5I97A

Structural analysis and inhibition of trae from the pkm101 type iv secretion system
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
143
structure length
143
Chain Sequence
b'TRDQTSYGDEIDKFWLTQYVIHRESYDFYSVQVDYTAVGLMSTPNVAESYQSKFKGRNGLDKVLGDSETTRVKINSVILDKPHGVATIRFTTVRRVRSNPVDDQPQRWIAIMGYEYKSLAMNAEQRYVNPLGFRVTSYRVNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conjugal transfer protein
publication title Structural Analysis and Inhibition of TraE from the pKM101 Type IV Secretion System.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Protein transport
total genus 41
structure length 143
sequence length 143
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.230 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5i97A00
5JBSA 4JF8A 5I97A 2CC3A 4KZ1A 4MEIA 4AKYA 2BHMA 4AKZA 4LSOA 4O3VA 4NHFA
chains in the Genus database with same CATH superfamily
4J5KA 1O7MB 3I0YA 1B2SA 1DMQA 3HOHA 1JB4A 3OWYA 4KVHA 1YIJ3 3EC9A 3CMA3 2WOHA 4HM5B 5FGOA 1RN7A 2JQ5A 1RGKA 1FGTA 1W02A 2WOFA 2O3OA 3D4AA 1CH0A 3PYJA 5AIIA 1JBTA 2XF3A 1T2IA 1IVXA 1US1A 1YJ93 2BMOB 2W56A 4HJLB 3G713 1FUWA 1TRQA 3GAXA 3G4S3 2B24B 2IYJA 2GBXB 5BVBA 1V74A 5AEUB 3F9SA 4JRFA 1ZX2A 2CHCA 7GSPA 1GOYA 1Q824 3AHWA 3Q3FA 3CPOA 1C54A 1PFPA 1BSBA 2QGUA 2W6JH 3NX0A 1T5YA 4L8OA 3F40A 5EQLA 4BU4A 1U8CB 2BT3A 1R4YA 2F56A 3G16A 1UUGB 3IPTA 3K63A 3CME3 1BRGA 1GMPA 3CCS3 1I3IA 1K28A 5DREA 2Z76A 2UUGC 4RBNA 1SIIA 1IVWA 3DXOA 3X41A 1JB2A 4R80A 4HM0B 1OF5A 3CNXA 3NXJA 1KD14 1ROVA 1GMQA 2ZA4A 1M1K4 1IV7A 1N9EA 3KFQC 2CKFB 5AIFA 1MOLA 4OK0A 1CYVA 1LOXA 1OF5B 3X42A 1O7GB 3MWZA 2UX0A 4N6LA 1KC84 1K8A4 3F14A 2WGOA 3KSPA 3EE1A 5JPUA 1AVKA 4BIRA 2CFKA 5LC6A 2GEYA 1LQMB 1VQ63 1FGQA 5HGRA 1BRIA 3FG4A 3NUVA 3SOYA 2BU4A 1Q814 3V99A 1RGEA 1UI7A 3DGOA 1JBRA 3UJMA 2GEXA 1BRKA 2WO0A 4MMYB 4N6OB 1AV4A 3GZBA 1VQ83 3LOYA 5CK6A 3E99A 3G0KA 1QJGA 4XDWA 1YIT3 3NQYA 4FMCA 3LMLA 1FUTA 4LZIA 1K41A 4MJDA 2F5MA 3AMOA 3MG1A 2UGIA 3PCSA 1NWWA 3MKIA 1B2XA 1IQXA 2RCDA 3A76A 1LNIA 4I5QA 4N3VA 5LC7A 3RNTA 3WOFB 2OQEC 4IIAA 2CFDA 3HK4A 1I8VA 2C4BA 5G2GA 1GSPA 3DGMA 3UL5A 1RGLA 1VQ93 4EW5A 1UDII 2MF7A 1TFKA 5GSPA 5IEOA 5AYSC 2F4YA 3GWRA 1JN5A 4I4KA 3OWSA 3WOEB 2F86B 2HMLB 5I97A 5AIHA 1N8QA 2PNCA 2SARA 3D5IA 3B4OA 1QVG2 4CJNA 3LTDA 4KFEA 1BAOA 1O7WB 1E3VA 3WHOA 2F99A 2YFIB 5G1KA 1JN5B 1BRJA 3S27A 1JRQA 1NDOB 3B4PA 1EA2A 1W00A 3UNLA 5CF2A 2L4VA 1UI8A 7RNTA 1Q7Y4 1BRHA 3PCRA 3KZTA 1OHPA 2IMJA 6GSPA 1T3BA 1PY3A 3NV0A 1CEWI 3CCM3 2KF6A 3OW22 1W01A 3EJVA 1AY7A 1E97A 1Q42A 4EBGA 1B21A 3IJEB 4HVNA 4K90B 1NNVA 3DUKA 1IK3A 4GHOA 1BNGA 8RNTA 4CDLA 1UCIA 1JZDA 4BTXA 1OGZA 1I2GA 3FF0A 1D6YA 2KF4A 3NBRA 4L7KA 2P05A 4Q53A 2R41A 1VQO3 2OQEA 3CC23 1IYYA 2GSPA 1DVCA 1X1UA 2D1WA 1BVIA 1ULJB 2KAAA 1NJI4 3LT9A 5KP4A 1A90A 1BANA 1BSDA 3NBBA 1GD4A 4HZ9B 2OTL3 3AHSA 1PU4A 2Z7AA 3ZFZA 4RNTA 3OXAA 4O8SA 3HIIA 2YX9A 1OH0A 1TU5A 4XBYA 1L5GB 1OACA 2CFGA 2F98A 2KF5A 4FCZA 5IEPA 1RNBA 1IT7A 1DVDA 2STDA 1JZOA 2Z6BA 2O9UX 4HOHA 1RHLA 5BU4A 3JUPA 2HMMB 5IG0A 1KQS2 1BOXA 1RRHA 4ILFA 3DH2A 3BNEA 1RCLA 1NU3A 3DMCA 3H51A 1M1XB 5AI1A 3LH4A 1QMAA 2KCDA 3EN8A 3FF2A 3MYTA 2P38A 3NM2A 2CC3A 4HKVB 2IUJA 1S723 1G0TA 1Y4KA 4HM4B 1EEJA 1LRAA 2KF3A 2K54A 2E2UA 2XSOB 4KT3B 1RKYA 1LOWA 3G8ZA 1I2FA 4HM3B 1TUHA 1VQQA 1E3RA 3LT8A 3MHEA 4EV5A 3EBTA 4BTYA 2F5WA 1YGEA 5IERA 1UCJA 1X1WA 3LTBA 4OUQA 5M19A 1VZZA 3CU3A 4U13A 1FA3A 2ZDJA 1AQZA 1K734 3M8CA 3UB1A 1MWRA 5RNTA 4QWTA 1IQ8A 3FGYA 1FGMA 3Q2PA 4MEIA 5EVHA 3B7CA 3F7XA 1DMMA 5TGNA 8CHOA 1YI23 1N5HA 4X2OA 1B2ZA 1I2EA 2AAEA 3LXUX 4HM1B 2BIRA 3SVAA 1OCVA 1X1YA 2CFWA 4BL2A 1PYLA 1IT8A 1TTOA 1BUQA 3CCL3 2IUKA 2XR8B 3MG2A 5EEOA 