5I9PA

Crystal structure of staphylococcal nuclease variant delta+phs t62h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9pA00
5C5LA 1STYA 4DU9A 2EYMA 2OEOA 2F0WA 5CC4A 4ZQ3A 3P75A 1KDCA 3OMCA 4B9XA 5KGUA 4ZUIA 1SYEA 3D8GA 3NUCA 4KHVA 5HGTA 5M9OA 1TR5A 3ITPA 2F0EA 2HQEA 1EY9A 2PQEA 3DMUA 5CV4A 4DGZA 4K5VA 2F0OA 5E1FA 3ERQA 4ID6A 5C5MA 3BDCA 4J6HA 3SK6A 4QF4A 2F0LA 3HEJA 1SNDA 3D4DA 3D4WA 5E3FA 2PW7A 5KEEA 5CR3A 1EZ8A 3MEHA 5CV6A 1EY6A 1STNA 2M00A 2PYKA 3H6MA 5F2DA 5I6YA 5IOCA 3NQTA 4B9WA 1SYGA 3MHBA 1F2MA 4IALA 3S9WA 4K6DA 3QOJA 5DEHA 2EYPA 2SOBA 4ME5A 1A3VA 1SYBA 4E6IA 3EVQA 3SK5A 2EYOA 2F0HA 4PMBA 3V2TA 5IGEA 3NK9A 4R8NA 4S3SA 3QB3A 4IZ8A 2EYJA 2PZUA 3MXPA 2F0VA 3SK8A 5IGGA 5IGBA 1JOQA 3T13A 1A2UA 1SYDA 3NP8A 5J1ZA 4F7XA 5CGKA 2F0SA 4KY7A 2EYLA 2F0FA 1ENCA 4H7BA 5KRUA 2ENBA 4KTAA 3LX0A 4NP5A 4MIUA 1SNMA 2RBMA 1AEXA 5CV5A 5DAUA 2F0PA 3TP7A 3TP8A 5J22A 1STGA 3BDLA 3EJIA 4K5WA 4NKLA 3RUZA 3MVVA 4IUNA 1JORA 5EGTA 3DHQA 2KHSA 4DFAA 3SR1A 5C4ZA 5IGDA 1EYDA 4KD4A 2EYHA 2F0JA 4PNYA 5C4HA 5IODA 3D6CA 5JAVA 3SHLA 4EQOA 2F3VA 4NMZA 4OL7A 2F0TA 5I9PA 2RKSA 4G57A 5IGFA 2F0NA 1STAA 3QOLA 2PZWA 1EQVA 1F2ZA 4TRDA 3TMEA 2KQ3A 4K2LA 1IHZA 4PMCA 1KAAA 2F0UA 3TP6A 1II3A 2EYFA 1STHA 5HURA 1SNOA 2EY1A 3OSOA 1F2YA 5IIFA 4KY5A 4I65A 2O4XA 5J39A 3P1HA 1U9RA 4WRDA 2F0MA 1A3TA 2EY2A 4QMGA 5CV7A 4HMIA 4J1MA 2F0GA 1EY0A 4RKLA 5CV9A 2PZTA 4KJNA 3U9OA 4EQPA 4KY6A 3E5SA 2NUCA 5C3WA 2EY5A 1EY5A 2EY6A 1KABA 3NHHA 1JOOA 1SNQA 4ZUJA 3C1FA 4YIJA 5C3XA 3MZ5A 4DF7A 2EXZA 1TT2A 4LAAA 1A2TA 4F8MA 4KJOA 3VA5A 5C6AA 4K2KA 5I9OA 1NSNS 5EKLA 3EROA 4NDXA 3SXHA 5IGCA 1SYCA 1STBA 2F3WA 4KD3A 4K8IA 3R3OA 3C1EA 4K5XA 2WACA 5EKKA 4HTHA 3NXWA 2SNMA 1NUCA 5K5PA 1EY7A 4HMJA 2OF1A 1KDAA 4ODGA 5ISRA 1KDBA 5KYLA 1JOKA 4RKBA 4EQNA 2QDBA 4K14A 3OMGA 1EYCA 5CV8A 4WORA 1EY4A 1RKNA 2PW5A 2SNSA 3OWFA 2F0IA 4N9TA 4QB4A 3PMFA 5I6WA 2F0QA 5KIXA 1SYFA 5KYIA 1EY8A 1SNPA 1SNCA 1TQOA 5JOBA 4K8JA 2F0DA 2OXPA 1A3UA 3TP5A 2F0KA 1EZ6A 2LKVA 3HZXA 4N9PA 3SK4A 1EYAA 1ENAA 3T16A 2RDFA 4KV6A 5NUCA 4EVOA
chains in the Genus database with same CATH superfamily
3I91A 4C3JH 1G51A 2JA6H 2XGTA 3WWVA 2UXCQ 5C3EG 4GKKQ 5ELEA 3ITPA 1LT6D 2HQEA 1I4PA 3O13A 3VR6A 1RL2A 5GQOA 3U4VA 3BDCA 1CI3M 1SR3A 4R9WA 2N3SA 2XRQD 4GKJQ 1FGBD 3BG3A 2NVYB 4A3JG 3S16B 4DUZQ 4E6IA 1TKWB 2B2VC 3SK5A 5ELDA 4PMBA 1PHJA 4X6AH 1X3PA 2Z9HA 1A2UA 2JA9A 3CQZH 2YV5A 3K0XA 4F7XA 3HG9A 4ZYSA 3NPPA 5C0XH 1MI2A 1GUTA 3TN2A 2RBMA 1GUNA 1V8QA 1NJIC 4O1NA 4UP7A 1R4PB 1PZID 4BBRB 4IJLA 5E4XA 1XMOL 4A3BG 3J7A5 1EYGA 3MXNA 3J81c 1LACA 1YBYA 1BBXC 2E74C 3S2HH 1LTBD 1X65A 3K7AH 3L2PA 3G71A 3SHLA 4OL7A 2UUBL 2A73B 4G57A 4XQQA 2R93B 1IL2A 5M3MH 4DN4M 1YEZA 1E2ZA 4C3JB 5E4WC 1BOSA 4I7AA 3HKZE 1IYJB 1QUQA 1U5KA 3HS0C 3K0YA 4KY5A 4DV7Q 4HJAA 1WD0A 4WRDA 2DJFC 2QKIC 3J7ZC 1VQ5A 2UXDQ 1O80A 2NVTH 1YVCA 1YNND 2XSCA 4A93H 4L6TB 4HIKA 3VA5A 3PO3G 5IGCA 3SXHA 5GAGC 1I3QH 2JEBI 4R4IA 2B63H 1BCPB 5EKKA 1PFBA 4JI1L 1VQPA 1FNWA 2K33A 5GAEC 4MN3A 4ME3A 1EOVA 4QY7A 3RR5A 4AYBE 1K3BC 5KYLA 4QCLA 3NELA 4OX9L 2LSSA 4BA2I 3OWFA 1Q3LA 2Y0SE 2G9HD 1G6ZA 1STEA 2LKVA 1HUNA 4FXKC 4GOPA 1WFQA 3S2HB 2N55A 3K7AB 1X56A 1FGUA 1VMCA 2WKDA 3NBHB 2K5NA 2F52A 3K6OA 5M3MB 1VQDA 1SE4A 4CDDC 4KI0A 3OW7A 4ID6A 4ULLA 1EOTA 4B3SQ 3PO2G 4IFDG 4M8AA 1F2MA 3KF8B 4HIDA 1Y1WG 3S15H 2SOBA 1IZ6A 5IGEA 3GTQB 4A93B 1WTQA 2LXJA 3MXPA 2VQEQ 1PYSB 1PTOF 2B2TC 1I3QB 1SYDA 3I4LA 2F0SA 3MXGA 1MD2D 1YJ9A 4KTAA 2HHHQ 1HCZA 1TWAH 5J3BA 2QA4A 4X62Q 1S4ZA 3BDLA 1RCVD 4XQJA 5EPKA 3F8TA 4RH6A 3URYA 3ULPA 3HOYB 2G5DA 1LTAD 4L63B 1QZGA 2VXWA 4P73A 1H9JA 1NR4A 1NMFA 2ALYB 5JAVA 4DV6Q 4PZ8A 4EQOA 4GZYC 5ELFA 4DV0L 4A3GH 2LS01 4OEMB 2NZ1D 1IL8A 4DAPA 4R4TA 4TRDA 4K6LA 2OT2A 4X64L 1J9OA 2L5TA 2EPBA 5IE8A 1STHA 1YNXA 1LTRD 2Q2UA 1KD1C 4LUOA 2O4XA 4RA8A 4RHRA 1FVIA 1CSQA 3Q22A 1SE2A 4DNIA 2EY6A 4BBRG 5C4XH 4C3IH 4YIJA 5JPMC 4EQ5A 3DM1A 3E6ZX 2ZJPA 3NWSA 1NSNS 2QDLA 3S15B 2EVBA 2L15A 3Q24A 3S2DH 2R93G 2SNMA 4BS9A 4HMJA 4C1NI 1PMRA 3KLWA 4C3JG 1B8AA 4AH6A 3M9BA 5BR8L 2MHVA 1NY4A 5LHY1 1WD1A 2EIFA 4OWTB 1TWAB 3ERSX 5EAYA 3RZOB 2RHQB 1FYCA 3G6EA 2AMCB 4HJ8A 1VCIA 2CH4A 1A3UA 2A69C 5FLXL 4JI3L 1YZ6A 2I46A 2A69D 2K01A 5CC4A 1QJOA 2SDFA 5E7NA 1KDCA 2Q2HA 1SEBD 1YNJC 2G9DA 4FDBA 4A3GB 1Q46A 5CORA 1EY9A 1YNJD 5C0XJ 5CV4A 1JICA 3F2DA 4GNXB 4HAEA 1I94Q 1ILPA 1CKMA 1ICFB 3HEJA 1SLJA 4O2DA 2E76C 3STBC 1HXYD 4H44C 2PYKA 5F2DA 3STBD 5C0XG 2UXCL 3MHBA 2K5DA 4F87A 1J8IA 2VL6A 4DK6C 1HJPA 5C4XB 3EVQA 4C3IB 2BE5C 2VW9A 2MGSA 2BE5D 3CW2C 1AZQA 2K5HA 1K8AC 2HCCA 1NCVA 2EYLA 2L0CA 4MZ9A 5M3MG 4LFBL 4DUZL 3QIAA 4K5WA 2K6AA 5G3LD 1D1KA 1HRJA 2XWJB 5CBEE 3TS0A 1ASZA 2KHSA 5HGQA 1EEID 5IYBH 2ZM6Q 1O7LA 5FO8B 1HTPA 1HNWQ 2EYHA 4B3TL 2RKSA 4FF3A 4LF4Q 4A93G 4WJ3M 4P74A 3A7AB 2AKWB 2X6LA 4PV1C 5JVH3 1EIGA 1M4VA 3Q8DA 2CCZA 1GHJA 1PTOC 3FPPA 1A3TA 4JOIC 4DR6L 3L7ZC 1PTOD 1ZXTA 3CHBD 4UPAA 4EX5A 1JJGA 4ZUJA 3NHHA 1JOOA 2IX3A 2CFMA 1L0YB 2PQAB 3F1ZA 1DXMA 3MZ5A 1NBWA 4RAUC 5FKAC 1TY0A 3HOYG 5FJ8H 1PLFA 2B2YC 5EKLA 5A2QL 2IHEA 4TKOB 2FFKB 2MP1A 1KL9A 2EOTA 4DV7L 4FF2A 2N49A 2QF7A 1R9TH 1EY7A 1PH9A 5M5WH 2D62A 3CPFA 1CUKA 2BA1A 2JE6I 4G7OC 4LFAL 4WORA 1VS0A 4QB4A 2PMZE 4Y52H 5HY6A 2E8GA 4R4CA 5JOBA 3T16A 2NN6H 4DU9A 4LF7Q 2M2LA 2ID0A 4KV6A 4JI6Q 1PFSA 4P71A 1Y8NB 5FLMH 4DR1L 3A8JE 1T5EA 5D65A 3QJYA 5IYCH 2OWOA 3P7JA 1YHBA 1KNEA 4DGZA 3W1BA 2ZXOA 3TS2A 3CRKC 2F0LA 3OPOA 4O0AA 4DK0A 1WTWA 2M00A 5IOCA 1D2BA 4GS3A 3J7AV 2EYPA 2FJ2A 2E2JH 4LFCQ 2F0HA 1LV9A 1IYUA 2ZJRA 2BDNA 4NPSA 2F0VA 3SK8A 3T1HQ 4L5RC 5BN4A 4B3SL 3DEPA 4WJWA 4LJZC 4A3GG 1R9TB 2L9HA 2NTSA 3GDEA 1ZKOA 3DWAA 4PMWA 3N52A 2VQEL 3E3XA 2NZOA 2A5HA 2KHJA 2TMPA 3MA2B 1ILQA 5C4XG 3AFQA 4C3IG 4X62L 2B3GA 3H0GB 1F9SA 4UY8C 1Q86C 3NBHA 2UUBQ 3PIOA 4A3JH 3HP3A 3ND9A 3UE1A 1S5BD 1EY0A 4FO2A 2LFNA 3C1FA 3MWYW 1YI2A 2K32A 1RODA 2A68C 3KF8A 4DXFA 4CDCC 2DY8A 1KTKA 4R8IA 4K8IA 2E2JB 4A4IA 2R61A 3R2TA 2X69A 3I3CA 1WVLA 2VY3A 5K5PA 3CRLC 3NSWA 3R93A 1IBMQ 4U673 3I73A 4RKBA 1XYIA 3CP0A 3CPWA 3H09A 4HIMA 1C0AA 4FF1A 2TSSA 1SYFA 1SNCA 5L37A 3KK7A 3D4RA 3BYTB 1EYAA 1SBBB 4DV1Q 4JI0Q 2EYMA 4HIOA 3TRZA 5JJZA 4ZUIA 4C1NK 5HGTA 1XMQQ 1QOHA 4A3EB 1UWVA 4K5VA 1AE3A 5E1FA 3FRPB 5C5MA 3AFPA 2RSNA 3CCJA 3I4NB 3FDTA 3NBIA 2QCPX 3GTJB 3LWUA 3D3RA 4L5QA 2JSOA 3C46A 3PO3H 1JMCA 2KEDA 1F77A 1SYGA 1QVCA 1L1OB 1E0BA 1Y1VH 4ZK9B 4GLVB 2A8VA 4K0KQ 5IYBG 1B4OA 1I94L 4IZ8A 1DOLA 4LK1C 3PF4A 1LLRD 4GOPC 1UEBA 5LMNQ 1RTNA 5KRUA 3FMCA 3PIO3 4G4KA 3LX0A 4QUFA 4DXGA 3EJIA 1XTDA 2L55A 3QR8A 3G4SA 1Q8KA 4CJ2C 2HCIA 5C4HA 1K9MC 2RHSB 4QL5A 1ONLA 1LABA 2XWBB 5FJ8G 2IPKD 2KJXA 2QEXA 2ZM6L 3A0JA 2AUKA 1M1KC 1PRTD 1EEFD 1W6JA 4QUCA 1HNWL 3DWPA 4FYDA 4ZKCB 2IL8A 4GNXA 1AFPA 2NUCA 2EY5A 1CZWA 2WIIB 2RVLA 2EXZA 1TT2A 1A2TA 1UAPA 4KKUA 1YJNA 1PYWD 2KCMA 2RDGA 3G6JB 1Y1VB 3BDOA 2WACA 2Z6BA 3IRBA 4DKAC 2NN6G 3E9IA 3H0GG 1IKMA 1X54A 1S40A 5FLXE 1EIYB 1XTCD 1VQCA 4B3RL 4N8X1 5IYCG 3OMGA 5T1GA 1EYCA 1WI5A 2SNSA 2NVYH 2QGQA 1SNPA 3KUPA 1ZEQX 1E2WA 3S1MH 3WOEA 1GVPA 1WTOA 5NUCA 1DONA 4DR7Q 4JG2A 1U0LA 4KKSA 1QNKA 4XTCS 4FNFA 2B2WA 3J80L 1P8LA 5K36H 3E0EA 1TVXA 2F0OA 1X3QA 2I5MX 1ASYA 4X3KA 5CYUA 3SK6A 1G8ZD 1O7YA 2JN4A 3DWQA 4WJ4A 5C4JB 2KA7A 3AU7A 3H15A 3CCMA 1SROA 1WTHA 3KJPA 2PQAA 4R1JA 4CGYB 2R93H 4A3CH 4S3SA 5IGBA 4F88A 4JI8L 3NP8A 1PH7A 1BCPF 1VQKA 1VQLA 3JC66 3CCSA 4C3HB 4MTNA 4A3EG 2AQ2B 4MIUA 4X66L 2F0PA 1QB5D 2KENA 4YWKA 4LFCL 2JXMB 2MUYA 3PUVA 5EBCA 2WB1B 2IJ0A 2CKZB 3T1HL 1SN8A 3I4NG 3HKSA 1KLUD 1EYDA 4B08A 2KUMA 4PNYA 1TS5A 4LFBQ 1KLGD 4KN4C 3U9SA 4JYAQ 3S1MB 2IW3A 2UU9Q 4JI5L 2ZT9C 3KLSA 3TMEA 3J80c 1II3A 4B3TQ 2KOLA 1QWYA 1J5EL 1B9NA 1RHPA 3UI2A 2EY2A 1J6QA 2CW0C 4RKLA 4CJ0B 1IBLL 3PSIA 3J81i 3JAML 3KJOA 1I4XA 2CW0D 1CHPD 3OIPA 4DV3Q 1K3RA 2Z4HA 4LF8Q 4NDXA 1CKNB 4DR6Q 2HD3A 1UE5A 2Z1CA 3R3OA 3NXWA 2K05A 2ZTDA 3DLLA 4OO1H 1A6XA 5DNFA 2D9UA 4LF5Q 3ONAB 2K04A 5ELNA 4LF6L 1FL0A 3LNNA 1EY4A 2C35B 2Z8LA 2E5LQ 3VDYA 1FJGL 1D8LA 5AJ3Q 3K57A 3K81C 2F0DA 2F0KA 3GTQH 2F03A 4MNOA 2YTVA 4IOAA 1IBML 2K75A 2JP1A 4LFAQ 1A0IA 2JQOA 5C44B 2Q2TA 3OMCA 1MJCA 5CMDA 4KHVA 1Y1VG 4ABNA 4LWCA 1S5FD 3A7LA 1XNQL 4NXNL 3D6WA 1HFGA 4DR1Q 1BBWA 1QCBD 4QF4A 4DV1L 4APVA 4JI0L 3EN2A 1V1PA 4XDXA 5AFWA 4KHZA 3HOYH 1GUOA 3MXUA 4DR4L 2B8FA 1XMQL 4BBSB 4JK1C 3JAMc 5DEHA 2RDHA 3I4MB 1SYBA 3K5MA 2L12A 5JJLA 2P5ZX 5DLQE 4OHJA 2B2UA 3MFGA 1CM9A 1Q7YC 3Q6SA 1SAPA 1AEXA 4M1UB 4K0KL 2MNAA 4XT1B 1JORA 2R92H 2A19A 1CQVA 5GADC 3UDIA 