5I9PA

Crystal structure of staphylococcal nuclease variant delta+phs t62h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9pA00
1SYCA 5J39A 2F0NA 2F3WA 4KY7A 5C5MA 4LAAA 4J1MA 2F0EA 2RDFA 5IIFA 3ERQA 4RKLA 5KRUA 4R8NA 1KDBA 4K5XA 3SK6A 2QDBA 2F0FA 1A3VA 4QF4A 4MIUA 1II3A 1F2ZA 4WORA 1JOQA 5EKKA 3SHLA 5I9PA 3NP8A 4KY5A 4EVOA 2KHSA 1JOOA 3DHQA 2F0GA 4IALA 4RKBA 5NUCA 2F0TA 5HGTA 4PMCA 5J1ZA 4KJOA 4G57A 2SNMA 3OMGA 1F2YA 2EYJA 1EY5A 3MXPA 5CV6A 5CV9A 4KD4A 4EQNA 4EQPA 2EY1A 5I9OA 2EYHA 2PQEA 4DU9A 4PNYA 1EYAA 4K8IA 5CV4A 4WRDA 2NUCA 1NSNS 2LKVA 4KD3A 4QMGA 4E6IA 2F0QA 5IGCA 5KEEA 3P75A 5IGFA 2EYFA 2F0VA 3DMUA 3SK5A 5IGDA 2EYOA 3QOLA 4NMZA 4K8JA 3T16A 1SYFA 1SNMA 2F0WA 3SK8A 1IHZA 3MEHA 2F0UA 5CR3A 4ODGA 5E3FA 5I6YA 2SOBA 4TRDA 2RBMA 1EYCA 1A3TA 3OMCA 4K14A 1KABA 3NHHA 4K6DA 4N9TA 5ISRA 5IOCA 2SNSA 4H7BA 4NP5A 4ZQ3A 5IGGA 1A2TA 2PW5A 4DFAA 3RUZA 4KTAA 2OF1A 1AEXA 2EY5A 5JAVA 1EZ8A 2WACA 2PW7A 1A3UA 3NUCA 3QOJA 1EY0A 4K2LA 5J22A 1U9RA 5EGTA 1TQOA 3SXHA 1STYA 5C3WA 2PZWA 5I6WA 1JORA 1EY9A 1KDAA 3ITPA 3TMEA 3V2TA 4QB4A 3TP8A 1EY6A 1EY7A 4S3SA 4YIJA 2EYMA 2EYPA 2EXZA 1EY8A 3HEJA 3QB3A 5KGUA 4OL7A 4DF7A 1STBA 1EZ6A 2EYLA 4K2KA 3EVQA 4NKLA 2PYKA 1NUCA 2F3VA 3D8GA 3SR1A 1KAAA 5M9OA 4N9PA 2O4XA 4I65A 5CV5A 1STAA 4K5WA 3OWFA 4KV6A 3SK4A 3T13A 3R3OA 4K5VA 5C3XA 2F0MA 4IUNA 3NQTA 1STNA 2F0IA 2M00A 3P1HA 5CV8A 3HZXA 3NK9A 1SYBA 4KJNA 2HQEA 1JOKA 5E1FA 1ENAA 5C6AA 5KYIA 1SYEA 3EJIA 3MVVA 4J6HA 5IGBA 1ENCA 1EYDA 2RKSA 4ID6A 1A2UA 4DGZA 3TP7A 2F0OA 4ZUJA 2F0KA 5JOBA 4ME5A 5IGEA 2PZUA 5C5LA 1SNCA 1SNOA 4NDXA 3NXWA 1SYDA 2F0SA 4IZ8A 3D4WA 1EY4A 2F0LA 3OSOA 3LX0A 1F2MA 4PMBA 5EKLA 1SYGA 2EY6A 1SNPA 5C4ZA 5IODA 5KIXA 2F0DA 3MZ5A 5CGKA 2OXPA 5CC4A 3PMFA 3TP6A 4B9XA 2PZTA 5DAUA 2KQ3A 3C1FA 5DEHA 4F7XA 3D6CA 2OEOA 3S9WA 5F2DA 4B9WA 5C4HA 4KHVA 4HMIA 2F0JA 3EROA 4HTHA 3VA5A 4ZUIA 4EQOA 1SNDA 1STHA 1KDCA 1STGA 5K5PA 5KYLA 1TT2A 3H6MA 3D4DA 5CV7A 3U9OA 4KY6A 3BDCA 1TR5A 1RKNA 3MHBA 1EQVA 2F0PA 4F8MA 3E5SA 3TP5A 3C1EA 3BDLA 2F0HA 2ENBA 2EY2A 5HURA 4HMJA 1SNQA
chains in the Genus database with same CATH superfamily
4C2MH 4KY7A 4B3RL 4DUYL 5M3MH 4JI7L 1PRTD 4K5XA 2IX1A 2QF7A 2G5DA 2X69A 4YHHQ 2E8GA 1KQSA 2QDLA 2MFIA 2A8VA 1VF5C 1KIXA 1O7LA 4H13C 3M3YH 2Z6BA 4X62Q 3PO2B 3KFUA 1ML0D 5L37A 3HFZB 3H09A 4PMCA 4V0BA 1DJRD 2K5VA 4PNYA 3SGIA 4KD3A 2LKVA 1LTBD 5IGCA 2E2JB 2KVMA 2NVYH 3P75A 2WV6D 2CQAA 2QGQA 3EA6A 3H3VH 4OELB 5CR3A 1EQRA 4ODGA 3MEFA 3D6WA 2F4VQ 5JAVA 5C44G 4A3CH 1TQOA 4CJ1B 1EY9A 2F4IA 2DNEA 5JVG3 2OTLA 3KJPA 5GADC 1J8IA 2JA6H 3CCRA 2VB3X 1EQQA 1Q1BA 4OL7A 4FDBA 4DF7A 4UY8C 2EZVA 3EVQA 1IXRA 1RJTA 3I70A 1SE4A 5JJKA 4PZ7A 4J8QA 1VS0A 3ICEA 4ZKBB 4N9PA 1QNKA 2YU9B 1TY0A 5IYBH 3K0YA 3NQTA 4P75A 3BZCA 3FEWX 3HOYB 2SEBD 2HQEA 1BCPF 4AH6A 1I4PA 2R7ZG 2IW3A 2VUMH 1RODA 1ESFA 2YTXA 1R9TB 1WJJA 1T5XD 1ZXTA 5LMNW 1ZKOA 3CC7A 2EVBA 4IPCA 4LUVA 4DV0Q 1Y1VH 3BU2A 3IRBA 1U0LA 3HOZH 3TP6A 4U673 1GUOA 2BA0A 4LW1A 1JE5A 5IYCH 2XRSD 3H94A 4M8AA 4DK1A 1KDCA 2F3IA 5GAHC 1QZHA 3HKZE 1L1OC 1HH2P 2NTSA 4A3KB 3SVMA 3HOUG 1JJ2A 2TMPA 4UDUC 3HOYG 4L5RC 4A3LH 1EQVA 2VUMB 5IY0A 3EQLC 5A2QL 5C5MA 1SNQA 2RDHA 2L11A 2DJGC 4BA1I 3FDTA 3OIQA 1PFBA 3PV0A 2HIVA 5EBCA 3CMAA 2K01A 4DXFA 3HKZB 4LFAQ 3PUZA 3SDZA 3FPPA 4B3ML 3CC4A 1QILA 1M4VA 3CCSA 2C35B 5DM63 3CMEA 1DONA 1S5DD 5FO7B 3OTOL 3I8ZA 5M5YH 2EYHA 3IFTA 3PO2G 3S16B 4MNOA 4NB3A 1CFMA 4JI2L 1H9SA 1PYSB 5IGFA 2EYFA 3J81L 5JJIA 1EFID 1ET6A 3T16A 3F8TA 5K36H 1SNMA 4RHRA 4DAMA 3M4QA 4IQZA 4K6DA 1W2BA 1B8AA 2SNSA 2CFMA 1KNEA 5M3FB 3RMHA 4JV5Q 3S15H 4LF4Q 1EIGA 2OF1A 1BOSA 1Z9FA 1VQ8A 3JC66 4JI6Q 1PZKD 3BZDB 2A1AA 1E24A 1CM9A 3J81c 2E2DC 2A6HC 3QB3A 2JA7H 1B3AA 2EOTA 4NKLA 1VQDA 1EU4A 5A2QE 1GXDC 1YNJD 3GV3A 2N8NA 2RSNA 4KLKA 4RG1A 1Z7TA 1HPCA 1TWHB 1VQJA 3HZXA 1VQNA 1ZEQX 4IPDA 4IO9A 4NXMQ 2AQ3B 5GAGC 4N8FA 5M3FG 2K4KA 3K7AB 4DR3Q 5EPJA 1K8GA 1KTKA 4DV7Q 1PHJA 1A8VA 1UE6A 1LM0A 1NMGA 4H44C 3KLWA 4JVZA 3K5MA 3QIAA 1SYGA 1MSGA 2Z0SA 2UXCQ 1FL0A 2IX0A 3HOXG 4DNIA 1LLRD 1WD1A 3J80L 2FINB 2AHOB 3GTGB 2OEOA 2WKDA 4OWWB 2K50A 3CW2C 3GTMB 5D3DA 2VUMG 1RCVD 1QG7A 3VR5A 1E0BA 3F1ZA 3CAMA 4DR4L 3OHXC 3SEBA 3T51B 4LUOA 4F8MA 3TP5A 1TKWB 5HURA 3AQQA 1FYCA 3WDNA 3M4PA 5TSSA 5KRUA 4A3FH 2UUCL 4UP7A 4GOPA 3SK6A 1GHKA 1TWFH 2QDBA 2X6GA 1VQIA 1F2ZA 1E2WA 1JR0D 3HP3A 1F9PA 2UUAL 5JPNC 5IYCG 3DHQA 3E9IA 4IALA 5J1ZA 1I6HH 1EOTA 2CQOA 1PTOF 2EY1A 3STBD 1IBMQ 2L55A 2BH2A 4GNXA 2WKCA 1CTMA 4CDDC 3TRZA 3GTJH 3NTIA 3R8BA 3OW2A 4AYBE 4LF5L 2ICEC 1JWMD 4JI0Q 2R92G 4B3RQ 4K14A 4HIOA 4A3FG 1V1PA 3AMUA 2R93G 1C4QA 1RTOA 4NP5A 4J15A 1EIHA 5E7NA 3KDFB 1WCMB 4JI8Q 2E2HB 3T1YQ 1BCPD 4K0KL 3NTKA 2ICIA 2A73B 5I6WA 3S16H 2ZXRA 4IFDJ 5COYA 3PIOA 4YIJA 4DV4Q 4XXEA 1XWEA 4CJ2C 2NWGA 4R4OA 3GTQH 1B44D 3V05A 5C0XG 4JI4Q 1PA6A 2AMCB 3NEMA 4DR6Q 1Q8KA 3UDFA 3MWYW 2HD3A 2M00A 4LUZA 2B63B 5M5WB 4YCWA 5KYIA 5IT9c 5IWAQ 2AQ2B 2B63H 2LSSA 2WINB 1NBWA 1D8LA 2AKWB 2PMZE 2F0LA 3OPOA 3QWNA 4OIJA 3GTMH 1QWYA 5HY6A 4JK1C 1K83H 5CC4A 2A19A 2KQ3A 5DEHA 1CKMA 1DD2A 2BOSA 2Z4HA 3R93A 4B9WA 1V9PA 1Q90A 1FNVA 1GUWA 1STHA 1CKOA 3H3VI 1KAWA 1TR5A 1OXUA 4OX9Q 3S2HH 1YNXA 2A69C 1B70B 5IIFA 5EPLA 2G9DA 1VQEA 2D0PA 2VS1A 4AYBG 5LHY1 4POFA 1UEAB 4OO1H 3ZYYX 5CBEE 1II3A 4WORA 1YJWA 4OEMB 1NTGA 1K3BC 3FPUB 2DY7A 3CXCA 1JOOA 3K5OA 2PCFB 2L12A 1HTLD 4A3EB 4EQNA 5FOBB 4LF8L 3FKIG 4EQPA 3K5NA 4DU9A 4KN4C 1HQRD 1PYBA 1X32A 2CVRA 2KHIA 3SK5A 1KL9A 1WTRA 2EJMA 3S14B 4R4IA 3EIVA 3T1HQ 2VQFQ 1XXGA 3A7AB 4DR7Q 4CDEC 2JSOA 4ZQ3A 4KMUC 3UE1A 2R61A 3ERSX 3IL8A 3KJOA 4TQUS 4RGMA 1YJ9A 2ZTCA 3S1RB 4JBMA 1LTTD 2JYOA 3EBEA 4WJ3M 2KJXA 4KN7C 2ZTDA 2WB1E 4QIWB 1U4RA 4R9WA 4LFCQ 1HNZQ 5JEAH 1PH8A 4P2CB 2JE6I 4XIGS 4X65Q 5KGUA 4KHPL 1DXMA 1EYGA 5C0XH 1E22A 1QUQA 1HRJA 3SK4A 3STBC 3JAML 2MJ8A 1CZGA 5ELBA 5CV8A 1OXXK 3J7AF 3KLRA 2B2WA 2F52A 3BVGA 1JMCA 2VNUD 3A5ZB 1CSQA 4L5QA 4B3SQ 1JWSD 4JV5L 4A93B 1GUTA 1PTOH 4PZ6A 3CCQA 2PZUA 1CT1D 1G6ZA 1VQ5A 4IZ8A 2G9HD 1YNND 5EBDA 1PZID 5EKLA 2KHJA 1D5MC 4BY1B 4FXKC 3WOEA 3E3XA 3S2DH 1G2SA 1SROA 2B2VC 4DR2Q 3C46A 1UNSA 5LMNQ 1HZ9A 1RTNA 1TS4A 4HN7A 4A3DH 1GHJA 3S15B 3RZDH 2NVTH 1XPRA 3DWQA 3CD6A 2B2TC 5C4JB 1KC8C 4IURA 2H5XA 2I5MX 2K1BA 3NELA 4A3GB 2IY5B 1GO3E 1SE2A 3UDGA 2NVQB 1IYVA 1U5KA 5BN5A 4DV7L 1CKNB 1IBLQ 3TBIB 1S40A 4A3JG 3KBGA 2NZHA 2EE1A 1JOQA 5EKKA 4C3IH 1L0WA 4AYBB 4H0LC 5EJWA 1MD2D 4JI1Q 2Z9HA 2L1BA 2GA4B 1Y1VG 1EFWA 1HJPA 2BE5C 3IKJA 5C3EB 3I55A 1ZYRD 4HSVA 3I90A 5D65A 3H91A 3BDOA 3DMUA 2AUKA 3URYA 4U68A 1D1KA 2Q8IB 1X65A 3DXJC 4C3IB 1HNXQ 4LMQD 4DUZL 3RR5A 2D9UA 1PH2A 4LF9L 4A3LG 3NQIA 4OXPA 4JI3L 1SXTA 3GTGH 5EKIA 1TS2A 4HSPA 3RD4A 1WI5A 4XQQA 3KDFA 4WJWA 4QB4A 5JEAJ 4GKJL 1ASYA 2JA8B 1Y1VB 2CWAA 1LTID 1STBA 3RZDB 2NVTB 4FXGC 1DCZA 5T1GA 1KNAA 3JAMi 3HOUB 3W3AA 3H0GH 3VR3A 4JI0L 3ER0A 3P20A 2L0CA 4MZ9A 1D6EC 2RKSA 1JC7A 1EL0A 1SE3A 5FO8B 1CA5A 2JQOA 3LWEA 4Z9CB 3WOFA 3BZKA 3T1YL 1XJVA 4L5TA 1QCBD 2K5NA 4PQXA 1CUKA 3FVQA 3W5OA 2JA6B 1MI2A 2V1CC 3GTKH 2D5DA 3A54A 2HDLA 1I4QA 4YHHL 3S1NH 3J80i 3PO3H 4IOCA 3BYYB 3UDIA 4BS9A 1XX8A 1G291 4X62L 1HR0Q 1IW7C 4ZAIA 4APVA 3NBIA 4IUPA 2LFNA 3E5SA 3Q22A 4V190 2ENBA 2IL8A 2HHHL 5A35A 1K9MC 1MBYA 3MXGA 1KDBA 1N33L 2HQLA 3L0OA 1IYJB 2P5ZX 1F2LA 1SE8A 2H4OA 3K80C 4WJ4A 1J5EL 1VF7A 3VR2A 1WVLA 4RCOA 3DWAA 4G57A 5CV6A 5I9OA 1Q3LA 3Q23A 1EWCA 2JN4A 4DXGA 3HOXH 