1ZO2A 3VGNA 3WR2A 1GD3A 2HMOB 2CFLA 5IENA 3EB8A 1D6UA 1R4CA 4J8TA 5DRVA 1BSEA 3AGNA 5AIGA 4HAAA 2P0XA 3GZYB 1SIHA 3GZRA 1QVF2 4GL6A 2OTJ3 4O2HA 3CPW2 1YJW3 2Y73A 3DY5A 4MMZB 2E2VA 3KCHA 1HZ1A 1ZS7A 2CG0A 1GS3A 2CWUA 3GZXB 3CNMA 2BHMA 4AKZA 5KP3A 1QAFA 1JBSA 3EN1B 1ISKA 2E2TA 2CK3H 1W5ZA 4H61A 1I70A 5A0OB 2WGQA 3V98A 4RNYA 3FG3A 1NB3I 4NHFA 1MWSA 1EG9B 3SLUA 3SX1A 2GBWB 1LXEA 1B2UA 2W9PA 3OX9A 3T0UA 2OOVC 2R4IA 2W9QA 1RGAA 1GY7A 3FKAA 3X40A 1YHQ3 1UUVB 1IQYA 2IY2A 5JBSA 1AR0A 4N6UA 1Q7HA 5BXQA 2FNQA 3LZAA 5G1LA 2ML6A 3HZPA 1RCKA 4FMAA 1BNIA 3CCE3 3KKGA 1OPYA 1SARA 4R9KA 4N6TA 3X3ZA 1VQP3 2MC8A 3CCR3 2B1XB 1RLSA 1SQWA 1BRNL 4JF8A 1STDA 2GXFA 2LYXA 3O8YA 3PGBA 1W2ZA 1IVUA 1X1XA 1GY6A 4J5GA 4OVMA 5ELUA 4XDVA 2CWVA 2XRXB 3SOAA 1TRPA 3NHXA 1HYFA 4AKYA 3VF1A 2GU1A 1MNLA 1JB5A 1O7PB 5AYRB 1N8R4 5JPPA 4ORLA 1SJWA 3WA3A 1RRLA 4R1KA 2CW9A 3ZG0A 4K1UA 2INXA 3BU4A 2OOVA 1BRSA 3L0RA 1FYSA 3BIRA 1RSNA 1MWTA 1B2MA 3EQQB 1IU7A 3F8XA 3G6E3 1WMPA 3EF8A 3I553 1BGSA 4R9LA 3VSYA 2SBLA 2XGLA 4XM4A 5D82A 3TDGA 5IG5A 3K5TA 4WP5A 3X3XA 2Z77A 3NBJA 3OV4A 3BNDA 2OWPA 1VQ73 1A67A 1V58A 2K3DA 3DGNA 1FGOA 3KE7A 3Q1CA 4EYCA 2Y74A 3SXXA 4HZBB 1YVBI 1WNHA 1W4NA 2C11A 1FZUA 3Q90A 3MPHA 3FLJA 2A15A 4FMBA 4GB5A 1Q9EA 3K9MC 1BNEA 3RGRA 3EHCA 1K9M4 3FH1A 1MWUA 3GSPA 6RNTA 1VQ53 3FZWA 1JJ22 1BSAA 4MMXB 5D83A 1B3SA 1GMRA 3SYUA 3CCV3 1ROAA 4AEQA 1FGRA 3V92A 1M904 1YNVX 2CX1A 1MGRA 3WODG 2IA7A 3CCQ3 1NB5I 1TP6A 3ZG5A 3WA2X 4HM6B 4FCJA 2L1SA 1TIJA 4TX4A 1GY5A 2PZVA 3CCJ3 1ASKA 1STFI 3NQZA 3ER7A 3F8HA 5M1AA 4EV2A 2RBIA 5CXOA 1QALA 5IG3A 3S28A 1G96A 4IT7A 5IG4A 3S67A 2P0MA 1RNTA 1RTUA 1VQM3 4DKIA 2W03A 1J2BA 1CQSA 4XB5A 1DETA 2HMNB 1VQL3 1O7NB 3DGLA 4XBXA 3OWUA 2CG1A 1JKGB 1LNHA 2D42A 3A5EA 1BIRA 4HBRA 4BTWA 1DYUA 1EUIC 2W2CA 3N54B 4XBTA 1UCKA 3S29A 1V57A 2RSXA 3CC73 3J7Yd 3RDEA 1IDPA 3T8NA 1QAKA 1WQLB 2CH9A 4HYZA 4RNZA 1W6YA 3D9RA 1SPUA 4WYKA 1GOVA 3GRDA 2K0MA 3H3HA 2H0IA 3F7SA 3LTAA 1RDSA 5BIRA 1D6ZA 3BB9A 4WYKB 1M9GA 4R4KA 1AVLA 5D81A 2LQVA 3K7CA 2W56B 5CF1A 2ZL8A 3HIGA 3S5CA 3JUQA 3ROBA 5KP1A 2XSHB 3PZWA 1TFOA 4FMDA 2AADA 4O02B 2W0QA 4STDA 5ELJA 1C7HA 2XFTA 3KN4A 1S5AA 4LEHA 1BNRA 2Q07A 3HX8A 1W6GA 1LQGC 1EKMA 2XFSA 3EBYA 3BNBA 4L8PA 2QA43 1Q40A 3JVCA 3MSOA 3PXMA 2BMQB 2BMRB 2HMJB 2JDIH 3CC43 3LYGA 3FG1A 2ML5A 4NPBA 1LOYA 2OCTA 1JV2B 4KFDA 4HM8B 1W2B2 1BSCA 1RJOA 1BNSA 1BUJA 1Q40B 2RFRA 1W7CA 2FXTA 1O7HB 4NREA 1DE3A 3B8LA 2XH9A 1RMSA 2ZHXB 3N9HA 1RGHA 2QIYA 1TJDA 3D79A 1UCLA 2W04A 1IVVA 1VQK3 1Q864 1GYBA 2CIUA 2BO9B 2C10A 1B27A 1OUNA 2P09A 4EC6A 9RNTA 1I0VA 2M7OA 3IMAB 4WFOA 3BLZA 4EXRA 1N9JA 3ECFA 3JUMA 1RN4A 3CCU3 1WTHA 3T8UA 1GOUA 1I3FA 4KZ1A 2GU3A 3CD63 1KWIA 1UW1A 2BNGA 2I9WA 3EX9A 4KFFA 4LSOA 1Z1SA 5AEWB 1IV9A 2CWTA 3MG3A 3HI7A 4HM2B 4LGQA 4K61A 2KXGA 4K1VA 3QK9A 1RGGA 3BNCA 5IF6A 2XGNA 3WMDA 1RN1A 5HOHA 1CYUA 3ALAA 1BNFA 1BU4A 3AMOB 5STDA 6STDA 5IW9A 1BNJA 4FCMA 4J9AA 4CCVA 1WMNA 4N6V0 4O3VA 3DM8A 3DZLA 2CX0A 3LTCA 1I0XA 2YFJB 1W6CA 4WHAA 1OHOA 2H0GA 1OHSA 4PEJA 3FCSB 1G02A 3RGAA 3JUOA 3N8BA 1LOVA 1ULIB 5FW5A 1ZGXA 1A2VA 3AGOA 1F8NA 1A2KA 2YFLB 4HM7B 2XEPA 3NM7A 3CXC2 1YVSA 4X2HA 4WWUC 1VQN3 2QEX3 3PS8A 1HU9A 4N6NB 4LYLB 1UGHI 4H3UA 4RZMA 3WDGB 1KSIA 1UGIA 3D3LA 1WMOA 1UUWB 2RGQA 2FGTA 5CLKA 1T2HA 3JUNA 3KSED 3NV0B 3U97A 3I563 4N6MA 3UL6A 4ZM8A 1EQKA 1U5OA 2HMKB 3U1WA 4FR9A 7STDA 4IPBA 4BL3A 3X3YA 3URPA 1RGCA 3FSDA 1YJN3 1MGWA 4G1MB 1B20A 1OGXA 2RNTA 1RGFA 2KRTA 1LVNA 1A2PA 1DMNA 1FUSA 1HKXA 3STDA 4CPKA 1NO3A 1FW7A 1YGWA 2HOHA 2V1LA 3QRDA 3KIIA 4LMIA 1JKGA 3D5GA 2J8XB 4GSPA 3K0ZA 2H0HA 3SEDA 1JNQA 5M18A 3DGYA 1N5PA 1VQ43
chains in the Genus database with same CATH topology