4JBMA 4KD4A 1PH8A 5LMNL 2D2CC 4DR3L 1MKHA 3CKIB 5I4DA 2QW7A 1STAA 4BY1H 1DOMA 2R3ZA 2KQ3A 3VYSA 4A3IH 3FVQA 4PMCA 1BNZA 5A35A 3P20A 5HURA 3RLOA 3OWEB 4IPCA 1DM0B 1JR0D 4JBJA 4I7ZC 4C3HG 3RZOH 2F0GA 1BCPC 5CV9A 4UDUC 2AWOA 1EY5A 1JQYD 1BCPD 3A74A 2WB1G 2F4VL 4N8FA 4DF7A 4HJ7A 1JB7A 3UDGA 2FINB 2DNCA 2KECA 1ET9A 4A75A 3S14H 4DA2A 1L1OA 2EXDA 3I55A 4ALPA 4K5XA 1JT8A 3EA6A 4TVAB 1Y8PB 2PCFB 1NUCA 1E1OA 1LT5D 4DAMA 1KDBA 1JOKA 3VR3A 4X65L 4KKTA 5K36G 2B8GA 4IOCA 1RKNA 4N9TA 1KNAA 5KIXA 3RMHA 1TQOA 2OXPA 3HZXA 2R92B 1ENAA 1VQMA 3HOVH 2F0WA 1Q90A 4JVZA 1VF7A 2KBNA 5D3IB 3D8GA 3NUCA 3T4AC 4X3SA 4JC0A 4IJHA 4A3CG 2AHOB 4BY1B 4RWSC 3IAYA 5LMUQ 4A3IB 4J6HA 1IW7C 1XWEA 4YCVA 2NVQH 3H3VI 1XXGA 1PFMA 4DR7L 1IW7D 2K5QA 2PW7A 4H13C 1GKHA 5I6YA 3VYRA 4IALA 3HOZB 1JJCB 3S1NH 1OXVA 4R4OA 2EYOA 2CVRA 4RCNA 2ZTCA 4GN5A 1N33Q 2Z6KA 4A3MH 2B29A 3S14B 3KF6B 3QG1A 5M5XB 5C44G 2MQHA 2PI2A 2HIVA 1XNRL 3PGZA 1ENCA 2DJGC 2SEBD 4DR2Q 1Z7TA 3K5NA 3CF5A 2F4IA 5LMNW 3VYUA 2V4DA 3RUZA 4JBKA 2Z4IA 3CC2A 3CCRA 3SR1A 4Q0FA 5M3FB 2I5LX 1TWGH 2A74C 1TY2A 4BBSG 4NMZA 3MFYA 3I4MG 1I6HB 4IPDA 1B50A 3HOVB 3W3AA 3HOXH 2OQ0A 1GUSA 1F2ZA 4K2LA 2DY7A 1IBKQ 1EFID 1ZYRC 1RIPA 4LNQA 3W5OA 5FO9B 5EKIA 1ZYRD 5CV7A 4X3UA 4JYAL 1EU4A 2PZTA 2UU9L 5COYA 2NVQB 1F2LA 4OO1G 1LUZA 1MSGA 3OTOL 3M4PA 1U4RA 1E7ZA 3E0JA 3BZKA 4ZAIA 1FNVA 3CU7A 3S1NB 1YITA 1UE1A 4LMQD 1EQRA 3TBIB 4A3MB 1PXUA 5IT9c 5JJIA 1WTRA 3W1GA 3IFDA 3M4OH 1CTMA 4DV3L 1AW7A 3S17H 4LF8L 3J7AF 1NNXA 3N6RA 2YTYA 4IPGA 3SK4A 1X3FA 2D5DA 4GNXC 5EPLA 1QG7A 5C5LA 1STYA 4B3RQ 1D1IA 1A15A 1TWGB 3DM3A 4LF5L 3RN5A 5M9OA 2E5LL 3J81E 3HOXB 5AJ3L 4HCSA 3ERQA 3BZCA 1F9PA 3CCLA 1DCZA 2EJGC 1C4QA 2B39A 1JCKB 1SFOB 5TSSA 4RGMA 1TWCB 4LUVA 1MBYA 5IYDH 4ME5A 3RNUA 2ZXRA 1VQJA 1VQIA 3PV0A 3M4QA 2PI2E 5DM73 2R92G 1HNZL 3H0GH 3I7FA 3GV6A 4OWWB 1CKNA 1BQQT 2YYZA 2EDGA 5CGKA 1CA5A 4XYQA 1BBUA 2CQOA 3ICEA 2B2WC 5M5YH 2K4KA 4BY1G 1STGA 2VQFQ 4JI8Q 4A3IG 3M4OB 3S17B 2EZVA 2JK8A 4X66Q 2V1CC 3HOZG 3AMUA 5I9PA 2F0TA 3EQLC 4NW2A 1N32Q 1NE3A 4RGNA 4OWXB 1B1ZA 3Q23A 1T9HA 3BVZA 4IUTA 1UE6A 2EY1A 1F2YA 2GA4B 5EQ0A 4JI5Q 3P1HA 1U9RA 1EIFA 2BCOA 1JC7A 1VQFA 3I56A 3FP9A 1D5ZC 1VDZA 4L8JA 3H94A 3GTGH 1EWHA 1V9PA 3KYHC 3ND8A 1EL0A 1WCMB 2PO4A 2MPMA 1J5EQ 2OQKA 2ZTEA 1ET6A 1S3OA 5M3FG 3EROA 1IBLQ 3GTPH 2LY7A 4A3EH 3HOWH 5IP9H 1SE3A 3HOVG 4IUPA 3OW2A 4DNRB 2IWHA 1V1PB 2E2IH 3I4NH 4DK1A 1KQSA 3GTJH 2WB1E 2X6GA 5M5YB 1VQBA 3BU2A 3J81j 2ASBA 3TP5A 1HH2P 4CHTB 3R8BA 3A55A 3PUWA 1H9SB 4FVMA 4LF6Q 1EFWA 2ZXPA 1FJGQ 1CT1D 2A68D 1S72A 3CD6A 1TR5A 3MC0B 3EFXD 1CHQD 4A3MG 1U4LA 3SGIA 4C56C 3PIPA 1D5XC 3D4WA 5KEEA 2PNHA 1SJHD 1W2BA 4CJ1B 4B9WA 3F2CA 1H9MA 2PPBC 1VF5C 1RJTA 3GTGB 3TQYA 1XNQQ 1MJEA 4NXNQ 3RD4A 1VQ6A 2ICEC 3W2DA 2RA4A 5LMUL 3NK9A 3S1QH 1G2SA 2R7ZH 2EYJA 4DR4Q 4LUZA 4IFDI 1B9MA 3UE0A 3GTPB 2E2HH 3GP7A 1R4QB 3L9AX 4YWLA 1EIHA 3HOWB 2WINB 4XIGS 4HSVA 3HOXG 5JJKA 2K50A 1E2VA 3CCQA 4HN7A 4GLXA 2E2IB 3HOUH 2I0QA 1N33L 1YJWA 2O2LD 1QZHA 1I4RA 1PRTB 2R7DA 3R2IA 1BVSA 5I2YA 4DR2L 1T5XD 2JEAI 1H95A 1HTLD 1LTSD 3CC4A 4P72A 4JI2L 5FK9C 1IHZA 3ULJA 1KAAA 1OO9B 4DR3Q 2B2UC 5C3WA 2I5HA 3OOCA 4IUUA 4A3KH 3RN2A 1JWMD 4JW0A 1A63A 4IUVA 4LAAA 2OTJA 1HPCA 1S5DD 1IBKL 5I9OA 1HQRD 3CMAA 4DAVA 1E3PA 3PCOB 3VR4A 2CHBD 3S1QB 2F4VQ 2R7ZB 1G6PA 3KF6A 1KDAA 5ISRA 3PIP3 2E2HB 2EJFC 4OGQC 1PYBA 2ES2A 4EQNA 3U58A 5C4JH 2R6GA 2VB3X 3MAQA 2MO1A 1K28A 2F0QA 2NYZD 2Q2IA 1Y8OB 3NWTA 4K8JA 3HOUB 4X65Q 4ILWA 1WCMG 4XYOA 3T53B 3EBEA 1HR0W 3SE0A 3F2BA 3KBXA 2AUJD 1HZAA 5IYDG 3UDXA 3HRZC 1H9KA 4C3HH 2F0EA 1L1OC 5JEAJ 1YHQA 2EE1A 3B6YA 3K59A 5E3FA 3A5ZB 1EZ8A 3MEHA 4DUYL 1K0RA 5JEAG 3CCUA 2JA8B 1XPOA 4POGA 4ZRZA 4L5SA 4A3KB 5KNBA 3I4OA 3V2TA 2K28A 1LTTD 2HT1A 4V190 3QB3A 1LM0A 4JV5Q 1HUMA 5C0XI 4KMUC 1FD7D 5D3DA 2XTIA 1KHIA 2HDLA 1C8CA 2VUMH 2RCFA 1PZKD 5IY0A 2BH2A 4PG3A 1E22A 1C7YA 3BYYB 4NKLA 5FOBB 1V43A 4O42A 4NB3A 4H0LC 2KHIA 3K5OA 1XNRQ 1X6OA 1Z47A 2O5JC 1K8OA 1TWHB 4UAIA 1YHAA 1S5ED 1SMYC 3CC7A 1SMYD 1QVFA 5IGFA 1L2FA 1EQTA 5I2XA 3FKIB 2VQFL 1PFNA 4YHHQ 4IURA 2Z6KC 4P75A 2BA0A 2HIXA 3OSOA 4I65A 1N8RC 3HOWG 5IP9G 3KBGA 4EQPA 4KJNA 3PUZA 2Q8RE 1N32L 4CDEC 1HA5A 3T56B 1KABA 1SNQA 4A3FH 2FHTA 4B3MQ 1DJRD 2R7FA 4KHPQ 2OTLA 5C44H 1B2TA 3VYTA 1G2TA 4AQYQ 3CCEA 3OYYA 1STBA 3K7UC 1VQEA 5BN3A 2K5VA 3OTOQ 3J80i 1F9RA 5IWAQ 1SXTA 4QIWB 1KIXA 2KCNA 4K14A 2JA5H 2VUMB 1CKOA 3X3MA 5A2QE 2IX1A 1TS3A 4BBSH 4CKBA 1EY8A 4CDFC 3I4MH 2XNAC 4EVOA 1TU2B 3I8ZA 1KRTA 4XT3B 1SYEA 3GTMH 3D0FA 1X55A 1PA6A 4G7HC 3A5UA 2PQEA 3U50C 1Z6HA 1W6KA 2R7ZG 1CSPA 4DNTB 2AQ3B 2C5CA 2FXQA 2YU9H 1JWSD 4YCUA 4K6DA 3TREA 4FP5D 4A3FB 3HOUG 2AWNA 2N78A 2HQLA 2N88A 4C2MH 2L1BA 2JA6B 2VB2X 1IKLA 1G291 4H7BA 4DV5L 1SNMA 1HNZQ 1RF2D 3FPUB 1K0SA 2NVXH 1YNNC 1MSHA 4RCOA 2WAQB 1B7YB 1IYVA 3DHQA 2JA5B 3JAMi 2KCTA 3F2UA 1QNUA 4JPBW 2K1BA 1A8VA 2K52A 1RTOA 1GXDC 1F9QA 4P2CB 2JA8G 2DUDA 3D6CA 1D5MC 3V96A 2F3VA 4BY7H 4A3KG 1M90C 2JYOA 3GV3A 1SDFA 1H9SA 4HJ9A 4YCWA 1GM5A 1EQVA 1K73C 1SJED 3CQZB 3GTMB 1SE8A 2EYFA 2LXKA 4KN7C 2CH4W 4OELB 5JPNC 4J1MA 3M3YH 2HUGA 4DR5Q 3A8KE 1M8AA 4PQXA 1B3AA 1TXYA 2XRSD 1XPUA 2YU9B 5LL6S 4F8MA 1VQAA 1WOCA 4JI7L 4RGOS 4RGTA 5C6AA 3G48A 1BXTA 1SYCA 3I72A 5G3LF 2EQSA 3C1EA 3WDNA 4IFDJ 1S5CD 3FKIG 4JBWA 1ENFA 4C2MB 3A8IE 2MO0A 1GOZA 1DYQA 4IPHA 5FO7B 1FNUA 1JB3A 1N34Q 3HOZH 2NVXB 2NVTB 1NR2A 1EZ6A 4N9PA 4IQZA 4DAYB 2K7VA 2OEOA 3P75A 5M5XH 5KGUA 4U68A 1Z9FA 4BY7B 2B63B 1EU3A 3MTSA 4PZ7A 1UEAB 1I4HA 5GROA 1GO3E 2L4NA 5EBDA 3CXCA 1CFMA 1Y14B 1STNA 4MTKA 4RG1A 4DK3C 5M3FH 4JI4L 2XVSA 3RZDH 2VUMG 1HHVA 3M3YB 2VNUD 2J0TD 1HR0Q 3K8AA 4R4QA 3CCVA 2F3IA 1PTOH 4DV2L 1I6HH 3KFUA 3DUZA 2RSOA 3UDFA 5CBAE 1GUGA 4BA1I 4NXML 1OTCA 3K58A 1LYLA 1K83H 2UXBQ 4UHVA 3T13A 5J1ZA 2WP8J 3J7YW 2WKCA 1B44D 2F0FA 3VR5A 5ELCA 2E75C 1EWIA 5CV5A 3TP8A 2K5WA 5J22A 1EWCA 3ER0A 1HQMC 3BJUA 2NBFA 4LF9L 4DFAA 1HZCA 3FHWA 5IGDA 4JV5L 1U4PA 2CWAA 2J7ZA 1OXSC 4XQNA 4GN3B 4KLKA 1I50H 1N36Q 3ZJYC 1D7QA 2L11A 1VQOA 4A3FG 3M7NA 5IT9L 1H9RA 4HR7B 2JA6G 1U4MA 3FEWX 1P16A 4Z9CB 2JA7H 1SNOA 2KVMA 2XN9C 4KY6A 4GN4B 4JI2Q 1HZ9A 4FXDA 2WAQG 2AQ1B 2A1AA 2ATWA 5LL6X 1WTPA 2JA5G 3RZDB 4YHHL 4K2KA 1PTOB 1VMPA 1JE4A 1AN8A 4HTHA 2M9VA 4YY3Q 1E24A 1NMGA 1ESFA 1G91A 4ZLTF 1K83B 1Q1EA 1GUWA 4DV4Q 4HJ5A 4B3ML 4KHPL 1BUVT 1SFOH 3S24A 4A76A 1TWCH 1DD2A 1LO5D 4AQYL 5CV8A 2WV6D 1KC8C 2PW5A 2IX0A 2B2VA 2NN6I 2FMMA 5I6WA 4GKKL 2Z0SA 1PH3A 5KNDA 3GTLH 5IWAL 1XX8A 1QVGA 1MGSA 2YTXA 3OIQA 1LT4D 1SMXA 4B9XA 4OONA 1CZGA 3TEHB 4A3LH 1VQHA 1I50B 4Y7NH 2QEJC 4GKJL 1HNXQ 4Q5VA 2VS1A 4CKEA 1O78A 3DMUA 3S2DB 4HEDA 4BXXH 1HZBA 2XIWA 3GO5A 3SVMA 2KCCA 1I5FA 3HKZB 4FF4A 1SNDA 2JA7B 1PVOA 4A3DH 2IY5B 3H3VH 1YIJA 2UUAQ 1CQFA 3QOJA 2E2DC 3J80E 1XPRA 3TDQA 5FLXc 3GTKH 4WFN3 4PZ6A 5GAHC 1CA6A 3IL8A 4R8NA 1JJ2A 4DUYQ 3KDFB 3I90A 1VQGA 3C3LA 1D6EC 4DPGA 4BY7G 2D0OA 2B63G 5KNCA 4AYBB 3EIVA 1O7IA 1L0WA 3AYHB 3BVMA 1WCMH 1ICWA 2Y0SB 4H02A 4UP9A 1GD7A 4IN3A 3T1YQ 1Y69U 3TZDA 1OXUA 1PH4A 1C48A 4J15A 3WOFA 3GTLB 2BOSA 2F1MA 3ULLA 1VQ7A 2VZAA 2QILA 2UXDL 1GHKA 5EJWA 1HFNA 4Y7NB 5JEAH 5IIFA 2KEEA 1KAWA 1K8MA 4YWMA 5J39A 1VQNA 1SSOA 4QMGA 3U9OA 3HFZB 1BF4A 1WYDA 4OIKA 2K14A 4RFBA 4A3DB 1I6VC 5C3XA 4QQBX 3SEBA 2EJMA 4FXGC 2UUCQ 3GTKB 3A54A 2O5IC 1AE2A 3TSSA 2A6EC 4DR5L 2ICIA 2GVBA 1FR3A 5IP7H 3JAME 2A6ED 2OF1A 4ODGA 2N8NA 2BDOA 3MXNB 1ML0D 1O7ZA 4AIMA 1A62A 3PMFA 1DGSA 5KYIA 3BVGA 1TS4A 4TQUS 2RCNA 3VA7A 2PNRC 2RDFA 4HSPA 1PRTF 2B2TA 1TS2A 2ZJQA 3DEOA 1WTXA 1JE5A 3C2PA 1QUQB 1N34L 4TSSA 3V05A 1TWFH 2D0PA 2WFWA 5M5WB 1VQ4A 1UNSA 3G7LA 1PH2A 3D4DA 2IT1A 3PF5A 5CR3A 5CV6A 2HDMA 1X3GA 3H6MA 4MHEA 1JWUD 1VQ9A 1NTGA 3S9WA 4QGUA 5C3EH 1A3VA 1LTID 2K03A 2RF4A 1LTLA 2C9OA 2HHHL 1PDQA 3M85A 1XMOQ 5IGGA 1JOQA 5T1IA 3L3OC 4OIJA 3GTOH 1RDPD 1E1TA 3H3VC 4QIWE 4KY7A 2NWGA 1EQQA 1GJXA 3NE5B 1EUJA 1HR0L 4DV6L 3H91A 4RMFA 3HKZG 1AP0A 4IUNA 5C4ZA 2IHFA 2JA7G 1C9OA 4GOPB 2UXBL 3M7GA 4DV5Q 5IODA 2H1EA 3IKJA 1ESRA 1DOKA 3BZDB 2Q8IB 3SDZA 4DAYA 3PQIA 3U4ZA 3CAMA 1BDOA 3QWNA 3QOLA 2Q8TA 1XJVA 1Q12A 2PZWA 5D14A 3BS1A 1DZ1A 2F0UA 5H1SE 4A3BH 5JVG3 4UP8A 2GVAA 4BWGB 3IFTA 3RLNA 2H5XA 3NEMA 2F0MA 4CBVA 1TWFB 1MHWC 4AYBG 1N36L 4JI1Q 3VR2A 5BN5A 3OHXC 2J4XA 1X32A 2Y0SG 1PV4A 4OX9Q 5EPJA 1OXTA 3LGJA 4KD3A 1TIID 5C3EB 2LMCB 2MJ8A 3PUYA 3AB9A 2I07B 1SRUA 1IXRA 1N9WA 4HCEA 1WJJA 1PH1A 4JI7Q 3GTOB 4LW1A 4IO9A 4A3LG 1V1QA 3M4YA 3X3NA 2WAQE 3GD7A 1OXXK 4ZCKA 3DXJC 4A3JB 2F0IA 2JA8H 4BXXG 2DNEA 2RQXA 2OCEA 4YY3L 3LWEA 1VQ8A 4A3DG 1BO0A 1LT3D 2H4OA 3T51B 4DV4L 4ZQ3A 3NTHA 4GLAC 1HA6A 3ZYYX 4J8QA 4L5TA 3PUXA 3NENA 1KXLA 1V1OA 1AZPA 1RD9D 2A6HC 4IUQA 1B3QA 2A6HD 3RLFA 1B53A 4A3BB 1EY6A 1PH6A 1TWHH 2CWPA 1CK1A 3KOJA 3NQTA 1HNXL 4OXPA 2NTTA 4KK7A 1I4GA 3S1RH 1PH5A 3FKIH 2PZUA 3NQIA 4JI4Q 1LTGD 1PRTC 1WTVA 4JOIA 3PO2H 5DM63 4IFDH 4CKCA 4DV2Q 3I2ZA 1K8GA 2ENBA 4XXEA 2UUAL 4NP5A 3TP7A 4DV0Q 3NTKA 4RHSA 5DAUA 1Q82C 1Y1WH 4NXMQ 1AH9A 3MVVA 3GQBA 3AQQA 5EGTA 4LF4L 2B2YA 2PMZB 4X64Q 1X3EA 3PO3B 5IT9E 2F0JA 3E9HA 1MIUA 3Q0AA 1NAPA 5ELOA 3TZUA 2NZHA 1QE6A 1X9NA 2F0NA 1BR9A 4POFA 3CMEA 5ELBA 4LF9Q 4X3TA 4ZKBB 4EGVA 5FLMG 1BKBA 3QO2A 3TP6A 3KLRA 3T1YL 1Q1BA 2FMCA 4HMIA 2BH8A 3A56A 1I4QA 1UUPA 5IP7G 4G7ZC 3E5SA 3S16H 1KRSA 4V0BA 1UE7A 4QJFA 2DN8A 5BR8Q 3K80C 4KJOA 3KLSX 1Q8IA 2NB0A 2F3WA 1B70B 4OO1I 3S1RB 3HGBA 4JI3Q 1L0XB 3I70A 3KDFA 2DGYA 4BBRH 4LF7L 3PO2B 2CQAA 2QDBA 2JJQA 3K5LA 2MFIA 3D31A 4JI6L 3L0OA 1W3SA 3J81L 3AEVA 1PZJD 1Y1WB 2UUCL 1QILA 3MEFA 2GN5A 3NTIA 1Q81C 4JCVE