2K28A 1NMFA 4FF3A 3I91A 1ILPA 3LGJA 1TWAB 1PFNA 3GO5A 1WOCA 3H0GB 4C3IG 3HKSA 2F0WA 4KKUA 1XMQL 4A3GH 2JEBI 4IFDH 2SOBA 4GLXA 1AFPA 1KABA 4DK3C 3J80c 3FRPB 3QR8A 1JJGA 1SFOB 4TVAB 1MJCA 1YEZA 5LMUL 1ONLA 5E4WC 2Z4IA 2I0QA 1I4HA 3EN2A 1LT4D 4LF8Q 3A74A 2L9HA 2QCPX 5LL6X 3G6JB 1E2VA 4DV0L 4YWMA 1EZ6A 3E0EA 1OXSC 2EYLA 1KAAA 1FJGL 3T13A 2D0OA 4K6LA 1N9WA 3CQZB 4DNTB 4BBSB 1STNA 3TN2A 1JOKA 1M90C 2VQFL 1NCVA 1EQTA 4DR7L 2B8GA 3VA7A 4XT3B 5DLQE 1VQFA 1BBWA 3M9BA 4RH6A 2R93H 5KIXA 1VDZA 1N36L 1H9SB 3H15A 4Y52H 2OXPA 1MSHA 2Z8LA 1PH5A 1X54A 1Q46A 4LJZC 3D6CA 1SMXA 4KHPQ 4B3MQ 1X6OA 5FLMH 1PRTB 1XTDA 4OWTB 1VQ7A 3I4OA 3U9OA 2ZJPA 1SLJA 1YZ6A 1J9OA 4XDXA 3C1EA 1UAPA 2KEEA 4RKBA 3CCLA 2F0NA 2F3WA 5D14A 4JI2Q 1B3QA 2RDFA 1BXTA 3FMCA 2Z6KA 4MIUA 5AJ3L 1N32Q 4OGQC 5IT9E 1XMOL 4GKKQ 1IKMA 3FKIB 2KHSA 2RSOA 4UPAA 3PO2H 4C3HH 4PV1C 5HGTA 2A69D 3OMGA 1PTOB 2UUBL 4LF6Q 4MN3A 4RAUC 1VQHA 2FXQA 3M7NA 1UWVA 1YITA 5CV4A 4A3EG 4KKTA 4O1NA 1V1QA 4IFDG 1TU2B 2XVSA 4NMZA 3F2CA 4HCEA 2B63G 4LFBQ 2B2WC 1FD7D 2BDNA 2K75A 4DUYQ 4N9TA 2CH4W 1AN8A 5ISRA 1UE1A 1HCZA 2JXMB 4MTNA 1YNJC 4GS3A 2AUJD 1EEFD 4ULLA 1E7ZA 4HEDA 4A3BB 1U9RA 1YHAA 3N6RA 1FGBD 1IBKQ 2CWPA 1GOZA 4P73A 3I72A 1QVCA 1W3SA 2RQXA 3AYHB 2JA9A 3HEJA 1VQ4A 2DY8A 2WB1B 1I6VC 4K2KA 4QIWE 2RVLA 1VQLA 1B9MA 4F88A 2RF4A 2F3VA 2EPBA 3K59A 3GTKB 3K0XA 2XWBB 1SYBA 3ULJA 1SYEA 1E1OA 3F2UA 4GN4B 1HNWQ 4ID6A 2DNCA 1B1ZA 2GN5A 4JI3Q 1GVPA 3K58A 4A76A 2MGSA 1HZCA 4PZ8A 1QVGA 3LX0A 5G3LF 4PMBA 5IYBG 5IODA 4DR1L 1SNPA 4QUCA 4KI0A 1V8QA 1TWAH 2CHBD 2KEDA 2JA8G 1E2ZA 2E2HH 4FNFA 2N49A 5FLXE 4WFN3 3NENA 1CA6A 5K5PA 1O7ZA 5CV7A 4DAYB 1RKNA 1YNNC 3ND8A 2DUDA 1Y1WB 2F0PA 3M4YA 3DM1A 4X6AH 2NYZD 4HMJA 4ZCKA 3I7FA 1SMYD 1ASZA 2FMCA 2NB0A 4P72A 1ESRA 3ERQA 3UDXA 2ATWA 4UP9A 4X66L 1A3VA 4ALPA 4PG3A 1A63A 2L15A 1Z6HA 2EDGA 4ZLTF 1I6HB 3HOVB 4X3UA 2LXKA 3K57A 4JI8L 1CZWA 3A55A 2PQEA 2SDFA 5ELDA 4BXXH 1EUJA 2NUCA 4IN3A 4JI7Q 1OTCA 5M5WH 4DV4L 2R93B 4UP8A 1AW7A 4Y7NB 3RLNA 4Q5VA 1X55A 3OMCA 2GVAA 3NHHA 2ASBA 4HJ8A 1N33Q 4DFAA 1PDQA 4O0AA 5IWAL 4L5SA 3NUCA 3TZDA 3I2ZA 1LACA 1IL8A 1SAPA 5GQOA 2PNRC 1NE3A 2B3GA 3CC2A 1SFOH 4TKOB 4G7ZC 2PYKA 4EGVA 5BR8Q 1WFQA 2VB2X 2HT1A 1SSOA 1U4LA 5IGGA 1XMQQ 3U4VA 1HA5A 3ONAB 1TWHH 1DZ1A 2KCMA 3PGZA 2C9OA 1A2UA 2JA7G 4LF4L 1CHPD 2ZXPA 4UAIA 2RCFA 1AZPA 3D4WA 3KF6B 3VYUA 2VY3A 2J0TD 3I56A 2UU9L 4R4TA 4QCLA 2Q2TA 1PLFA 3B6YA 2ALYB 1YVCA 3F2BA 1TY2A 4YWLA 1PH1A 3H6MA 3D4DA 3CCJA 4C3JB 4FYDA 3KF8A 1V1OA 3G71A 2PNHA 3PIO3 5J3BA 2A68D 1LABA 1HUNA 4NXML 4IUUA 4B3TL 2E5LQ 1S4ZA 3S1RH 3KLSX 1FR3A 3HRZC 4QQBX 4A93G 4HIDA 1G2TA 3PF4A 2BA1A 2R7ZH 1NR2A 4DV2Q 1KD1C 3L9AX 2A6HD 1N36Q 3NP8A 4NW2A 1IW7D 4KHZA 1XNRQ 3BG3A 4IUVA 1F2YA 1FVIA 4R4CA 1AE2A 2JEAI 4DAPA 4JW0A 2NVXH 2WB1G 3KUPA 3KLSA 2ZM6Q 3HS0C 4DNRB 3NE5B 4KKSA 4O42A 3QOLA 3I4NB 3HOUH 5T1IA 1BBUA 5ELFA 1EYCA 1IKLA 3H0GG 1R4QB 3VDYA 5M3MG 4CBVA 4EX5A 3S24A 3VR4A 2J4XA 4EQ5A 4KTAA 3T56B 1U4MA 1I5FA 3J81i 4YCUA 1XMOQ 4DR5L 2B2VA 2NZ1D 1UEBA 1Q81C 5IYDG 3TP8A 2EYMA 3CCMA 3HOWG 1QJOA 1PXUA 4LK1C 1NUCA 3C3LA 3SR1A 1UE5A 3S1MB 1A6XA 4LF5Q 4JYAQ 2PMZB 1T5EA 3W1GA 4RGOS 2JJQA 3DEOA 3P1HA 4LFBL 1VQCA 1ZYRC 1LYLA 2OT2A 4YY3L 2VQEQ 2ES2A 2A6ED 1DOLA 1EYDA 1O78A 5BN4A 4QJFA 2K7VA 1WCMG 5IGEA 4ILWA 1N34L 1G6PA 1K8OA 1SYDA 2RA4A 4XQJA 1HXYD 1JQYD 1HQMC 4K0KQ 4LNQA 3U9SA 1ICWA 1PTOC 3A5UA 3CCEA 3R2IA 5DAUA 1B53A 3A8KE 3S9WA 5F2DA 4JG2A 1EOVA 2MHVA 4HTHA 4Q0FA 3VA5A 1SBBB 2PPBC 4JC0A 1VCIA 4EQOA 2RHSB 1AZQA 3PIPA 5GROA 2B2YA 1LT3D 2CKZB 3HOVH 2BCOA 4OO1G 2H1EA 2K52A 5LL6S 1X56A 5C4JH 4DKAC 4GZYC 1HNWL 3PUXA 4J1MA 4RKLA 4A3GG 4RA8A 3BJUA 1NNXA 3OOCA 4G7OC 4QF4A 3GP7A 3GTOB 3S2DB 2R3ZA 2R7DA 4BA2I 3HOZB 4EVOA 5FLXc 2IHEA 4A3DG 1BCPB 1B50A 3AFQA 5NUCA 4YCVA 1Q7YC 1H95A 4CKCA 1HZBA 1YI2A 3I3CA 4DR4Q 3M85A 3BVMA 4IFDI 1HA6A 2R7FA 4QMGA 1O80A 1X3GA 1CI3M 2F0VA 3HOYH 2EYOA 2LY7A 4BBSG 2B39A 1GUSA 2NZOA 2MO1A 2UXDL 3AU7A 1H9MA 2YYZA 1KLGD 5JJZA 4MHEA 3HOZG 1A3UA 5J22A 4K2LA 2QA4A 3CQZH 5FLXL 1PRTC 1RHPA 1E3PA 1WD0A 2N3SA 1X3FA 3G4SA 3MA2B 1F9SA 2EXDA 2HUGA 2D2CC 4XT1B 4QL5A 1V43A 2K04A 4BBRB 4I65A 1HTPA 3HOWB 2IPKD 1S3OA 2WFWA 1X3EA 5E1FA 1Y14B 5JEAG 4DAYA 3PQIA 3TS0A 4J6HA 1ENCA 3Q0AA 3CCVA 2UXBQ 4RHSA 5I4DA 4ZUJA 1K0SA 4A4IA 1Y1WH 2F0KA 3K7UC 2Q2IA 4A3JB 2F0SA 3S14H 3L7ZC 3CF5A 3OSOA 3X3NA 3X3MA 1HZAA 4FF4A 2EY6A 2F0DA 3G7LA 4JI4L 1H9KA 4F7XA 3MXNB 2Q8RE 4C3HG 1VQMA 2F0JA 5BR8L 4R8IA 4A3EH 1SDFA 4I7AA 1I3QH 4XQNA 4A3JH 5EQ0A 4CJ0B 1PV4A 4IUQA 3OTOQ 4A3KG 4BXXG 3CKIB 1TWFB 2QILA 5FJ8G 5C0XJ 1XYIA 4NPSA 1BKBA 4HJAA 3KF8B 4A75A 1Y1WG 3VYTA 4RMFA 1L2FA 1C9OA 1GKHA 2KCCA 1K83B 1HFNA 1VQ9A 2PI2E 2ZTEA 5IE8A 4BY1G 5C44B 2O5JC 3DEPA 3H3VC 5ELOA 2VZAA 1QVFA 4OO1I 1ENFA 1LT5D 2EYJA 5CV9A 5FKAC 5LMNL 2A74C 1VQGA 3HOVG 4QY7A 2Z6KC 3IAYA 4IOAA 4K8IA 1JICA 3OW7A 1K3RA 1Q1EA 1BCPC 1NSNS 4E6IA 2ZXOA 2LS01 2FFKB 1RD9D 1SJED 2YTVA 5IGDA 1M8AA 1VMPA 1PZJD 2I46A 3J7ZC 2MPMA 1IHZA 3BYTB 1I4XA 4ZYSA 4TRDA 2RBMA 4DV1L 2N78A 4Y7NH 1ILQA 1XTCD 2MP1A 1Q86C 1PH7A 1PH6A 5BN3A 2YTYA 1NY4A 1EY0A 4P71A 1S72A 5EGTA 2K33A 3PUYA 3V2TA 4DK6C 1EY6A 4IPGA 1Y8OB 5IP9G 1I50B 4GLVB 1MJEA 5E4XA 1DOMA 4H02A 4X64Q 3T1HL 3FKIH 4HCSA 1UUPA 3I4MG 2QKIC 1SMYC 1LTAD 1N8RC 2OQKA 4K5VA 3P7JA 1BBXC 2AWNA 1A62A 4KJNA 4XYOA 1MIUA 2Y0SG 4HR7B 3CPFA 4JBJA 1HNXL 1W6KA 4X3SA 1HNZL 3D31A 4DGZA 1R9TH 1SNOA 1BNZA 4X65L 3MXNA 4NXNL 1B7YB 1CK1A 4A3BG 2K03A 1GUNA 2IWHA 3OWEB 5CGKA 4DAVA 2UUCQ 1IL2A 3FP9A 1Y69U 3PUWA 3RZOH 4AQYQ 2F03A 5C4HA 2NN6I 5DNFA 4RGTA 5KNBA 1I4RA 3SE0A 3J81j 1STGA 3KOJA 1TT2A 4JI5L 4R1JA 2E2IB 1BQQT 3BDLA 2F0HA 2EY2A 1K73C 3MXUA 1JJCB 1QNUA 1STEA 2NN6G 2AQ1B 1GM5A 1KHIA 4DR2L 4HIMA 1PFMA 4BBRH 3J81E 3M7GA 2GVBA 1LT6D 2F0GA 3D0FA 1WYDA 3M4OH 2WAQE 4KJOA 1EWIA 2KOLA 3PO3B 4DPGA 4KD4A 3W2DA 2QW7A 2NTTA 1VQKA 1P16A 2PQAA 1B9NA 1D5ZC 2HCIA 5IYDH 1NJIC 1JB3A 1IBLL 3E0JA 4CHTB 4RGNA 1B4OA 1J6QA 3U58A 4DR6L 1LTLA 2JA7B 4DR3L 4JI1L 2Q8TA 2JP1A 2HCCA 5M3MB 2IHFA 1C7YA 3QOJA 1RL2A 4AIMA 2A5HA 2FMMA 1TIID 4OHJA 3VYRA 5C3WA 2UXCL 3HOXB 2EIFA 3TMEA 3Q24A 1RDPD 4S3SA 1TWCH 3GTPH 2XIWA 4A3MG 1TWGB 5M3FH 4FO2A 4L63B 1XPUA 3TREA 2A68C 2O2LD 2N88A 5M9OA 3U4ZA 5C3XA 1WTPA 3R2TA 4DV5Q 4JPBW 4IUNA 2R7ZB 5DM73 2F4VL 1XPOA 5C6AA 1ENAA 3I4MB 3MVVA 1IYUA 2RDGA 2UXDQ 2NBFA 3DLLA 1OXTA 2I5LX 1IZ6A 5JOBA 4OWXB 5C5LA 3VYSA 1EIYB 3TZUA 4C3JH 1PFSA 2ZJRA 5LMUQ 4O2DA 5JVH3 5C4ZA 4DV6Q 2NVYB 4B9XA 5D3IB 2F1MA 4IUTA 5HGQA 5M5YB 3ULPA 3D4RA 1GUGA 3EROA 1YJNA 1IBML 2VL6A 1SNDA 3K5LA 3U50C 1NAPA 2B29A 2YV5A 5I2XA 3MHBA 1VQPA 2NN6H 2CW0D 2F0EA 2XWJB 4RWSC 1Y8NB 4BBSH 3CHBD 1EEID 3O13A 1FGUA 4C56C 2E76C 3S1MH 5EAYA 2EJFC 4A3KH 3HKZG 1HR0L 2PQAB 2KCNA 4FVMA 2SNMA 1EY5A 4KK7A 5CYUA 1LUZA 4BY7H 2CW0C 4RFBA 3D3RA 1EYAA 3PIP3 4BY7B 3RNUA 1DOKA 4BY1H 4A3IH 1KXLA 4K8JA 4LFAL 5I6YA 3AB9A 3S1QB 1A3TA 1S5BD 5CMDA 1FNUA 3QJYA 4JOIC 2Y0SE 3KBXA 5AJ3Q 4GOPC 1K8AC 1N32L 2BE5D 3CU7A 3NSWA 1PRTF 5C4XB 2M2LA 1NR4A 2K5QA 2LMCB 4C1NK 3K8AA 4G7HC 2Q2UA 1JORA 3GDEA 2KUMA 4GN5A 1PVOA 4GNXB 4B08A 4LF6L 3A7LA 1EY8A 2WAQG 4X3KA 1SR3A 1A15A 2K5WA 2UU9Q 1QE6A 1DYQA 1LTGD 3K6OA 3GTLH 3NBHA 3WWVA 5M5XH 1VMCA 4KV6A 3RN2A 3TEHB 3BS1A 2F0MA 1PYWD 1T9HA 4OX9L 3NK9A 1R4PB 1PH3A 4C1NI 4JI6L 1JT8A 2OCEA 2BH8A 2ID0A 2K6AA 3GQBA 4DV3L 2F0OA 1LO5D 1S5CD 3MFYA 1O7YA 1U4PA 2RHQB 4RCNA 2JA5G 1EY4A 1CSPA 4FP5D 1TWGH 