1O7MB 3I0YA 1DMQA 1JB4A 3OWYA 4KVHA 1YIJ3 3EC9A 3CMA3 2WOHA 4HM5B 5FGOA 1RN7A 2JQ5A 1FGTA 1W02A 2WOFA 2O3OA 3PYJA 5AIIA 2XF3A 1IVXA 1US1A 1YJ93 2BMOB 2W56A 4HJLB 3G713 1FUWA 3GAXA 3G4S3 2B24B 2GBXB 5BVBA 1V74A 5AEUB 3F9SA 4JRFA 1ZX2A 2CHCA 1Q824 3CPOA 1PFPA 2W6JH 2QGUA 3NX0A 4L8OA 1T5YA 3F40A 5EQLA 1U8CB 2BT3A 3G16A 3IPTA 3CME3 3K63A 3CCS3 1K28A 5DREA 2Z76A 4RBNA 1SIIA 1IVWA 3DXOA 3X41A 1JB2A 4R80A 4HM0B 1OF5A 3CNXA 3NXJA 1KD14 1ROVA 1M1K4 1IV7A 1N9EA 3KFQC 2CKFB 5AIFA 1MOLA 4OK0A 1CYVA 1LOXA 1OF5B 3X42A 1O7GB 3MWZA 2UX0A 4N6LA 1KC84 1K8A4 3F14A 2WGOA 3KSPA 3EE1A 5JPUA 1AVKA 2CFKA 5LC6A 2GEYA 1VQ63 1FGQA 5HGRA 3FG4A 3NUVA 3SOYA 1Q814 3V99A 1UI7A 3DGOA 3UJMA 2GEXA 2WO0A 4MMYB 4N6OB 1AV4A 3GZBA 1VQ83 3LOYA 5CK6A 3E99A 3G0KA 1QJGA 4XDWA 1YIT3 3NQYA 4FMCA 3LMLA 4LZIA 1K41A 4MJDA 3AMOA 3MG1A 3PCSA 1NWWA 3MKIA 1IQXA 2RCDA 1A67A 3A76A 4N3VA 3WOFB 5LC7A 2OQEC 4IIAA 2CFDA 3HK4A 5G2GA 3DGMA 3UL5A 1VQ93 2MF7A 1TFKA 5IEOA 5AYSC 3GWRA 1JN5A 4I4KA 3OWSA 3WOEB 2F86B 2HMLB 5I97A 5AIHA 1N8QA 2PNCA 3B4OA 1QVG2 3LTDA 4KFEA 1O7WB 1E3VA 2F99A 2YFIB 1JN5B 3S27A 1JRQA 1NDOB 3B4PA 1EA2A 1W00A 3UNLA 5CF2A 2L4VA 1UI8A 1Q7Y4 3PCRA 3KZTA 1OHPA 2IMJA 3NV0A 3CCM3 1CEWI 3OW22 1W01A 3EJVA 1E97A 1Q42A 4EBGA 3IJEB 4HVNA 4K90B 1IK3A 3DUKA 4CDLA 4BTXA 1OGZA 3FF0A 1D6YA 3NBRA 4L7KA 2P05A 4Q53A 1VQO3 2OQEA 3CC23 1DVCA 2D1WA 1ULJB 1NJI4 3LT9A 5KP4A 1A90A 3NBBA 1GD4A 4HZ9B 2OTL3 1PU4A 2Z7AA 3OXAA 4O8SA 3HIIA 2YX9A 1OH0A 1TU5A 4XBYA 1L5GB 1OACA 2CFGA 2F98A 4FCZA 5IEPA 1IT7A 1DVDA 2STDA 2Z6BA 2O9UX 3JUPA 2HMMB 5IG0A 1KQS2 1RRHA 3BNEA 3DMCA 1NU3A 3H51A 1M1XB 5AI1A 3LH4A 1QMAA 2KCDA 3EN8A 3FF2A 3MYTA 2P38A 3NM2A 2CC3A 4HKVB 2IUJA 1S723 1Y4KA 4HM4B 2K54A 2E2UA 2XSOB 1RKYA 3G8ZA 4HM3B 1TUHA 1E3RA 3LT8A 3MHEA 4EV5A 3EBTA 4BTYA 1YGEA 5IERA 4OUQA 3LTBA 1VZZA 3CU3A 4U13A 1FA3A 2ZDJA 1K734 3M8CA 3UB1A 4QWTA 1IQ8A 3FGYA 1FGMA 3Q2PA 4MEIA 5EVHA 3B7CA 3F7XA 1DMMA 5TGNA 8CHOA 1YI23 1N5HA 4X2OA 3LXUX 4HM1B 3SVAA 1OCVA 2CFWA 1IT8A 1BUQA 3CCL3 2IUKA 2XR8B 3MG2A 5EEOA 1ZO2A 3VGNA 1GD3A 2HMOB 2CFLA 5IENA 3EB8A 1D6UA 1R4CA 4J8TA 5DRVA 5AIGA 2P0XA 3GZYB 1SIHA 3GZRA 1QVF2 4GL6A 2OTJ3 4O2HA 3CPW2 1YJW3 2Y73A 3DY5A 4MMZB 2E2VA 3GZXB 2CG0A 1GS3A 2CWUA 3CNMA 2BHMA 4AKZA 5KP3A 1QAFA 3EN1B 1ISKA 2E2TA 2CK3H 1W5ZA 4H61A 5A0OB 2WGQA 3V98A 4RNYA 3FG3A 1NB3I 4NHFA 3SX1A 1EG9B 3SLUA 2GBWB 1LXEA 2W9PA 3OX9A 3T0UA 2OOVC 2R4IA 2W9QA 3FKAA 1GY7A 3X40A 1YHQ3 1UUVB 1IQYA 5JBSA 1AR0A 4N6UA 5BXQA 2FNQA 3LZAA 2ML6A 3HZPA 4FMAA 3CCE3 3KKGA 1OPYA 4R9KA 4N6TA 3X3ZA 1VQP3 2MC8A 3CCR3 2B1XB 1SQWA 4JF8A 1STDA 2GXFA 2LYXA 3O8YA 3PGBA 1W2ZA 1IVUA 4OVMA 1GY6A 5ELUA 4XDVA 2CWVA 2XRXB 3SOAA 3NHXA 4AKYA 3VF1A 2GU1A 1MNLA 1JB5A 1O7PB 5AYRB 1N8R4 5JPPA 4ORLA 1SJWA 3WA3A 1RRLA 4R1KA 2CW9A 4K1UA 2INXA 2OOVA 3L0RA 3EQQB 1IU7A 3F8XA 3G6E3 1WMPA 3EF8A 3I553 4R9LA 3VSYA 2SBLA 2XGLA 4XM4A 5D82A 3TDGA 5IG5A 3K5TA 4WP5A 3X3XA 2Z77A 3NBJA 3OV4A 3BNDA 2OWPA 1VQ73 3DGNA 3KE7A 3Q1CA 1FGOA 4EYCA 2Y74A 3SXXA 4HZBB 1YVBI 1WNHA 1W4NA 2C11A 3Q90A 3MPHA 3FLJA 2A15A 4FMBA 4GB5A 3K9MC 3RGRA 3EHCA 1K9M4 3FH1A 1VQ53 3FZWA 1JJ22 4MMXB 5D83A 3CCV3 1ROAA 4AEQA 1FGRA 3V92A 1M904 3WODG 2IA7A 3CCQ3 1NB5I 1TP6A 3WA2X 4HM6B 4FCJA 4TX4A 1TIJA 1GY5A 2PZVA 3CCJ3 1ASKA 1STFI 3NQZA 3ER7A 3F8HA 4EV2A 5CXOA 1QALA 5IG3A 3S28A 1G96A 4IT7A 5IG4A 3S67A 2P0MA 1VQM3 1J2BA 2W03A 1CQSA 4XB5A 2HMNB 1VQL3 1O7NB 3DGLA 4XBXA 3OWUA 2CG1A 1JKGB 1LNHA 2D42A 4HBRA 4BTWA 1DYUA 2W2CA 3N54B 4XBTA 3S29A 2RSXA 3CC73 3J7Yd 3RDEA 1IDPA 3T8NA 1QAKA 1WQLB 2CH9A 4HYZA 4RNZA 1W6YA 3D9RA 1SPUA 4WYKA 3GRDA 2K0MA 3H3HA 3F7SA 3LTAA 1D6ZA 3BB9A 4WYKB 1M9GA 4R4KA 1AVLA 5D81A 2LQVA 3K7CA 2W56B 5CF1A 2ZL8A 3HIGA 3S5CA 