chains in the Genus database with same CATH topology
3I91A 5ELEA 3ITPA 1LT6D 2HQEA 1I4PA 3O13A 3VR6A 3BDCA 1CI3M 4R9WA 2XRQD 1FGBD 3BG3A 2NVYB 3S16B 4E6IA 1TKWB 2B2VC 3SK5A 5ELDA 4PMBA 1X3PA 1A2UA 4F7XA 3HG9A 4ZYSA 3NPPA 5C0XH 1MI2A 1GUTA 3TN2A 2RBMA 1GUNA 1V8QA 4O1NA 1R4PB 1PZID 4BBRB 5E4XA 3MXNA 1LACA 1BBXC 2E74C 1LTBD 3SHLA 4OL7A 2A73B 4G57A 4XQQA 2R93B 4DN4M 1E2ZA 4C3JB 5E4WC 1BOSA 3HS0C 3K0YA 1WD0A 4KY5A 4WRDA 2QKIC 1O80A 1YNND 2XSCA 4L6TB 3VA5A 5IGCA 3SXHA 2JEBI 1BCPB 5EKKA 1PFBA 1FNWA 2K33A 4MN3A 5KYLA 4QCLA 4BA2I 3OWFA 1Q3LA 2G9HD 1G6ZA 1STEA 2LKVA 1HUNA 4FXKC 3S2HB 2N55A 3K7AB 1VMCA 2WKDA 3K6OA 5M3MB 1SE4A 4KI0A 3OW7A 4ID6A 4ULLA 1EOTA 4IFDG 4M8AA 1F2MA 2SOBA 5IGEA 3GTQB 4A93B 1WTQA 3MXPA 1PTOF 2B2TC 1I3QB 1SYDA 3I4LA 2F0SA 3MXGA 1MD2D 4KTAA 1HCZA 1S4ZA 3BDLA 1RCVD 4XQJA 5EPKA 4RH6A 3URYA 3HOYB 1LTAD 4L63B 2VXWA 1H9JA 1NR4A 5JAVA 4EQOA 4GZYC 5ELFA 2LS01 2NZ1D 1IL8A 4DAPA 4TRDA 4K6LA 2OT2A 1J9OA 2L5TA 2EPBA 1STHA 1LTRD 2O4XA 4RA8A 4RHRA 3Q22A 1SE2A 2EY6A 4YIJA 5JPMC 3DM1A 3E6ZX 3NWSA 1NSNS 3S15B 2EVBA 3Q24A 2SNMA 4BS9A 4HMJA 4C1NI 1PMRA 4C3JG 2MHVA 5LHY1 1WD1A 1TWAB 3RZOB 1FYCA 1VCIA 1A3UA 2A69C 5FLXL 2I46A 2A69D 2K01A 5CC4A 1QJOA 2SDFA 1KDCA 1SEBD 1YNJC 2G9DA 4A3GB 5CORA 1EY9A 1YNJD 5C0XJ 5CV4A 1JICA 4HAEA 1ILPA 3HEJA 2E76C 1HXYD 4H44C 2PYKA 5F2DA 5C0XG 3MHBA 2K5DA 4F87A 1J8IA 5C4XB 3EVQA 4C3IB 2BE5C 2MGSA 2BE5D 1AZQA 2HCCA 1NCVA 2EYLA 2L0CA 3QIAA 4K5WA 2K6AA 5G3LD 1D1KA 1HRJA 2XWJB 5CBEE 2KHSA 1EEID 1O7LA 5FO8B 1HTPA 2EYHA 2RKSA 4FF3A 3A7AB 2X6LA 4PV1C 5JVH3 1EIGA 1M4VA 1GHJA 1PTOC 3FPPA 1A3TA 3L7ZC 1PTOD 1ZXTA 3CHBD 4ZUJA 3NHHA 1JOOA 2IX3A 1L0YB 1DXMA 3MZ5A 5FKAC 4RAUC 1TY0A 1PLFA 2B2YC 5EKLA 5A2QL 4TKOB 2FFKB 2MP1A 2EOTA 4FF2A 2QF7A 1EY7A 2D62A 2BA1A 2JE6I 4G7OC 4WORA 4QB4A 5JOBA 3T16A 2NN6H 4DU9A 2M2LA 2ID0A 4KV6A 1Y8NB 3A8JE 1T5EA 5D65A 3QJYA 3P7JA 1KNEA 4DGZA 2ZXOA 3CRKC 2F0LA 3OPOA 4DK0A 1WTWA 2M00A 5IOCA 1D2BA 3J7AV 2EYPA 2FJ2A 2F0HA 1LV9A 1IYUA 2BDNA 2F0VA 3SK8A 5BN4A 3DEPA 4WJWA 4LJZC 1R9TB 2L9HA 2NTSA 1ZKOA 3DWAA 4PMWA 3N52A 2A5HA 2TMPA 3MA2B 1ILQA 4C3IG 3H0GB 1F9SA 3NBHA 3HP3A 3ND9A 1S5BD 1EY0A 4FO2A 2LFNA 3C1FA 3MWYW 2K32A 1RODA 2A68C 3KF8A 4DXFA 2DY8A 1KTKA 4R8IA 4K8IA 2E2JB 2R61A 3R2TA 2X69A 3I3CA 1WVLA 5K5PA 3CRLC 3NSWA 3R93A 4U673 3I73A 4RKBA 1XYIA 3H09A 4FF1A 2TSSA 1SYFA 1SNCA 3KK7A 3D4RA 3BYTB 1EYAA 1SBBB 2EYMA 5JJZA 4ZUIA 4C1NK 5HGTA 1QOHA 4A3EB 4K5VA 5E1FA 3FRPB 5C5MA 2RSNA 3I4NB 3FDTA 3NBIA 2QCPX 3GTJB 3LWUA 3D3RA 3C46A 2JSOA 2KEDA 1F77A 1SYGA 1E0BA 4ZK9B 1B4OA 4IZ8A 1DOLA 4LK1C 1LLRD 1RTNA 5KRUA 3FMCA 3PIO3 4G4KA 3LX0A 4QUFA 4DXGA 3EJIA 2L55A 4CJ2C 2HCIA 5C4HA 1ONLA 1LABA 2XWBB 2IPKD 2KJXA 2AUKA 1PRTD 1EEFD 1W6JA 4QUCA 3DWPA 4FYDA 4ZKCB 2IL8A 1AFPA 2NUCA 2EY5A 1CZWA 2WIIB 2RVLA 2EXZA 1TT2A 1A2TA 1UAPA 4KKUA 1PYWD 2RDGA 3G6JB 1Y1VB 3BDOA 2WACA 2NN6G 1IKMA 5FLXE 1XTCD 3OMGA 5T1GA 1EYCA 2SNSA 1SNPA 3KUPA 1ZEQX 1E2WA 3WOEA 1WTOA 5NUCA 1DONA 4KKSA 1QNKA 4XTCS 4FNFA 2B2WA 3J80L 5K36H 1TVXA 2F0OA 1X3QA 4X3KA 5CYUA 3SK6A 1G8ZD 1O7YA 3DWQA 5C4JB 2KA7A 3AU7A 4CGYB 4S3SA 5IGBA 4F88A 3NP8A 1BCPF 4C3HB 2AQ2B 4MIUA 2F0PA 1QB5D 2JXMB 2MUYA 3PUVA 5EBCA 2WB1B 2IJ0A 1KLUD 1EYDA 4B08A 2KUMA 4PNYA 1TS5A 1KLGD 4KN4C 3U9SA 3S1MB 2IW3A 2ZT9C 3KLSA 3TMEA 1II3A 2KOLA 1QWYA 1B9NA 1RHPA 3UI2A 2EY2A 2CW0C 4RKLA 4CJ0B 3JAML 1I4XA 2CW0D 1CHPD 3OIPA 2Z4HA 4NDXA 2Z1CA 3R3OA 3NXWA 2K05A 4OO1H 1A6XA 5DNFA 2D9UA 3ONAB 2K04A 1EY4A 3LNNA 2Z8LA 3K57A 2F0DA 2F0KA 2F03A 2JP1A 5C44B 3OMCA 5CMDA 4KHVA 4ABNA 1S5FD 3A7LA 3D6WA 1HFGA 1QCBD 4QF4A 4XDXA 1V1PA 5AFWA 4KHZA 1GUOA 3MXUA 2B8FA 4BBSB 4JK1C 5DEHA 2RDHA 3I4MB 1SYBA 3K5MA 2L12A 4OHJA 2B2UA 3MFGA 1CM9A 3Q6SA 1SAPA 1AEXA 4M1UB 4XT1B 1JORA 1CQVA 4KD4A 2D2CC 3CKIB 5I4DA 1STAA 1DOMA 2R3ZA 2KQ3A 3VYSA 3FVQA 4PMCA 1BNZA 5A35A 3P20A 5HURA 3OWEB 1DM0B 1JR0D 4I7ZC 4C3HG 2F0GA 1BCPC 5CV9A 4UDUC 2AWOA 1EY5A 1JQYD 1BCPD 4DF7A 2FINB 2DNCA 2KECA 1ET9A 4DA2A 4K5XA 3EA6A 1Y8PB 2PCFB 1NUCA 1LT5D 1KDBA 1JOKA 3VR3A 4KKTA 5K36G 2B8GA 1RKNA 4N9TA 1KNAA 5KIXA 3RMHA 1TQOA 2OXPA 3HZXA 2R92B 1ENAA 2F0WA 1Q90A 1VF7A 5D3IB 3T4AC 3D8GA 3NUCA 4X3SA 4BY1B 4RWSC 3IAYA 4A3IB 4J6HA 1IW7C 1XWEA 1XXGA 1PFMA 1IW7D 2K5QA 2PW7A 4H13C 5I6YA 3VYRA 4IALA 3HOZB 1OXVA 2EYOA 2CVRA 4RCNA 3S14B 3QG1A 5M5XB 1ENCA 2SEBD 1Z7TA 3K5NA 2F4IA 3VYUA 2V4DA 3RUZA 2Z4IA 3SR1A 4Q0FA 5M3FB 2A74C 1TY2A 4NMZA 3MFYA 1I6HB 1B50A 3HOVB 3W3AA 1GUSA 1F2ZA 4K2LA 2DY7A 1EFID 1ZYRC 5FO9B 5EKIA 1ZYRD 5CV7A 4X3UA 1EU4A 2PZTA 5COYA 2NVQB 1F2LA 4OO1G 1MSGA 1U4RA 3E0JA 4ZAIA 1FNVA 3CU7A 3S1NB 4LMQD 3TBIB 4A3MB 1PXUA 1WTRA 3IFDA 1CTMA 1AW7A 3J7AF 3N6RA 3SK4A 2D5DA 5EPLA 1QG7A 5C5LA 1STYA 1D1IA 1A15A 1TWGB 5M9OA 3J81E 3HOXB 4HCSA 3ERQA 1F9PA 1DCZA 2EJGC 1C4QA 2B39A 1JCKB 1SFOB 5TSSA 4RGMA 1TWCB 1MBYA 4ME5A 2ZXRA 3PV0A 5DM73 3GV6A 1BQQT 2YYZA 2EDGA 5CGKA 1CA5A 4XYQA 2B2WC 1STGA 3M4OB 3S17B 2EZVA 3AMUA 5I9PA 2F0TA 3EQLC 4NW2A 4RGNA 1B1ZA 3Q23A 3BVZA 4IUTA 2EY1A 1F2YA 2GA4B 5EQ0A 3P1HA 1U9RA 2BCOA 1JC7A 1D5ZC 1VDZA 4L8JA 3H94A 1EWHA 3ND8A 1EL0A 1WCMB 2PO4A 2MPMA 1ET6A 3EROA 2LY7A 1SE3A 4IUPA 4DNRB 2IWHA 1V1PB 4DK1A 2X6GA 5M5YB 3TP5A 4CHTB 3R8BA 3A55A 3PUWA 1H9SB 4FVMA 2ZXPA 1CT1D 2A68D 1TR5A 3MC0B 3EFXD 1CHQD 1U4LA 4C56C 1D5XC 3D4WA 5KEEA 1SJHD 4CJ1B 4B9WA 1H9MA 2PPBC 1VF5C 1RJTA 3GTGB 3RD4A 2ICEC 3W2DA 2RA4A 3NK9A 1G2SA 2EYJA 4IFDI 1B9MA 3GTPB 3GP7A 1R4QB 3L9AX 1EIHA 3HOWB 2WINB 4XIGS 4HSVA 1E2VA 4HN7A 2E2IB 2O2LD 1I4RA 1PRTB 3R2IA 5I2YA 1T5XD 2JEAI 1HTLD 1LTSD 5FK9C 1IHZA 1KAAA 1OO9B 2B2UC 5C3WA 3OOCA 4IUUA 1JWMD 4IUVA 4LAAA 1HPCA 1S5DD 5I9OA 1HQRD 4DAVA 3VR4A 2CHBD 3S1QB 2R7ZB 1KDAA 5ISRA 3PIP3 2E2HB 2EJFC 4OGQC 4EQNA 2R6GA 2VB3X 3MAQA 2F0QA 2NYZD 1Y8OB 3NWTA 4K8JA 3HOUB 4ILWA 4XYOA 3T53B 3SE0A 3KBXA 2AUJD 3HRZC 1H9KA 2F0EA 5JEAJ 2EE1A 3K59A 5E3FA 1EZ8A 3MEHA 5JEAG 2JA8B 4ZRZA 4A3KB 5KNBA 3V2TA 2K28A 1LTTD 4V190 3QB3A 1HUMA 5C0XI 4KMUC 1FD7D 5D3DA 1C8CA 2HDLA 1PZKD 3BYYB 4NKLA 5FOBB 1V43A 4O42A 4H0LC 3K5OA 1Z47A 2O5JC 1K8OA 1TWHB 4UAIA 1S5ED 1SMYC 1SMYD 5IGFA 1EQTA 5I2XA 3FKIB 1PFNA 4IURA 2BA0A 3OSOA 4I65A 3KBGA 4EQPA 4KJNA 3PUZA 2Q8RE 1HA5A 3T56B 1KABA 1SNQA 2FHTA 1DJRD 1B2TA 3VYTA 1G2TA 1STBA 5BN3A 1F9RA 1SXTA 4QIWB 2KCNA 4K14A 2VUMB 3X3MA 5A2QE 2IX1A 1TS3A 4CKBA 1EY8A 2XNAC 4EVOA 1TU2B 3I8ZA 4XT3B 1SYEA 4G7HC 2PQEA 1Z6HA 1W6KA 4DNTB 2AQ3B 2C5CA 1JWSD 4K6DA 4FP5D 4A3FB 2AWNA 2N88A 2L1BA 2JA6B 2VB2X 1IKLA 1G291 4H7BA 1SNMA 1RF2D 3FPUB 1YNNC 1MSHA 4RCOA 2WAQB 1IYVA 3DHQA 2JA5B 3F2UA 1QNUA 2K1BA 1RTOA 1GXDC 1F9QA 4P2CB 3D6CA 1D5MC 3V96A 2F3VA 2JYOA 3GV3A 1SDFA 1H9SA 1EQVA 1SJED 3CQZB 3GTMB 2EYFA 4KN7C 5JPNC 4J1MA 2HUGA 3A8KE 1M8AA 4PQXA 1B3AA 2XRSD 2YU9B 5LL6S 4F8MA 4RGOS 4RGTA 5C6AA 1BXTA 1SYCA 3I72A 5G3LF 3C1EA 3WDNA 4IFDJ 1S5CD 4JBWA 1ENFA 4C2MB 3A8IE 1GOZA 1DYQA 5FO7B 1FNUA 1JB3A 2NVXB 2NVTB 1NR2A 1EZ6A 4N9PA 4IQZA 2K7VA 2OEOA 3P75A 5KGUA 4U68A 4BY7B 2B63B 1EU3A 3MTSA 1UEAB 1I4HA 2L4NA 5EBDA 1CFMA 1STNA 2XVSA 1HHVA 3M3YB 2VNUD 2J0TD 1PTOH 3DUZA 2RSOA 5CBAE 1GUGA 4BA1I 3K58A 3T13A 5J1ZA 2WP8J 3J7YW 2WKCA 1B44D 2F0FA 3VR5A 5ELCA 2E75C 5CV5A 3TP8A 2K5WA 5J22A 1EWCA 1HQMC 2NBFA 4DFAA 5IGDA 1U4PA 2J7ZA 4XQNA 1OXSC 2L11A 3M7NA 5IT9L 1H9RA 4HR7B 1U4MA 3FEWX 4Z9CB 1SNOA 2KVMA 2XN9C 4KY6A 4FXDA 2AQ1B 5LL6X 1WTPA 3RZDB 4K2KA 1PTOB 1VMPA 1JE4A 1AN8A 4HTHA 2M9VA 1ESFA 1G91A 4ZLTF 1K83B 1Q1EA 1GUWA 1BUVT 1DD2A 1LO5D 5CV8A 2WV6D 2PW5A 2IX0A 2B2VA 2NN6I 2FMMA 5I6WA 5KNDA 