1BO0A 1F2MA 2MUYA 2E5LL 1IBKL 4A3DB 1TWCB 3GTPB 3LWUA 4GLAC 3S1NB 4FXDA 1E1TA 2FJ2A 4DN4M 3CPWA 1K28A 3CP0A 3MFGA 3C2PA 4DV2L 1LTSD 1B2TA 4KHVA 1BF4A 3DWPA 2QEJC 1L0YB 3M3YB 4KY6A 3BDCA 3HGBA 3W1BA 4A93H 1MKHA 5JJLA 2PO4A 5KNCA 2XTIA 2QEXA 4C3JG 1MGSA 3E9HA 4LAAA 4BWGB 1I4GA 1UE7A 3MC0B 2CH4A 1BUVT 4C2MB 2F0FA 3GV6A 4NXNQ 4LF7Q 3SHLA 5I9PA 2A6EC 3S2HB 4KY5A 4DK0A 2OQ0A 3KK7A 1QOHA 3VR6A 5C3EG 4DUZQ 3M4OB 1VQOA 4BY7G 1ET9A 5AFWA 3V96A 1M1KC 5EPKA 2FHTA 1C0AA 4L8JA 2AWOA 3I4NG 1F9QA 3L3OC 4A3BH 1X3PA 1L0XB 1F77A 1TS5A 1YHBA 3SK8A 1H9RA 1YHQA 2UUAQ 1I94Q 2ZJQA 4HJ9A 5IP7G 2KECA 3GTLB 4UHVA 5ELNA 4H7BA 4CKEA 4X66Q 4PMWA 1L1OA 3PSIA 2PW5A 2R92B 3RUZA 1CQFA 1AEXA 2EY5A 2MO0A 1EZ8A 4I7ZC 2UUBQ 4YY3Q 2VQEL 2PW7A 2EJGC 3JAME 3RLFA 1STYA 5C3EH 2PZWA 4MTKA 2OWOA 4ZKCB 2JK8A 1KDAA 1A0IA 5C4XH 1EU3A 2IJ0A 2K32A 3PO3G 1G51A 2EYPA 2DN8A 3MAQA 1HFGA 2XN9C 4GOPB 1JB7A 1XNQL 1VQ6A 3EFXD 1X9NA 4C3HB 3DUZA 2K14A 4X3TA 5CBAE 1OO9B 1STAA 1EIFA 4ZK9B 3R3OA 3RZOB 1D5XC 4GNXC 5IP7H 1WCMH 3ND9A 1QZGA 5IGBA 3HG9A 2HDMA 5FO9B 2NVQH 2JA5B 1K8MA 2JA6G 5FJ8H 3NXWA 2IX3A 3S17H 1F9RA 3AEVA 3NWTA 4IPHA 5G3LD 3OIPA 4QUFA 2DGYA 2HHHQ 3MZ5A 3PMFA 3AFPA 1PH4A 1HR0W 4P74A 1S5FD 1TS3A 3QG1A 4GN3B 2J7ZA 1PH9A 1EWHA 3Q6SA 1DM0B 2R6GA 4N8X1 4XYQA 4DV5L 1I50H 5KYLA 1ICFB 1H9JA 2KCTA 1SYCA 4DR1Q 1HHVA 1C8CA 4A3FB 1AE3A 1DGSA 3A8IE 4LF9Q 3L2PA 1SJHD 2NVXB 4IJLA 3NPPA 1PMRA 1CHQD 4DV6L 4JBKA 3CRKC 2B2YC 2C5CA 4HJ7A 2F0TA 3RLOA 3A56A 1BVSA 3MXPA 4GKJQ 1KRSA 2B8FA 4ZRZA 5IP9H 2VXWA 1QB5D 2DJFC 4ME3A 3KYHC 3J7A5 1L1OB 5E3FA 2F0UA 2E2IH 1P8LA 2D62A 1VQAA 3NTHA 3N52A 5IOCA 3OYYA 2O5IC 2LXJA 1A2TA 2RCNA 1QUQB 5FK9C 3PF5A 2Z1CA 1LTRD 3GTJB 3SXHA 5CORA 3FHWA 4ABNA 2UXBL 1WTQA 3ITPA 1XNRL 3QO2A 3ZJYC 5FLMG 1EY7A 2B2UC 4BBRG 1I3QB 3F2DA 3BVZA 1JWUD 2ZM6L 1X3QA 1SRUA 2O4XA 1TVXA 1BR9A 1YBYA 3OWFA 3J7AV 4CKBA 1MHWC 2K5HA 2F0IA 2XGTA 3T53B 1Y8PB 4LWCA 1D1IA 4HAEA 3NBHB 2R92H 4JBWA 1JE4A 3PCOB 4LFCL 1W6JA 3A8JE 4DA2A 3HOWH 3TP7A 1WTHA 4G4KA 4A3IG 1G8ZD 4NDXA 5C4XG 2Q2HA 4IJHA 3Q8DA 4XTCS 2PZTA 2I07B 1J5EQ 3C1FA 2CCZA 5K36G 2WAQB 1JCKB 5M5XB 1WTOA 1SEBD 3UI2A 4HMIA 4GKKL 3A0JA 1TXYA 4JCVE 1D2BA 4JYAL 4FF1A 3ULLA 1BDOA 4B3SL 3CRLC 4CDFC 1YIJA 2X6LA 4L6TB 2Y0SB 2K5DA 3J7YW 5J39A 1AH9A 2MNAA 4OONA 5I2YA 4DV3Q 1S5ED 3CCUA 4R8NA 4POGA 4TSSA 1N34Q 3LNNA 3TQYA 2N55A 1LV9A 2KENA 4DV1Q 4HJ5A 3NWSA 3PUVA 2V4DA 3GTQB 3K81C 5IT9L 3S17B 3MTSA 2VW9A 3JAMc 5C44H 2JA8H 4A3CG 3DM3A 4QGUA 1WTVA 2JA5H 1OXVA 4B3TQ 4A3MH 3I73A 4WRDA 1GD7A 5KEEA 1FJGQ 2F0QA 3I4LA 1KLUD 1SYFA 3MEHA 1Q12A 4X64L 3GTOH 1PTOD 1Q8IA 4LF7L 4FF2A 2WACA 1KRTA 5ELCA 2M9VA 2B2UA 2YU9H 2E75C 1CKNA 2EXZA 3G48A 2EQSA 1RF2D 3UE0A 1Z47A 3D8GA 3G6EA 4F87A 4HIKA 1WTXA 5CV5A 4K5WA 3KF6A 2K05A 2WIIB 5KNDA 4AQYL 1V1PB 1I94L 3TSSA 3TS2A 4DR5Q 2XNAC 5C0XI 3EJIA 4M1UB 2IT1A 5H1SE 1AP0A 1VQBA 2XRQD 4JI5Q 2PI2A 2L5TA 4ME5A 5JPMC 5ELEA 2XSCA 1SNCA 4OIKA 3T4AC 3S1QH 2KBNA 4CGYB 2B2TA 4CDCC 3I4MH 1HUMA 4A3IB 2E2JH 1C48A 1K0RA 1XNQQ 5GAEC 4A3MB 1RIPA 2L4NA 4R4QA 3TDQA 1CQVA 2TSSA 1D7QA 4ZUIA 1O7IA 2ZT9C 1Q82C 4JOIA 3RN5A 1SN8A 1WTWA 2HIXA 3GD7A 2MQHA 2KA7A 4YWKA 1GJXA 2BDOA 3K7AH 2I5HA 1G91A 2OTJA 3E6ZX 1FNWA 2WP8J 3IFDA 3I4NH 3J80E 2E74C
chains in the Genus database with same CATH topology
4KY7A 1PRTD 4K5XA 2IX1A 2QF7A 2X69A 1VF5C 1O7LA 4H13C 3PO2B 1ML0D 3H09A 4PMCA 4V0BA 1DJRD 4PNYA 4KD3A 2LKVA 1LTBD 5IGCA 2E2JB 2KVMA 3P75A 2WV6D 2CQAA 3EA6A 5CR3A 4ODGA 3D6WA 5JAVA 1TQOA 4CJ1B 1EY9A 2F4IA 2DNEA 5JVG3 1J8IA 2VB3X 1Q1BA 4OL7A 4DF7A 2EZVA 3EVQA 1RJTA 3I70A 1SE4A 4J8QA 4ZKBB 4N9PA 1QNKA 2YU9B 1TY0A 3K0YA 3NQTA 3FEWX 3HOYB 2SEBD 2HQEA 1BCPF 1I4PA 2IW3A 1RODA 1ESFA 1R9TB 1ZXTA 1T5XD 1ZKOA 2EVBA 3TP6A 4U673 1GUOA 2BA0A 2XRSD 3H94A 4M8AA 4DK1A 1KDCA 2NTSA 4A3KB 3SVMA 2TMPA 4UDUC 2VUMB 1EQVA 3EQLC 5A2QL 5C5MA 1SNQA 2RDHA 2L11A 4BA1I 3FDTA 3OIQA 1PFBA 3PV0A 5EBCA 2K01A 4DXFA 3HKZB 3SDZA 3PUZA 3FPPA 1QILA 1M4VA 5DM63 1DONA 1S5DD 5FO7B 3I8ZA 2EYHA 3IFTA 3S16B 1CFMA 1H9SA 5IGFA 2EYFA 3J81L 1EFID 1ET6A 3T16A 5K36H 1SNMA 4RHRA 4IQZA 4K6DA 2SNSA 1KNEA 5M3FB 3RMHA 1EIGA 2OF1A 1BOSA 1PZKD 3BZDB 1CM9A 2E2DC 2A6HC 3QB3A 1B3AA 2EOTA 4NKLA 1EU4A 5A2QE 1GXDC 1YNJD 3GV3A 2RSNA 1Z7TA 1HPCA 1TWHB 3HZXA 1ZEQX 2AQ3B 3K7AB 5EPJA 1KTKA 4H44C 3K5MA 3QIAA 1SYGA 1MSGA 2IX0A 1LLRD 1WD1A 3J80L 2FINB 3GTGB 2OEOA 2WKDA 3GTMB 5D3DA 1RCVD 1QG7A 3VR5A 1E0BA 3OHXC 3SEBA 3T51B 4F8MA 3TP5A 1TKWB 5HURA 1FYCA 3WDNA 5TSSA 5KRUA 3SK6A 1GHKA 2QDBA 2X6GA 1F2ZA 1E2WA 1JR0D 3HP3A 1F9PA 5JPNC 3DHQA 4IALA 5J1ZA 1EOTA 2EY1A 1PTOF 2L55A 2WKCA 1CTMA 3NTIA 3R8BA 2ICEC 1JWMD 4K14A 1V1PA 3AMUA 1C4QA 1RTOA 4NP5A 1EIHA 1WCMB 2E2HB 1BCPD 3NTKA 2ICIA 2A73B 5I6WA 2ZXRA 4IFDJ 5COYA 4YIJA 4XXEA 1XWEA 4CJ2C 2NWGA 1B44D 3V05A 5C0XG 3MWYW 2M00A 2B63B 5M5WB 5KYIA 2AQ2B 2WINB 2F0LA 3OPOA 3QWNA 4OIJA 1QWYA 4JK1C 5CC4A 2KQ3A 5DEHA 1DD2A 2BOSA 2Z4HA 3R93A 4B9WA 1Q90A 1FNVA 1GUWA 1STHA 1TR5A 1OXUA 2A69C 5IIFA 5EPLA 2G9DA 5LHY1 1UEAB 4OO1H 3ZYYX 5CBEE 1II3A 4WORA 3FPUB 2DY7A 1JOOA 3K5OA 2PCFB 2L12A 1HTLD 4A3EB 4EQNA 5FOBB 4EQPA 3K5NA 4DU9A 4KN4C 1HQRD 1X32A 2CVRA 3SK5A 1WTRA 2EJMA 3S14B 1XXGA 3A7AB 2JSOA 4ZQ3A 4KMUC 2R61A 3IL8A 4TQUS 4RGMA 3S1RB 1LTTD 2JYOA 2KJXA 4KN7C 4QIWB 1U4RA 4R9WA 5JEAH 4P2CB 2JE6I 4XIGS 5KGUA 1DXMA 5C0XH 1HRJA 3SK4A 3JAML 2MJ8A 1CZGA 5ELBA 5CV8A 1OXXK 3J7AF 3KLRA 2B2WA 3BVGA 2VNUD 1JWSD 4A93B 1GUTA 1PTOH 2PZUA 1CT1D 1G6ZA 4IZ8A 2G9HD 1YNND 5EBDA 1PZID 5EKLA 1D5MC 4BY1B 4FXKC 3WOEA 1G2SA 2B2VC 3C46A 1UNSA 1RTNA 1TS4A 4HN7A 1GHJA 3S15B 3DWQA 2B2TC 5C4JB 4IURA 2K1BA 4A3GB 1SE2A 2NVQB 1IYVA 5BN5A 3TBIB 3KBGA 2EE1A 1JOQA 5EKKA 4AYBB 4H0LC 5EJWA 1MD2D 2L1BA 2GA4B 2BE5C 3IKJA 5C3EB 1ZYRD 4HSVA 3I90A 5D65A 3H91A 3BDOA 3DMUA 2AUKA 3URYA 4U68A 1D1KA 2Q8IB 3DXJC 4C3IB 4LMQD 2D9UA 3NQIA 1SXTA 5EKIA 1TS2A 4HSPA 3RD4A 4XQQA 4WJWA 4QB4A 5JEAJ 2JA8B 1Y1VB 1LTID 1STBA 3RZDB 2NVTB 4FXGC 1DCZA 5T1GA 1KNAA 3HOUB 3W3AA 3VR3A 3P20A 2L0CA 1D6EC 2RKSA 1JC7A 1EL0A 1SE3A 5FO8B 1CA5A 3LWEA 4Z9CB 3WOFA 1QCBD 4PQXA 3FVQA 2JA6B 1MI2A 2D5DA 3A54A 2HDLA 1I4QA 3BYYB 4BS9A 1XX8A 1G291 1IW7C 4ZAIA 3NBIA 4IUPA 2LFNA 3E5SA 3Q22A 4V190 2ENBA 2IL8A 5A35A 1MBYA 3MXGA 1KDBA 1F2LA 2H4OA 1VF7A 3VR2A 1WVLA 4RCOA 3DWAA 4G57A 5CV6A 5I9OA 1Q3LA 3Q23A 1EWCA 4DXGA 2K28A 4FF3A 3I91A 1ILPA 1TWAB 1PFNA 3GO5A 3H0GB 4C3IG 2F0WA 4KKUA 4IFDH 2JEBI 2SOBA 1AFPA 1KABA 3FRPB 1SFOB 1ONLA 5E4WC 2Z4IA 1I4HA 1LT4D 2L9HA 2QCPX 5LL6X 3G6JB 1E2VA 1EZ6A 1OXSC 2EYLA 1KAAA 3T13A 4K6LA 3CQZB 4DNTB 4BBSB 1STNA 3TN2A 1JOKA 1NCVA 1EQTA 2B8GA 3VA7A 4XT3B 4RH6A 5KIXA 1VDZA 1H9SB 2OXPA 1MSHA 2Z8LA 4LJZC 3D6CA 1PRTB 3U9OA 1J9OA 4XDXA 3C1EA 1UAPA 2KEEA 4RKBA 2F0NA 2F3WA 5D14A 2RDFA 1BXTA 3FMCA 4MIUA 4OGQC 5IT9E 1IKMA 3FKIB 2KHSA 2RSOA 4PV1C 5HGTA 2A69D 3OMGA 1PTOB 4MN3A 4RAUC 3M7NA 5CV4A 4KKTA 4O1NA 4IFDG 1TU2B 2XVSA 4NMZA 4HCEA 2B2WC 1FD7D 2BDNA 4N9TA 1AN8A 5ISRA 1HCZA 2JXMB 1YNJC 2AUJD 1EEFD 4ULLA 4HEDA 4A3BB 1U9RA 3N6RA 1FGBD 1GOZA 3I72A 2RQXA 3HEJA 2DY8A 2WB1B 1I6VC 4K2KA 2RVLA 1B9MA 4F88A 2F3VA 2EPBA 3K59A 3GTKB 2XWBB 1SYBA 1SYEA 3F2UA 4ID6A 2DNCA 1B1ZA 3K58A 2MGSA 3LX0A 5G3LF 4PMBA 5IODA 1SNPA 4QUCA 4KI0A 1V8QA 2CHBD 2KEDA 1E2ZA 4FNFA 5FLXE 4WFN3 1CA6A 5K5PA 1O7ZA 5CV7A 1RKNA 1YNNC 3ND8A 1Y1WB 2F0PA 3M4YA 3DM1A 2NYZD 4HMJA 1SMYD 2FMCA 2NB0A 1ESRA 3ERQA 1A3VA 1Z6HA 2EDGA 4ZLTF 1I6HB 3HOVB 4X3UA 