 3CMA3 3G6E3 3OWUA 4IT7A 4N6OB 1IT8A 2XSHB 4HM3B 1EG9B 1L5GB 1R4CA 5LC7A 3WOEB 3FSDA 4X2OA 1YHQ3 2Y74A 1DVDA 3JUOA 5BVBA 1U5OA 4N6V0 1IV9A 3K5TA 2ZDJA 4G1MB 3U1WA 4FR9A 5IERA 3EC9A 2XGLA 3F7XA 1YIJ3 3NQZA 4O2HA 2K0MA 2K54A 4RZMA 3WDGB 2GEYA 5AYSC 2YX9A 3PCRA 4L7KA 1V74A 4N3VA 4HM7B 3AMOA 2BMRB 2IMJA 1RRHA 3NM7A 5JPUA 3CC43 5AEWB 1QAKA 3AMOB 1VQ83 2LYXA 2Z6BA 2P0MA 3FG4A 4WYKA 1GS3A 1GYBA 1JKGA 2D1WA 3GAXA 5AI1A 4FCJA 4ZM8A 2XGNA 1IV7A 4MMYB 5EQLA 2RFRA 3T8UA 3HIGA 5ELJA 1O7HB 2CIUA 1UI8A 3STDA 2B24B 3CCJ3 1KQS2 3HI7A 3OW22 5IG0A 3SVAA 1NB5I 2LQVA 1K41A 2WOFA 3MWZA 2BMOB 3NV0A 3X3XA 2BNGA 4L8OA 1Y4KA 1M904 7STDA 4KFEA 3S29A 2GXFA 3MG2A 2M7OA 2Q07A 4WWUC 3UL5A 3CU3A 1US1A 1E3VA 1UUWB 5AIGA 3HZPA 1W6YA 2CH9A 4HZ9B 3NXJA 3K7CA 1VQO3 1IVXA 3OX9A 1ROVA 3IPTA 4J9AA 1TFOA 3M8CA 4J8TA 3FGYA 1CQSA 3EN1B 3DY5A 3F9SA 3GZRA 4BTXA 4JRFA 2CWUA 3CPOA 2W03A 1QMAA 1O7GB 1ULIB 3CCS3 1WMOA 2XSOB 4MJDA 1KC84 1Q864 3PXMA 1VZZA 3V99A 1ZO2A 4XM4A 1GY6A 3TDGA 3F8HA 3KSED 2MF7A 1WMNA 4EYCA 1G96A 2ML6A 2OOVC 1M1XB 5D83A 3GZBA 3QK9A 2CHCA 5JBSA 3EB8A 1JB4A 4N6UA 1WQLB 4IIAA 2E2TA 1W6CA 1HKXA 2CWVA 1W2B2 3NBJA 4WFOA 1A2VA 4U13A 3FZWA 1ZX2A 3LYGA 1RRLA 2BO9B 4LZIA 5D82A 3SOAA 3G16A 1IQXA 5FGOA 3NQYA 3MPHA 1W5ZA 1W00A 4K90B 2HMJB 1E3RA 1D6YA 1ULJB 1RJOA 5CF2A 1QJGA 2CFWA 4IPBA 2Y73A 1YGEA 2XR8B 4AEQA 2QGUA 1Q40A 3NUVA 2E2VA 1VQ43 3UJMA 2YFLB 2OQEA 1DMQA 3DZLA 3EBTA 4LSOA 1QALA 4GB5A 4HBRA 4MEIA 3MSOA 3KKGA 2PNCA 2W56A 1Q7Y4 1PU4A 3Q1CA 3SLUA 1JV2B 4HKVB 4XDWA 1YJN3 4H3UA 1JB5A 4XBTA 5AIFA 5IG5A 1AV4A 2Z76A 1N5HA 1U8CB 1OHOA 3CCQ3 3S5CA 2FNQA 4HM1B 4HM0B 5BXQA 2STDA 2XFTA 1O7NB 1OGZA 1N8R4 1JB2A 5CK6A 1D6UA 4WYKB 3VSYA 3MG1A 2ZL8A 1C7HA 2W2CA 4LGQA 1OH0A 1JJ22 1IT7A 1FGQA 3CCV3 3PS8A 5IENA 1LXEA 3T0UA 4HZBB 4CDLA 5EEOA 1FGTA 3GZXB 5A0OB 3LT9A 4O8SA 3NBRA 3BNCA 2BHMA 4TX4A 3CCE3 2GEXA 3F8XA 1IVUA 4KFDA 4R4KA 3I553 3UL6A 3FCSB 4HYZA 3KFQC 1Q40B 2RGQA 4RNZA 2QA43 5IEPA 1IVVA 3JUNA 4X2HA 4HJLB 2F98A 1E97A 2JQ5A 4BTYA 5KP4A 3U97A 3K9MC 4OUQA 3G8ZA 2CC3A 4H61A 4GL6A 5KP3A 5IG4A 3HIIA 3D9RA 2CW9A 2KRTA 3EN8A 1N5PA 3HX8A 5AYRB 2OQEC 2CK3H 4O3VA 3WA3A 1S723 2W04A 2OOVA 1K9M4 2OTJ3 3UNLA 4HM5B 3LMLA 4K1VA 2L4VA 1RN7A 1UUVB 2WGQA 1N9JA 3OWSA 1YVBI 3JUMA 3WODG 1JN5B 1LNHA 1SQWA 2BMQB 2C10A 4R9LA 3MYTA 4EV5A 1W02A 5AEUB 1Q824 2F86B 2O3OA 3CCR3 3CCU3 1NJI4 2RSXA 4FMBA 1JKGB 3K63A 4JF8A 1OF5A 1NO3A 2INXA 3NX0A 2QEX3 3QRDA 3CC23 1IU7A 1NWWA 3N8BA 3ER7A 1J2BA 1TP6A 1W6GA 2W9QA 1M1K4 1SIIA 3B4OA 5TGNA 2IUKA 3N54B 1W7CA 3CXC2 3DGLA 3WOFB 