1XX8A 1MGSA 3OIQA 1LT4D 4B9XA 1CZGA 1I50B 2QEJC 4Q5VA 4CKEA 1O78A 3DMUA 3S2DB 4HEDA 2XIWA 3GO5A 3SVMA 2KCCA 3HKZB 4FF4A 1SNDA 2JA7B 1CQFA 3QOJA 2E2DC 3J80E 3TDQA 4WFN3 1CA6A 3IL8A 4R8NA 3I90A 3C3LA 1D6EC 5KNCA 4AYBB 3BVMA 1ICWA 2Y0SB 4IN3A 1Y69U 3TZDA 1OXUA 1C48A 3WOFA 3GTLB 2BOSA 2F1MA 2QILA 1GHKA 5EJWA 1HFNA 4Y7NB 5JEAH 5IIFA 2KEEA 1K8MA 5J39A 1SSOA 4QMGA 3U9OA 1BF4A 4OIKA 4RFBA 4A3DB 1I6VC 5C3XA 3SEBA 2EJMA 4FXGC 3GTKB 3A54A 2O5IC 3TSSA 2A6EC 2ICIA 1FR3A 3JAME 2A6ED 2OF1A 4ODGA 2BDOA 1ML0D 1O7ZA 3PMFA 5KYIA 3BVGA 1TS4A 4TQUS 3VA7A 2PNRC 2RDFA 4HSPA 1PRTF 2B2TA 1TS2A 3DEOA 1WTXA 3C2PA 4TSSA 3V05A 5M5WB 1UNSA 3G7LA 3D4DA 2IT1A 5CR3A 5CV6A 2HDMA 3H6MA 4MHEA 1JWUD 3S9WA 1A3VA 1LTID 2K03A 2C9OA 1PDQA 3M85A 5IGGA 1JOQA 5T1IA 3L3OC 4OIJA 1RDPD 3H3VC 4KY7A 2NWGA 1GJXA 3NE5B 3H91A 1AP0A 4IUNA 5C4ZA 3M7GA 5IODA 2H1EA 3IKJA 1ESRA 1DOKA 3BZDB 2Q8IB 3SDZA 4DAYA 1BDOA 3QWNA 3QOLA 2Q8TA 1Q12A 2PZWA 5D14A 3BS1A 1DZ1A 2F0UA 5JVG3 4BWGB 3IFTA 4CBVA 2F0MA 1TWFB 3VR2A 5BN5A 3OHXC 2J4XA 1X32A 5EPJA 1OXTA 4KD3A 1TIID 5C3EB 2LMCB 2MJ8A 3PUYA 3AB9A 2I07B 4HCEA 3GTOB 3M4YA 3X3NA 3GD7A 1OXXK 3DXJC 4A3JB 2F0IA 2DNEA 2RQXA 3LWEA 1BO0A 1LT3D 2H4OA 3T51B 4ZQ3A 3NTHA 1HA6A 3ZYYX 4J8QA 3PUXA 1V1OA 1AZPA 1RD9D 2A6HC 4IUQA 2A6HD 3RLFA 1B53A 4A3BB 1EY6A 1CK1A 3NQTA 2NTTA 4KK7A 1I4GA 2PZUA 3NQIA 1LTGD 1PRTC 1WTVA 5DM63 4IFDH 4CKCA 2ENBA 4XXEA 4NP5A 3TP7A 3NTKA 4RHSA 5DAUA 3MVVA 3GQBA 5EGTA 2B2YA 2PMZB 3PO3B 5IT9E 2F0JA 3Q0AA 1NAPA 3TZUA 1QE6A 2F0NA 1BR9A 5ELBA 4X3TA 4ZKBB 4EGVA 3QO2A 3TP6A 3KLRA 1Q1BA 2FMCA 4HMIA 3A56A 1I4QA 1UUPA 4G7ZC 3E5SA 4V0BA 2DN8A 4KJOA 3KLSX 1Q8IA 2NB0A 2F3WA 4OO1I 3S1RB 3HGBA 1L0XB 3I70A 3PO2B 2CQAA 2QDBA 3K5LA 3D31A 3J81L 1PZJD 1Y1WB 1QILA 3NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C5L A;  1STY A;  4DU9 A;  2EYM A;  2OEO A;  2F0W A;  5CC4 A;  4ZQ3 A;  3P75 A;  1KDC A;  3OMC A;  4B9X A;  5KGU A;  4ZUI A;  1SYE A;  3D8G A;  3NUC A;  4KHV A;  5HGT A;  5M9O A;  1TR5 A;  3ITP A;  2F0E A;  2HQE A;  1EY9 A;  2PQE A;  3DMU A;  5CV4 A;  4DGZ A;  4K5V A;  2F0O A;  5E1F A;  3ERQ A;  4ID6 A;  5C5M A;  3BDC A;  4J6H A;  3SK6 A;  4QF4 A;  2F0L A;  3HEJ A;  1SND A;  3D4D A;  3D4W A;  5E3F A;  2PW7 A;  5KEE A;  5CR3 A;  1EZ8 A;  3MEH A;  5CV6 A;  1EY6 A;  1STN A;  2M00 A;  2PYK A;  3H6M A;  5F2D A;  5I6Y A;  5IOC A;  3NQT A;  4B9W A;  1SYG A;  3MHB A;  1F2M A;  4IAL A;  3S9W A;  4K6D A;  3QOJ A;  5DEH A;  2EYP A;  2SOB A;  4ME5 A;  1A3V A;  1SYB A;  4E6I A;  3EVQ A;  3SK5 A;  2EYO A;  2F0H A;  4PMB A;  3V2T A;  5IGE A;  3NK9 A;  4R8N A;  4S3S A;  3QB3 A;  4IZ8 A;  2EYJ A;  2PZU A;  3MXP A;  2F0V A;  3SK8 A;  5IGG A;  5IGB A;  1JOQ A;  3T13 A;  1A2U A;  1SYD A;  3NP8 A;  5J1Z A;  4F7X A;  5CGK A;  2F0S A;  4KY7 A;  2EYL A;  2F0F A;  1ENC A;  4H7B A;  5KRU A;  2ENB A;  4KTA A;  3LX0 A;  4NP5 A;  4MIU A;  1SNM A;  2RBM A;  1AEX A;  5CV5 A;  5DAU A;  2F0P A;  3TP7 A;  3TP8 A;  5J22 A;  1STG A;  3BDL A;  3EJI A;  4K5W A;  4NKL A;  3RUZ A;  3MVV A;  4IUN A;  1JOR A;  5EGT A;  3DHQ A;  2KHS A;  4DFA A;  3SR1 A;  5C4Z A;  5IGD A;  1EYD A;  4KD4 A;  2EYH A;  2F0J A;  4PNY A;  5C4H A;  5IOD A;  3D6C A;  5JAV A;  3SHL A;  4EQO A;  2F3V A;  4NMZ A;  4OL7 A;  2F0T A;  5I9P A;  2RKS A;  4G57 A;  5IGF A;  2F0N A;  1STA A;  3QOL A;  2PZW A;  1EQV A;  1F2Z A;  4TRD A;  3TME A;  2KQ3 A;  4K2L A;  1IHZ A;  4PMC A;  1KAA A;  2F0U A;  3TP6 A;  1II3 A;  2EYF A;  1STH A;  5HUR A;  1SNO A;  2EY1 A;  3OSO A;  1F2Y A;  5IIF A;  4KY5 A;  4I65 A;  2O4X A;  5J39 A;  3P1H A;  1U9R A;  4WRD A;  2F0M A;  1A3T A;  2EY2 A;  4QMG A;  5CV7 A;  4HMI A;  4J1M A;  2F0G A;  1EY0 A;  4RKL A;  5CV9 A;  2PZT A;  4KJN A;  3U9O A;  4EQP A;  4KY6 A;  3E5S A;  2NUC A;  5C3W A;  2EY5 A;  1EY5 A;  2EY6 A;  1KAB A;  3NHH A;  1JOO A;  1SNQ A;  4ZUJ A;  3C1F A;  4YIJ A;  5C3X A;  3MZ5 A;  4DF7 A;  2EXZ A;  1TT2 A;  4LAA A;  1A2T A;  4F8M A;  4KJO A;  3VA5 A;  5C6A A;  4K2K A;  5I9O A;  1NSN S;  5EKL A;  3ERO A;  4NDX A;  3SXH A;  5IGC A;  1SYC A;  1STB A;  2F3W A;  4KD3 A;  4K8I A;  3R3O A;  3C1E A;  4K5X A;  2WAC A;  5EKK A;  4HTH A;  3NXW A;  2SNM A;  1NUC A;  5K5P A;  1EY7 A;  4HMJ A;  2OF1 A;  1KDA A;  4ODG A;  5ISR A;  1KDB A;  5KYL A;  1JOK A;  4RKB A;  4EQN A;  2QDB A;  4K14 A;  3OMG A;  1EYC A;  5CV8 A;  4WOR A;  1EY4 A;  1RKN A;  2PW5 A;  2SNS A;  3OWF A;  2F0I A;  4N9T A;  4QB4 A;  3PMF A;  5I6W A;  2F0Q A;  5KIX A;  1SYF A;  5KYI A;  1EY8 A;  1SNP A;  1SNC A;  1TQO A;  5JOB A;  4K8J A;  2F0D A;  2OXP A;  1A3U A;  3TP5 A;  2F0K A;  1EZ6 A;  2LKV A;  3HZX A;  4N9P A;  3SK4 A;  1EYA A;  1ENA A;  3T16 A;  2RDF A;  4KV6 A;  5NUC A;  4EVO A; 
#chains in the Genus database with same CATH topology
 3I91 A;  4C3J H;  1G51 A;  2JA6 H;  2XGT A;  3WWV A;  2UXC Q;  5C3E G;  4GKK Q;  5ELE A;  3ITP A;  1LT6 D;  2HQE A;  1I4P A;  3O13 A;  3VR6 A;  1RL2 A;  5GQO A;  3U4V A;  3BDC A;  1CI3 M;  1SR3 A;  4R9W A;  2N3S A;  2XRQ D;  4GKJ Q;  1FGB D;  3BG3 A;  2NVY B;  4A3J G;  3S16 B;  4DUZ Q;  4E6I A;  1TKW B;  2B2V C;  3SK5 A;  5ELD A;  4PMB A;  1PHJ A;  4X6A H;  1X3P A;  2Z9H A;  1A2U A;  2JA9 A;  3CQZ H;  2YV5 A;  3K0X A;  4F7X A;  3HG9 A;  4ZYS A;  3NPP A;  5C0X H;  1MI2 A;  1GUT A;  3TN2 A;  2RBM A;  1GUN A;  1V8Q A;  1NJI C;  4O1N A;  4UP7 A;  1R4P B;  1PZI D;  4BBR B;  4IJL A;  5E4X A;  1XMO L;  4A3B G;  3J7A 5;  1EYG A;  3MXN A;  3J81 c;  1LAC A;  1YBY A;  1BBX C;  2E74 C;  3S2H H;  1LTB D;  1X65 A;  3K7A H;  3L2P A;  3G71 A;  3SHL A;  4OL7 A;  2UUB L;  2A73 B;  4G57 A;  4XQQ A;  2R93 B;  1IL2 A;  5M3M H;  4DN4 M;  1YEZ A;  1E2Z A;  4C3J B;  5E4W C;  1BOS A;  4I7A A;  3HKZ E;  1IYJ B;  1QUQ A;  1U5K A;  3HS0 C;  3K0Y A;  4KY5 A;  4DV7 Q;  4HJA A;  1WD0 A;  4WRD A;  2DJF C;  2QKI C;  3J7Z C;  1VQ5 A;  2UXD Q;  1O80 A;  2NVT H;  1YVC A;  1YNN D;  2XSC A;  4A93 H;  4L6T B;  4HIK A;  3VA5 A;  3PO3 G;  5IGC A;  3SXH A;  5GAG C;  1I3Q H;  2JEB I;  4R4I A;  2B63 H;  1BCP B;  5EKK A;  1PFB A;  4JI1 L;  1VQP A;  1FNW A;  2K33 A;  5GAE C;  4MN3 A;  4ME3 A;  1EOV A;  4QY7 A;  3RR5 A;  4AYB E;  1K3B C;  5KYL A;  4QCL A;  3NEL A;  4OX9 L;  2LSS A;  4BA2 I;  3OWF A;  1Q3L A;  2Y0S E;  2G9H D;  1G6Z A;  1STE A;  2LKV A;  1HUN A;  4FXK C;  4GOP A;  1WFQ A;  3S2H B;  2N55 A;  3K7A B;  1X56 A;  1FGU A;  1VMC A;  2WKD A;  3NBH B;  2K5N A;  2F52 A;  3K6O A;  5M3M B;  1VQD A;  1SE4 A;  4CDD C;  4KI0 A;  3OW7 A;  4ID6 A;  4ULL A;  1EOT A;  4B3S Q;  3PO2 G;  4IFD G;  4M8A A;  1F2M A;  3KF8 B;  4HID A;  1Y1W G;  3S15 H;  2SOB A;  1IZ6 A;  5IGE A;  3GTQ B;  4A93 B;  1WTQ A;  2LXJ A;  3MXP A;  2VQE Q;  1PYS B;  1PTO F;  2B2T C;  1I3Q B;  1SYD A;  3I4L A;  2F0S A;  3MXG A;  1MD2 D;  1YJ9 A;  4KTA A;  2HHH Q;  1HCZ A;  1TWA H;  5J3B A;  2QA4 A;  4X62 Q;  1S4Z A;  3BDL A;  1RCV D;  4XQJ A;  5EPK A;  3F8T A;  4RH6 A;  3URY A;  3ULP A;  3HOY B;  2G5D A;  1LTA D;  4L63 B;  1QZG A;  2VXW A;  4P73 A;  1H9J A;  1NR4 A;  1NMF A;  2ALY B;  5JAV A;  4DV6 Q;  4PZ8 A;  4EQO A;  4GZY C;  5ELF A;  4DV0 L;  4A3G H;  2LS0 1;  4OEM B;  2NZ1 D;  1IL8 A;  4DAP A;  4R4T A;  4TRD A;  4K6L A;  2OT2 A;  4X64 L;  1J9O A;  2L5T A;  2EPB A;  5IE8 A;  1STH A;  1YNX A;  1LTR D;  2Q2U A;  1KD1 C;  4LUO A;  2O4X A;  4RA8 A;  4RHR A;  1FVI A;  1CSQ A;  3Q22 A;  1SE2 A;  4DNI A;  2EY6 A;  4BBR G;  5C4X H;  4C3I H;  4YIJ A;  5JPM C;  4EQ5 A;  3DM1 A;  3E6Z X;  2ZJP A;  3NWS A;  1NSN S;  2QDL A;  3S15 B;  2EVB A;  2L15 A;  3Q24 A;  3S2D H;  2R93 G;  2SNM A;  4BS9 A;  4HMJ A;  4C1N I;  1PMR A;  3KLW A;  4C3J G;  1B8A A;  4AH6 A;  3M9B A;  5BR8 L;  2MHV A;  1NY4 A;  5LHY 1;  1WD1 A;  2EIF A;  4OWT B;  1TWA B;  3ERS X;  5EAY A;  3RZO B;  2RHQ B;  1FYC A;  3G6E A;  2AMC B;  4HJ8 A;  1VCI A;  2CH4 A;  1A3U A;  2A69 C;  5FLX L;  4JI3 L;  1YZ6 A;  2I46 A;  2A69 D;  2K01 A;  5CC4 A;  1QJO A;  2SDF A;  5E7N A;  1KDC A;  2Q2H A;  1SEB D;  1YNJ C;  2G9D A;  4FDB A;  4A3G B;  1Q46 A;  5COR A;  1EY9 A;  1YNJ D;  5C0X J;  5CV4 A;  1JIC A;  3F2D A;  4GNX B;  4HAE A;  1I94 Q;  1ILP A;  1CKM A;  1ICF B;  3HEJ A;  1SLJ A;  4O2D A;  2E76 C;  3STB C;  1HXY D;  4H44 C;  2PYK A;  5F2D A;  3STB D;  5C0X G;  2UXC L;  3MHB A;  2K5D A;  4F87 A;  1J8I A;  2VL6 A;  4DK6 C;  1HJP A;  5C4X B;  3EVQ A;  4C3I B;  2BE5 C;  2VW9 A;  2MGS A;  2BE5 D;  3CW2 C;  1AZQ A;  2K5H A;  1K8A C;  2HCC A;  1NCV A;  2EYL A;  2L0C A;  4MZ9 A;  5M3M