3K57A 1CZWA 3A55A 2PQEA 2SDFA 5ELDA 2NUCA 4IN3A 2R93B 1AW7A 4Y7NB 4Q5VA 3OMCA 3NHHA 4DFAA 1PDQA 3NUCA 3TZDA 1LACA 1IL8A 1SAPA 2PNRC 4TKOB 4G7ZC 2PYKA 4EGVA 2VB2X 1SSOA 1U4LA 5IGGA 1HA5A 3ONAB 1DZ1A 2C9OA 1A2UA 1CHPD 2ZXPA 4UAIA 1AZPA 3D4WA 3VYUA 2J0TD 4QCLA 1PLFA 1TY2A 3H6MA 3D4DA 4C3JB 4FYDA 3KF8A 1V1OA 3PIO3 2A68D 1LABA 1HUNA 4IUUA 1S4ZA 3KLSX 1FR3A 3HRZC 1G2TA 2BA1A 1NR2A 3L9AX 2A6HD 3NP8A 4NW2A 1IW7D 4KHZA 3BG3A 4IUVA 1F2YA 2JEAI 4DAPA 3KUPA 3KLSA 3HS0C 4DNRB 3NE5B 4KKSA 4O42A 3QOLA 3I4NB 5T1IA 5ELFA 1EYCA 1IKLA 1R4QB 4CBVA 3VR4A 2J4XA 4KTAA 3T56B 1U4MA 2B2VA 2NZ1D 3TP8A 2EYMA 1QJOA 1PXUA 4LK1C 3C3LA 1NUCA 3SR1A 3S1MB 1A6XA 2PMZB 1T5EA 4RGOS 3DEOA 3P1HA 1ZYRC 2OT2A 2A6ED 1DOLA 1EYDA 1O78A 5BN4A 2K7VA 5IGEA 1K8OA 4ILWA 1SYDA 2RA4A 4XQJA 1HXYD 1JQYD 1HQMC 3U9SA 1ICWA 1PTOC 3R2IA 5DAUA 1B53A 3A8KE 3S9WA 5F2DA 2MHVA 4HTHA 4Q0FA 3VA5A 1SBBB 2PPBC 4EQOA 1VCIA 1AZQA 2B2YA 1LT3D 2BCOA 4OO1G 2H1EA 5LL6S 4GZYC 3PUXA 4J1MA 4RKLA 4RA8A 3OOCA 4G7OC 4QF4A 3GP7A 3GTOB 3S2DB 2R3ZA 4BA2I 3HOZB 4EVOA 1BCPB 1B50A 5NUCA 4CKCA 3I3CA 3M85A 3BVMA 4IFDI 1HA6A 4QMGA 1O80A 1CI3M 2F0VA 2EYOA 2LY7A 2B39A 1GUSA 3AU7A 1H9MA 2YYZA 1KLGD 5JJZA 4MHEA 1A3UA 5J22A 4K2LA 5FLXL 1PRTC 1RHPA 1WD0A 3MA2B 1F9SA 2HUGA 2D2CC 4XT1B 1V43A 2K04A 4BBRB 4I65A 1HTPA 3HOWB 2IPKD 5E1FA 5JEAG 4DAYA 4J6HA 1ENCA 3Q0AA 4RHSA 5I4DA 4ZUJA 2F0KA 4A3JB 2F0SA 3L7ZC 3OSOA 3X3NA 3X3MA 4FF4A 2EY6A 2F0DA 3G7LA 1H9KA 4F7XA 2Q8RE 4C3HG 2F0JA 4R8IA 1SDFA 4XQNA 5EQ0A 4CJ0B 4IUQA 3CKIB 1TWFB 2QILA 5C0XJ 1XYIA 3VYTA 2KCCA 1K83B 1HFNA 5C44B 2O5JC 3DEPA 3H3VC 4OO1I 1ENFA 1LT5D 2EYJA 5CV9A 5FKAC 2A74C 3IAYA 4K8IA 1JICA 3OW7A 1Q1EA 1BCPC 1NSNS 4E6IA 2ZXOA 2LS01 2FFKB 1RD9D 1SJED 5IGDA 1M8AA 1VMPA 1PZJD 2I46A 2MPMA 1IHZA 3BYTB 1I4XA 4ZYSA 4TRDA 2RBMA 1ILQA 1XTCD 2MP1A 5BN3A 1EY0A 5EGTA 2K33A 3PUYA 3V2TA 1EY6A 1Y8OB 1I50B 5E4XA 1DOMA 4HCSA 1UUPA 2QKIC 1SMYC 1LTAD 4K5VA 3P7JA 1BBXC 2AWNA 4KJNA 4XYOA 4HR7B 1W6KA 4X3SA 3D31A 4DGZA 1SNOA 1BNZA 3MXNA 1CK1A 2K03A 1GUNA 2IWHA 3OWEB 5CGKA 4DAVA 1Y69U 3PUWA 2F03A 5C4HA 2NN6I 5DNFA 4RGTA 5KNBA 1I4RA 3SE0A 1STGA 1TT2A 2E2IB 1BQQT 3BDLA 2F0HA 2EY2A 3MXUA 1QNUA 1STEA 2NN6G 2AQ1B 1PFMA 3J81E 3M7GA 1LT6D 2F0GA 4KJOA 2KOLA 3PO3B 4KD4A 3W2DA 2NTTA 1B9NA 1D5ZC 2HCIA 1JB3A 3E0JA 4CHTB 4RGNA 1B4OA 2JA7B 2Q8TA 2JP1A 2HCCA 5M3MB 3QOJA 5C3WA 2A5HA 2FMMA 1TIID 4OHJA 3VYRA 3HOXB 3TMEA 3Q24A 1RDPD 4S3SA 2XIWA 1TWGB 4FO2A 4L63B 2A68C 2O2LD 2N88A 5M9OA 5C3XA 1WTPA 3R2TA 4IUNA 2R7ZB 5DM73 5C6AA 1ENAA 3I4MB 3MVVA 1IYUA 2RDGA 2NBFA 1OXTA 5JOBA 3VYSA 5C5LA 3TZUA 5JVH3 5C4ZA 2NVYB 4B9XA 5D3IB 2F1MA 4IUTA 5M5YB 3D4RA 1GUGA 3EROA 1SNDA 3K5LA 1NAPA 5I2XA 3MHBA 2NN6H 2CW0D 2F0EA 2XWJB 4RWSC 1Y8NB 3CHBD 1EEID 3O13A 4C56C 2E76C 2EJFC 2KCNA 4FVMA 2SNMA 1EY5A 4KK7A 5CYUA 2CW0C 4RFBA 3D3RA 1EYAA 3PIP3 4BY7B 1DOKA 4K8JA 5I6YA 3AB9A 3S1QB 1A3TA 1S5BD 5CMDA 1FNUA 3QJYA 3KBXA 2BE5D 3CU7A 3NSWA 1PRTF 5C4XB 2M2LA 1NR4A 2K5QA 2LMCB 4C1NK 4G7HC 1JORA 2KUMA 4B08A 3A7LA 1EY8A 4X3KA 1A15A 2K5WA 1QE6A 1DYQA 1LTGD 3K6OA 3NBHA 1VMCA 4KV6A 3BS1A 2F0MA 1PYWD 3NK9A 1R4PB 4C1NI 2ID0A 2K6AA 3GQBA 2F0OA 1LO5D 1S5CD 3MFYA 1O7YA 1U4PA 4RCNA 1EY4A 4FP5D 1BO0A 1F2MA 2MUYA 4A3DB 1TWCB 3GTPB 3LWUA 3S1NB 4FXDA 2FJ2A 4DN4M 3MFGA 3C2PA 1B2TA 1LTSD 4KHVA 1BF4A 3DWPA 2QEJC 1L0YB 3M3YB 4KY6A 3BDCA 3HGBA 2PO4A 5KNCA 4C3JG 1MGSA 4LAAA 4BWGB 1I4GA 3MC0B 4C2MB 1BUVT 2F0FA 3GV6A 3SHLA 5I9PA 2A6EC 3S2HB 4KY5A 4DK0A 3KK7A 1QOHA 3VR6A 3M4OB 1ET9A 5AFWA 3V96A 5EPKA 2FHTA 4L8JA 2AWOA 1F9QA 3L3OC 1X3PA 1L0XB 1F77A 1TS5A 3SK8A 1H9RA 3GTLB 2KECA 4H7BA 4CKEA 4PMWA 2PW5A 2R92B 3RUZA 1CQFA 1AEXA 2EY5A 1EZ8A 4I7ZC 2PW7A 2EJGC 3JAME 3RLFA 1STYA 2PZWA 4ZKCB 1KDAA 1EU3A 2IJ0A 2K32A 2EYPA 3MAQA 2DN8A 1HFGA 2XN9C 3EFXD 4C3HB 3DUZA 4X3TA 5CBAE 1OO9B 1STAA 4ZK9B 3R3OA 3RZOB 1D5XC 3ND9A 5IGBA 3HG9A 2HDMA 5FO9B 2JA5B 1K8MA 3NXWA 2IX3A 1F9RA 3NWTA 5G3LD 3OIPA 4QUFA 3MZ5A 3PMFA 1S5FD 1TS3A 3QG1A 2J7ZA 1EWHA 3Q6SA 1DM0B 2R6GA 4XYQA 5KYLA 1H9JA 1SYCA 1HHVA 1C8CA 4A3FB 3A8IE 2NVXB 1SJHD 3NPPA 1PMRA 1CHQD 3CRKC 2B2YC 2C5CA 2F0TA 3A56A 3MXPA 2B8FA 4ZRZA 2VXWA 1QB5D 5E3FA 2F0UA 2D62A 3NTHA 3N52A 5IOCA 2O5IC 1A2TA 5FK9C 2Z1CA 1LTRD 3GTJB 3SXHA 5CORA 4ABNA 1WTQA 3ITPA 3QO2A 1EY7A 2B2UC 1I3QB 3BVZA 1JWUD 1X3QA 2O4XA 1TVXA 1BR9A 3OWFA 3J7AV 4CKBA 2F0IA 3T53B 1Y8PB 1D1IA 4HAEA 4JBWA 1JE4A 1W6JA 3A8JE 4DA2A 3TP7A 4G4KA 1G8ZD 4NDXA 4XTCS 2PZTA 2I07B 3C1FA 5K36G 2WAQB 5M5XB 1JCKB 1WTOA 1SEBD 3UI2A 4HMIA 1D2BA 4FF1A 1BDOA 3CRLC 2X6LA 4L6TB 2Y0SB 2K5DA 3J7YW 5J39A 5I2YA 1S5ED 4R8NA 4TSSA 3LNNA 2N55A 1LV9A 3NWSA 3PUVA 2V4DA 3GTQB 5IT9L 3S17B 3MTSA 1WTVA 1OXVA 3I73A 4WRDA 5KEEA 2F0QA 3I4LA 1KLUD 1SYFA 3MEHA 1Q12A 1PTOD 1Q8IA 4FF2A 2WACA 5ELCA 2M9VA 2B2UA 2E75C 2EXZA 1RF2D 1Z47A 3D8GA 4F87A 1WTXA 5CV5A 4K5WA 2K05A 2WIIB 5KNDA 1V1PB 3TSSA 2XNAC 5C0XI 3EJIA 4M1UB 2IT1A 1AP0A 2XRQD 2L5TA 5JPMC 4ME5A 5ELEA 2XSCA 1SNCA 4OIKA 3T4AC 4CGYB 2B2TA 1HUMA 4A3IB 1C48A 4A3MB 2L4NA 3TDQA 1CQVA 2TSSA 4ZUIA 2ZT9C 1WTWA 3GD7A 2KA7A 1GJXA 2BDOA 1G91A 3E6ZX 1FNWA 2WP8J 3IFDA 3J80E 2E74C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYC A;  5J39 A;  2F0N A;  2F3W A;  4KY7 A;  5C5M A;  4LAA A;  4J1M A;  2F0E A;  2RDF A;  5IIF A;  3ERQ A;  4RKL A;  5KRU A;  4R8N A;  1KDB A;  4K5X A;  3SK6 A;  2QDB A;  2F0F A;  1A3V A;  4QF4 A;  4MIU A;  1II3 A;  1F2Z A;  4WOR A;  1JOQ A;  5EKK A;  3SHL A;  5I9P A;  3NP8 A;  4KY5 A;  4EVO A;  2KHS A;  1JOO A;  3DHQ A;  2F0G A;  4IAL A;  4RKB A;  5NUC A;  2F0T A;  5HGT A;  4PMC A;  5J1Z A;  4KJO A;  4G57 A;  2SNM A;  3OMG A;  1F2Y A;  2EYJ A;  1EY5 A;  3MXP A;  5CV6 A;  5CV9 A;  4KD4 A;  4EQN A;  4EQP A;  2EY1 A;  5I9O A;  2EYH A;  2PQE A;  4DU9 A;  4PNY A;  1EYA A;  4K8I A;  5CV4 A;  4WRD A;  2NUC A;  1NSN S;  2LKV A;  4KD3 A;  4QMG A;  4E6I A;  2F0Q A;  5IGC A;  5KEE A;  3P75 A;  5IGF A;  2EYF A;  2F0V A;  3DMU A;  3SK5 A;  5IGD A;  2EYO A;  3QOL A;  4NMZ A;  4K8J A;  3T16 A;  1SYF A;  1SNM A;  2F0W A;  3SK8 A;  1IHZ A;  3MEH A;  2F0U A;  5CR3 A;  4ODG A;  5E3F A;  5I6Y A;  2SOB A;  4TRD A;  2RBM A;  1EYC A;  1A3T A;  3OMC A;  4K14 A;  1KAB A;  3NHH A;  4K6D A;  4N9T A;  5ISR A;  5IOC A;  2SNS A;  4H7B A;  4NP5 A;  4ZQ3 A;  5IGG A;  1A2T A;  2PW5 A;  4DFA A;  3RUZ A;  4KTA A;  2OF1 A;  1AEX A;  2EY5 A;  5JAV A;  1EZ8 A;  2WAC A;  2PW7 A;  1A3U A;  3NUC A;  3QOJ A;  1EY0 A;  4K2L A;  5J22 A;  1U9R A;  5EGT A;  1TQO A;  3SXH A;  1STY A;  5C3W A;  2PZW A;  5I6W A;  1JOR A;  1EY9 A;  1KDA A;  3ITP A;  3TME A;  3V2T A;  4QB4 A;  3TP8 A;  1EY6 A;  1EY7 A;  4S3S A;  4YIJ A;  2EYM A;  2EYP A;  2EXZ A;  1EY8 A;  3HEJ A;  3QB3 A;  5KGU A;  4OL7 A;  4DF7 A;  1STB A;  1EZ6 A;  2EYL A;  4K2K A;  3EVQ A;  4NKL A;  2PYK A;  1NUC A;  2F3V A;  3D8G A;  3SR1 A;  1KAA A;  5M9O A;  4N9P A;  2O4X A;  4I65 A;  5CV5 A;  1STA A;  4K5W A;  3OWF A;  4KV6 A;  3SK4 A;  3T13 A;  3R3O A;  4K5V A;  5C3X A;  2F0M A;  4IUN A;  3NQT A;  1STN A;  2F0I A;  2M00 A;  3P1H A;  5CV8 A;  3HZX A;  3NK9 A;  1SYB A;  4KJN A;  2HQE A;  1JOK A;  5E1F A;  1ENA A;  5C6A A;  5KYI A;  1SYE A;  3EJI A;  3MVV A;  4J6H A;  5IGB A;  1ENC A;  1EYD A;  2RKS A;  4ID6 A;  1A2U A;  4DGZ A;  3TP7 A;  2F0O A;  4ZUJ A;  2F0K A;  5JOB A;  4ME5 A;  5IGE A;  2PZU A;  5C5L A;  1SNC A;  1SNO A;  4NDX A;  3NXW A;  1SYD A;  2F0S A;  4IZ8 A;  3D4W A;  1EY4 A;  2F0L A;  3OSO A;  3LX0 A;  1F2M A;  4PMB A;  5EKL A;  1SYG A;  2EY6 A;  1SNP A;  5C4Z A;  5IOD A;  5KIX A;  2F0D A;  3MZ5 A;  5CGK A;  2OXP A;  5CC4 A;  3PMF A;  3TP6 A;  4B9X A;  2PZT A;  5DAU A;  2KQ3 A;  3C1F A;  5DEH A;  4F7X A;  3D6C A;  2OEO A;  3S9W A;  5F2D A;  4B9W A;  5C4H A;  4KHV A;  4HMI A;  2F0J A;  3ERO A;  4HTH A;  3VA5 A;  4ZUI A;  4EQO A;  1SND A;  1STH A;  1KDC A;  1STG A;  5K5P A;  5KYL A;  1TT2 A;  3H6M A;  3D4D A;  5CV7 A;  3U9O A;  4KY6 A;  3BDC A;  1TR5 A;  1RKN A;  3MHB A;  1EQV A;  2F0P A;  4F8M A;  3E5S A;  3TP5 A;  3C1E A;  3BDL A;  2F0H A;  2ENB A;  2EY2 A;  5HUR A;  4HMJ A;  1SNQ A; 