2YFIB 1PFPA 2IA7A 3D3LA 5FW5A 1CYVA 4O02B 1QVF2 1TU5A 3DUKA 3CC73 2JDIH 1W01A 3RDEA 1D6ZA 3EJVA 3B7CA 2CFLA 1OUNA 4K1UA 3MHEA 2CG1A 2KXGA 3DXOA 4PEJA 2CKFB 1VQL3 3X3YA 3PZWA 4EC6A 5EVHA 4HM2B 6STDA 5JPPA 2E2UA 1OGXA 1STFI 5D81A 3BNEA 5IG3A 1SPUA 3JVCA 2F99A 1DVCA 3OXAA 1JN5A 5CF1A 1VQ63 5STDA 4BTWA 1ISKA 1IDPA 3HK4A 3PGBA 3FLJA 1YIT3 1K8A4 1LVNA 3VF1A 2ML5A 3PYJA 2FGTA 2CFGA 1GD4A 3G0KA 3MKIA 4RNYA 3NHXA 4FMCA 3F14A 2Z77A 3G4S3 2KCDA 4QWTA 2V1LA 1NU3A 1O7WB 4EV2A 2B1XB 2W0QA 3V98A 2D42A 2HMLB 1SIHA 2GBXB 3JUQA 3FH1A 4N6LA 5KP1A 3KIIA 1YJ93 1JRQA 3NV0B 1IQ8A 3GRDA 3O8YA 2W9PA 1IVWA 3S28A 1AVLA 3JUPA 4MMXB 3I0YA 2GU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZ1 A;  5I97 A;  4O3V A;  4AKZ A;  4LSO A;  4MEI A;  4AKY A;  5JBS A;  4NHF A;  4JF8 A;  2BHM A;  2CC3 A; 
#chains in the Genus database with same CATH topology
 1I2G A;  2XH9 A;  1M9G A;  4OVM A;  1YJW 3;  1CYU A;  3RGR A;  1BRS A;  3KSP A;  5IF6 A;  1RGC A;  4KZ1 A;  4CJN A;  3V92 A;  1B3S A;  1Q9E A;  3LTC A;  7GSP A;  2CWT A;  5IEO A;  4BU4 A;  1A90 A;  3MG3 A;  3LT8 A;  3CNM A;  5AII A;  3A76 A;  2OCT A;  3D4A A;  2KF6 A;  4HM4 B;  1JZD A;  1RHL A;  5DRV A;  1RCL A;  1LNI A;  2H0G A;  2HMK B;  1OAC A;  4XDV A;  1EQK A;  3J7Y d;  3DGN A;  1TRP A;  4KT3 B;  1AR0 A;  1DYU A;  1VQK 3;  3D5G A;  2UGI A;  4AKZ A;  2HMM B;  3LH4 A;  3LTD A;  3S67 A;  1VQP 3;  1UGH I;  1WNH A;  1K73 4;  3PCS A;  2IUJ A;  1O7M B;  3ZFZ A;  1RGG A;  2Z7A A;  1I70 A;  1ZGX A;  3A5E A;  1EKM A;  3EE1 A;  4WP5 A;  2OWP A;  1I8V A;  3EF8 A;  3SOY A;  1QVG 2;  1JNQ A;  3F40 A;  1FGR A;  3D5I A;  3X3Z A;  1OCV A;  3E99 A;  3NM2 A;  5AIH A;  4L8P A;  1DET A;  3DM8 A;  2MC8 A;  2W6J H;  3X40 A;  4FCM A;  1AVK A;  4CCV A;  1LOX A;  2CFD A;  4ORL A;  3CCL 3;  5CLK A;  1YVS A;  1W4N A;  3EX9 A;  3CPW 2;  3SXX A;  1GMP A;  1UCK A;  2AAD A;  3LZA A;  3KE7 A;  1CEW I;  1TUH A;  1VQM 3;  3IMA B;  4HM8 B;  1FGO A;  1FUW A;  2HMO B;  1VQ7 3;  2P0X A;  5LC6 A;  1RGK A;  3Q2P A;  2BT3 A;  1TTO A;  2WGO A;  1OF5 B;  4RBN A;  1Q81 4;  2PZV A;  1UDI I;  3N9H A;  1VQ9 3;  2FXT A;  1UUG B;  1WTH A;  4K61 A;  1K28 A;  3X41 A;  1X1X A;  2SAR A;  3FG1 A;  3FF2 A;  4AKY A;  4EBG A;  1DMM A;  1NB3 I;  2XF3 A;  1I0X A;  2YFJ B;  3NBB A;  3FG3 A;  3I56 3;  4GHO A;  1MOL A;  5I97 A;  1JZO A;  3RGA A;  1UW1 A;  1WMP A;  1F8N A;  4Q53 A;  3H3H A;  2HMN B;  4MMZ B;  5G1K A;  4LEH A;  4R9K A;  3ECF A;  4N6N B;  3SED A;  1STD A;  3F7S A;  3RNT A;  4HVN A;  3Q3F A;  2O9U X;  4KFF A;  2WO0 