3JUQA 3ROBA 5KP1A 2XSHB 3PZWA 1TFOA 4FMDA 4O02B 2W0QA 4STDA 5ELJA 1C7HA 2XFTA 3KN4A 1S5AA 4LEHA 2Q07A 3HX8A 1W6GA 1EKMA 2XFSA 3EBYA 3BNBA 4L8PA 2QA43 1Q40A 3JVCA 3MSOA 3PXMA 2BMQB 2BMRB 2HMJB 2JDIH 3CC43 3LYGA 3FG1A 2ML5A 2OCTA 1JV2B 4KFDA 4HM8B 1W2B2 1RJOA 1Q40B 2RFRA 1W7CA 2FXTA 1O7HB 4NREA 3B8LA 2XH9A 3N9HA 2QIYA 2W04A 1IVVA 1VQK3 1Q864 1GYBA 2CIUA 2BO9B 2C10A 1OUNA 2P09A 4EC6A 2M7OA 3IMAB 4WFOA 3BLZA 4EXRA 1N9JA 3ECFA 3JUMA 3CCU3 1WTHA 3T8UA 4KZ1A 2GU3A 3CD63 1KWIA 1UW1A 2BNGA 2I9WA 3EX9A 4KFFA 4LSOA 1Z1SA 5AEWB 1IV9A 2CWTA 3MG3A 3HI7A 4HM2B 4LGQA 4K61A 2KXGA 4K1VA 3QK9A 3BNCA 5IF6A 2XGNA 3WMDA 1CYUA 3ALAA 3AMOB 5STDA 6STDA 5IW9A 4FCMA 4J9AA 4CCVA 1WMNA 4N6V0 4O3VA 3DM8A 3DZLA 3LTCA 2YFJB 1W6CA 4WHAA 1OHOA 1OHSA 4PEJA 3FCSB 3RGAA 3JUOA 3N8BA 1ULIB 5FW5A 1A2VA 1F8NA 1A2KA 2YFLB 4HM7B 2XEPA 3NM7A 3CXC2 4X2HA 1VQN3 4WWUC 2QEX3 3PS8A 1HU9A 4N6NB 4H3UA 4RZMA 3WDGB 1KSIA 3D3LA 1WMOA 1UUWB 2RGQA 2FGTA 5CLKA 3JUNA 3KSED 3NV0B 3U97A 3I563 4N6MA 3UL6A 4ZM8A 1EQKA 1U5OA 2HMKB 3U1WA 4FR9A 7STDA 4IPBA 3X3YA 3FSDA 1YJN3 4G1MB 1OGXA 2KRTA 1LVNA 1DMNA 3STDA 1HKXA 1NO3A 2V1LA 3QRDA 3KIIA 4LMIA 1JKGA 3K0ZA 3SEDA 1JNQA 1N5PA 1VQ43
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JBS A;  4JF8 A;  5I97 A;  2CC3 A;  4KZ1 A;  4MEI A;  4AKY A;  2BHM A;  4AKZ A;  4LSO A;  4O3V A;  4NHF A; 
#chains in the Genus database with same CATH topology
 4J5K A;  1O7M B;  3I0Y A;  1B2S A;  1DMQ A;  3HOH A;  1JB4 A;  3OWY A;  4KVH A;  1YIJ 3;  3EC9 A;  3CMA 3;  2WOH A;  4HM5 B;  5FGO A;  1RN7 A;  2JQ5 A;  1RGK A;  1FGT A;  1W02 A;  2WOF A;  2O3O A;  3D4A A;  1CH0 A;  3PYJ A;  5AII A;  1JBT A;  2XF3 A;  1T2I A;  1IVX A;  1US1 A;  1YJ9 3;  2BMO B;  2W56 A;  4HJL B;  3G71 3;  1FUW A;  1TRQ A;  3GAX A;  3G4S 3;  2B24 B;  2IYJ A;  2GBX B;  5BVB A;  1V74 A;  5AEU B;  3F9S A;  4JRF A;  1ZX2 A;  2CHC A;  7GSP A;  1GOY A;  1Q82 4;  3AHW A;  3Q3F A;  3CPO A;  1C54 A;  1PFP A;  1BSB A;  2QGU A;  2W6J H;  3NX0 A;  1T5Y A;  4L8O A;  3F40 A;  5EQL A;  4BU4 A;  1U8C B;  2BT3 A;  1R4Y A;  2F56 A;  3G16 A;  1UUG B;  3IPT A;  3K63 A;  3CME 3;  1BRG A;  1GMP A;  3CCS 3;  1I3I A;  1K28 A;  5DRE A;  2Z76 A;  2UUG C;  4RBN A;  1SII A;  1IVW A;  3DXO A;  3X41 A;  1JB2 A;  4R80 A;  4HM0 B;  1OF5 A;  3CNX A;  3NXJ A;  1KD1 4;  1ROV A;  1GMQ A;  2ZA4 A;  1M1K 4;  1IV7 A;  1N9E A;  3KFQ C;  2CKF B;  5AIF A;  1MOL A;  4OK0 A;  1CYV A;  1LOX A;  1OF5 B;  3X42 A;  1O7G B;  3MWZ A;  2UX0 A;  4N6L A;  1KC8 4;  1K8A 4;  3F14 A;  2WGO A;  3KSP A;  3EE1 A;  5JPU A;  1AVK A;  4BIR A;  2CFK A;  5LC6 A;  2GEY A;  1LQM B;  1VQ6 3;  1FGQ A;  5HGR A;  1BRI A;  3FG4 A;  3NUV A;  3SOY A;  2BU4 A;  1Q81 4;  3V99 A;  1RGE A;  1UI7 A;  3DGO A;  1JBR A;  3UJM A;  2GEX A;  1BRK A;  2WO0 A;  4MMY B;  4N6O B;  1AV4 A;  3GZB A;  1VQ8 3;  3LOY A;  5CK6 A;  3E99 A;  3G0K A;  1QJG A;  4XDW A;  1YIT 3;  3NQY A;  4FMC A;  3LML A;  1FUT A;  4LZI A;  1K41 A;  4MJD A;  2F5M A;  3AMO A;  3MG1 A;  2UGI A;  3PCS A;  1NWW A;  3MKI A;  1B2X A;  1IQX A;  2RCD A;  3A76 A;  1LNI A;  4I5Q A;  4N3V A;  5LC7 A;  3RNT A;  3WOF B;  2OQE C;  4IIA A;  2CFD A;  3HK4 A;  1I8V A;  2C4B A;  5G2G A;  1GSP A;  3DGM A;  3UL5 A;  1RGL A;  1VQ9 3;  4EW5 A;  1UDI I;  2MF7 A;  1TFK A;  5GSP A;  5IEO A;  5AYS C;  2F4Y A;  3GWR A;  1JN5 A;  4I4K A;  3OWS A;  3WOE B;  2F86 B;  2HML B;  5I97 A;  5AIH A;  1N8Q A;  2PNC A;  2SAR A;  3D5I A;  3B4O A;  1QVG 2;  4CJN A;  3LTD A;  4KFE A;  1BAO A;  1O7W B;  1E3V A;  3WHO A;  2F99 A;  2YFI B;  5G1K A;  1JN5 B;  1BRJ A;  3S27 A;  1JRQ A;  1NDO B;  3B4P A;  1EA2 A;  1W00 A;  3UNL A;  5CF2 A;  2L4V A;  1UI8 A;  7RNT A;  