#chains in the Genus database with same CATH topology
 4C2M H;  4KY7 A;  4B3R L;  4DUY L;  5M3M H;  4JI7 L;  1PRT D;  4K5X A;  2IX1 A;  2QF7 A;  2G5D A;  2X69 A;  4YHH Q;  2E8G A;  1KQS A;  2QDL A;  2MFI A;  2A8V A;  1VF5 C;  1KIX A;  1O7L A;  4H13 C;  3M3Y H;  2Z6B A;  4X62 Q;  3PO2 B;  3KFU A;  1ML0 D;  5L37 A;  3HFZ B;  3H09 A;  4PMC A;  4V0B A;  1DJR D;  2K5V A;  4PNY A;  3SGI A;  4KD3 A;  2LKV A;  1LTB D;  5IGC A;  2E2J B;  2KVM A;  2NVY H;  3P75 A;  2WV6 D;  2CQA A;  2QGQ A;  3EA6 A;  3H3V H;  4OEL B;  5CR3 A;  1EQR A;  4ODG A;  3MEF A;  3D6W A;  2F4V Q;  5JAV A;  5C44 G;  4A3C H;  1TQO A;  4CJ1 B;  1EY9 A;  2F4I A;  2DNE A;  5JVG 3;  2OTL A;  3KJP A;  5GAD C;  1J8I A;  2JA6 H;  3CCR A;  2VB3 X;  1EQQ A;  1Q1B A;  4OL7 A;  4FDB A;  4DF7 A;  4UY8 C;  2EZV A;  3EVQ A;  1IXR A;  1RJT A;  3I70 A;  1SE4 A;  5JJK A;  4PZ7 A;  4J8Q A;  1VS0 A;  3ICE A;  4ZKB B;  4N9P A;  1QNK A;  2YU9 B;  1TY0 A;  5IYB H;  3K0Y A;  3NQT A;  4P75 A;  3BZC A;  3FEW X;  3HOY B;  2SEB D;  2HQE A;  1BCP F;  4AH6 A;  1I4P A;  2R7Z G;  2IW3 A;  2VUM H;  1ROD A;  1ESF A;  2YTX A;  1R9T B;  1WJJ A;  1T5X D;  1ZXT A;  5LMN W;  1ZKO A;  3CC7 A;  2EVB A;  4IPC A;  4LUV A;  4DV0 Q;  1Y1V H;  3BU2 A;  3IRB A;  1U0L A;  3HOZ H;  3TP6 A;  4U67 3;  1GUO A;  2BA0 A;  4LW1 A;  1JE5 A;  5IYC H;  2XRS D;  3H94 A;  4M8A A;  4DK1 A;  1KDC A;  2F3I A;  5GAH C;  1QZH A;  3HKZ E;  1L1O C;  1HH2 P;  2NTS A;  4A3K B;  3SVM A;  3HOU G;  1JJ2 A;  2TMP A;  4UDU C;  3HOY G;  4L5R C;  4A3L H;  1EQV A;  2VUM B;  5IY0 A;  3EQL C;  5A2Q L;  5C5M A;  1SNQ A;  2RDH A;  2L11 A;  2DJG C;  4BA1 I;  3FDT A;  3OIQ A;  1PFB A;  3PV0 A;  2HIV A;  5EBC A;  3CMA A;  2K01 A;  4DXF A;  3HKZ B;  4LFA Q;  3PUZ A;  3SDZ A;  3FPP A;  4B3M L;  3CC4 A;  1QIL A;  1M4V A;  3CCS A;  2C35 B;  5DM6 3;  3CME A;  1DON A;  1S5D D;  5FO7 B;  3OTO L;  3I8Z A;  5M5Y H;  2EYH A;  3IFT A;  3PO2 G;  3S16 B;  4MNO A;  4NB3 A;  1CFM A;  4JI2 L;  1H9S A;  1PYS B;  5IGF A;  2EYF A;  3J81 L;  5JJI A;  1EFI D;  1ET6 A;  3T16 A;  3F8T A;  5K36 H;  1SNM A;  4RHR A;  4DAM A;  3M4Q A;  4IQZ A;  4K6D A;  1W2B A;  1B8A A;  2SNS A;  2CFM A;  1KNE A;  5M3F B;  3RMH A;  4JV5 Q;  3S15 H;  4LF4 Q;  1EIG A;  2OF1 A;  1BOS A;  1Z9F A;  1VQ8 A;  3JC6 6;  4JI6 Q;  1PZK D;  3BZD B;  2A1A A;  1E24 A;  1CM9 A;  3J81 c;  2E2D C;  2A6H C;  3QB3 A;  2JA7 H;  1B3A A;  2EOT A;  4NKL A;  1VQD A;  1EU4 A;  5A2Q E;  1GXD C;  1YNJ D;  3GV3 A;  2N8N A;  2RSN A;  4KLK A;  4RG1 A;  1Z7T A;  1HPC A;  1TWH B;  1VQJ A;  3HZX A;  1VQN A;  1ZEQ X;  4IPD A;  4IO9 A;  4NXM Q;  2AQ3 B;  5GAG C;  4N8F A;  5M3F G;  2K4K A;  3K7A B;  4DR3 Q;  5EPJ A;  1K8G A;  1KTK A;  4DV7 Q;  1PHJ A;  1A8V A;  1UE6 A;  1LM0 A;  1NMG A;  4H44 C;  3KLW A;  4JVZ A;  3K5M A;  3QIA A;  1SYG A;  1MSG A;  2Z0S A;  2UXC Q;  1FL0 A;  2IX0 A;  3HOX G;  4DNI A;  1LLR D;  1WD1 A;  3J80 L;  2FIN B;  2AHO B;  3GTG B;  2OEO A;  2WKD A;  4OWW B;  2K50 A;  3CW2 C;  3GTM B;  5D3D A;  2VUM G;  1RCV D;  1QG7 A;  3VR5 A;  1E0B A;  3F1Z A;  3CAM A;  4DR4 L;  3OHX C;  3SEB A;  3T51 B;  4LUO A;  4F8M A;  3TP5 A;  1TKW B;  5HUR A;  3AQQ A;  1FYC A;  3WDN A;  3M4P A;  5TSS A;  5KRU A;  4A3F H;  2UUC L;  4UP7 A;  4GOP A;  3SK6 A;  1GHK A;  1TWF H;  2QDB A;  2X6G A;  1VQI A;  1F2Z A;  1E2W A;  1JR0 D;  3HP3 A;  1F9P A;  2UUA L;  5JPN C;  5IYC G;  3DHQ A;  3E9I A;  4IAL A;  5J1Z A;  1I6H H;  1EOT A;  2CQO A;  1PTO F;  2EY1 A;  3STB D;  1IBM Q;  2L55 A;  2BH2 A;  4GNX A;  2WKC A;  1CTM A;  4CDD C;  3TRZ A;  3GTJ H;  3NTI A;  3R8B A;  3OW2 A;  4AYB E;  4LF5 L;  2ICE C;  1JWM D;  4JI0 Q;  2R92 G;  4B3R Q;  4K14 A;  4HIO A;  4A3F G;  1V1P A;  3AMU A;  2R93 G;  1C4Q A;  1RTO A;  4NP5 A;  4J15 A;  1EIH A;  5E7N A;  3KDF B;  1WCM B;  4JI8 Q;  2E2H B;  3T1Y Q;  1BCP D;  4K0K L;  3NTK A;  2ICI A;  2A73 B;  5I6W A;  3S16 H;  2ZXR A;  4IFD J;  5COY A;  3PIO A;  4YIJ A;  4DV4 Q;  4XXE A;  1XWE A;  4CJ2 C;  2NWG A;  4R4O A;  3GTQ H;  1B44 D;  3V05 A;  5C0X G;  4JI4 Q;  1PA6 A;  2AMC B;  3NEM A;  4DR6 Q;  1Q8K A;  3UDF A;  3MWY W;  2HD3 A;  2M00 A;  4LUZ A;  2B63 B;  5M5W B;  4YCW A;  5KYI A;  5IT9 c;  5IWA Q;  2AQ2 B;  2B63 H;  2LSS A;  2WIN B;  1NBW A;  1D8L A;  2AKW B;  2PMZ E;  2F0L A;  3OPO A;  3QWN A;  4OIJ A;  3GTM H;  1QWY A;  5HY6 A;  4JK1 C;  1K83 H;  5CC4 A;  2A19 A;  2KQ3 A;  5DEH A;  1CKM A;  1DD2 A;  2BOS A;  2Z4H A;  3R93 A;  4B9W A;  1V9P A;  1Q90 A;  1FNV A;  1GUW A;  1STH A;  1CKO A;  3H3V I;  1KAW A;  1TR5 A;  1OXU A;  4OX9 Q;  3S2H H;  1YNX A;  2A69 C;  1B70 B;  5IIF A;  5EPL A;  2G9D A;  1VQE A;  2D0P A;  2VS1 A;  4AYB G;  5LHY 1;  4POF A;  1UEA B;  4OO1 H;  3ZYY X;  5CBE E;  1II3 A;  4WOR A;  1YJW A;  4OEM B;  1NTG A;  1K3B C;  3FPU B;  2DY7 A;  3CXC A;  1JOO A;  3K5O A;  2PCF B;  2L12 A;  1HTL D;  4A3E B;  4EQN A;  5FOB B;  4LF8 L;  3FKI G;  4EQP A;  3K5N A;  4DU9 A;  4KN4 C;  1HQR D;  1PYB A;  1X32 A;  2CVR A;  2KHI A;  3SK5 A;  1KL9 A;  1WTR A;  2EJM A;  3S14 B;  4R4I A;  3EIV A;  3T1H Q;  2VQF Q;  1XXG A;  3A7A B;  4DR7 Q;  4CDE C;  2JSO A;  4ZQ3 A;  4KMU C;  3UE1 A;  2R61 A;  3ERS X;  3IL8 A;  3KJO A;  4TQU S;  4RGM A;  1YJ9 A;  2ZTC A;  3S1R B;  4JBM A;  1LTT D;  2JYO A;  3EBE A;  4WJ3 M;  2KJX A;  4KN7 C;  2ZTD A;  2WB1 E;  4QIW B;  1U4R A;  4R9W A;  4LFC Q;  1HNZ Q;  5JEA H;  1PH8 A;  4P2C B;  2JE6 I;  4XIG S;  4X65 Q;  5KGU A;  4KHP L;  1DXM A;  1EYG A;  5C0X H;  1E22 A;  1QUQ A;  1HRJ A;  3SK4 A;  3STB C;  3JAM L;  2MJ8 A;  1CZG A;  5ELB A;  5CV8 A;  1OXX K;  3J7A F;  3KLR A;  2B2W A;  2F52 A;  3BVG A;  1JMC A;  2VNU D;  3A5Z B;  1CSQ A;  4L5Q A;  4B3S Q;  1JWS D;  4JV5 L;  4A93 B;  1GUT A;  1PTO H;  4PZ6 A;  3CCQ A;  2PZU A;  1CT1 D;  1G6Z A;  1VQ5 A;  4IZ8 A;  2G9H D;  1YNN D;  5EBD A;  1PZI D;  5EKL A;  2KHJ A;  1D5M C;  4BY1 B;  4FXK C;  3WOE A;  3E3X A;  3S2D H;  1G2S A;  1SRO A;  2B2V C;  4DR2 Q;  3C46 A;  1UNS A;  5LMN Q;  1HZ9 A;  1RTN A;  1TS4 A;  4HN7 A;  4A3D H;  1GHJ A;  3S15 B;  3RZD H;  2NVT H;  1XPR A;  3DWQ A;  3CD6 A;  2B2T C;  5C4J B;  1KC8 C;  4IUR A;  2H5X A;  2I5M X;  2K1B A;  3NEL A;  4A3G B;  2IY5 B;  1GO3 E;  1SE2 A;  3UDG A;  2NVQ B;  1IYV A;  1U5K A;  5BN5 A;  4DV7 L;  1CKN B;  1IBL Q;  3TBI B;  1S40 A;  4A3J G;  3KBG A;  2NZH A;  2EE1 A;  1JOQ A;  5EKK A;  4C3I H;  1L0W A;  4AYB B;  4H0L C;  5EJW A;  1MD2 D;  4JI1 Q;  2Z9H A;  2L1B A;  2GA4 B;  1Y1V G;  1EFW A;  1HJP A;  2BE5 C;  3IKJ A;  5C3E B;  3I55 A;  1ZYR D;  4HSV A;  3I90 A;  5D65 A;  3H91 A;  3BDO A;  3DMU A;  2AUK A;  3URY A;  4U68 A;  1D1K A;  2Q8I B;  1X65 A;  3DXJ C;  4C3I B;  1HNX Q;  4LMQ D;  4DUZ L;  3RR5 A;  2D9U A;  1PH2 A;  4LF9 L;  4A3L G;  3NQI A;  4OXP A;  4JI3 L;  1SXT A;  3GTG H;  5EKI A;  1TS2 A;  4HSP A;  3RD4 A;  1WI5 A;  4XQQ A;  3KDF A;  4WJW A;  4QB4 A;  5JEA J;  4GKJ L;  1ASY A;  2JA8 B;  1Y1V B;  2CWA A;  1LTI D;  1STB A;  3RZD B;  2NVT B;  4FXG C;  1DCZ A;  5T1G A;  1KNA A;  3JAM i;  3HOU B;  3W3A A;  3H0G H;  3VR3 A;  4JI0 L;  3ER0 A;  3P20 A;  2L0C A;  4MZ9 A;  1D6E C;  2RKS A;  1JC7 A;  1EL0 A;  1SE3 A;  5FO8 B;  1CA5 A;  2JQO A;  3LWE A;  4Z9C B;  3WOF A;  3BZK A;  3T1Y L;  1XJV A;  4L5T A;  1QCB D;  2K5N A;  4PQX A;  1CUK A;  3FVQ A;  3W5O A;  2JA6 B;  1MI2 A;  2V1C C;  3GTK H;  2D5D A;  3A54 A;  2HDL A;  1I4Q A;  4YHH L;  3S1N H;  3J80 i;  3PO3 H;  4IOC A;  3BYY B;  3UDI A;  4BS9 A;  1XX8 A;  1G29 1;  4X62 L;  1HR0 Q;  1IW7 C;  4ZAI A;  4APV A;  3NBI A;  4IUP A;  2LFN A;  3E5S A;  3Q22 A;  4V19 0;  2ENB A;  2IL8 A;  2HHH L;  5A35 A;  1K9M C;  1MBY A;  3MXG A;  1KDB A;  1N33 L;  2HQL A;  3L0O A;  1IYJ B;  2P5Z X;  1F2L A;  1SE8 A;  2H4O A;  3K80 C;  4WJ4 A;  1J5E L;  1VF7 A;  3VR2 A;  1WVL A;  4RCO A;  3DWA A;  4G57 A;  5CV6 A;  5I9O A;  1Q3L A;  3Q23 A;  1EWC A;  2JN4 A;  4DXG A;  3HOX H;  2K28 A;  1NMF A;  4FF3 A;  3I91 A;  1ILP A;  3LGJ A;  1TWA B;  1PFN A;  3GO5 A;  1WOC A;  3H0G B;  4C3I G;  3HKS A;  2F0W A;  4KKU A;  1XMQ L;  4A3G H;  2JEB I;  4IFD H;  2SOB A;  4GLX A;  1AFP A;  1KAB A;  4DK3 C;  3J80 c;  3FRP B;  3QR8 A;  1JJG A;  1SFO B;  4TVA B;  1MJC A;  1YEZ A;  5LMU L;  1ONL A;  5E4W C;  2Z4I A;  2I0Q A;  1I4H A;  3EN2 A;  1LT4 D;  4LF8 Q;  3A74 A;  2L9H A;  2QCP X;  5LL6 X;  3G6J B;  1E2V A;  4DV0 L;  4YWM A;  1EZ6 A;  3E0E A;  1OXS C;  2EYL A;  1KAA A;  1FJG L;  3T13 A;  2D0O A;  4K6L A;  1N9W A;  3CQZ B;  4DNT B;  4BBS B;  1STN A;  3TN2 A;  1JOK A;  1M90 C;  2VQF L;  1NCV A;  1EQT A;  4DR7 L;  2B8G A;  3VA7 A;  4XT3 B;  5DLQ E;  1VQF A;  1BBW A;  3M9B A;  4RH6 A;  2R93 H;  5KIX A;  1VDZ A;  1N36 L;  1H9S B;  3H15 A;  4Y52 H;  2OXP A;  1MSH A;  2Z8L A;  1PH5 A;  1X54 A;  1Q46 A;  4LJZ C;  3D6C A;  1SMX A;  4KHP Q;  4B3M Q;  1X6O A;  5FLM H;  1PRT B;  1XTD A;  4OWT B;  1VQ7 A;  3I4O A;  3U9O A;  2ZJP A;  1SLJ A;  1YZ6 A;  1J9O A;  4XDX A;  3C1E A;  1UAP A;  2KEE A;  4RKB A;  3CCL A;  2F0N A;  2F3W A;  5D14 A;  4JI2 Q;  1B3Q A;  2RDF A;  1BXT A;  3FMC A;  2Z6K A;  4MIU A;  5AJ3 L;  1N32 Q;  4OGQ C;  5IT9 E;  1XMO L;  4GKK Q;  1IKM A;  3FKI B;  2KHS A;  2RSO A;  4UPA A;  3PO2 H;  4C3H H;  4PV1 C;  5HGT A;  2A69 D;  3OMG A;  1PTO B;  2UUB L;  4LF6 Q;  4MN3 A;  4RAU C;  1VQH A;  2FXQ A;  3M7N A;  1UWV A;  1YIT A;  5CV4 A;  4A3E G;  4KKT A;  4O1N A;  1V1Q A;  4IFD G;  1TU2 B;  2XVS A;  4NMZ A;  3F2C A;  4HCE A;  2B63 G;  4LFB Q;  2B2W C;  1FD7 D;  2BDN A;  2K75 A;  4DUY Q;  4N9T A;  2CH4 W;  1AN8 A;  5ISR A;  1UE1 A;  1HCZ A;  2JXM B;  4MTN A;  1YNJ C;  4GS3 A;  2AUJ D;  1EEF D;  4ULL A;  1E7Z A;  4HED A;  4A3B B;  1U9R A;  1YHA A;  3N6R A;  1FGB D;  1IBK Q;  2CWP A;  1GOZ A;  4P73 A;  3I72 A;  1QVC A;  1W3S A;  2RQX A;  3AYH B;  2JA9 A;  3HEJ A;  1VQ4 A;  2DY8 A;  2WB1 B;  1I6V C;  4K2K A;  4QIW E;  2RVL A;  1VQL A;  1B9M A;  4F88 A;  2RF4 A;  2F3V A;  2EPB A;  3K59 A;  3GTK B;  3K0X A;  2XWB B;  1SYB A;  3ULJ A;  1SYE A;  1E1O A;  3F2U A;  4GN4 B;  1HNW Q;  4ID6 A;  2DNC A;  1B1Z A;  2GN5 A;  4JI3 Q;  1GVP A;  3K58 A;  4A76 A;  2MGS A;  1HZC A;  4PZ8 A;  1QVG A;  3LX0 A;  5G3L F;  4PMB A;  5IYB G;  5IOD A;  4DR1 L;  1SNP A;  4QUC A;  4KI0 A;  1V8Q A;  1TWA H;  2CHB D;  2KED A;  2JA8 G;  1E2Z A;  2E2H H;  4FNF A;  2N49 A;  5FLX E;  4WFN 3;  3NEN A;  1CA6 A;  5K5P A;  1O7Z A;  5CV7 A;  4DAY B;  1RKN A;  1YNN C;  3ND8 A;  2DUD A;  1Y1W B;  2F0P A;  3M4Y A;  3DM1 A;  4X6A H;  2NYZ D;  4HMJ A;  4ZCK A;  3I7F A;  1SMY D;  1ASZ A;  2FMC A;  2NB0 A;  4P72 A;  1ESR A;  3ERQ A;  3UDX A;  2ATW A;  4UP9 A;  4X66 L;  1A3V A;  4ALP A;  4PG3 A;  1A63 A;  2L15 A;  1Z6H A;  2EDG A;  4ZLT F;  1I6H B;  3HOV B;  4X3U A;  2LXK A;  3K57 A;  4JI8 L;  1CZW A;  3A55 A;  2PQE A;  2SDF A;  5ELD A;  4BXX H;  1EUJ A;  2NUC A;  4IN3 A;  4JI7 Q;  1OTC A;  5M5W H;  4DV4 L;  2R93 B;  4UP8 A;  1AW7 A;  4Y7N B;  3RLN A;  4Q5V A;  1X55 A;  3OMC A;  2GVA A;  3NHH A;  2ASB A;  4HJ8 A;  1N33 Q;  4DFA A;  1PDQ A;  4O0A A;  5IWA L;  4L5S A;  3NUC A;  3TZD A;  3I2Z A;  1LAC A;  1IL8 A;  1SAP A;  5GQO A;  2PNR C;  1NE3 A;  2B3G A;  3CC2 A;  1SFO H;  4TKO B;  4G7Z C;  2PYK A;  4EGV A;  5BR8 Q;  1WFQ A;  2VB2 X;  2HT1 A;  1SSO A;  1U4L A;  5IGG A;  1XMQ Q;  3U4V A;  1HA5 A;  3ONA B;  1TWH H;  1DZ1 A;  2KCM A;  3PGZ A;  2C9O A;  1A2U A;  2JA7 G;  4LF4 L;  1CHP D;  2ZXP A;  4UAI A;  2RCF A;  1AZP A;  3D4W A;  3KF6 B;  3VYU A;  2VY3 A;  2J0T D;  3I56 A;  2UU9 L;  4R4T A;  4QCL A;  2Q2T A;  1PLF A;  3B6Y A;  2ALY B;  1YVC A;  3F2B A;  1TY2 A;  4YWL A;  1PH1 A;  3H6M A;  3D4D A;  3CCJ A;  4C3J B;  4FYD A;  3KF8 A;  1V1O A;  3G71 A;  2PNH A;  3PIO 3;  5J3B A;  2A68 D;  1LAB A;  1HUN A;  4NXM L;  4IUU A;  4B3T L;  2E5L Q;  1S4Z A;  3S1R H;  3KLS X;  1FR3 A;  3HRZ C;  4QQB X;  4A93 G;  4HID A;  1G2T A;  3PF4 A;  2BA1 A;  2R7Z H;  1NR2 A;  4DV2 Q;  1KD1 C;  3L9A X;  2A6H D;  1N36 Q;  3NP8 A;  4NW2 A;  1IW7 D;  4KHZ A;  1XNR Q;  3BG3 A;  4IUV A;  1F2Y A;  1FVI A;  4R4C A;  1AE2 A;  2JEA I;  4DAP A;  4JW0 A;  2NVX H;  2WB1 G;  3KUP A;  3KLS A;  2ZM6 Q;  3HS0 C;  4DNR B;  3NE5 B;  4KKS A;  4O42 A;  3QOL A;  3I4N B;  3HOU H;  5T1I A;  1BBU A;  5ELF A;  1EYC A;  1IKL A;  3H0G G;  1R4Q B;  3VDY A;  5M3M G;  4CBV A;  4EX5 A;  3S24 A;  3VR4 A;  2J4X A;  4EQ5 A;  4KTA A;  3T56 B;  1U4M A;  1I5F A;  3J81 i;  4YCU A;  1XMO Q;  4DR5 L;  2B2V A;  2NZ1 D;  1UEB A;  1Q81 C;  5IYD G;  3TP8 A;  2EYM A;  3CCM A;  3HOW G;  1QJO A;  1PXU A;  4LK1 C;  1NUC A;  3C3L A;  3SR1 A;  1UE5 A;  3S1M B;  1A6X A;  4LF5 Q;  4JYA Q;  2PMZ B;  1T5E A;  3W1G A;  4RGO S;  2JJQ A;  3DEO A;  3P1H A;  4LFB L;  1VQC A;  1ZYR C;  1LYL A;  2OT2 A;  4YY3 L;  2VQE Q;  2ES2 A;  2A6E D;  1DOL A;  1EYD A;  1O78 A;  5BN4 A;  4QJF A;  2K7V A;  1WCM G;  5IGE A;  4ILW A;  1N34 L;  1G6P A;  1K8O A;  1SYD A;  2RA4 A;  4XQJ A;  1HXY D;  1JQY D;  1HQM C;  4K0K Q;  4LNQ A;  3U9S A;  1ICW A;  1PTO C;  3A5U A;  3CCE A;  3R2I A;  5DAU A;  1B53 A;  3A8K E;  3S9W A;  5F2D A;  4JG2 A;  1EOV A;  2MHV A;  4HTH A;  4Q0F A;  3VA5 A;  1SBB B;  2PPB C;  4JC0 A;  1VCI A;  4EQO A;  2RHS B;  1AZQ A;  3PIP A;  5GRO A;  2B2Y A;  1LT3 D;  2CKZ B;  3HOV H;  2BCO A;  4OO1 G;  2H1E A;  2K52 A;  5LL6 S;  1X56 A;  5C4J H;  4DKA C;  4GZY C;  1HNW L;  3PUX A;  4J1M A;  4RKL A;  4A3G G;  4RA8 A;  3BJU A;  1NNX A;  3OOC A;  4G7O C;  4QF4 A;  3GP7 A;  3GTO B;  3S2D B;  2R3Z A;  2R7D A;  4BA2 I;  3HOZ B;  4EVO A;  5FLX c;  2IHE A;  4A3D G;  1BCP B;  1B50 A;  3AFQ A;  5NUC A;  4YCV A;  1Q7Y C;  1H95 A;  4CKC A;  1HZB A;  1YI2 A;  3I3C A;  4DR4 Q;  3M85 A;  3BVM A;  4IFD I;  1HA6 A;  2R7F A;  4QMG A;  1O80 A;  1X3G A;  1CI3 M;  2F0V A;  3HOY H;  2EYO A;  2LY7 A;  4BBS G;  2B39 A;  1GUS A;  2NZO A;  2MO1 A;  2UXD L;  3AU7 A;  1H9M A;  2YYZ A;  1KLG D;  5JJZ A;  4MHE A;  3HOZ G;  1A3U A;  5J22 A;  4K2L A;  2QA4 A;  3CQZ H;  5FLX L;  1PRT C;  1RHP A;  1E3P A;  1WD0 A;  2N3S A;  1X3F A;  3G4S A;  3MA2 B;  1F9S A;  2EXD A;  2HUG A;  2D2C C;  4XT1 