A;  3ALA A;  3SX1 A;  1RMS A;  2XFS A;  8RNT A;  3BNB A;  1W2Z A;  1A2K A;  1I3F A;  3LTA A;  1G0T A;  2C11 A;  3T8N A;  2WOH A;  1KSI A;  2L1S A;  1YI2 3;  2F5M A;  2RNT A;  4HM6 B;  1QAF A;  2UX0 A;  3K0Z A;  2A15 A;  3DMC A;  4GSP A;  4EW5 A;  3WHO A;  1BAO A;  3DGM A;  3GWR A;  2RCD A;  2W56 B;  1X1U A;  3CD6 3;  3LTB A;  1HU9 A;  3KN4 A;  5ELU A;  4XBY A;  3G71 3;  1Q42 A;  1O7P B;  1MNL A;  3BLZ A;  4FCZ A;  2QIY A;  4NRE A;  1YGW A;  1BGS A;  3FKA A;  4LMI A;  2CFK A;  1EEJ A;  3KZT A;  1JBS A;  3DH2 A;  1IQY A;  1RGF A;  4XB5 A;  3OV4 A;  1BUQ A;  3UB1 A;  3L0R A;  1IYY A;  1UI7 A;  1S5A A;  3H51 A;  5G2G A;  1ROA A;  1MWU A;  1FGM A;  2SBL A;  3LXU X;  3WMD A;  5IW9 A;  1IK3 A;  4FMD A;  3B8L A;  3LOY A;  1NNV A;  4I4K A;  2ZA4 A;  1YNV X;  4NHF A;  1X1Y A;  1OHP A;  1BSC A;  3GZY B;  1BNI A;  2XEP A;  1T5Y A;  1TIJ A;  4WHA A;  1PY3 A;  3URP A;  4N6T A;  1NDO B;  1V57 A;  1TFK A;  1X1W A;  1A67 A;  3FF0 A;  1I2F A;  3X42 A;  2RBI A;  4R1K A;  5DRE A;  3B4P A;  1KWI A;  1GY5 A;  3CCM 3;  3EBY A;  1OPY A;  3EHC A;  3BB9 A;  1GMR A;  1FA3 A;  3OWY A;  1LOV A;  2P05 A;  2KF4 A;  4N6M A;  1DMN A;  1B2U A;  1EA2 A;  2P09 A;  3Q90 A;  1UCI A;  4KVH A;  4XBX A;  1VQN 3;  1OHS A;  1Z1S A;  1VQ5 3;  4R80 A;  4FMA A;  5G1L A;  2I9W A;  2GBW B;  4STD A;  1GD3 A;  3BND A;  1FW7 A;  1N9E A;  2R4I A;  2XRX B;  4EXR A;  3WA2 X;  8CHO A;  1BNG A;  5CXO A;  3VGN A;  1RKY A;  1N8Q A;  3CME 3;  3CNX A;  3EQQ B;  1JBR A;  3IJE B;  2OTL 3;  2GU3 A;  1GY7 A;  4OK0 A;  3ROB A;  3S27 A;  1SJW A;  2CG0 A;  1ASK A;  1KD1 4;  1BRN L;  3DGO A;  1B2M A;  5HGR A;  2P38 A;  3CMA 3;  3G6E 3;  3OWU A;  4IT7 A;  4N6O B;  1IT8 A;  2XSH B;  4HM3 B;  1EG9 B;  1L5G B;  1R4C A;  5LC7 A;  3WOE B;  3FSD A;  2H0I A;  4X2O A;  6RNT A;  2KAA A;  2Y74 A;  1DVD A;  3JUO A;  5BVB A;  1U5O A;  4N6V 0;  1IV9 A;  3K5T A;  2ZDJ A;  4G1M B;  3U1W A;  1BU4 A;  1BNJ A;  2IYJ A;  4FR9 A;  4RNT A;  3EC9 A;  5HOH A;  2XGL A;  5IER A;  3F7X A;  1YIJ 3;  3NQZ A;  4O2H A;  2K0M A;  2K54 A;  4RZM A;  3WDG B;  2GEY A;  5AYS C;  1RSN A;  2YX9 A;  3PCR A;  3ZG0 A;  4L7K A;  1V74 A;  1HYF A;  1G02 A;  4HM7 B;  3AMO A;  4N3V A;  1BSE A;  2BMR B;  2IMJ A;  1RRH A;  1BIR A;  3NM7 A;  5JPU A;  3CC4 3;  5AEW B;  1QAK A;  3AMO B;  1VQ8 3;  1RGE A;  2LYX A;  2Z6B A;  2P0M A;  3FG4 A;  1B2X A;  4WYK A;  1GS3 A;  1GYB A;  1JKG A;  2D1W A;  3GAX A;  5AI1 A;  4FCJ A;  4ZM8 A;  2XGN A;  1IV7 A;  4MMY B;  5EQL A;  5RNT A;  2RFR A;  1RTU A;  3T8U A;  1MGW A;  