1Q7Y 4;  1BRH A;  3PCR A;  3KZT A;  1OHP A;  2IMJ A;  6GSP A;  1T3B A;  1PY3 A;  3NV0 A;  1CEW I;  3CCM 3;  2KF6 A;  3OW2 2;  1W01 A;  3EJV A;  1AY7 A;  1E97 A;  1Q42 A;  4EBG A;  1B21 A;  3IJE B;  4HVN A;  4K90 B;  1NNV A;  3DUK A;  1IK3 A;  4GHO A;  1BNG A;  8RNT A;  4CDL A;  1UCI A;  1JZD A;  4BTX A;  1OGZ A;  1I2G A;  3FF0 A;  1D6Y A;  2KF4 A;  3NBR A;  4L7K A;  2P05 A;  4Q53 A;  2R41 A;  1VQO 3;  2OQE A;  3CC2 3;  1IYY A;  2GSP A;  1DVC A;  1X1U A;  2D1W A;  1BVI A;  1ULJ B;  2KAA A;  1NJI 4;  3LT9 A;  5KP4 A;  1A90 A;  1BAN A;  1BSD A;  3NBB A;  1GD4 A;  4HZ9 B;  2OTL 3;  3AHS A;  1PU4 A;  2Z7A A;  3ZFZ A;  4RNT A;  3OXA A;  4O8S A;  3HII A;  2YX9 A;  1OH0 A;  1TU5 A;  4XBY A;  1L5G B;  1OAC A;  2CFG A;  2F98 A;  2KF5 A;  4FCZ A;  5IEP A;  1RNB A;  1IT7 A;  1DVD A;  2STD A;  1JZO A;  2Z6B A;  2O9U X;  4HOH A;  1RHL A;  5BU4 A;  3JUP A;  2HMM B;  5IG0 A;  1KQS 2;  1BOX A;  1RRH A;  4ILF A;  3DH2 A;  3BNE A;  1RCL A;  1NU3 A;  3DMC A;  3H51 A;  1M1X B;  5AI1 A;  3LH4 A;  1QMA A;  2KCD A;  3EN8 A;  3FF2 A;  3MYT A;  2P38 A;  3NM2 A;  2CC3 A;  4HKV B;  2IUJ A;  1S72 3;  1G0T A;  1Y4K A;  4HM4 B;  1EEJ A;  1LRA A;  2KF3 A;  2K54 A;  2E2U A;  2XSO B;  4KT3 B;  1RKY A;  1LOW A;  3G8Z A;  1I2F A;  4HM3 B;  1TUH A;  1VQQ A;  1E3R A;  3LT8 A;  3MHE A;  4EV5 A;  3EBT A;  4BTY A;  2F5W A;  1YGE A;  5IER A;  1UCJ A;  1X1W A;  3LTB A;  4OUQ A;  5M19 A;  1VZZ A;  3CU3 A;  4U13 A;  1FA3 A;  2ZDJ A;  1AQZ A;  1K73 4;  3M8C A;  3UB1 A;  1MWR A;  5RNT A;  4QWT A;  1IQ8 A;  3FGY A;  1FGM A;  3Q2P A;  4MEI A;  5EVH A;  3B7C A;  3F7X A;  1DMM A;  5TGN A;  8CHO A;  1YI2 3;  1N5H A;  4X2O A;  1B2Z A;  1I2E A;  2AAE A;  3LXU X;  4HM1 B;  2BIR A;  3SVA A;  1OCV A;  1X1Y A;  2CFW A;  4BL2 A;  1PYL A;  1IT8 A;  1TTO A;  1BUQ A;  3CCL 3;  2IUK A;  2XR8 B;  3MG2 A;  5EEO A;  1ZO2 A;  3VGN A;  3WR2 A;  1GD3 A;  2HMO B;  2CFL A;  5IEN A;  3EB8 A;  1D6U A;  1R4C A;  4J8T A;  5DRV A;  1BSE A;  3AGN A;  5AIG A;  4HAA A;  2P0X A;  3GZY B;  1SIH A;  3GZR A;  1QVF 2;  4GL6 A;  2OTJ 3;  4O2H A;  3CPW 2;  1YJW 3;  2Y73 A;  3DY5 A;  4MMZ B;  2E2V A;  3KCH A;  1HZ1 A;  1ZS7 A;  2CG0 A;  1GS3 A;  2CWU A;  3GZX B;  3CNM A;  2BHM A;  4AKZ A;  5KP3 A;  1QAF A;  1JBS A;  3EN1 B;  1ISK A;  2E2T A;  2CK3 H;  1W5Z A;  4H61 A;  1I70 A;  5A0O B;  2WGQ A;  3V98 A;  4RNY A;  3FG3 A;  1NB3 I;  4NHF A;  1MWS A;  1EG9 B;  3SLU A;  3SX1 A;  2GBW B;  1LXE A;  1B2U A;  2W9P A;  3OX9 A;  3T0U A;  2OOV C;  2R4I A;  2W9Q A;  1RGA A;  1GY7 A;  3FKA A;  3X40 A;  1YHQ 3;  1UUV B;  1IQY A;  2IY2 A;  5JBS A;  1AR0 A;  4N6U A;  1Q7H A;  5BXQ A;  2FNQ A;  3LZA A;  5G1L A;  2ML6 A;  3HZP A;  1RCK A;  4FMA A;  1BNI A;  3CCE 3;  3KKG A;  1OPY A;  1SAR A;  4R9K A;  4N6T A;  3X3Z A;  1VQP 3;  2MC8 A;  3CCR 3;  2B1X B;  1RLS A;  1SQW A;  1BRN L;  4JF8 A;  1STD A;  2GXF A;  2LYX A;  3O8Y A;  3PGB A;  1W2Z A;  1IVU A;  1X1X A;  1GY6 A;  4J5G A;  4OVM A;  5ELU A;  4XDV A;  2CWV A;  2XRX B;  3SOA A;  1TRP A;  3NHX A;  1HYF A;  4AKY A;  3VF1 A;  2GU1 A;  1MNL A;  1JB5 A;  1O7P B;  5AYR B;  1N8R 4;  5JPP A;  4ORL A;  1SJW A;  3WA3 A;  1RRL A;  4R1K A;  2CW9 A;  3ZG0 A;  4K1U A;  2INX A;  3BU4 A;  2OOV A;  1BRS A;  3L0R A;  1FYS A;  3BIR A;  1RSN A;  1MWT A;  1B2M A;  3EQQ B;  1IU7 A;  3F8X A;  3G6E 3;  1WMP A;  3EF8 A;  3I55 3;  1BGS A;  4R9L A;  3VSY A;  2SBL A;  2XGL A;  4XM4 A;  5D82 A;  3TDG A;  5IG5 A;  3K5T A;  4WP5 A;  3X3X A;  2Z77 A;  3NBJ A;  3OV4 A;  3BND A;  2OWP A;  1VQ7 3;  1A67 A;  1V58 A;  2K3D A;  3DGN A;  1FGO A;  3KE7 A;  3Q1C A;  4EYC A;  2Y74 A;  3SXX A;  4HZB B;  1YVB I;  1WNH A;  1W4N A;  2C11 A;  