G;  4LFB L;  4DUZ L;  3QIA A;  4K5W A;  2K6A A;  5G3L D;  1D1K A;  1HRJ A;  2XWJ B;  5CBE E;  3TS0 A;  1ASZ A;  2KHS A;  5HGQ A;  1EEI D;  5IYB H;  2ZM6 Q;  1O7L A;  5FO8 B;  1HTP A;  1HNW Q;  2EYH A;  4B3T L;  2RKS A;  4FF3 A;  4LF4 Q;  4A93 G;  4WJ3 M;  4P74 A;  3A7A B;  2AKW B;  2X6L A;  4PV1 C;  5JVH 3;  1EIG A;  1M4V A;  3Q8D A;  2CCZ A;  1GHJ A;  1PTO C;  3FPP A;  1A3T A;  4JOI C;  4DR6 L;  3L7Z C;  1PTO D;  1ZXT A;  3CHB D;  4UPA A;  4EX5 A;  1JJG A;  4ZUJ A;  3NHH A;  1JOO A;  2IX3 A;  2CFM A;  1L0Y B;  2PQA B;  3F1Z A;  1DXM A;  3MZ5 A;  1NBW A;  4RAU C;  5FKA C;  1TY0 A;  3HOY G;  5FJ8 H;  1PLF A;  2B2Y C;  5EKL A;  5A2Q L;  2IHE A;  4TKO B;  2FFK B;  2MP1 A;  1KL9 A;  2EOT A;  4DV7 L;  4FF2 A;  2N49 A;  2QF7 A;  1R9T H;  1EY7 A;  1PH9 A;  5M5W H;  2D62 A;  3CPF A;  1CUK A;  2BA1 A;  2JE6 I;  4G7O C;  4LFA L;  4WOR A;  1VS0 A;  4QB4 A;  2PMZ E;  4Y52 H;  5HY6 A;  2E8G A;  4R4C A;  5JOB A;  3T16 A;  2NN6 H;  4DU9 A;  4LF7 Q;  2M2L A;  2ID0 A;  4KV6 A;  4JI6 Q;  1PFS A;  4P71 A;  1Y8N B;  5FLM H;  4DR1 L;  3A8J E;  1T5E A;  5D65 A;  3QJY A;  5IYC H;  2OWO A;  3P7J A;  1YHB A;  1KNE A;  4DGZ A;  3W1B A;  2ZXO A;  3TS2 A;  3CRK C;  2F0L A;  3OPO A;  4O0A A;  4DK0 A;  1WTW A;  2M00 A;  5IOC A;  1D2B A;  4GS3 A;  3J7A V;  2EYP A;  2FJ2 A;  2E2J H;  4LFC Q;  2F0H A;  1LV9 A;  1IYU A;  2ZJR A;  2BDN A;  4NPS A;  2F0V A;  3SK8 A;  3T1H Q;  4L5R C;  5BN4 A;  4B3S L;  3DEP A;  4WJW A;  4LJZ C;  4A3G G;  1R9T B;  2L9H A;  2NTS A;  3GDE A;  1ZKO A;  3DWA A;  4PMW A;  3N52 A;  2VQE L;  3E3X A;  2NZO A;  2A5H A;  2KHJ A;  2TMP A;  3MA2 B;  1ILQ A;  5C4X G;  3AFQ A;  4C3I G;  4X62 L;  2B3G A;  3H0G B;  1F9S A;  4UY8 C;  1Q86 C;  3NBH A;  2UUB Q;  3PIO A;  4A3J H;  3HP3 A;  3ND9 A;  3UE1 A;  1S5B D;  1EY0 A;  4FO2 A;  2LFN A;  3C1F A;  3MWY W;  1YI2 A;  2K32 A;  1ROD A;  2A68 C;  3KF8 A;  4DXF A;  4CDC C;  2DY8 A;  1KTK A;  4R8I A;  4K8I A;  2E2J B;  4A4I A;  2R61 A;  3R2T A;  2X69 A;  3I3C A;  1WVL A;  2VY3 A;  5K5P A;  3CRL C;  3NSW A;  3R93 A;  1IBM Q;  4U67 3;  3I73 A;  4RKB A;  1XYI A;  3CP0 A;  3CPW A;  3H09 A;  4HIM A;  1C0A A;  4FF1 A;  2TSS A;  1SYF A;  1SNC A;  5L37 A;  3KK7 A;  3D4R A;  3BYT B;  1EYA A;  1SBB B;  4DV1 Q;  4JI0 Q;  2EYM A;  4HIO A;  3TRZ A;  5JJZ A;  4ZUI A;  4C1N K;  5HGT A;  1XMQ Q;  1QOH A;  4A3E B;  1UWV A;  4K5V A;  1AE3 A;  5E1F A;  3FRP B;  5C5M A;  3AFP A;  2RSN A;  3CCJ A;  3I4N B;  3FDT A;  3NBI A;  2QCP X;  3GTJ B;  3LWU A;  3D3R A;  4L5Q A;  2JSO A;  3C46 A;  3PO3 H;  1JMC A;  2KED A;  1F77 A;  1SYG A;  1QVC A;  1L1O B;  1E0B A;  1Y1V H;  4ZK9 B;  4GLV B;  2A8V A;  4K0K Q;  5IYB G;  1B4O A;  1I94 L;  4IZ8 A;  1DOL A;  4LK1 C;  3PF4 A;  1LLR D;  4GOP C;  1UEB A;  5LMN Q;  1RTN A;  5KRU A;  3FMC A;  3PIO 3;  4G4K A;  3LX0 A;  4QUF A;  4DXG A;  3EJI A;  1XTD A;  2L55 A;  3QR8 A;  3G4S A;  1Q8K A;  4CJ2 C;  2HCI A;  5C4H A;  1K9M C;  2RHS B;  4QL5 A;  1ONL A;  1LAB A;  2XWB B;  5FJ8 G;  2IPK D;  2KJX A;  2QEX A;  2ZM6 L;  3A0J A;  2AUK A;  1M1K C;  1PRT D;  1EEF D;  1W6J A;  4QUC A;  1HNW L;  3DWP A;  4FYD A;  4ZKC B;  2IL8 A;  4GNX A;  1AFP A;  2NUC A;  2EY5 A;  1CZW A;  2WII B;  2RVL A;  2EXZ A;  1TT2 A;  1A2T A;  1UAP A;  4KKU A;  1YJN A;  1PYW D;  2KCM A;  2RDG A;  3G6J B;  1Y1V B;  3BDO A;  2WAC A;  2Z6B A;  3IRB A;  4DKA C;  2NN6 G;  3E9I A;  3H0G G;  1IKM A;  1X54 A;  1S40 A;  5FLX E;  1EIY B;  1XTC D;  1VQC A;  4B3R L;  4N8X 1;  5IYC G;  3OMG A;  5T1G A;  1EYC A;  1WI5 A;  2SNS A;  2NVY H;  2QGQ A;  1SNP A;  3KUP A;  1ZEQ X;  1E2W A;  3S1M H;  3WOE A;  1GVP A;  1WTO A;  5NUC A;  1DON A;  4DR7 Q;  4JG2 A;  1U0L A;  4KKS A;  1QNK A;  4XTC S;  4FNF A;  2B2W A;  3J80 L;  1P8L A;  5K36 H;  3E0E A;  1TVX A;  2F0O A;  1X3Q A;  2I5M X;  1ASY A;  4X3K A;  5CYU A;  3SK6 A;  1G8Z D;  1O7Y A;  2JN4 A;  3DWQ A;  4WJ4 A;  5C4J B;  2KA7 A;  3AU7 A;  3H15 A;  3CCM A;  1SRO A;  1WTH A;  3KJP A;  2PQA A;  4R1J A;  4CGY B;  2R93 H;  4A3C H;  4S3S A;  5IGB A;  4F88 A;  4JI8 L;  3NP8 A;  1PH7 A;  1BCP F;  1VQK A;  1VQL A;  3JC6 6;  3CCS A;  4C3H B;  4MTN A;  4A3E G;  2AQ2 B;  4MIU A;  4X66 L;  2F0P A;  1QB5 D;  2KEN A;  4YWK A;  4LFC L;  2JXM B;  2MUY A;  3PUV A;  5EBC A;  2WB1 B;  2IJ0 A;  2CKZ B;  3T1H L;  1SN8 A;  3I4N G;  3HKS A;  1KLU D;  1EYD A;  4B08 A;  2KUM A;  4PNY A;  1TS5 A;  4LFB Q;  1KLG D;  4KN4 C;  3U9S A;  4JYA Q;  3S1M B;  2IW3 A;  2UU9 Q;  4JI5 L;  2ZT9 C;  3KLS A;  3TME A;  3J80 c;  1II3 A;  4B3T Q;  2KOL A;  1QWY A;  1J5E L;  1B9N A;  1RHP A;  3UI2 A;  2EY2 A;  1J6Q A;  2CW0 C;  4RKL A;  4CJ0 B;  1IBL L;  3PSI A;  3J81 i;  3JAM L;  3KJO A;  1I4X A;  2CW0 D;  1CHP D;  3OIP A;  4DV3 Q;  1K3R A;  2Z4H A;  4LF8 Q;  4NDX A;  1CKN B;  4DR6 Q;  2HD3 A;  1UE5 A;  2Z1C A;  3R3O A;  3NXW A;  2K05 A;  2ZTD A;  3DLL A;  4OO1 H;  1A6X A;  5DNF A;  2D9U A;  4LF5 Q;  3ONA B;  2K04 A;  5ELN A;  4LF6 L;  1FL0 A;  3LNN A;  1EY4 A;  2C35 B;  2Z8L A;  2E5L Q;  3VDY A;  1FJG L;  1D8L A;  5AJ3 Q;  3K57 A;  3K81 C;  2F0D A;  2F0K A;  3GTQ H;  2F03 A;  4MNO A;  2YTV A;  4IOA A;  1IBM L;  2K75 A;  2JP1 A;  4LFA Q;  1A0I A;  2JQO A;  5C44 B;  2Q2T A;  3OMC A;  1MJC A;  5CMD A;  4KHV A;  1Y1V G;  4ABN A;  4LWC A;  1S5F D;  3A7L A;  1XNQ L;  4NXN L;  3D6W A;  1HFG A;  4DR1 Q;  1BBW A;  1QCB D;  4QF4 A;  4DV1 L;  4APV A;  4JI0 L;  3EN2 A;  1V1P A;  4XDX A;  5AFW A;  4KHZ A;  3HOY H;  1GUO A;  3MXU A;  4DR4 L;  2B8F A;  1XMQ L;  4BBS B;  4JK1 C;  3JAM c;  5DEH A;  2RDH A;  3I4M B;  1SYB A;  3K5M A;  2L12 A;  5JJL A;  2P5Z X;  5DLQ E;  4OHJ A;  2B2U A;  3MFG A;  1CM9 A;  1Q7Y C;  3Q6S A;  1SAP A;  1AEX A;  4M1U B;  4K0K L;  2MNA A;  4XT1 B;  1JOR A;  2R92 H;  2A19 A;  1CQV A;  5GAD C;  3UDI A;  4JBM A;  4KD4 A;  1PH8 A;  5LMN L;  2D2C C;  4DR3 L;  1MKH A;  3CKI B;  5I4D A;  2QW7 A;  1STA A;  4BY1 H;  1DOM A;  2R3Z A;  2KQ3 A;  3VYS A;  4A3I H;  3FVQ A;  4PMC A;  1BNZ A;  5A35 A;  3P20 A;  5HUR A;  3RLO A;  3OWE B;  4IPC A;  1DM0 B;  1JR0 D;  4JBJ A;  4I7Z C;  4C3H G;  3RZO H;  2F0G A;  1BCP C;  5CV9 A;  4UDU C;  2AWO A;  1EY5 A;  1JQY D;  1BCP D;  3A74 A;  2WB1 G;  2F4V L;  4N8F A;  4DF7 A;  4HJ7 A;  1JB7 A;  3UDG A;  2FIN B;  2DNC A;  2KEC A;  1ET9 A;  4A75 A;  3S14 H;  4DA2 A;  1L1O A;  2EXD A;  3I55 A;  4ALP A;  4K5X A;  1JT8 A;  3EA6 A;  4TVA B;  1Y8P B;  2PCF B;  1NUC A;  1E1O A;  1LT5 D;  4DAM A;  1KDB A;  1JOK A;  3VR3 A;  4X65 L;  4KKT A;  5K36 G;  2B8G A;  4IOC A;  1RKN A;  4N9T A;  1KNA A;  5KIX A;  3RMH A;  1TQO A;  2OXP A;  3HZX A;  2R92 B;  1ENA A;  1VQM A;  3HOV H;  2F0W A;  1Q90 A;  4JVZ A;  1VF7 A;  2KBN A;  5D3I B;  3D8G A;  3NUC A;  3T4A C;  4X3S A;  4JC0 A;  4IJH A;  4A3C G;  2AHO B;  4BY1 B;  4RWS C;  3IAY A;  5LMU Q;  4A3I B;  4J6H A;  1IW7 C;  1XWE A;  4YCV A;  2NVQ H;  3H3V I;  1XXG A;  1PFM A;  4DR7 L;  1IW7 D;  2K5Q A;  2PW7 A;  4H13 C;  1GKH A;  5I6Y A;  3VYR A;  4IAL A;  3HOZ B;  1JJC B;  3S1N H;  1OXV A;  4R4O A;  2EYO A;  2CVR A;  4RCN A;  2ZTC A;  4GN5 A;  1N33 Q;  2Z6K A;  4A3M H;  2B29 A;  3S14 B;  3KF6 B;  3QG1 A;  5M5X B;  5C44 G;  2MQH A;  2PI2 A;  2HIV A;  1XNR L;  3PGZ A;  1ENC A;  2DJG C;  2SEB D;  4DR2 Q;  1Z7T A;  3K5N A;  3CF5 A;  2F4I A;  5LMN W;  3VYU A;  2V4D A;  3RUZ A;  4JBK A;  2Z4I A;  3CC2 A;  3CCR A;  3SR1 A;  4Q0F A;  5M3F B;  2I5L X;  1TWG H;  2A74 C;  1TY2 A;  4BBS G;  4NMZ A;  3MFY A;  3I4M G;  1I6H B;  4IPD A;  1B50 A;  3HOV B;  3W3A A;  3HOX H;  2OQ0 A;  1GUS A;  1F2Z A;  4K2L A;  2DY7 A;  1IBK Q;  1EFI D;  1ZYR C;  1RIP A;  4LNQ A;  3W5O A;  5FO9 B;  5EKI A;  1ZYR D;  5CV7 A;  4X3U A;  4JYA L;  1EU4 A;  2PZT A;  2UU9 L;  5COY A;  2NVQ B;  1F2L A;  4OO1 G;  1LUZ A;  1MSG A;  3OTO L;  3M4P A;  1U4R A;  1E7Z A;  3E0J A;  3BZK A;  4ZAI A;  1FNV A;  3CU7 A;  3S1N B;  1YIT A;  1UE1 A;  4LMQ D;  1EQR A;  3TBI B;  4A3M B;  1PXU A;  5IT9 c;  5JJI A;  1WTR A;  3W1G A;  3IFD A;  3M4O H;  1CTM A;  4DV3 L;  1AW7 A;  3S17 H;  4LF8 L;  3J7A F;  1NNX A;  3N6R A;  2YTY A;  4IPG A;  3SK4 A;  1X3F A;  2D5D A;  4GNX C;  5EPL A;  1QG7 A;  5C5L A;  1STY A;  4B3R Q;  1D1I A;  1A15 A;  1TWG B;  3DM3 A;  4LF5 L;  3RN5 A;  5M9O A;  2E5L L;  3J81 E;  3HOX B;  5AJ3 L;  4HCS A;  3ERQ A;  3BZC A;  1F9P A;  3CCL A;  1DCZ A;  2EJG C;  1C4Q A;  2B39 A;  1JCK B;  1SFO B;  5TSS A;  4RGM A;  1TWC B;  4LUV A;  1MBY A;  5IYD H;  4ME5 A;  3RNU A;  2ZXR