3HIG A;  5ELJ A;  1O7H B;  2CIU A;  2F4Y A;  1UI8 A;  1BNF A;  5BU4 A;  1RLS A;  1I2E A;  2B24 B;  3STD A;  3CCJ 3;  1KQS 2;  3HI7 A;  3OW2 2;  1FUT A;  5IG0 A;  3SVA A;  2LQV A;  1K41 A;  2WOF A;  3MWZ A;  1NB5 I;  2BMO B;  3NV0 A;  3SYU A;  3X3X A;  3ZG5 A;  2BNG A;  4L8O A;  1Y4K A;  1RGH A;  7STD A;  4KFE A;  1M90 4;  3S29 A;  2GXF A;  3MG2 A;  2M7O A;  2Q07 A;  4WWU C;  3UL5 A;  3CU3 A;  1US1 A;  1I3I A;  1E3V A;  1UUW B;  5AIG A;  1I0V A;  3HZP A;  1W6Y A;  2CH9 A;  4HZ9 B;  1MWT A;  3NXJ A;  1GMQ A;  3K7C A;  1VQO 3;  1IVX A;  3OX9 A;  9RNT A;  1ROV A;  3IPT A;  4J9A A;  1TFO A;  3M8C A;  1RNB A;  2C4B A;  3AGN A;  2IY2 A;  4J8T A;  2KF5 A;  1Q7H A;  3FGY A;  1LRA A;  1GOV A;  3BIR A;  1CQS A;  3EN1 B;  3DY5 A;  3AHW A;  3HOH A;  4LYL B;  1N8R 4;  3F9S A;  3GZR A;  4BTX A;  4JRF A;  2CWU A;  3CPO A;  2W03 A;  4ILF A;  1BRH A;  1QMA A;  1O7G B;  1ULI B;  3CCS 3;  1WMO A;  2XSO B;  1RCK A;  4MJD A;  1BUJ A;  1KC8 4;  1Q86 4;  3PXM A;  1VZZ A;  3V99 A;  1ZO2 A;  4XM4 A;  1GY6 A;  3TDG A;  3WR2 A;  1C54 A;  3F8H A;  3KSE D;  2MF7 A;  1WMN A;  4EYC A;  1G96 A;  2ML6 A;  2OOV C;  1B27 A;  1M1X B;  5D83 A;  3GZB A;  3QK9 A;  2CHC A;  5JBS A;  3EB8 A;  1JB4 A;  2KF3 A;  4N6U A;  1RN4 A;  1WQL B;  4IIA A;  5M1A A;  4J5K A;  2E2T A;  5GSP A;  1W6C A;  1HKX A;  3GSP A;  2CWV A;  3DGY A;  1W2B 2;  3NBJ A;  4WFO A;  1A2V A;  4U13 A;  3FZW A;  1SAR A;  1ZX2 A;  1DE3 A;  3LYG A;  1RGA A;  4DKI A;  1RRL A;  2BO9 B;  1LOW A;  4LZI A;  5D82 A;  3SOA A;  3G16 A;  1IQX A;  5FGO A;  3NQY A;  3MPH A;  1W5Z A;  1W00 A;  4K90 B;  2HMJ B;  5M19 A;  1E3R A;  1MWS A;  1D6Y A;  1ULJ B;  1RJO A;  5CF2 A;  4BL3 A;  1QJG A;  5BIR A;  2CFW A;  4IPB A;  2Y73 A;  1YGE A;  2XR8 B;  3KCH A;  4AEQ A;  2QGU A;  4I5Q A;  1Q40 A;  3NUV A;  2E2V A;  1VQ4 3;  3UJM A;  2YFL B;  2OQE A;  5M18 A;  1DMQ A;  3DZL A;  3EBT A;  4LSO A;  1QAL A;  4GB5 A;  4HBR A;  4MEI A;  3MSO A;  1MGR A;  2CX1 A;  1GOU A;  3KKG A;  2PNC A;  2W56 A;  1Q7Y 4;  7RNT A;  4CPK A;  1PU4 A;  3Q1C A;  3SLU A;  4BL2 A;  1JV2 B;  1EUI C;  4HKV B;  4XDW A;  1YJN 3;  4H3U A;  1JB5 A;  4XBT A;  5AIF A;  5IG5 A;  1AV4 A;  2Z76 A;  1N5H A;  1U8C B;  1OHO A;  3CCQ 3;  3S5C A;  2FNQ A;  4HM1 B;  4HM0 B;  5BXQ A;  2R41 A;  1BRG A;  1GSP A;  1OGZ A;  1AQZ A;  1O7N B;  1JB2 A;  2H0H A;  1D6U A;  2STD A;  2XFT A;  4WYK B;  5CK6 A;  3VSY A;  3MG1 A;  1ZS7 A;  1C7H A;  2W2C A;  2ZL8 A;  1OH0 A;  3BU4 A;  4LGQ A;  1IT7 A;  1FGQ A;  1LQG C;  3CCV 3;  3PS8 A;  5IEN A;  1JJ2 