1FZU A;  3Q90 A;  3MPH A;  3FLJ A;  2A15 A;  4FMB A;  4GB5 A;  1Q9E A;  3K9M C;  1BNE A;  3RGR A;  3EHC A;  1K9M 4;  3FH1 A;  1MWU A;  3GSP A;  6RNT A;  1VQ5 3;  3FZW A;  1JJ2 2;  1BSA A;  4MMX B;  5D83 A;  1B3S A;  1GMR A;  3SYU A;  3CCV 3;  1ROA A;  4AEQ A;  1FGR A;  3V92 A;  1M90 4;  1YNV X;  2CX1 A;  1MGR A;  3WOD G;  2IA7 A;  3CCQ 3;  1NB5 I;  1TP6 A;  3ZG5 A;  3WA2 X;  4HM6 B;  4FCJ A;  2L1S A;  1TIJ A;  4TX4 A;  1GY5 A;  2PZV A;  3CCJ 3;  1ASK A;  1STF I;  3NQZ A;  3ER7 A;  3F8H A;  5M1A A;  4EV2 A;  2RBI A;  5CXO A;  1QAL A;  5IG3 A;  3S28 A;  1G96 A;  4IT7 A;  5IG4 A;  3S67 A;  2P0M A;  1RNT A;  1RTU A;  1VQM 3;  4DKI A;  2W03 A;  1J2B A;  1CQS A;  4XB5 A;  1DET A;  2HMN B;  1VQL 3;  1O7N B;  3DGL A;  4XBX A;  3OWU A;  2CG1 A;  1JKG B;  1LNH A;  2D42 A;  3A5E A;  1BIR A;  4HBR A;  4BTW A;  1DYU A;  1EUI C;  2W2C A;  3N54 B;  4XBT A;  1UCK A;  3S29 A;  1V57 A;  2RSX A;  3CC7 3;  3J7Y d;  3RDE A;  1IDP A;  3T8N A;  1QAK A;  1WQL B;  2CH9 A;  4HYZ A;  4RNZ A;  1W6Y A;  3D9R A;  1SPU A;  4WYK A;  1GOV A;  3GRD A;  2K0M A;  3H3H A;  2H0I A;  3F7S A;  3LTA A;  1RDS A;  5BIR A;  1D6Z A;  3BB9 A;  4WYK B;  1M9G A;  4R4K A;  1AVL A;  5D81 A;  2LQV A;  3K7C A;  2W56 B;  5CF1 A;  2ZL8 A;  3HIG A;  3S5C A;  3JUQ A;  3ROB A;  5KP1 A;  2XSH B;  3PZW A;  1TFO A;  4FMD A;  2AAD A;  4O02 B;  2W0Q A;  4STD A;  5ELJ A;  1C7H A;  2XFT A;  3KN4 A;  1S5A A;  4LEH A;  1BNR A;  2Q07 A;  3HX8 A;  1W6G A;  1LQG C;  1EKM A;  2XFS A;  3EBY A;  3BNB A;  4L8P A;  2QA4 3;  1Q40 A;  3JVC A;  3MSO A;  3PXM A;  2BMQ B;  2BMR B;  2HMJ B;  2JDI H;  3CC4 3;  3LYG A;  3FG1 A;  2ML5 A;  4NPB A;  1LOY A;  2OCT A;  1JV2 B;  4KFD A;  4HM8 B;  1W2B 2;  1BSC A;  1RJO A;  1BNS A;  1BUJ A;  1Q40 B;  2RFR A;  1W7C A;  2FXT A;  1O7H B;  4NRE A;  1DE3 A;  3B8L A;  2XH9 A;  1RMS A;  2ZHX B;  3N9H A;  1RGH A;  2QIY A;  1TJD A;  3D79 A;  1UCL A;  2W04 A;  1IVV A;  1VQK 3;  1Q86 4;  1GYB A;  2CIU A;  2BO9 B;  2C10 A;  1B27 A;  1OUN A;  2P09 A;  4EC6 A;  9RNT A;  1I0V A;  2M7O A;  3IMA B;  4WFO A;  3BLZ A;  4EXR A;  1N9J A;  3ECF A;  3JUM A;  1RN4 A;  3CCU 3;  1WTH A;  3T8U A;  1GOU A;  1I3F A;  4KZ1 A;  2GU3 A;  3CD6 3;  1KWI A;  1UW1 A;  2BNG A;  2I9W A;  3EX9 A;  4KFF A;  4LSO A;  1Z1S A;  5AEW B;  1IV9 A;  2CWT A;  3MG3 A;  3HI7 A;  4HM2 B;  4LGQ A;  4K61 A;  2KXG A;  4K1V A;  3QK9 A;  1RGG A;  3BNC A;  5IF6 A;  2XGN A;  3WMD A;  1RN1 A;  5HOH A;  1CYU A;  3ALA A;  1BNF A;  1BU4 A;  3AMO B;  5STD A;  6STD A;  5IW9 A;  1BNJ A;  4FCM A;  4J9A A;  4CCV A;  1WMN A;  4N6V 0;  4O3V A;  3DM8 A;  3DZL A;  2CX0 A;  3LTC A;  1I0X A;  2YFJ B;  1W6C A;  4WHA A;  1OHO A;  2H0G A;  1OHS A;  4PEJ A;  3FCS B;  1G02 A;  3RGA A;  3JUO A;  3N8B A;  1LOV A;  1ULI B;  5FW5 A;  1ZGX A;  1A2V A;  3AGO A;  1F8N A;  1A2K A;  2YFL B;  4HM7 B;  2XEP A;  3NM7 A;  3CXC 2;  1YVS A;  4X2H A;  4WWU C;  1VQN 3;  2QEX 3;  3PS8 A;  1HU9 A;  4N6N B;  4LYL B;  1UGH I;  4H3U A;  4RZM A;  3WDG B;  1KSI A;  1UGI A;  3D3L A;  1WMO A;  1UUW B;  2RGQ A;  2FGT A;  5CLK A;  1T2H A;  3JUN A;  3KSE D;  3NV0 B;  3U97 A;  3I56 3;  4N6M A;  3UL6 A;  4ZM8 A;  1EQK A;  1U5O A;  2HMK B;  3U1W A;  4FR9 A;  7STD A;  4IPB A;  4BL3 A;  3X3Y A;  3URP A;  1RGC A;  3FSD A;  1YJN 3;  1MGW A;  4G1M B;  1B20 A;  1OGX A;  2RNT A;  1RGF A;  2KRT A;  1LVN A;  1A2P A;  1DMN A;  1FUS A;  1HKX A;  3STD A;  4CPK A;  1NO3 A;  1FW7 A;  1YGW A;  2HOH A;  2V1L A;  3QRD A;  3KII A;  4LMI A;  1JKG A;  3D5G A;  2J8X B;  4GSP A;  3K0Z A;  2H0H A;  3SED A;  1JNQ A;  5M18 A;  3DGY A;  1N5P A;  1VQ4 3; 
#chains in the Genus database with same CATH homology