A;  1VQJ A;  1VQI A;  3PV0 A;  3M4Q A;  2PI2 E;  5DM7 3;  2R92 G;  1HNZ L;  3H0G H;  3I7F A;  3GV6 A;  4OWW B;  1CKN A;  1BQQ T;  2YYZ A;  2EDG A;  5CGK A;  1CA5 A;  4XYQ A;  1BBU A;  2CQO A;  3ICE A;  2B2W C;  5M5Y H;  2K4K A;  4BY1 G;  1STG A;  2VQF Q;  4JI8 Q;  4A3I G;  3M4O B;  3S17 B;  2EZV A;  2JK8 A;  4X66 Q;  2V1C C;  3HOZ G;  3AMU A;  5I9P A;  2F0T A;  3EQL C;  4NW2 A;  1N32 Q;  1NE3 A;  4RGN A;  4OWX B;  1B1Z A;  3Q23 A;  1T9H A;  3BVZ A;  4IUT A;  1UE6 A;  2EY1 A;  1F2Y A;  2GA4 B;  5EQ0 A;  4JI5 Q;  3P1H A;  1U9R A;  1EIF A;  2BCO A;  1JC7 A;  1VQF A;  3I56 A;  3FP9 A;  1D5Z C;  1VDZ A;  4L8J A;  3H94 A;  3GTG H;  1EWH A;  1V9P A;  3KYH C;  3ND8 A;  1EL0 A;  1WCM B;  2PO4 A;  2MPM A;  1J5E Q;  2OQK A;  2ZTE A;  1ET6 A;  1S3O A;  5M3F G;  3ERO A;  1IBL Q;  3GTP H;  2LY7 A;  4A3E H;  3HOW H;  5IP9 H;  1SE3 A;  3HOV G;  4IUP A;  3OW2 A;  4DNR B;  2IWH A;  1V1P B;  2E2I H;  3I4N H;  4DK1 A;  1KQS A;  3GTJ H;  2WB1 E;  2X6G A;  5M5Y B;  1VQB A;  3BU2 A;  3J81 j;  2ASB A;  3TP5 A;  1HH2 P;  4CHT B;  3R8B A;  3A55 A;  3PUW A;  1H9S B;  4FVM A;  4LF6 Q;  1EFW A;  2ZXP A;  1FJG Q;  1CT1 D;  2A68 D;  1S72 A;  3CD6 A;  1TR5 A;  3MC0 B;  3EFX D;  1CHQ D;  4A3M G;  1U4L A;  3SGI A;  4C56 C;  3PIP A;  1D5X C;  3D4W A;  5KEE A;  2PNH A;  1SJH D;  1W2B A;  4CJ1 B;  4B9W A;  3F2C A;  1H9M A;  2PPB C;  1VF5 C;  1RJT A;  3GTG B;  3TQY A;  1XNQ Q;  1MJE A;  4NXN Q;  3RD4 A;  1VQ6 A;  2ICE C;  3W2D A;  2RA4 A;  5LMU L;  3NK9 A;  3S1Q H;  1G2S A;  2R7Z H;  2EYJ A;  4DR4 Q;  4LUZ A;  4IFD I;  1B9M A;  3UE0 A;  3GTP B;  2E2H H;  3GP7 A;  1R4Q B;  3L9A X;  4YWL A;  1EIH A;  3HOW B;  2WIN B;  4XIG S;  4HSV A;  3HOX G;  5JJK A;  2K50 A;  1E2V A;  3CCQ A;  4HN7 A;  4GLX A;  2E2I B;  3HOU H;  2I0Q A;  1N33 L;  1YJW A;  2O2L D;  1QZH A;  1I4R A;  1PRT B;  2R7D A;  3R2I A;  1BVS A;  5I2Y A;  4DR2 L;  1T5X D;  2JEA I;  1H95 A;  1HTL D;  1LTS D;  3CC4 A;  4P72 A;  4JI2 L;  5FK9 C;  1IHZ A;  3ULJ A;  1KAA A;  1OO9 B;  4DR3 Q;  2B2U C;  5C3W A;  2I5H A;  3OOC A;  4IUU A;  4A3K H;  3RN2 A;  1JWM D;  4JW0 A;  1A63 A;  4IUV A;  4LAA A;  2OTJ A;  1HPC A;  1S5D D;  1IBK L;  5I9O A;  1HQR D;  3CMA A;  4DAV A;  1E3P A;  3PCO B;  3VR4 A;  2CHB D;  3S1Q B;  2F4V Q;  2R7Z B;  1G6P A;  3KF6 A;  1KDA A;  5ISR A;  3PIP 3;  2E2H B;  2EJF C;  4OGQ C;  1PYB A;  2ES2 A;  4EQN A;  3U58 A;  5C4J H;  2R6G A;  2VB3 X;  3MAQ A;  2MO1 A;  1K28 A;  2F0Q A;  2NYZ D;  2Q2I A;  1Y8O B;  3NWT A;  4K8J A;  3HOU B;  4X65 Q;  4ILW A;  1WCM G;  4XYO A;  3T53 B;  3EBE A;  1HR0 W;  3SE0 A;  3F2B A;  3KBX A;  2AUJ D;  1HZA A;  5IYD G;  3UDX A;  3HRZ C;  1H9K A;  4C3H H;  2F0E A;  1L1O C;  5JEA J;  1YHQ A;  2EE1 A;  3B6Y A;  3K59 A;  5E3F A;  3A5Z B;  1EZ8 A;  3MEH A;  4DUY L;  1K0R A;  5JEA G;  3CCU A;  2JA8 B;  1XPO A;  4POG A;  4ZRZ A;  4L5S A;  4A3K B;  5KNB A;  3I4O A;  3V2T A;  2K28 A;  1LTT D;  2HT1 A;  4V19 0;  3QB3 A;  1LM0 A;  4JV5 Q;  1HUM A;  5C0X I;  4KMU C;  1FD7 D;  5D3D A;  2XTI A;  1KHI A;  2HDL A;  1C8C A;  2VUM H;  2RCF A;  1PZK D;  5IY0 A;  2BH2 A;  4PG3 A;  1E22 A;  1C7Y A;  3BYY B;  4NKL A;  5FOB B;  1V43 A;  4O42 A;  4NB3 A;  4H0L C;  2KHI A;  3K5O A;  1XNR Q;  1X6O A;  1Z47 A;  2O5J C;  1K8O A;  1TWH B;  4UAI A;  1YHA A;  1S5E D;  1SMY C;  3CC7 A;  1SMY D;  1QVF A;  5IGF A;  1L2F A;  1EQT A;  5I2X A;  3FKI B;  2VQF L;  1PFN A;  4YHH Q;  4IUR A;  2Z6K C;  4P75 A;  2BA0 A;  2HIX A;  3OSO A;  4I65 A;  1N8R C;  3HOW G;  5IP9 G;  3KBG A;  4EQP A;  4KJN A;  3PUZ A;  2Q8R E;  1N32 L;  4CDE C;  1HA5 A;  3T56 B;  1KAB A;  1SNQ A;  4A3F H;  2FHT A;  4B3M Q;  1DJR D;  2R7F A;  4KHP Q;  2OTL A;  5C44 H;  1B2T A;  3VYT A;  1G2T A;  4AQY Q;  3CCE A;  3OYY A;  1STB A;  3K7U C;  1VQE A;  5BN3 A;  2K5V A;  3OTO Q;  3J80 i;  1F9R A;  5IWA Q;  1SXT A;  4QIW B;  1KIX A;  2KCN A;  4K14 A;  2JA5 H;  2VUM B;  1CKO A;  3X3M A;  5A2Q E;  2IX1 A;  1TS3 A;  4BBS H;  4CKB A;  1EY8 A;  4CDF C;  3I4M H;  2XNA C;  4EVO A;  1TU2 B;  3I8Z A;  1KRT A;  4XT3 B;  1SYE A;  3GTM H;  3D0F A;  1X55 A;  1PA6 A;  4G7H C;  3A5U A;  2PQE A;  3U50 C;  1Z6H A;  1W6K A;  2R7Z G;  1CSP A;  4DNT B;  2AQ3 B;  2C5C A;  2FXQ A;  2YU9 H;  1JWS D;  4YCU A;  4K6D A;  3TRE A;  4FP5 D;  4A3F B;  3HOU G;  2AWN A;  2N78 A;  2HQL A;  2N88 A;  4C2M H;  2L1B A;  2JA6 B;  2VB2 X;  1IKL A;  1G29 1;  4H7B A;  4DV5 L;  1SNM A;  1HNZ Q;  1RF2 D;  3FPU B;  1K0S A;  2NVX H;  1YNN C;  1MSH A;  4RCO A;  2WAQ B;  1B7Y B;  1IYV A;  3DHQ A;  2JA5 B;  3JAM i;  2KCT A;  3F2U A;  1QNU A;  4JPB W;  2K1B A;  1A8V A;  2K52 A;  1RTO A;  1GXD C;  1F9Q A;  4P2C B;  2JA8 G;  2DUD A;  3D6C A;  1D5M C;  3V96 A;  2F3V A;  4BY7 H;  4A3K G;  1M90 C;  2JYO A;  3GV3 A;  1SDF A;  1H9S A;  4HJ9 A;  4YCW A;  1GM5 A;  1EQV A;  1K73 C;  1SJE D;  3CQZ B;  3GTM B;  1SE8 A;  2EYF A;  2LXK A;  4KN7 C;  2CH4 W;  4OEL B;  5JPN C;  4J1M A;  3M3Y H;  2HUG A;  4DR5 Q;  3A8K E;  1M8A A;  4PQX A;  1B3A A;  1TXY A;  2XRS D;  1XPU A;  2YU9 B;  5LL6 S;  4F8M A;  1VQA A;  1WOC A;  4JI7 L;  4RGO S;  4RGT A;  5C6A A;  3G48 A;  1BXT A;  1SYC A;  3I72 A;  5G3L F;  2EQS A;  3C1E A;  3WDN A;  4IFD J;  1S5C D;  3FKI G;  4JBW A;  1ENF A;  4C2M B;  3A8I E;  2MO0 A;  1GOZ A;  1DYQ A;  4IPH A;  5FO7 B;  1FNU A;  1JB3 A;  1N34 Q;  3HOZ H;  2NVX B;  2NVT B;  1NR2 A;  1EZ6 A;  4N9P A;  4IQZ A;  4DAY B;  2K7V A;  2OEO A;  3P75 A;  5M5X H;  5KGU A;  4U68 A;  1Z9F A;  4BY7 B;  2B63 B;  1EU3 A;  3MTS A;  4PZ7 A;  1UEA B;  1I4H A;  5GRO A;  1GO3 E;  2L4N A;  5EBD A;  3CXC A;  1CFM A;  1Y14 B;  1STN A;  4MTK A;  4RG1 A;  4DK3 C;  5M3F H;  4JI4 L;  2XVS A;  3RZD H;  2VUM G;  1HHV A;  3M3Y B;  2VNU D;  2J0T D;  1HR0 Q;  3K8A A;  4R4Q A;  3CCV A;  2F3I A;  1PTO H;  4DV2 L;  1I6H H;  3KFU A;  3DUZ A;  2RSO A;  3UDF A;  5CBA E;  1GUG A;  4BA1 I;  4NXM L;  1OTC A;  3K58 A;  1LYL A;  1K83 H;  2UXB Q;  4UHV A;  3T13 A;  5J1Z A;  2WP8 J;  3J7Y W;  2WKC A;  1B44 D;  2F0F A;  3VR5 A;  5ELC A;  2E75 C;  1EWI A;  5CV5 A;  3TP8 A;  2K5W A;  5J22 A;  1EWC A;  3ER0 A;  1HQM C;  3BJU A;  2NBF A;  4LF9 L;  4DFA A;  1HZC A;  3FHW A;  5IGD A;  4JV5 L;  1U4P A;  2CWA A;  2J7Z A;  1OXS C;  4XQN A;  4GN3 B;  4KLK A;  1I50 H;  1N36 Q;  3ZJY C;  1D7Q A;  2L11 A;  1VQO A;  4A3F G;  3M7N A;  5IT9 L;  1H9R A;  4HR7 B;  2JA6 G;  1U4M A;  3FEW X;  1P16 A;  4Z9C B;  2JA7 H;  1SNO A;  2KVM A;  2XN9 C;  4KY6 A;  4GN4 B;  4JI2 Q;  1HZ9 A;  4FXD A;  2WAQ G;  2AQ1 B;  2A1A A;  2ATW A;  5LL6 X;  1WTP A;  2JA5 G;  3RZD B;  4YHH L;  4K2K A;  1PTO B;  1VMP A;  1JE4 A;  1AN8 A;  4HTH A;  2M9V A;  4YY3 Q;  1E24 A;  1NMG A;  1ESF A;  1G91 A;  4ZLT F;  1K83 B;  1Q1E A;  1GUW A;  4DV4 Q;  4HJ5 A;  4B3M L;  4KHP L;  1BUV T;  1SFO H;  3S24 A;  4A76 A;  1TWC H;  1DD2 A;  1LO5 D;  4AQY L;  5CV8 A;  2WV6 D;  1KC8 C;  2PW5 A;  2IX0 A;  2B2V A;  2NN6 I;  2FMM A;  5I6W A;  4GKK L;  2Z0S A;  1PH3 A;  5KND A;  3GTL H;  5IWA L;  1XX8 A;  1QVG A;  1MGS A;  2YTX A;  3OIQ A;  1LT4 D;  1SMX A;  4B9X A;  4OON A;  1CZG A;  3TEH B;  4A3L H;  1VQH A;  1I50 B;  4Y7N H;  2QEJ C;  4GKJ L;  1HNX Q;  4Q5V A;  2VS1 A;  4CKE A;  1O78 A;  3DMU A;  3S2D B;  4HED A;  4BXX H;  1HZB A;  2XIW A;  3GO5 A;  3SVM A;  2KCC A;  1I5F A;  3HKZ B;  4FF4 A;  1SND A;  2JA7 B;  1PVO A;  4A3D H;  2IY5 B;  3H3V H;  1YIJ A;  2UUA Q;  1CQF A;  3QOJ A;  2E2D C;  3J80 E;  1XPR A;  3TDQ A;  5FLX c;  3GTK H;  4WFN 3;  4PZ6 A;  5GAH C;  1CA6 A;  3IL8 A;  4R8N A;  1JJ2 A;  4DUY Q;  3KDF B;  3I90 A;  1VQG A;  3C3L A;  1D6E C;  4DPG A;  4BY7 G;  2D0O A;  2B63 G;  5KNC A;  4AYB B;  3EIV A;  1O7I A;  1L0W A;  3AYH B;  3BVM A;  1WCM H;  1ICW A;  2Y0S B;  4H02 A;  4UP9 A;  1GD7 A;  4IN3 A;  3T1Y Q;  1Y69 U;  3TZD A;  1OXU A;  1PH4 A;  1C48 A;  4J15 A;  3WOF A;  3GTL B;  2BOS A;  2F1M A;  3ULL A;  1VQ7 A;  2VZA A;  2QIL A;  2UXD L;  1GHK A;  5EJW A;  1HFN A;  4Y7N B;  5JEA H;  5IIF A;  2KEE A;  1KAW A;  1K8M A;  4YWM A;  5J39 A;  1VQN A;  1SSO A;  4QMG A;  3U9O A;  3HFZ B;  1BF4 A;  1WYD A;  4OIK A;  2K14 A;  4RFB A;  4A3D B;  1I6V C;  5C3X A;  4QQB X;  3SEB A;  2EJM A;  4FXG C;  2UUC Q;  3GTK B;  3A54 A;  2O5I C;  1AE2 A;  3TSS A;  2A6E C;  4DR5 L;  2ICI A;  2GVB A;  1FR3 A;  5IP7 H;  3JAM E;  2A6E D;  2OF1 A;  4ODG A;  2N8N A;  2BDO A;  3MXN B;  1ML0 D;  1O7Z A;  4AIM A;  1A62 A;  3PMF A;  1DGS A;  5KYI A;  3BVG A;  1TS4 A;  4TQU S;  2RCN A;  