2;  1LXE A;  3T0U A;  4HZB B;  4CDL A;  5EEO A;  1FGT A;  1BRJ A;  3GZX B;  1A2P A;  5A0O B;  3LT9 A;  2GSP A;  1YHQ 3;  4O8S A;  1AY7 A;  3NBR A;  3BNC A;  2BHM A;  1BSD A;  4TX4 A;  3CCE 3;  2GEX A;  3F8X A;  1IVU A;  4KFD A;  1B2S A;  1FZU A;  4R4K A;  3I55 3;  3UL6 A;  3FCS B;  4HYZ A;  3KFQ C;  1Q40 B;  2RGQ A;  4RNZ A;  2QA4 3;  1GOY A;  5IEP A;  1IVV A;  3JUN A;  4NPB A;  4X2H A;  4HJL B;  2F98 A;  1E97 A;  2JQ5 A;  4BTY A;  1B2Z A;  5KP4 A;  3U97 A;  3K9M C;  4OUQ A;  3G8Z A;  2CC3 A;  4H61 A;  4GL6 A;  5KP3 A;  5IG4 A;  3HII A;  3D9R A;  1T3B A;  2CW9 A;  2KRT A;  3EN8 A;  1N5P A;  1BSA A;  3HX8 A;  5AYR B;  2OQE C;  2CK3 H;  4HAA A;  4O3V A;  4BIR A;  3WA3 A;  2W04 A;  1S72 3;  2OOV A;  1K9M 4;  2OTJ 3;  3UNL A;  2UUG C;  4HM5 B;  3LML A;  4K1V A;  2L4V A;  1RN7 A;  1UUV B;  6GSP A;  1CH0 A;  1TRQ A;  2WGQ A;  1N9J A;  3OWS A;  1YVB I;  3JUM A;  3WOD G;  1JN5 B;  1LNH A;  1SQW A;  2BMQ B;  2C10 A;  4R9L A;  3MYT A;  4EV5 A;  1W02 A;  5AEU B;  1Q82 4;  2F86 B;  2O3O A;  3CCR 3;  3CCU 3;  1NJI 4;  2RSX A;  4FMB A;  1JKG B;  3K63 A;  4JF8 A;  1LQM B;  1OF5 A;  1NO3 A;  2INX A;  1UGI A;  3NX0 A;  1BNR A;  2QEX 3;  3QRD A;  3CC2 3;  1IU7 A;  1FYS A;  3AGO A;  1NWW A;  3N8B A;  3ER7 A;  1J2B A;  1V58 A;  1TP6 A;  2HOH A;  1W6G A;  2W9Q A;  1M1K 4;  1SII A;  2ZHX B;  3B4O A;  5TGN A;  1RN1 A;  2IUK A;  3N54 B;  1W7C A;  3CXC 2;  3DGL A;  3WOF B;  2YFI B;  1PFP A;  2K3D A;  4HOH A;  2IA7 A;  2F5W A;  3D3L A;  5FW5 A;  1R4Y A;  1BNE A;  1BNS A;  1CYV A;  1RNT A;  1B21 A;  1BOX A;  1BRK A;  4O02 B;  1TU5 A;  3DUK A;  3CC7 3;  2JDI H;  1QVF 2;  1RGL A;  1W01 A;  1T2H A;  3RDE A;  1D6Z A;  3EJV A;  1BVI A;  3B7C A;  2BIR A;  2CFL A;  1OUN A;  1VQQ A;  2BU4 A;  4K1U A;  3MHE A;  2CG1 A;  2KXG A;  1TJD A;  3DXO A;  2CX0 A;  2CKF B;  4PEJ A;  1VQL 3;  3X3Y A;  3PZW A;  4EC6 A;  5EVH A;  4HM2 B;  6STD A;  5JPP A;  2E2U A;  1T2I A;  1BSB A;  1OGX A;  1STF I;  2J8X B;  5D81 A;  3BNE A;  5IG3 A;  1SPU A;  3JVC A;  2F99 A;  1DVC A;  3OXA A;  1JN5 A;  5CF1 A;  1VQ6 3;  5STD A;  4BTW A;  1B20 A;  1UCJ A;  1ISK A;  1IDP A;  3HK4 A;  3PGB A;  3AHS A;  3FLJ A;  1YIT 3;  1MWR A;  1LOY A;  1HZ1 A;  4J5G A;  1K8A 4;  1LVN A;  1BAN A;  1RDS A;  3VF1 A;  1JBT A;  1BRI A;  2ML5 A;  3PYJ A;  2FGT A;  2CFG A;  1GD4 A;  3G0K A;  3MKI A;  4RNY A;  3NHX A;  4FMC A;  3D79 A;  3F14 A;  2Z77 A;  3G4S 3;  2KCD A;  4QWT A;  2V1L A;  1NU3 A;  1PYL A;  1O7W B;  4EV2 A;  2B1X B;  1FUS A;  2W0Q A;  1UCL A;  2D42 A;  2HML B;  1SIH A;  3V98 A;  2F56 A;  2GBX B;  3FH1 A;  3JUQ A;  4N6L A;  5KP1 A;  3KII A;  1YJ9 3;  2AAE A;  1JRQ A;  3NV0 B;  1IQ8 A;  3GRD A;  3O8Y A;  2W9P A;  1IVW A;  3S28 A;  1AVL A;  3JUP A;  4MMX B;  3I0Y A;  2GU1 A; 
#chains in the Genus database with same CATH homology
 2XH9 A;  1M9G A;  4OVM A;  1YJW 3;  1CYU A;  3RGR A;  3KSP A;  5IF6 A;  4KZ1 A;  3V92 A;  3LTC A;  2CWT A;  5IEO A;  1A90 A;  3MG3 A;  3LT8 A;  3CNM A;  5AII A;  3A76 A;  2OCT A;  4HM4 B;  5DRV A;  2HMK B;  1OAC A;  4XDV A;  1EQK A;  3J7Y d;  3DGN A;  1AR0 A;  1DYU A;  1VQK 3;  4AKZ A;  2HMM B;  3LH4 A;  3LTD A;  3S67 A;  1VQP 3;  1WNH A;  1K73 4;  3PCS A;  2IUJ A;  1O7M B;  2Z7A A;  4WP5 A;  3EE1 A;  1EKM A;  2OWP A;  3EF8 A;  3SOY A;  1QVG 2;  1JNQ A;  3F40 A;  1FGR A;  3X3Z A;  1OCV A;  3E99 A;  3NM2 A;  5AIH A;  4L8P A;  3DM8 A;  2MC8 A;  2W6J H;  3X40 A;  4FCM A;  1AVK A;  4CCV A;  1LOX A;  2CFD A;  4ORL A;  3CCL 3;  5CLK A;  1W4N A;  3EX9 A;  3CPW 2;  3SXX A;  3LZA A;  3KE7 A;  1CEW I;  1TUH A;  1VQM 3;  3IMA B;  4HM8 B;  1FGO A;  1FUW A;  2HMO B;  1VQ7 3;  2P0X A;  5LC6 A;  3Q2P A;  2BT3 A;  2WGO A;  4RBN A;  1OF5 B;  1Q81 4;  2PZV A;  3N9H A;  1VQ9 3;  2FXT A;  4K61 A;  1WTH A;  1K28 A;  3X41 A;  3FG1 A;  3FF2 A;  4AKY A;  4EBG A;  1DMM A;  1NB3 I;  2XF3 A;  2YFJ B;  3NBB A;  3FG3 A;  3I56 3;  1MOL A;  5I97 A;  3RGA A;  1UW1 A;  1WMP A;  1F8N A;  4Q53 A;  3H3H A;  2HMN B;  4MMZ B;  4LEH A;  4R9K A;  3ECF A;  4N6N B;  3SED A;  1STD A;  3F7S A;  4HVN A;  2O9U X;  4KFF A;  2WO0 A;  3ALA A;  3SX1 A;  2XFS A;  3BNB A;  1W2Z A;  1A2K A;  3LTA A;  2C11 A;  3T8N A;  2WOH A;  1KSI A;  1YI2 3;  4HM6 B;  1QAF A;  2UX0 A;  3K0Z A;  2A15 A;  3DMC A;  3DGM A;  3GWR A;  2RCD A;  2W56 B;  3CD6 3;  3LTB A;  1HU9 A;  3KN4 A;  5ELU A;  4XBY A;  3G71 3;  1Q42 A;  1O7P B;  1MNL A;  3BLZ A;  4FCZ A;  2QIY A;  4NRE A;  3FKA A;  4LMI A;  2CFK A;  3KZT A;  1IQY A;  4XB5 A;  3OV4 A;  1BUQ A;  3UB1 A;  3L0R A;  1UI7 A;  1S5A A;  3H51 A;  5G2G A;  1ROA A;  1FGM A;  2SBL A;  3LXU X;  3WMD A;  5IW9 A;  1IK3 A;  4FMD A;  3B8L A;  3LOY A;  4I4K A;  4NHF A;  1OHP A;  3GZY B;  2XEP A;  1T5Y A;  1TIJ A;  4WHA A;  4N6T A;  1NDO B;  1TFK A;  1A67 A;  3FF0 A;  3X42 A;  4R1K A;  5DRE A;  3B4P A;  1KWI A;  1GY5 A;  3CCM 3;  3EBY A;  1OPY A;  3EHC A;  3BB9 A;  1FA3 A;  3OWY A;  2P05 A;  4N6M A;  1DMN A;  1EA2 A;  2P09 A;  3Q90 A;  4KVH A;  4XBX A;  1VQN 3;  1OHS A;  1Z1S A;  1VQ5 3;  4R80 A;  4FMA A;  2I9W A;  2GBW B;  4STD A;  1GD3 A;  3BND A;  1N9E A;  