 1O7M B;  3I0Y A;  1DMQ A;  1JB4 A;  3OWY A;  4KVH A;  1YIJ 3;  3EC9 A;  3CMA 3;  2WOH A;  4HM5 B;  5FGO A;  1RN7 A;  2JQ5 A;  1FGT A;  1W02 A;  2WOF A;  2O3O A;  3PYJ A;  5AII A;  2XF3 A;  1IVX A;  1US1 A;  1YJ9 3;  2BMO B;  2W56 A;  4HJL B;  3G71 3;  1FUW A;  3GAX A;  3G4S 3;  2B24 B;  2GBX B;  5BVB A;  1V74 A;  5AEU B;  3F9S A;  4JRF A;  1ZX2 A;  2CHC A;  1Q82 4;  3CPO A;  1PFP A;  2W6J H;  2QGU A;  3NX0 A;  4L8O A;  1T5Y A;  3F40 A;  5EQL A;  1U8C B;  2BT3 A;  3G16 A;  3IPT A;  3CME 3;  3K63 A;  3CCS 3;  1K28 A;  5DRE A;  2Z76 A;  4RBN A;  1SII A;  1IVW A;  3DXO A;  3X41 A;  1JB2 A;  4R80 A;  4HM0 B;  1OF5 A;  3CNX A;  3NXJ A;  1KD1 4;  1ROV A;  1M1K 4;  1IV7 A;  1N9E A;  3KFQ C;  2CKF B;  5AIF A;  1MOL A;  4OK0 A;  1CYV A;  1LOX A;  1OF5 B;  3X42 A;  1O7G B;  3MWZ A;  2UX0 A;  4N6L A;  1KC8 4;  1K8A 4;  3F14 A;  2WGO A;  3KSP A;  3EE1 A;  5JPU A;  1AVK A;  2CFK A;  5LC6 A;  2GEY A;  1VQ6 3;  1FGQ A;  5HGR A;  3FG4 A;  3NUV A;  3SOY A;  1Q81 4;  3V99 A;  1UI7 A;  3DGO A;  3UJM A;  2GEX A;  2WO0 A;  4MMY B;  4N6O B;  1AV4 A;  3GZB A;  1VQ8 3;  3LOY A;  5CK6 A;  3E99 A;  3G0K A;  1QJG A;  4XDW A;  1YIT 3;  3NQY A;  4FMC A;  3LML A;  4LZI A;  1K41 A;  4MJD A;  3AMO A;  3MG1 A;  3PCS A;  1NWW A;  3MKI A;  1IQX A;  2RCD A;  1A67 A;  3A76 A;  4N3V A;  3WOF B;  5LC7 A;  2OQE C;  4IIA A;  2CFD A;  3HK4 A;  5G2G A;  3DGM A;  3UL5 A;  1VQ9 3;  2MF7 A;  1TFK A;  5IEO A;  5AYS C;  3GWR A;  1JN5 A;  4I4K A;  3OWS A;  3WOE B;  2F86 B;  2HML B;  5I97 A;  5AIH A;  1N8Q A;  2PNC A;  3B4O A;  1QVG 2;  3LTD A;  4KFE A;  1O7W B;  1E3V A;  2F99 A;  2YFI B;  1JN5 B;  3S27 A;  1JRQ A;  1NDO B;  3B4P A;  1EA2 A;  1W00 A;  3UNL A;  5CF2 A;  2L4V A;  1UI8 A;  1Q7Y 4;  3PCR A;  3KZT A;  1OHP A;  2IMJ A;  3NV0 A;  3CCM 3;  1CEW I;  3OW2 2;  1W01 A;  3EJV A;  1E97 A;  1Q42 A;  4EBG A;  3IJE B;  4HVN A;  4K90 B;  1IK3 A;  3DUK A;  4CDL A;  4BTX A;  1OGZ A;  3FF0 A;  1D6Y A;  3NBR A;  4L7K A;  2P05 A;  4Q53 A;  1VQO 3;  2OQE A;  3CC2 3;  1DVC A;  2D1W A;  1ULJ B;  1NJI 4;  3LT9 A;  5KP4 A;  1A90 A;  3NBB A;  1GD4 A;  4HZ9 B;  2OTL 3;  1PU4 A;  2Z7A A;  3OXA A;  4O8S A;  3HII A;  2YX9 A;  1OH0 A;  1TU5 A;  4XBY A;  1L5G B;  1OAC A;  2CFG A;  2F98 A;  4FCZ A;  5IEP A;  1IT7 A;  1DVD A;  2STD A;  2Z6B A;  2O9U X;  3JUP A;  2HMM B;  5IG0 A;  1KQS 2;  1RRH A;  3BNE A;  3DMC A;  1NU3 A;  3H51 A;  1M1X B;  5AI1 A;  3LH4 A;  1QMA A;  2KCD A;  3EN8 A;  3FF2 A;  3MYT A;  2P38 A;  3NM2 A;  2CC3 A;  4HKV B;  2IUJ A;  1S72 3;  1Y4K A;  4HM4 B;  2K54 A;  2E2U A;  2XSO B;  1RKY A;  3G8Z A;  4HM3 B;  1TUH A;  1E3R A;  3LT8 A;  3MHE A;  4EV5 A;  3EBT A;  4BTY A;  1YGE A;  5IER A;  4OUQ A;  3LTB A;  1VZZ A;  3CU3 A;  4U13 A;  1FA3 A;  2ZDJ A;  1K73 4;  3M8C A;  3UB1 A;  4QWT A;  1IQ8 A;  3FGY A;  1FGM A;  3Q2P A;  4MEI A;  5EVH A;  3B7C A;  3F7X A;  1DMM A;  5TGN A;  8CHO A;  1YI2 3;  1N5H A;  4X2O A;  3LXU X;  4HM1 B;  3SVA A;  1OCV A;  2CFW A;  1IT8 A;  1BUQ A;  3CCL 3;  2IUK A;  2XR8 B;  3MG2 A;  5EEO A;  1ZO2 A;  3VGN A;  1GD3 A;  2HMO B;  2CFL A;  5IEN A;  3EB8 A;  1D6U A;  1R4C A;  4J8T A;  5DRV A;  5AIG A;  2P0X A;  3GZY B;  1SIH A;  3GZR A;  1QVF 2;  4GL6 A;  2OTJ 3;  4O2H A;  3CPW 2;  1YJW 3;  2Y73 A;  3DY5 A;  4MMZ B;  2E2V A;  3GZX B;  2CG0 A;  1GS3 A;  2CWU A;  3CNM A;  2BHM A;  4AKZ A;  5KP3 A;  1QAF A;  3EN1 B;  1ISK A;  2E2T A;  2CK3 H;  1W5Z A;  4H61 A;  5A0O B;  2WGQ A;  3V98 A;  4RNY A;  3FG3 A;  1NB3 I;  4NHF A;  3SX1 A;  1EG9 B;  3SLU A;  2GBW B;  1LXE A;  2W9P A;  3OX9 A;  3T0U A;  2OOV C;  2R4I A;  2W9Q A;  3FKA A;  1GY7 A;  3X40 A;  1YHQ 3;  1UUV B;  1IQY A;  5JBS A;  1AR0 A;  