B;  4QL5 A;  1V43 A;  2K04 A;  4BBR B;  4I65 A;  1HTP A;  3HOW B;  2IPK D;  1S3O A;  2WFW A;  1X3E A;  5E1F A;  1Y14 B;  5JEA G;  4DAY A;  3PQI A;  3TS0 A;  4J6H A;  1ENC A;  3Q0A A;  3CCV A;  2UXB Q;  4RHS A;  5I4D A;  4ZUJ A;  1K0S A;  4A4I A;  1Y1W H;  2F0K A;  3K7U C;  2Q2I A;  4A3J B;  2F0S A;  3S14 H;  3L7Z C;  3CF5 A;  3OSO A;  3X3N A;  3X3M A;  1HZA A;  4FF4 A;  2EY6 A;  2F0D A;  3G7L A;  4JI4 L;  1H9K A;  4F7X A;  3MXN B;  2Q8R E;  4C3H G;  1VQM A;  2F0J A;  5BR8 L;  4R8I A;  4A3E H;  1SDF A;  4I7A A;  1I3Q H;  4XQN A;  4A3J H;  5EQ0 A;  4CJ0 B;  1PV4 A;  4IUQ A;  3OTO Q;  4A3K G;  4BXX G;  3CKI B;  1TWF B;  2QIL A;  5FJ8 G;  5C0X J;  1XYI A;  4NPS A;  1BKB A;  4HJA A;  3KF8 B;  4A75 A;  1Y1W G;  3VYT A;  4RMF A;  1L2F A;  1C9O A;  1GKH A;  2KCC A;  1K83 B;  1HFN A;  1VQ9 A;  2PI2 E;  2ZTE A;  5IE8 A;  4BY1 G;  5C44 B;  2O5J C;  3DEP A;  3H3V C;  5ELO A;  2VZA A;  1QVF A;  4OO1 I;  1ENF A;  1LT5 D;  2EYJ A;  5CV9 A;  5FKA C;  5LMN L;  2A74 C;  1VQG A;  3HOV G;  4QY7 A;  2Z6K C;  3IAY A;  4IOA A;  4K8I A;  1JIC A;  3OW7 A;  1K3R A;  1Q1E A;  1BCP C;  1NSN S;  4E6I A;  2ZXO A;  2LS0 1;  2FFK B;  1RD9 D;  1SJE D;  2YTV A;  5IGD A;  1M8A A;  1VMP A;  1PZJ D;  2I46 A;  3J7Z C;  2MPM A;  1IHZ A;  3BYT B;  1I4X A;  4ZYS A;  4TRD A;  2RBM A;  4DV1 L;  2N78 A;  4Y7N H;  1ILQ A;  1XTC D;  2MP1 A;  1Q86 C;  1PH7 A;  1PH6 A;  5BN3 A;  2YTY A;  1NY4 A;  1EY0 A;  4P71 A;  1S72 A;  5EGT A;  2K33 A;  3PUY A;  3V2T A;  4DK6 C;  1EY6 A;  4IPG A;  1Y8O B;  5IP9 G;  1I50 B;  4GLV B;  1MJE A;  5E4X A;  1DOM A;  4H02 A;  4X64 Q;  3T1H L;  3FKI H;  4HCS A;  1UUP A;  3I4M G;  2QKI C;  1SMY C;  1LTA D;  1N8R C;  2OQK A;  4K5V A;  3P7J A;  1BBX C;  2AWN A;  1A62 A;  4KJN A;  4XYO A;  1MIU A;  2Y0S G;  4HR7 B;  3CPF A;  4JBJ A;  1HNX L;  1W6K A;  4X3S A;  1HNZ L;  3D31 A;  4DGZ A;  1R9T H;  1SNO A;  1BNZ A;  4X65 L;  3MXN A;  4NXN L;  1B7Y B;  1CK1 A;  4A3B G;  2K03 A;  1GUN A;  2IWH A;  3OWE B;  5CGK A;  4DAV A;  2UUC Q;  1IL2 A;  3FP9 A;  1Y69 U;  3PUW A;  3RZO H;  4AQY Q;  2F03 A;  5C4H A;  2NN6 I;  5DNF A;  4RGT A;  5KNB A;  1I4R A;  3SE0 A;  3J81 j;  1STG A;  3KOJ A;  1TT2 A;  4JI5 L;  4R1J A;  2E2I B;  1BQQ T;  3BDL A;  2F0H A;  2EY2 A;  1K73 C;  3MXU A;  1JJC B;  1QNU A;  1STE A;  2NN6 G;  2AQ1 B;  1GM5 A;  1KHI A;  4DR2 L;  4HIM A;  1PFM A;  4BBR H;  3J81 E;  3M7G A;  2GVB A;  1LT6 D;  2F0G A;  3D0F A;  1WYD A;  3M4O H;  2WAQ E;  4KJO A;  1EWI A;  2KOL A;  3PO3 B;  4DPG A;  4KD4 A;  3W2D A;  2QW7 A;  2NTT A;  1VQK A;  1P16 A;  2PQA A;  1B9N A;  1D5Z C;  2HCI A;  5IYD H;  1NJI C;  1JB3 A;  1IBL L;  3E0J A;  4CHT B;  4RGN A;  1B4O A;  1J6Q A;  3U58 A;  4DR6 L;  1LTL A;  2JA7 B;  4DR3 L;  4JI1 L;  2Q8T A;  2JP1 A;  2HCC A;  5M3M B;  2IHF A;  1C7Y A;  3QOJ A;  1RL2 A;  4AIM A;  2A5H A;  2FMM A;  1TII D;  4OHJ A;  3VYR A;  5C3W A;  2UXC L;  3HOX B;  2EIF A;  3TME A;  3Q24 A;  1RDP D;  4S3S A;  1TWC H;  3GTP H;  2XIW A;  4A3M G;  1TWG B;  5M3F H;  4FO2 A;  4L63 B;  1XPU A;  3TRE A;  2A68 C;  2O2L D;  2N88 A;  5M9O A;  3U4Z A;  5C3X A;  1WTP A;  3R2T A;  4DV5 Q;  4JPB W;  4IUN A;  2R7Z B;  5DM7 3;  2F4V L;  1XPO A;  5C6A A;  1ENA A;  3I4M B;  3MVV A;  1IYU A;  2RDG A;  2UXD Q;  2NBF A;  3DLL A;  1OXT A;  2I5L X;  1IZ6 A;  5JOB A;  4OWX B;  5C5L A;  3VYS A;  1EIY B;  3TZU A;  4C3J H;  1PFS A;  2ZJR A;  5LMU Q;  4O2D A;  5JVH 3;  5C4Z A;  4DV6 Q;  2NVY B;  4B9X A;  5D3I B;  2F1M A;  4IUT A;  5HGQ A;  5M5Y B;  3ULP A;  3D4R A;  1GUG A;  3ERO A;  1YJN A;  1IBM L;  2VL6 A;  1SND A;  3K5L A;  3U50 C;  1NAP A;  2B29 A;  2YV5 A;  5I2X A;  3MHB A;  1VQP A;  2NN6 H;  2CW0 D;  2F0E A;  2XWJ B;  4RWS C;  1Y8N B;  4BBS H;  3CHB D;  1EEI D;  3O13 A;  1FGU A;  4C56 C;  2E76 C;  3S1M H;  5EAY A;  2EJF C;  4A3K H;  3HKZ G;  1HR0 L;  2PQA B;  2KCN A;  4FVM A;  2SNM A;  1EY5 A;  4KK7 A;  5CYU A;  1LUZ A;  4BY7 H;  2CW0 C;  4RFB A;  3D3R A;  1EYA A;  3PIP 3;  4BY7 B;  3RNU A;  1DOK A;  4BY1 H;  4A3I H;  1KXL A;  4K8J A;  4LFA L;  5I6Y A;  3AB9 A;  3S1Q B;  1A3T A;  1S5B D;  5CMD A;  1FNU A;  3QJY A;  4JOI C;  2Y0S E;  3KBX A;  5AJ3 Q;  4GOP C;  1K8A C;  1N32 L;  2BE5 D;  3CU7 A;  3NSW A;  1PRT F;  5C4X B;  2M2L A;  1NR4 A;  2K5Q A;  2LMC B;  4C1N K;  3K8A A;  4G7H C;  2Q2U A;  1JOR A;  3GDE A;  2KUM A;  4GN5 A;  1PVO A;  4GNX B;  4B08 A;  4LF6 L;  3A7L A;  1EY8 A;  2WAQ G;  4X3K A;  1SR3 A;  1A15 A;  2K5W A;  2UU9 Q;  1QE6 A;  1DYQ A;  1LTG D;  3K6O A;  3GTL H;  3NBH A;  3WWV A;  5M5X H;  1VMC A;  4KV6 A;  3RN2 A;  3TEH B;  3BS1 A;  2F0M A;  1PYW D;  1T9H A;  4OX9 L;  3NK9 A;  1R4P B;  1PH3 A;  4C1N I;  4JI6 L;  1JT8 A;  2OCE A;  2BH8 A;  2ID0 A;  2K6A A;  3GQB A;  4DV3 L;  2F0O A;  1LO5 D;  1S5C D;  3MFY A;  1O7Y A;  1U4P A;  2RHQ B;  4RCN A;  2JA5 G;  1EY4 A;  1CSP A;  4FP5 D;  1TWG H;  1BO0 A;  1F2M A;  2MUY A;  2E5L L;  1IBK L;  4A3D B;  1TWC B;  3GTP B;  3LWU A;  4GLA C;  3S1N B;  4FXD A;  1E1T A;  2FJ2 A;  4DN4 M;  3CPW A;  1K28 A;  3CP0 A;  3MFG A;  3C2P A;  4DV2 L;  1LTS D;  1B2T A;  4KHV A;  1BF4 A;  3DWP A;  2QEJ C;  1L0Y B;  3M3Y B;  4KY6 A;  3BDC A;  3HGB A;  3W1B A;  4A93 H;  1MKH A;  5JJL A;  2PO4 A;  5KNC A;  2XTI A;  2QEX A;  4C3J G;  1MGS A;  3E9H A;  4LAA A;  4BWG B;  1I4G A;  1UE7 A;  3MC0 B;  2CH4 A;  1BUV T;  4C2M B;  2F0F A;  3GV6 A;  4NXN Q;  4LF7 Q;  3SHL A;  5I9P A;  2A6E C;  3S2H B;  4KY5 A;  4DK0 A;  2OQ0 A;  3KK7 A;  1QOH A;  3VR6 A;  5C3E G;  4DUZ Q;  3M4O B;  1VQO A;  4BY7 G;  1ET9 A;  5AFW A;  3V96 A;  1M1K C;  5EPK A;  2FHT A;  1C0A A;  4L8J A;  2AWO A;  3I4N G;  1F9Q A;  3L3O C;  4A3B H;  1X3P A;  1L0X B;  1F77 A;  1TS5 A;  1YHB A;  3SK8 A;  1H9R A;  1YHQ A;  2UUA Q;  1I94 Q;  2ZJQ A;  4HJ9 A;  5IP7 G;  2KEC A;  3GTL B;  4UHV A;  5ELN A;  4H7B A;  4CKE A;  4X66 Q;  4PMW A;  1L1O A;  3PSI A;  2PW5 A;  2R92 B;  3RUZ A;  1CQF A;  1AEX A;  2EY5 A;  2MO0 A;  1EZ8 A;  4I7Z C;  2UUB Q;  4YY3 Q;  2VQE L;  2PW7 A;  2EJG C;  3JAM E;  3RLF A;  1STY A;  5C3E H;  2PZW A;  4MTK A;  2OWO A;  4ZKC B;  2JK8 A;  1KDA A;  1A0I A;  5C4X H;  1EU3 A;  2IJ0 A;  2K32 A;  3PO3 G;  1G51 A;  2EYP A;  2DN8 A;  3MAQ A;  1HFG A;  2XN9 C;  4GOP B;  1JB7 A;  1XNQ L;  1VQ6 A;  3EFX D;  1X9N A;  4C3H B;  3DUZ A;  2K14 A;  4X3T A;  5CBA E;  1OO9 B;  1STA A;  1EIF A;  4ZK9 B;  3R3O A;  3RZO B;  1D5X C;  4GNX C;  5IP7 H;  1WCM H;  3ND9 A;  1QZG A;  5IGB A;  3HG9 A;  2HDM A;  5FO9 B;  2NVQ H;  2JA5 B;  1K8M A;  2JA6 G;  5FJ8 H;  3NXW A;  2IX3 A;  3S17 H;  1F9R A;  3AEV A;  3NWT A;  4IPH A;  5G3L D;  3OIP A;  4QUF A;  2DGY A;  2HHH Q;  3MZ5 A;  3PMF A;  3AFP A;  1PH4 A;  1HR0 W;  4P74 A;  1S5F D;  1TS3 A;  3QG1 A;  4GN3 B;  2J7Z A;  1PH9 A;  1EWH A;  3Q6S A;  1DM0 B;  2R6G A;  4N8X 1;  4XYQ A;  4DV5 L;  1I50 H;  5KYL A;  1ICF B;  1H9J A;  2KCT A;  1SYC A;  4DR1 Q;  1HHV A;  1C8C A;  4A3F B;  1AE3 A;  1DGS A;  3A8I E;  4LF9 Q;  3L2P A;  1SJH D;  2NVX B;  4IJL A;  3NPP A;  1PMR A;  1CHQ D;  4DV6 L;  4JBK A;  3CRK C;  2B2Y C;  2C5C A;  4HJ7 A;  2F0T A;  3RLO A;  3A56 A;  1BVS A;  3MXP A;  4GKJ Q;  1KRS A;  2B8F A;  4ZRZ A;  5IP9 H;  2VXW A;  1QB5 D;  2DJF C;  4ME3 A;  3KYH C;  3J7A 5;  1L1O B;  5E3F A;  2F0U A;  2E2I H;  1P8L A;  2D62 A;  1VQA A;  3NTH A;  3N52 A;  5IOC A;  3OYY A;  2O5I C;  