2R4I A;  2XRX B;  4EXR A;  3WA2 X;  8CHO A;  1RKY A;  5CXO A;  3VGN A;  3CME 3;  1N8Q A;  3CNX A;  3EQQ B;  3IJE B;  2OTL 3;  2GU3 A;  1GY7 A;  4OK0 A;  3ROB A;  3S27 A;  1SJW A;  2CG0 A;  1ASK A;  1KD1 4;  3DGO A;  5HGR A;  2P38 A;  3CMA 3;  3G6E 3;  3OWU A;  4IT7 A;  4N6O B;  1IT8 A;  2XSH B;  4HM3 B;  1EG9 B;  1L5G B;  1R4C A;  5LC7 A;  3WOE B;  3FSD A;  4X2O A;  1YHQ 3;  2Y74 A;  1DVD A;  3JUO A;  5BVB A;  1U5O A;  4N6V 0;  1IV9 A;  3K5T A;  2ZDJ A;  4G1M B;  3U1W A;  4FR9 A;  5IER A;  3EC9 A;  2XGL A;  3F7X A;  1YIJ 3;  3NQZ A;  4O2H A;  2K0M A;  2K54 A;  4RZM A;  3WDG B;  2GEY A;  5AYS C;  2YX9 A;  3PCR A;  4L7K A;  1V74 A;  4N3V A;  4HM7 B;  3AMO A;  2BMR B;  2IMJ A;  1RRH A;  3NM7 A;  5JPU A;  3CC4 3;  5AEW B;  1QAK A;  3AMO B;  1VQ8 3;  2LYX A;  2Z6B A;  2P0M A;  3FG4 A;  4WYK A;  1GS3 A;  1GYB A;  1JKG A;  2D1W A;  3GAX A;  5AI1 A;  4FCJ A;  4ZM8 A;  2XGN A;  1IV7 A;  4MMY B;  5EQL A;  2RFR A;  3T8U A;  3HIG A;  5ELJ A;  1O7H B;  2CIU A;  1UI8 A;  3STD A;  2B24 B;  3CCJ 3;  1KQS 2;  3HI7 A;  3OW2 2;  5IG0 A;  3SVA A;  1NB5 I;  2LQV A;  1K41 A;  2WOF A;  3MWZ A;  2BMO B;  3NV0 A;  3X3X A;  2BNG A;  4L8O A;  1Y4K A;  1M90 4;  7STD A;  4KFE A;  3S29 A;  2GXF A;  3MG2 A;  2M7O A;  2Q07 A;  4WWU C;  3UL5 A;  3CU3 A;  1US1 A;  1E3V A;  1UUW B;  5AIG A;  3HZP A;  1W6Y A;  2CH9 A;  4HZ9 B;  3NXJ A;  3K7C A;  1VQO 3;  1IVX A;  3OX9 A;  1ROV A;  3IPT A;  4J9A A;  1TFO A;  3M8C A;  4J8T A;  3FGY A;  1CQS A;  3EN1 B;  3DY5 A;  3F9S A;  3GZR A;  4BTX A;  4JRF A;  2CWU A;  3CPO A;  2W03 A;  1QMA A;  1O7G B;  1ULI B;  3CCS 3;  1WMO A;  2XSO B;  4MJD A;  1KC8 4;  1Q86 4;  3PXM A;  1VZZ A;  3V99 A;  1ZO2 A;  4XM4 A;  1GY6 A;  3TDG A;  3F8H A;  3KSE D;  2MF7 A;  1WMN A;  4EYC A;  1G96 A;  2ML6 A;  2OOV C;  1M1X B;  5D83 A;  3GZB A;  3QK9 A;  2CHC A;  5JBS A;  3EB8 A;  1JB4 A;  4N6U A;  1WQL B;  4IIA A;  2E2T A;  1W6C A;  1HKX A;  2CWV A;  1W2B 2;  3NBJ A;  4WFO A;  1A2V A;  4U13 A;  3FZW A;  1ZX2 A;  3LYG A;  1RRL A;  2BO9 B;  4LZI A;  5D82 A;  3SOA A;  3G16 A;  1IQX A;  5FGO A;  3NQY A;  3MPH A;  1W5Z A;  1W00 A;  4K90 B;  2HMJ B;  1E3R A;  1D6Y A;  1ULJ B;  1RJO A;  5CF2 A;  1QJG A;  2CFW A;  4IPB A;  2Y73 A;  1YGE A;  2XR8 B;  4AEQ A;  2QGU A;  1Q40 A;  3NUV A;  2E2V A;  1VQ4 3;  3UJM A;  2YFL B;  2OQE A;  1DMQ A;  3DZL A;  3EBT A;  4LSO A;  1QAL A;  4GB5 A;  4HBR A;  4MEI A;  3MSO A;  3KKG A;  2PNC A;  2W56 A;  1Q7Y 4;  1PU4 A;  3Q1C A;  3SLU A;  1JV2 B;  4HKV B;  4XDW A;  1YJN 3;  4H3U A;  