3VA7 A;  2PNR C;  2RDF A;  4HSP A;  1PRT F;  2B2T A;  1TS2 A;  2ZJQ A;  3DEO A;  1WTX A;  1JE5 A;  3C2P A;  1QUQ B;  1N34 L;  4TSS A;  3V05 A;  1TWF H;  2D0P A;  2WFW A;  5M5W B;  1VQ4 A;  1UNS A;  3G7L A;  1PH2 A;  3D4D A;  2IT1 A;  3PF5 A;  5CR3 A;  5CV6 A;  2HDM A;  1X3G A;  3H6M A;  4MHE A;  1JWU D;  1VQ9 A;  1NTG A;  3S9W A;  4QGU A;  5C3E H;  1A3V A;  1LTI D;  2K03 A;  2RF4 A;  1LTL A;  2C9O A;  2HHH L;  1PDQ A;  3M85 A;  1XMO Q;  5IGG A;  1JOQ A;  5T1I A;  3L3O C;  4OIJ A;  3GTO H;  1RDP D;  1E1T A;  3H3V C;  4QIW E;  4KY7 A;  2NWG A;  1EQQ A;  1GJX A;  3NE5 B;  1EUJ A;  1HR0 L;  4DV6 L;  3H91 A;  4RMF A;  3HKZ G;  1AP0 A;  4IUN A;  5C4Z A;  2IHF A;  2JA7 G;  1C9O A;  4GOP B;  2UXB L;  3M7G A;  4DV5 Q;  5IOD A;  2H1E A;  3IKJ A;  1ESR A;  1DOK A;  3BZD B;  2Q8I B;  3SDZ A;  4DAY A;  3PQI A;  3U4Z A;  3CAM A;  1BDO A;  3QWN A;  3QOL A;  2Q8T A;  1XJV A;  1Q12 A;  2PZW A;  5D14 A;  3BS1 A;  1DZ1 A;  2F0U A;  5H1S E;  4A3B H;  5JVG 3;  4UP8 A;  2GVA A;  4BWG B;  3IFT A;  3RLN A;  2H5X A;  3NEM A;  2F0M A;  4CBV A;  1TWF B;  1MHW C;  4AYB G;  1N36 L;  4JI1 Q;  3VR2 A;  5BN5 A;  3OHX C;  2J4X A;  1X32 A;  2Y0S G;  1PV4 A;  4OX9 Q;  5EPJ A;  1OXT A;  3LGJ A;  4KD3 A;  1TII D;  5C3E B;  2LMC B;  2MJ8 A;  3PUY A;  3AB9 A;  2I07 B;  1SRU A;  1IXR A;  1N9W A;  4HCE A;  1WJJ A;  1PH1 A;  4JI7 Q;  3GTO B;  4LW1 A;  4IO9 A;  4A3L G;  1V1Q A;  3M4Y A;  3X3N A;  2WAQ E;  3GD7 A;  1OXX K;  4ZCK A;  3DXJ C;  4A3J B;  2F0I A;  2JA8 H;  4BXX G;  2DNE A;  2RQX A;  2OCE A;  4YY3 L;  3LWE A;  1VQ8 A;  4A3D G;  1BO0 A;  1LT3 D;  2H4O A;  3T51 B;  4DV4 L;  4ZQ3 A;  3NTH A;  4GLA C;  1HA6 A;  3ZYY X;  4J8Q A;  4L5T A;  3PUX A;  3NEN A;  1KXL A;  1V1O A;  1AZP A;  1RD9 D;  2A6H C;  4IUQ A;  1B3Q A;  2A6H D;  3RLF A;  1B53 A;  4A3B B;  1EY6 A;  1PH6 A;  1TWH H;  2CWP A;  1CK1 A;  3KOJ A;  3NQT A;  1HNX L;  4OXP A;  2NTT A;  4KK7 A;  1I4G A;  3S1R H;  1PH5 A;  3FKI H;  2PZU A;  3NQI A;  4JI4 Q;  1LTG D;  1PRT C;  1WTV A;  4JOI A;  3PO2 H;  5DM6 3;  4IFD H;  4CKC A;  4DV2 Q;  3I2Z A;  1K8G A;  2ENB A;  4XXE A;  2UUA L;  4NP5 A;  3TP7 A;  4DV0 Q;  3NTK A;  4RHS A;  5DAU A;  1Q82 C;  1Y1W H;  4NXM Q;  1AH9 A;  3MVV A;  3GQB A;  3AQQ A;  5EGT A;  4LF4 L;  2B2Y A;  2PMZ B;  4X64 Q;  1X3E A;  3PO3 B;  5IT9 E;  2F0J A;  3E9H A;  1MIU A;  3Q0A A;  1NAP A;  5ELO A;  3TZU A;  2NZH A;  1QE6 A;  1X9N A;  2F0N A;  1BR9 A;  4POF A;  3CME A;  5ELB A;  4LF9 Q;  4X3T A;  4ZKB B;  4EGV A;  5FLM G;  1BKB A;  3QO2 A;  3TP6 A;  3KLR A;  3T1Y L;  1Q1B A;  2FMC A;  4HMI A;  2BH8 A;  3A56 A;  1I4Q A;  1UUP A;  5IP7 G;  4G7Z C;  3E5S A;  3S16 H;  1KRS A;  4V0B A;  1UE7 A;  4QJF A;  2DN8 A;  5BR8 Q;  3K80 C;  4KJO A;  3KLS X;  1Q8I A;  2NB0 A;  2F3W A;  1B70 B;  4OO1 I;  3S1R B;  3HGB A;  4JI3 Q;  1L0X B;  3I70 A;  3KDF A;  2DGY A;  4BBR H;  4LF7 L;  3PO2 B;  2CQA A;  2QDB A;  2JJQ A;  3K5L A;  2MFI A;  3D31 A;  4JI6 L;  3L0O A;  1W3S A;  3J81 L;  3AEV A;  1PZJ D;  1Y1W B;  2UUC L;  1QIL A;  3MEF A;  2GN5 A;  3NTI A;  1Q81 C;  4JCV E; 
#chains in the Genus database with same CATH homology
 3I91 A;  5ELE A;  3ITP A;  1LT6 D;  2HQE A;  1I4P A;  3O13 A;  3VR6 A;  3BDC A;  1CI3 M;  4R9W A;  2XRQ D;  1FGB D;  3BG3 A;  2NVY B;  3S16 B;  4E6I A;  1TKW B;  2B2V C;  3SK5 A;  5ELD A;  4PMB A;  1X3P A;  1A2U A;  4F7X A;  3HG9 A;  4ZYS A;  3NPP A;  5C0X H;  1MI2 A;  1GUT A;  3TN2 A;  2RBM A;  1GUN A;  1V8Q A;  4O1N A;  1R4P B;  1PZI D;  4BBR B;  5E4X A;  3MXN A;  1LAC A;  1BBX C;  2E74 C;  1LTB D;  3SHL A;  4OL7 A;  2A73 B;  4G57 A;  4XQQ A;  2R93 B;  4DN4 M;  1E2Z A;  4C3J B;  5E4W C;  1BOS A;  3HS0 C;  3K0Y A;  1WD0 A;  4KY5 A;  4WRD A;  2QKI C;  1O80 A;  1YNN D;  2XSC A;  4L6T B;  3VA5 A;  5IGC A;  3SXH A;  2JEB I;  1BCP B;  5EKK A;  1PFB A;  1FNW A;  2K33 A;  4MN3 A;  5KYL A;  4QCL A;  4BA2 I;  3OWF A;  1Q3L A;  2G9H D;  1G6Z A;  1STE A;  2LKV A;  1HUN A;  4FXK C;  3S2H B;  2N55 A;  3K7A B;  1VMC A;  2WKD A;  3K6O A;  5M3M B;  1SE4 A;  4KI0 A;  3OW7 A;  4ID6 A;  4ULL A;  1EOT A;  4IFD G;  4M8A A;  1F2M A;  2SOB A;  5IGE A;  3GTQ B;  4A93 B;  1WTQ A;  3MXP A;  1PTO F;  2B2T C;  1I3Q B;  1SYD A;  3I4L A;  2F0S A;  3MXG A;  1MD2 D;  4KTA A;  1HCZ A;  1S4Z A;  3BDL A;  1RCV D;  4XQJ A;  5EPK A;  4RH6 A;  3URY A;  3HOY B;  1LTA D;  4L63 B;  2VXW A;  1H9J A;  1NR4 A;  5JAV A;  4EQO A;  4GZY C;  5ELF A;  2LS0 1;  2NZ1 D;  1IL8 A;  4DAP A;  4TRD A;  4K6L A;  2OT2 A;  1J9O A;  2L5T A;  2EPB A;  1STH A;  1LTR D;  2O4X A;  4RA8 A;  4RHR A;  3Q22 A;  1SE2 A;  2EY6 A;  4YIJ A;  5JPM C;  3DM1 A;  3E6Z X;  3NWS A;  1NSN S;  3S15 B;  2EVB A;  3Q24 A;  2SNM A;  4BS9 A;  4HMJ A;  4C1N I;  1PMR A;  4C3J G;  2MHV A;  5LHY 1;  1WD1 A;  1TWA B;  3RZO B;  1FYC A;  1VCI A;  1A3U A;  2A69 C;  5FLX L;  2I46 A;  2A69 D;  2K01 A;  5CC4 A;  1QJO A;  2SDF A;  1KDC A;  1SEB D;  1YNJ C;  2G9D A;  4A3G B;  5COR A;  1EY9 A;  1YNJ D;  5C0X J;  5CV4 A;  1JIC A;  4HAE A;  1ILP A;  3HEJ A;  2E76 C;  1HXY D;  4H44 C;  2PYK A;  5F2D A;  5C0X G;  3MHB A;  2K5D A;  4F87 A;  1J8I A;  5C4X B;  3EVQ A;  4C3I B;  2BE5 C;  2MGS A;  2BE5 D;  1AZQ A;  2HCC A;  1NCV A;  2EYL A;  2L0C A;  3QIA A;  4K5W A;  2K6A A;  5G3L D;  1D1K A;  1HRJ A;  2XWJ B;  5CBE E;  2KHS A;  1EEI D;  1O7L A;  5FO8 B;  1HTP A;  2EYH A;  2RKS A;  4FF3 A;  3A7A B;  2X6L A;  4PV1 C;  5JVH 3;  1EIG A;  1M4V A;  1GHJ A;  1PTO C;  3FPP A;  1A3T A;  3L7Z C;  1PTO D;  1ZXT A;  3CHB D;  4ZUJ A;  3NHH A;  1JOO A;  2IX3 A;  1L0Y B;  1DXM A;  3MZ5 A;  5FKA C;  4RAU C;  1TY0 A;  1PLF A;  2B2Y C;  5EKL A;  5A2Q L;  4TKO B;  2FFK B;  2MP1 A;  2EOT A;  4FF2 A;  2QF7 A;  1EY7 A;  2D62 A;  2BA1 A;  2JE6 I;  4G7O C;  4WOR A;  4QB4 A;  5JOB A;  3T16 A;  2NN6 H;  4DU9 A;  2M2L A;  2ID0 A;  4KV6 A;  1Y8N B;  3A8J E;  1T5E A;  5D65 A;  3QJY A;  3P7J A;  1KNE A;  4DGZ A;  2ZXO A;  3CRK C;  2F0L A;  3OPO A;  4DK0 A;  1WTW A;  2M00 A;  5IOC A;  1D2B A;  3J7A V;  2EYP A;  2FJ2 A;  2F0H A;  1LV9 A;  1IYU A;  2BDN A;  2F0V A;  3SK8 A;  5BN4 A;  3DEP A;  4WJW A;  4LJZ C;  1R9T B;  2L9H A;  2NTS A;  1ZKO A;  3DWA A;  4PMW A;  3N52 A;  2A5H A;  2TMP A;  3MA2 B;  1ILQ A;  4C3I G;  3H0G B;  1F9S A;  3NBH A;  3HP3 A;  3ND9 A;  1S5B D;  1EY0 A;  4FO2 A;  2LFN A;  3C1F A;  3MWY W;  2K32 A;  1ROD A;  2A68 C;  3KF8 A;  4DXF A;  2DY8 A;  1KTK A;  4R8I A;  4K8I A;  2E2J B;  2R61 A;  3R2T A;  2X69 A;  3I3C A;  1WVL A;  5K5P A;  3CRL C;  3NSW A;  3R93 A;  4U67 3;  3I73 A;  4RKB A;  1XYI A;  3H09 A;  4FF1 A;  2TSS A;  1SYF A;  1SNC A;  3KK7 A;  3D4R A;  3BYT B;  1EYA A;  1SBB B;  2EYM A;  5JJZ A;  4ZUI A;  4C1N K;  5HGT A;  1QOH A;  4A3E B;  4K5V A;  5E1F A;  3FRP B;  5C5M A;  2RSN A;  3I4N B;  3FDT A;  3NBI A;  2QCP X;  3GTJ B;  3LWU A;  3D3R A;  3C46 A;  2JSO A;  2KED A;  1F77 A;  1SYG A;  1E0B A;  4ZK9 B;  1B4O A;  4IZ8 A;  1DOL A;  4LK1 C;  1LLR D;  1RTN A;  5KRU A;  3FMC A;  3PIO 3;  4G4K A;  3LX0 A;  4QUF A;  4DXG A;  3EJI A;  2L55 A;  4CJ2 C;  2HCI A;  5C4H A;  1ONL A;  1LAB A;  2XWB B;  2IPK D;  2KJX A;  2AUK A;  1PRT D;  1EEF D;  1W6J A;  4QUC A;  3DWP A;  4FYD A;  4ZKC B;  2IL8 A;  1AFP A;  2NUC A;  2EY5 A;  1CZW A;  2WII B;  2RVL A;  2EXZ A;  1TT2 A;  1A2T A;  1UAP A;  4KKU A;  1PYW D;  2RDG A;  3G6J B;  1Y1V B;  3BDO A;  2WAC A;  2NN6 G;  1IKM A;  5FLX E;  1XTC D;  3OMG A;  5T1G A;  1EYC A;  2SNS A;  1SNP A;  3KUP A;  1ZEQ X;  1E2W A;  3WOE A;  1WTO A;  5NUC A;  1DON A;  4KKS A;  1QNK A;  4XTC S;  4FNF A;  2B2W A;  3J80 L;  5K36 H;  1TVX A;  2F0O A;  1X3Q A;  4X3K A;  5CYU A;  3SK6 A;  1G8Z D;  1O7Y A;  3DWQ A;  5C4J B;  2KA7 A;  3AU7 A;  4CGY B;  4S3S A;  5IGB A;  4F88 A;  3NP8 A;  1BCP F;  4C3H B;  2AQ2 B;  4MIU A;  2F0P A;  1QB5 D;  2JXM B;  2MUY A;  3PUV A;  5EBC A;  2WB1 B;  2IJ0 A;  1KLU D;  1EYD A;  4B08 A;  2KUM A;  4PNY A;  1TS5 A;  1KLG D;  4KN4 C;  3U9S A;  3S1M B;  2IW3 A;  2ZT9 C;  3KLS A;  3TME A;  1II3 A;  2KOL A;  1QWY A;  1B9N A;  1RHP A;  3UI2 A;  2EY2 A;  2CW0 C;  4RKL A;  4CJ0 B;  3JAM L;  1I4X A;  2CW0 D;  1CHP D;  3OIP A;  2Z4H A;  4NDX A;  2Z1C A;  3R3O A;  3NXW A;  2K05 A;  4OO1 H;  1A6X A;  5DNF A;  2D9U A;  3ONA B;  2K04 A;  1EY4 A;  3LNN A;  2Z8L A;  3K57 A;  2F0D A;  2F0K A;  2F03 A;  2JP1 A;  5C44 B;  3OMC A;  5CMD A;  4KHV A;  4ABN A;  1S5F D;  3A7L A;  3D6W A;  1HFG A;  1QCB D;  4QF4 A;  4XDX A;  1V1P A;  