4N6U A;  5BXQ A;  2FNQ A;  3LZA A;  2ML6 A;  3HZP A;  4FMA A;  3CCE 3;  3KKG A;  1OPY A;  4R9K A;  4N6T A;  3X3Z A;  1VQP 3;  2MC8 A;  3CCR 3;  2B1X B;  1SQW A;  4JF8 A;  1STD A;  2GXF A;  2LYX A;  3O8Y A;  3PGB A;  1W2Z A;  1IVU A;  4OVM A;  1GY6 A;  5ELU A;  4XDV A;  2CWV A;  2XRX B;  3SOA A;  3NHX A;  4AKY A;  3VF1 A;  2GU1 A;  1MNL A;  1JB5 A;  1O7P B;  5AYR B;  1N8R 4;  5JPP A;  4ORL A;  1SJW A;  3WA3 A;  1RRL A;  4R1K A;  2CW9 A;  4K1U A;  2INX A;  2OOV A;  3L0R A;  3EQQ B;  1IU7 A;  3F8X A;  3G6E 3;  1WMP A;  3EF8 A;  3I55 3;  4R9L A;  3VSY A;  2SBL A;  2XGL A;  4XM4 A;  5D82 A;  3TDG A;  5IG5 A;  3K5T A;  4WP5 A;  3X3X A;  2Z77 A;  3NBJ A;  3OV4 A;  3BND A;  2OWP A;  1VQ7 3;  3DGN A;  3KE7 A;  3Q1C A;  1FGO A;  4EYC A;  2Y74 A;  3SXX A;  4HZB B;  1YVB I;  1WNH A;  1W4N A;  2C11 A;  3Q90 A;  3MPH A;  3FLJ A;  2A15 A;  4FMB A;  4GB5 A;  3K9M C;  3RGR A;  3EHC A;  1K9M 4;  3FH1 A;  1VQ5 3;  3FZW A;  1JJ2 2;  4MMX B;  5D83 A;  3CCV 3;  1ROA A;  4AEQ A;  1FGR A;  3V92 A;  1M90 4;  3WOD G;  2IA7 A;  3CCQ 3;  1NB5 I;  1TP6 A;  3WA2 X;  4HM6 B;  4FCJ A;  4TX4 A;  1TIJ A;  1GY5 A;  2PZV A;  3CCJ 3;  1ASK A;  1STF I;  3NQZ A;  3ER7 A;  3F8H A;  4EV2 A;  5CXO A;  1QAL A;  5IG3 A;  3S28 A;  1G96 A;  4IT7 A;  5IG4 A;  3S67 A;  2P0M A;  1VQM 3;  1J2B A;  2W03 A;  1CQS A;  4XB5 A;  2HMN B;  1VQL 3;  1O7N B;  3DGL A;  4XBX A;  3OWU A;  2CG1 A;  1JKG B;  1LNH A;  2D42 A;  4HBR A;  4BTW A;  1DYU A;  2W2C A;  3N54 B;  4XBT A;  3S29 A;  2RSX A;  3CC7 3;  3J7Y d;  3RDE A;  1IDP A;  3T8N A;  1QAK A;  1WQL B;  2CH9 A;  4HYZ A;  4RNZ A;  1W6Y A;  3D9R A;  1SPU A;  4WYK A;  3GRD A;  2K0M A;  3H3H A;  3F7S A;  3LTA A;  1D6Z A;  3BB9 A;  4WYK B;  1M9G A;  4R4K A;  1AVL A;  5D81 A;  2LQV A;  3K7C A;  2W56 B;  5CF1 A;  2ZL8 A;  3HIG A;  3S5C A;  3JUQ A;  3ROB A;  5KP1 A;  2XSH B;  3PZW A;  1TFO A;  4FMD A;  4O02 B;  2W0Q A;  4STD A;  5ELJ A;  1C7H A;  2XFT A;  3KN4 A;  1S5A A;  4LEH A;  2Q07 A;  3HX8 A;  1W6G A;  1EKM A;  2XFS A;  3EBY A;  3BNB A;  4L8P A;  2QA4 3;  1Q40 A;  3JVC A;  3MSO A;  3PXM A;  2BMQ B;  2BMR B;  2HMJ B;  2JDI H;  3CC4 3;  3LYG A;  3FG1 A;  2ML5 A;  2OCT A;  1JV2 B;  4KFD A;  4HM8 B;  1W2B 2;  1RJO A;  1Q40 B;  2RFR A;  1W7C A;  2FXT A;  1O7H B;  4NRE A;  3B8L A;  2XH9 A;  3N9H A;  2QIY A;  2W04 A;  1IVV A;  1VQK 3;  1Q86 4;  1GYB A;  2CIU A;  2BO9 B;  2C10 A;  1OUN A;  2P09 A;  4EC6 A;  2M7O A;  3IMA B;  4WFO A;  3BLZ A;  4EXR A;  1N9J A;  3ECF A;  3JUM A;  3CCU 3;  1WTH A;  3T8U A;  4KZ1 A;  2GU3 A;  3CD6 3;  1KWI A;  1UW1 A;  2BNG A;  2I9W A;  3EX9 A;  4KFF A;  4LSO A;  1Z1S A;  5AEW B;  1IV9 A;  2CWT A;  3MG3 A;  3HI7 A;  4HM2 B;  4LGQ A;  4K61 A;  2KXG A;  4K1V A;  3QK9 A;  3BNC A;  5IF6 A;  2XGN A;  3WMD A;  1CYU A;  3ALA A;  3AMO B;  5STD A;  6STD A;  5IW9 A;  4FCM A;  4J9A A;  4CCV A;  1WMN A;  4N6V 0;  4O3V A;  3DM8 A;  3DZL A;  3LTC A;  2YFJ B;  1W6C A;  4WHA A;  1OHO A;  1OHS A;  4PEJ A;  3FCS B;  3RGA A;  3JUO A;  3N8B A;  1ULI B;  5FW5 A;  1A2V A;  1F8N A;  1A2K A;  2YFL B;  4HM7 B;  2XEP A;  3NM7 A;  3CXC 2;  4X2H A;  1VQN 3;  4WWU C;  2QEX 3;  3PS8 A;  1HU9 A;  4N6N B;  4H3U A;  4RZM A;  3WDG B;  1KSI A;  3D3L A;  1WMO A;  1UUW B;  2RGQ A;  2FGT A;  5CLK A;  3JUN A;  3KSE D;  3NV0 B;  3U97 A;  3I56 3;  4N6M A;  3UL6 A;  4ZM8 A;  1EQK A;  1U5O A;  2HMK B;  3U1W A;  4FR9 A;  7STD A;  4IPB A;  3X3Y A;  3FSD A;  1YJN 3;  4G1M B;  1OGX A;  2KRT A;  1LVN A;  1DMN A;  3STD A;  1HKX A;  1NO3 A;  2V1L A;  3QRD A;  3KII A;  4LMI A;  1JKG A;  3K0Z A;  3SED A;  1JNQ A;  1N5P A;  1VQ4 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...