1JB5 A;  4XBT A;  5AIF A;  5IG5 A;  1AV4 A;  2Z76 A;  1N5H A;  1U8C B;  1OHO A;  3CCQ 3;  3S5C A;  2FNQ A;  4HM1 B;  4HM0 B;  5BXQ A;  2STD A;  2XFT A;  1O7N B;  1OGZ A;  1N8R 4;  1JB2 A;  5CK6 A;  1D6U A;  4WYK B;  3VSY A;  3MG1 A;  2ZL8 A;  1C7H A;  2W2C A;  4LGQ A;  1OH0 A;  1JJ2 2;  1IT7 A;  1FGQ A;  3CCV 3;  3PS8 A;  5IEN A;  1LXE A;  3T0U A;  4HZB B;  4CDL A;  5EEO A;  1FGT A;  3GZX B;  5A0O B;  3LT9 A;  4O8S A;  3NBR A;  3BNC A;  2BHM A;  4TX4 A;  3CCE 3;  2GEX A;  3F8X A;  1IVU A;  4KFD A;  4R4K A;  3I55 3;  3UL6 A;  3FCS B;  4HYZ A;  3KFQ C;  1Q40 B;  2RGQ A;  4RNZ A;  2QA4 3;  5IEP A;  1IVV A;  3JUN A;  4X2H A;  4HJL B;  2F98 A;  1E97 A;  2JQ5 A;  4BTY A;  5KP4 A;  3U97 A;  3K9M C;  4OUQ A;  3G8Z A;  2CC3 A;  4H61 A;  4GL6 A;  5KP3 A;  5IG4 A;  3HII A;  3D9R A;  2CW9 A;  2KRT A;  3EN8 A;  1N5P A;  3HX8 A;  5AYR B;  2OQE C;  2CK3 H;  4O3V A;  3WA3 A;  1S72 3;  2W04 A;  2OOV A;  1K9M 4;  2OTJ 3;  3UNL A;  4HM5 B;  3LML A;  4K1V A;  2L4V A;  1RN7 A;  1UUV B;  2WGQ A;  1N9J A;  3OWS A;  1YVB I;  3JUM A;  3WOD G;  1JN5 B;  1LNH A;  1SQW A;  2BMQ B;  2C10 A;  4R9L A;  3MYT A;  4EV5 A;  1W02 A;  5AEU B;  1Q82 4;  2F86 B;  2O3O A;  3CCR 3;  3CCU 3;  1NJI 4;  2RSX A;  4FMB A;  1JKG B;  3K63 A;  4JF8 A;  1OF5 A;  1NO3 A;  2INX A;  3NX0 A;  2QEX 3;  3QRD A;  3CC2 3;  1IU7 A;  1NWW A;  3N8B A;  3ER7 A;  1J2B A;  1TP6 A;  1W6G A;  2W9Q A;  1M1K 4;  1SII A;  3B4O A;  5TGN A;  2IUK A;  3N54 B;  1W7C A;  3CXC 2;  3DGL A;  3WOF B;  2YFI B;  1PFP A;  2IA7 A;  3D3L A;  5FW5 A;  1CYV A;  4O02 B;  1QVF 2;  1TU5 A;  3DUK A;  3CC7 3;  2JDI H;  1W01 A;  3RDE A;  1D6Z A;  3EJV A;  3B7C A;  2CFL A;  1OUN A;  4K1U A;  3MHE A;  2CG1 A;  2KXG A;  3DXO A;  4PEJ A;  2CKF B;  1VQL 3;  3X3Y A;  3PZW A;  4EC6 A;  5EVH A;  4HM2 B;  6STD A;  5JPP A;  2E2U A;  1OGX A;  1STF I;  5D81 A;  3BNE A;  5IG3 A;  1SPU A;  3JVC A;  2F99 A;  1DVC A;  3OXA A;  1JN5 A;  5CF1 A;  1VQ6 3;  5STD A;  4BTW A;  1ISK A;  1IDP A;  3HK4 A;  3PGB A;  3FLJ A;  1YIT 3;  1K8A 4;  1LVN A;  3VF1 A;  2ML5 A;  3PYJ A;  2FGT A;  2CFG A;  1GD4 A;  3G0K A;  3MKI A;  4RNY A;  3NHX A;  4FMC A;  3F14 A;  2Z77 A;  3G4S 3;  2KCD A;  4QWT A;  2V1L A;  1NU3 A;  1O7W B;  4EV2 A;  2B1X B;  2W0Q A;  3V98 A;  2D42 A;  2HML B;  1SIH A;  2GBX B;  3JUQ A;  3FH1 A;  4N6L A;  5KP1 A;  3KII A;  1YJ9 3;  1JRQ A;  3NV0 B;  1IQ8 A;  3GRD A;  3O8Y A;  2W9P A;  1IVW A;  3S28 A;  1AVL A;  3JUP A;  4MMX B;  3I0Y A;  2GU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...