5AFW A;  4KHZ A;  1GUO A;  3MXU A;  2B8F A;  4BBS B;  4JK1 C;  5DEH A;  2RDH A;  3I4M B;  1SYB A;  3K5M A;  2L12 A;  4OHJ A;  2B2U A;  3MFG A;  1CM9 A;  3Q6S A;  1SAP A;  1AEX A;  4M1U B;  4XT1 B;  1JOR A;  1CQV A;  4KD4 A;  2D2C C;  3CKI B;  5I4D A;  1STA A;  1DOM A;  2R3Z A;  2KQ3 A;  3VYS A;  3FVQ A;  4PMC A;  1BNZ A;  5A35 A;  3P20 A;  5HUR A;  3OWE B;  1DM0 B;  1JR0 D;  4I7Z C;  4C3H G;  2F0G A;  1BCP C;  5CV9 A;  4UDU C;  2AWO A;  1EY5 A;  1JQY D;  1BCP D;  4DF7 A;  2FIN B;  2DNC A;  2KEC A;  1ET9 A;  4DA2 A;  4K5X A;  3EA6 A;  1Y8P B;  2PCF B;  1NUC A;  1LT5 D;  1KDB A;  1JOK A;  3VR3 A;  4KKT A;  5K36 G;  2B8G A;  1RKN A;  4N9T A;  1KNA A;  5KIX A;  3RMH A;  1TQO A;  2OXP A;  3HZX A;  2R92 B;  1ENA A;  2F0W A;  1Q90 A;  1VF7 A;  5D3I B;  3T4A C;  3D8G A;  3NUC A;  4X3S A;  4BY1 B;  4RWS C;  3IAY A;  4A3I B;  4J6H A;  1IW7 C;  1XWE A;  1XXG A;  1PFM A;  1IW7 D;  2K5Q A;  2PW7 A;  4H13 C;  5I6Y A;  3VYR A;  4IAL A;  3HOZ B;  1OXV A;  2EYO A;  2CVR A;  4RCN A;  3S14 B;  3QG1 A;  5M5X B;  1ENC A;  2SEB D;  1Z7T A;  3K5N A;  2F4I A;  3VYU A;  2V4D A;  3RUZ A;  2Z4I A;  3SR1 A;  4Q0F A;  5M3F B;  2A74 C;  1TY2 A;  4NMZ A;  3MFY A;  1I6H B;  1B50 A;  3HOV B;  3W3A A;  1GUS A;  1F2Z A;  4K2L A;  2DY7 A;  1EFI D;  1ZYR C;  5FO9 B;  5EKI A;  1ZYR D;  5CV7 A;  4X3U A;  1EU4 A;  2PZT A;  5COY A;  2NVQ B;  1F2L A;  4OO1 G;  1MSG A;  1U4R A;  3E0J A;  4ZAI A;  1FNV A;  3CU7 A;  3S1N B;  4LMQ D;  3TBI B;  4A3M B;  1PXU A;  1WTR A;  3IFD A;  1CTM A;  1AW7 A;  3J7A F;  3N6R A;  3SK4 A;  2D5D A;  5EPL A;  1QG7 A;  5C5L A;  1STY A;  1D1I A;  1A15 A;  1TWG B;  5M9O A;  3J81 E;  3HOX B;  4HCS A;  3ERQ A;  1F9P A;  1DCZ A;  2EJG C;  1C4Q A;  2B39 A;  1JCK B;  1SFO B;  5TSS A;  4RGM A;  1TWC B;  1MBY A;  4ME5 A;  2ZXR A;  3PV0 A;  5DM7 3;  3GV6 A;  1BQQ T;  2YYZ A;  2EDG A;  5CGK A;  1CA5 A;  4XYQ A;  2B2W C;  1STG A;  3M4O B;  3S17 B;  2EZV A;  3AMU A;  5I9P A;  2F0T A;  3EQL C;  4NW2 A;  4RGN A;  1B1Z A;  3Q23 A;  3BVZ A;  4IUT A;  2EY1 A;  1F2Y A;  2GA4 B;  5EQ0 A;  3P1H A;  1U9R A;  2BCO A;  1JC7 A;  1D5Z C;  1VDZ A;  4L8J A;  3H94 A;  1EWH A;  3ND8 A;  1EL0 A;  1WCM B;  2PO4 A;  2MPM A;  1ET6 A;  3ERO A;  2LY7 A;  1SE3 A;  4IUP A;  4DNR B;  2IWH A;  1V1P B;  4DK1 A;  2X6G A;  5M5Y B;  3TP5 A;  4CHT B;  3R8B A;  3A55 A;  3PUW A;  1H9S B;  4FVM A;  2ZXP A;  1CT1 D;  2A68 D;  1TR5 A;  3MC0 B;  3EFX D;  1CHQ D;  1U4L A;  4C56 C;  1D5X C;  3D4W A;  5KEE A;  1SJH D;  4CJ1 B;  4B9W A;  1H9M A;  2PPB C;  1VF5 C;  1RJT A;  3GTG B;  3RD4 A;  2ICE C;  3W2D A;  2RA4 A;  3NK9 A;  1G2S A;  2EYJ A;  4IFD I;  1B9M A;  3GTP B;  3GP7 A;  1R4Q B;  3L9A X;  1EIH A;  3HOW B;  2WIN B;  4XIG S;  4HSV A;  1E2V A;  4HN7 A;  2E2I B;  2O2L D;  1I4R A;  1PRT B;  3R2I A;  5I2Y A;  1T5X D;  2JEA I;  1HTL D;  1LTS D;  5FK9 C;  1IHZ A;  1KAA A;  1OO9 B;  2B2U C;  5C3W A;  3OOC A;  4IUU A;  1JWM D;  4IUV A;  4LAA A;  1HPC A;  1S5D D;  5I9O A;  1HQR D;  4DAV A;  3VR4 A;  2CHB D;  3S1Q B;  2R7Z B;  1KDA A;  5ISR A;  3PIP 3;  2E2H B;  2EJF C;  4OGQ C;  4EQN A;  2R6G A;  2VB3 X;  3MAQ A;  2F0Q A;  2NYZ D;  1Y8O B;  3NWT A;  4K8J A;  3HOU B;  4ILW A;  4XYO A;  3T53 B;  3SE0 A;  3KBX A;  2AUJ D;  3HRZ C;  1H9K A;  2F0E A;  5JEA J;  2EE1 A;  3K59 A;  5E3F A;  1EZ8 A;  3MEH A;  5JEA G;  2JA8 B;  4ZRZ A;  4A3K B;  5KNB A;  3V2T A;  2K28 A;  1LTT D;  4V19 0;  3QB3 A;  1HUM A;  5C0X I;  4KMU C;  1FD7 D;  5D3D A;  1C8C A;  2HDL A;  1PZK D;  3BYY B;  4NKL A;  5FOB B;  1V43 A;  4O42 A;  4H0L C;  3K5O A;  1Z47 A;  2O5J C;  1K8O A;  1TWH B;  4UAI A;  1S5E D;  1SMY C;  1SMY D;  5IGF A;  1EQT A;  5I2X A;  3FKI B;  1PFN A;  4IUR A;  2BA0 A;  3OSO A;  4I65 A;  3KBG A;  4EQP A;  4KJN A;  3PUZ A;  2Q8R E;  1HA5 A;  3T56 B;  1KAB A;  1SNQ A;  2FHT A;  1DJR D;  1B2T A;  3VYT A;  1G2T A;  1STB A;  5BN3 A;  1F9R A;  1SXT A;  4QIW B;  2KCN A;  4K14 A;  2VUM B;  3X3M A;  5A2Q E;  2IX1 A;  1TS3 A;  4CKB A;  1EY8 A;  2XNA C;  4EVO A;  1TU2 B;  3I8Z A;  4XT3 B;  1SYE A;  4G7H C;  2PQE A;  1Z6H A;  1W6K A;  4DNT B;  2AQ3 B;  2C5C A;  1JWS D;  4K6D A;  4FP5 D;  4A3F B;  2AWN A;  2N88 A;  2L1B A;  2JA6 B;  2VB2 X;  1IKL A;  1G29 1;  4H7B A;  1SNM A;  1RF2 D;  3FPU B;  1YNN C;  1MSH A;  4RCO A;  2WAQ B;  1IYV A;  3DHQ A;  2JA5 B;  3F2U A;  1QNU A;  2K1B A;  1RTO A;  1GXD C;  1F9Q A;  4P2C B;  3D6C A;  1D5M C;  3V96 A;  2F3V A;  2JYO A;  3GV3 A;  1SDF A;  1H9S A;  1EQV A;  1SJE D;  3CQZ B;  3GTM B;  2EYF A;  4KN7 C;  5JPN C;  4J1M A;  2HUG A;  3A8K E;  1M8A A;  4PQX A;  1B3A A;  2XRS D;  2YU9 B;  5LL6 S;  4F8M A;  4RGO S;  4RGT A;  5C6A A;  1BXT A;  1SYC A;  3I72 A;  5G3L F;  3C1E A;  3WDN A;  4IFD J;  1S5C D;  4JBW A;  1ENF A;  4C2M B;  3A8I E;  1GOZ A;  1DYQ A;  5FO7 B;  1FNU A;  1JB3 A;  2NVX B;  2NVT B;  1NR2 A;  1EZ6 A;  4N9P A;  4IQZ A;  2K7V A;  2OEO A;  3P75 A;  5KGU A;  4U68 A;  4BY7 B;  2B63 B;  1EU3 A;  3MTS A;  1UEA B;  1I4H A;  2L4N A;  5EBD A;  1CFM A;  1STN A;  2XVS A;  1HHV A;  3M3Y B;  2VNU D;  2J0T D;  1PTO H;  3DUZ A;  2RSO A;  5CBA E;  1GUG A;  4BA1 I;  3K58 A;  3T13 A;  5J1Z A;  2WP8 J;  3J7Y W;  2WKC A;  1B44 D;  2F0F A;  3VR5 A;  5ELC A;  2E75 C;  5CV5 A;  3TP8 A;  2K5W A;  5J22 A;  1EWC A;  1HQM C;  2NBF A;  4DFA A;  5IGD A;  1U4P A;  2J7Z A;  4XQN A;  1OXS C;  2L11 A;  3M7N A;  5IT9 L;  1H9R A;  4HR7 B;  1U4M A;  3FEW X;  4Z9C B;  1SNO A;  2KVM A;  2XN9 C;  4KY6 A;  4FXD A;  2AQ1 B;  5LL6 X;  1WTP A;  3RZD B;  4K2K A;  1PTO B;  1VMP A;  1JE4 A;  1AN8 A;  4HTH A;  2M9V A;  1ESF A;  1G91 A;  4ZLT F;  1K83 B;  1Q1E A;  1GUW A;  1BUV T;  1DD2 A;  1LO5 D;  5CV8 A;  2WV6 D;  2PW5 A;  2IX0 A;  2B2V A;  2NN6 I;  2FMM A;  5I6W A;  5KND A;  1XX8 A;  1MGS A;  3OIQ A;  1LT4 D;  4B9X A;  1CZG A;  1I50 B;  2QEJ C;  4Q5V A;  4CKE A;  1O78 A;  3DMU A;  3S2D B;  4HED A;  2XIW A;  3GO5 A;  3SVM A;  2KCC A;  3HKZ B;  4FF4 A;  1SND A;  2JA7 B;  1CQF A;  3QOJ A;  2E2D C;  3J80 E;  3TDQ A;  4WFN 3;  1CA6 A;  3IL8 A;  4R8N A;  3I90 A;  3C3L A;  1D6E C;  5KNC A;  4AYB B;  3BVM A;  1ICW A;  2Y0S B;  4IN3 A;  1Y69 U;  3TZD A;  1OXU A;  1C48 A;  3WOF A;  3GTL B;  2BOS A;  2F1M A;  2QIL A;  1GHK A;  5EJW A;  1HFN A;  4Y7N B;  5JEA H;  5IIF A;  2KEE A;  1K8M A;  5J39 A;  1SSO A;  4QMG A;  3U9O A;  1BF4 A;  4OIK A;  4RFB A;  4A3D B;  1I6V C;  5C3X A;  3SEB A;  2EJM A;  4FXG C;  3GTK B;  3A54 A;  2O5I C;  3TSS A;  2A6E C;  2ICI A;  1FR3 A;  3JAM E;  2A6E D;  2OF1 A;  4ODG A;  2BDO A;  1ML0 D;  1O7Z A;  3PMF A;  5KYI A;  3BVG A;  1TS4 A;  4TQU S;  3VA7 A;  2PNR C;  2RDF A;  4HSP A;  1PRT F;  2B2T A;  1TS2 A;  3DEO A;  1WTX A;  3C2P A;  4TSS A;  3V05 A;  5M5W B;  1UNS A;  3G7L A;  3D4D A;  2IT1 A;  5CR3 A;  5CV6 A;  2HDM A;  3H6M A;  4MHE A;  1JWU D;  3S9W A;  1A3V A;  1LTI D;  2K03 A;  2C9O A;  1PDQ A;  3M85 A;  5IGG A;  1JOQ A;  5T1I A;  3L3O C;  4OIJ A;  1RDP D;  3H3V C;  4KY7 A;  2NWG A;  1GJX A;  3NE5 B;  3H91 A;  1AP0 A;  4IUN A;  5C4Z A;  3M7G A;  5IOD A;  2H1E A;  3IKJ A;  1ESR A;  1DOK A;  3BZD B;  2Q8I B;  3SDZ A;  4DAY A;  1BDO A;  3QWN A;  3QOL A;  2Q8T A;  1Q12 A;  2PZW A;  5D14 A;  3BS1 A;  1DZ1 A;  2F0U A;  5JVG 3;  4BWG B;  3IFT A;  4CBV A;  2F0M A;  1TWF B;  3VR2 A;  5BN5 A;  3OHX C;  2J4X A;  1X32 A;  5EPJ A;  1OXT A;  4KD3 A;  1TII D;  5C3E B;  2LMC B;  2MJ8 A;  3PUY A;  3AB9 A;  2I07 B;  4HCE A;  3GTO B;  3M4Y A;  3X3N A;  3GD7 A;  1OXX K;  3DXJ C;  4A3J B;  2F0I A;  2DNE A;  2RQX A;  3LWE A;  1BO0 A;  1LT3 D;  2H4O A;  3T51 B;  4ZQ3 A;  3NTH A;  1HA6 A;  3ZYY X;  4J8Q A;  3PUX A;  1V1O A;  1AZP A;  1RD9 D;  2A6H C;  4IUQ A;  2A6H D;  3RLF A;  1B53 A;  4A3B B;  1EY6 A;  1CK1 A;  3NQT A;  2NTT A;  4KK7 A;  1I4G A;  2PZU A;  3NQI A;  1LTG D;  1PRT C;  1WTV A;  5DM6 3;  4IFD H;  4CKC A;  2ENB A;  4XXE A;  4NP5 A;  3TP7 A;  3NTK A;  4RHS A;  5DAU A;  3MVV A;  3GQB A;  5EGT A;  2B2Y A;  2PMZ B;  3PO3 B;  5IT9 E;  2F0J A;  3Q0A A;  1NAP A;  3TZU A;  1QE6 A;  2F0N A;  1BR9 A;  5ELB A;  4X3T A;  4ZKB B;  4EGV A;  3QO2 A;  3TP6 A;  3KLR A;  1Q1B A;  2FMC A;  4HMI A;  3A56 A;  1I4Q A;  1UUP A;  4G7Z C;  3E5S A;  4V0B A;  2DN8 A;  4KJO A;  3KLS X;  1Q8I A;  2NB0 A;  2F3W A;  4OO1 I;  3S1R B;  3HGB A;  1L0X B;  3I70 A;  3PO2 B;  2CQA A;  2QDB A;  3K5L A;  3D31 A;  3J81 L;  1PZJ D;  1Y1W B;  1QIL A;  3NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...