2LXJ A;  1A2T A;  2RCN A;  1QUQ B;  5FK9 C;  3PF5 A;  2Z1C A;  1LTR D;  3GTJ B;  3SXH A;  5COR A;  3FHW A;  4ABN A;  2UXB L;  1WTQ A;  3ITP A;  1XNR L;  3QO2 A;  3ZJY C;  5FLM G;  1EY7 A;  2B2U C;  4BBR G;  1I3Q B;  3F2D A;  3BVZ A;  1JWU D;  2ZM6 L;  1X3Q A;  1SRU A;  2O4X A;  1TVX A;  1BR9 A;  1YBY A;  3OWF A;  3J7A V;  4CKB A;  1MHW C;  2K5H A;  2F0I A;  2XGT A;  3T53 B;  1Y8P B;  4LWC A;  1D1I A;  4HAE A;  3NBH B;  2R92 H;  4JBW A;  1JE4 A;  3PCO B;  4LFC L;  1W6J A;  3A8J E;  4DA2 A;  3HOW H;  3TP7 A;  1WTH A;  4G4K A;  4A3I G;  1G8Z D;  4NDX A;  5C4X G;  2Q2H A;  4IJH A;  3Q8D A;  4XTC S;  2PZT A;  2I07 B;  1J5E Q;  3C1F A;  2CCZ A;  5K36 G;  2WAQ B;  1JCK B;  5M5X B;  1WTO A;  1SEB D;  3UI2 A;  4HMI A;  4GKK L;  3A0J A;  1TXY A;  4JCV E;  1D2B A;  4JYA L;  4FF1 A;  3ULL A;  1BDO A;  4B3S L;  3CRL C;  4CDF C;  1YIJ A;  2X6L A;  4L6T B;  2Y0S B;  2K5D A;  3J7Y W;  5J39 A;  1AH9 A;  2MNA A;  4OON A;  5I2Y A;  4DV3 Q;  1S5E D;  3CCU A;  4R8N A;  4POG A;  4TSS A;  1N34 Q;  3LNN A;  3TQY A;  2N55 A;  1LV9 A;  2KEN A;  4DV1 Q;  4HJ5 A;  3NWS A;  3PUV A;  2V4D A;  3GTQ B;  3K81 C;  5IT9 L;  3S17 B;  3MTS A;  2VW9 A;  3JAM c;  5C44 H;  2JA8 H;  4A3C G;  3DM3 A;  4QGU A;  1WTV A;  2JA5 H;  1OXV A;  4B3T Q;  4A3M H;  3I73 A;  4WRD A;  1GD7 A;  5KEE A;  1FJG Q;  2F0Q A;  3I4L A;  1KLU D;  1SYF A;  3MEH A;  1Q12 A;  4X64 L;  3GTO H;  1PTO D;  1Q8I A;  4LF7 L;  4FF2 A;  2WAC A;  1KRT A;  5ELC A;  2M9V A;  2B2U A;  2YU9 H;  2E75 C;  1CKN A;  2EXZ A;  3G48 A;  2EQS A;  1RF2 D;  3UE0 A;  1Z47 A;  3D8G A;  3G6E A;  4F87 A;  4HIK A;  1WTX A;  5CV5 A;  4K5W A;  3KF6 A;  2K05 A;  2WII B;  5KND A;  4AQY L;  1V1P B;  1I94 L;  3TSS A;  3TS2 A;  4DR5 Q;  2XNA C;  5C0X I;  3EJI A;  4M1U B;  2IT1 A;  5H1S E;  1AP0 A;  1VQB A;  2XRQ D;  4JI5 Q;  2PI2 A;  2L5T A;  4ME5 A;  5JPM C;  5ELE A;  2XSC A;  1SNC A;  4OIK A;  3T4A C;  3S1Q H;  2KBN A;  4CGY B;  2B2T A;  4CDC C;  3I4M H;  1HUM A;  4A3I B;  2E2J H;  1C48 A;  1K0R A;  1XNQ Q;  5GAE C;  4A3M B;  1RIP A;  2L4N A;  4R4Q A;  3TDQ A;  1CQV A;  2TSS A;  1D7Q A;  4ZUI A;  1O7I A;  2ZT9 C;  1Q82 C;  4JOI A;  3RN5 A;  1SN8 A;  1WTW A;  2HIX A;  3GD7 A;  2MQH A;  2KA7 A;  4YWK A;  1GJX A;  2BDO A;  3K7A H;  2I5H A;  1G91 A;  2OTJ A;  3E6Z X;  1FNW A;  2WP8 J;  3IFD A;  3I4N H;  3J80 E;  2E74 C; 
#chains in the Genus database with same CATH homology
 4KY7 A;  1PRT D;  4K5X A;  2IX1 A;  2QF7 A;  2X69 A;  1VF5 C;  1O7L A;  4H13 C;  3PO2 B;  1ML0 D;  3H09 A;  4PMC A;  4V0B A;  1DJR D;  4PNY A;  4KD3 A;  2LKV A;  1LTB D;  5IGC A;  2E2J B;  2KVM A;  3P75 A;  2WV6 D;  2CQA A;  3EA6 A;  5CR3 A;  4ODG A;  3D6W A;  5JAV A;  1TQO A;  4CJ1 B;  1EY9 A;  2F4I A;  2DNE A;  5JVG 3;  1J8I A;  2VB3 X;  1Q1B A;  4OL7 A;  4DF7 A;  2EZV A;  3EVQ A;  1RJT A;  3I70 A;  1SE4 A;  4J8Q A;  4ZKB B;  4N9P A;  1QNK A;  2YU9 B;  1TY0 A;  3K0Y A;  3NQT A;  3FEW X;  3HOY B;  2SEB D;  2HQE A;  1BCP F;  1I4P A;  2IW3 A;  1ROD A;  1ESF A;  1R9T B;  1ZXT A;  1T5X D;  1ZKO A;  2EVB A;  3TP6 A;  4U67 3;  1GUO A;  2BA0 A;  2XRS D;  3H94 A;  4M8A A;  4DK1 A;  1KDC A;  2NTS A;  4A3K B;  3SVM A;  2TMP A;  4UDU C;  2VUM B;  1EQV A;  3EQL C;  5A2Q L;  5C5M A;  1SNQ A;  2RDH A;  2L11 A;  4BA1 I;  3FDT A;  3OIQ A;  1PFB A;  3PV0 A;  5EBC A;  2K01 A;  4DXF A;  3HKZ B;  3SDZ A;  3PUZ A;  3FPP A;  1QIL A;  1M4V A;  5DM6 3;  1DON A;  1S5D D;  5FO7 B;  3I8Z A;  2EYH A;  3IFT A;  3S16 B;  1CFM A;  1H9S A;  5IGF A;  2EYF A;  3J81 L;  1EFI D;  1ET6 A;  3T16 A;  5K36 H;  1SNM A;  4RHR A;  4IQZ A;  4K6D A;  2SNS A;  1KNE A;  5M3F B;  3RMH A;  1EIG A;  2OF1 A;  1BOS A;  1PZK D;  3BZD B;  1CM9 A;  2E2D C;  2A6H C;  3QB3 A;  1B3A A;  2EOT A;  4NKL A;  1EU4 A;  5A2Q E;  1GXD C;  1YNJ D;  3GV3 A;  2RSN A;  1Z7T A;  1HPC A;  1TWH B;  3HZX A;  1ZEQ X;  2AQ3 B;  3K7A B;  5EPJ A;  1KTK A;  4H44 C;  3K5M A;  3QIA A;  1SYG A;  1MSG A;  2IX0 A;  1LLR D;  1WD1 A;  3J80 L;  2FIN B;  3GTG B;  2OEO A;  2WKD A;  3GTM B;  5D3D A;  1RCV D;  1QG7 A;  3VR5 A;  1E0B A;  3OHX C;  3SEB A;  3T51 B;  4F8M A;  3TP5 A;  1TKW B;  5HUR A;  1FYC A;  3WDN A;  5TSS A;  5KRU A;  3SK6 A;  1GHK A;  2QDB A;  2X6G A;  1F2Z A;  1E2W A;  1JR0 D;  3HP3 A;  1F9P A;  5JPN C;  3DHQ A;  4IAL A;  5J1Z A;  1EOT A;  2EY1 A;  1PTO F;  2L55 A;  2WKC A;  1CTM A;  3NTI A;  3R8B A;  2ICE C;  1JWM D;  4K14 A;  1V1P A;  3AMU A;  1C4Q A;  1RTO A;  4NP5 A;  1EIH A;  1WCM B;  2E2H B;  1BCP D;  3NTK A;  2ICI A;  2A73 B;  5I6W A;  2ZXR A;  4IFD J;  5COY A;  4YIJ A;  4XXE A;  1XWE A;  4CJ2 C;  2NWG A;  1B44 D;  3V05 A;  5C0X G;  3MWY W;  2M00 A;  2B63 B;  5M5W B;  5KYI A;  2AQ2 B;  2WIN B;  2F0L A;  3OPO A;  3QWN A;  4OIJ A;  1QWY A;  4JK1 C;  5CC4 A;  2KQ3 A;  5DEH A;  1DD2 A;  2BOS A;  2Z4H A;  3R93 A;  4B9W A;  1Q90 A;  1FNV A;  1GUW A;  1STH A;  1TR5 A;  1OXU A;  2A69 C;  5IIF A;  5EPL A;  2G9D A;  5LHY 1;  1UEA B;  4OO1 H;  3ZYY X;  5CBE E;  1II3 A;  4WOR A;  3FPU B;  2DY7 A;  1JOO A;  3K5O A;  2PCF B;  2L12 A;  1HTL D;  4A3E B;  4EQN A;  5FOB B;  4EQP A;  3K5N A;  4DU9 A;  4KN4 C;  1HQR D;  1X32 A;  2CVR A;  3SK5 A;  1WTR A;  2EJM A;  3S14 B;  1XXG A;  3A7A B;  2JSO A;  4ZQ3 A;  4KMU C;  2R61 A;  3IL8 A;  4TQU S;  4RGM A;  3S1R B;  1LTT D;  2JYO A;  2KJX A;  4KN7 C;  4QIW B;  1U4R A;  4R9W A;  5JEA H;  4P2C B;  2JE6 I;  4XIG S;  5KGU A;  1DXM A;  5C0X H;  1HRJ A;  3SK4 A;  3JAM L;  2MJ8 A;  1CZG A;  5ELB A;  5CV8 A;  1OXX K;  3J7A F;  3KLR A;  2B2W A;  3BVG A;  2VNU D;  1JWS D;  4A93 B;  1GUT A;  1PTO H;  2PZU A;  1CT1 D;  1G6Z A;  4IZ8 A;  2G9H D;  1YNN D;  5EBD A;  1PZI D;  5EKL A;  1D5M C;  4BY1 B;  4FXK C;  3WOE A;  1G2S A;  2B2V C;  3C46 A;  1UNS A;  1RTN A;  1TS4 A;  4HN7 A;  1GHJ A;  3S15 B;  3DWQ A;  2B2T C;  5C4J B;  4IUR A;  2K1B A;  4A3G B;  1SE2 A;  2NVQ B;  1IYV A;  5BN5 A;  3TBI B;  3KBG A;  2EE1 A;  1JOQ A;  5EKK A;  4AYB B;  4H0L C;  5EJW A;  1MD2 D;  2L1B A;  2GA4 B;  2BE5 C;  3IKJ A;  5C3E B;  1ZYR D;  4HSV A;  3I90 A;  5D65 A;  3H91 A;  3BDO A;  3DMU A;  2AUK A;  3URY A;  4U68 A;  1D1K A;  2Q8I B;  3DXJ C;  4C3I B;  4LMQ D;  2D9U A;  3NQI A;  1SXT A;  5EKI A;  1TS2 A;  4HSP A;  3RD4 A;  4XQQ A;  4WJW A;  4QB4 A;  5JEA J;  2JA8 B;  1Y1V B;  1LTI D;  1STB A;  3RZD B;  2NVT B;  4FXG C;  1DCZ A;  5T1G A;  1KNA A;  3HOU B;  3W3A A;  3VR3 A;  3P20 A;  2L0C A;  1D6E C;  2RKS A;  1JC7 A;  1EL0 A;  1SE3 A;  5FO8 B;  1CA5 A;  3LWE A;  4Z9C B;  3WOF A;  1QCB D;  4PQX A;  3FVQ A;  2JA6 B;  1MI2 A;  2D5D A;  3A54 A;  2HDL A;  1I4Q A;  3BYY B;  4BS9 A;  1XX8 A;  1G29 1;  1IW7 C;  4ZAI A;  3NBI A;  4IUP A;  2LFN A;  3E5S A;  3Q22 A;  4V19 0;  2ENB A;  2IL8 A;  5A35 A;  1MBY A;  3MXG A;  1KDB A;  1F2L A;  2H4O A;  1VF7 A;  3VR2 A;  1WVL A;  4RCO A;  3DWA A;  4G57 A;  5CV6 A;  5I9O A;  1Q3L A;  3Q23 A;  1EWC A;  4DXG A;  2K28 A;  4FF3 A;  3I91 A;  1ILP A;  1TWA B;  1PFN A;  3GO5 A;  3H0G B;  4C3I G;  2F0W A;  4KKU A;  4IFD H;  2JEB I;  2SOB A;  1AFP A;  1KAB A;  3FRP B;  1SFO B;  1ONL A;  5E4W C;  2Z4I A;  1I4H A;  1LT4 D;  2L9H A;  2QCP X;  5LL6 X;  3G6J B;  1E2V A;  1EZ6 A;  1OXS C;  2EYL A;  1KAA A;  3T13 A;  4K6L A;  3CQZ B;  4DNT B;  4BBS B;  1STN A;  3TN2 A;  1JOK A;  1NCV A;  1EQT A;  2B8G A;  3VA7 A;  4XT3 B;  4RH6 A;  5KIX A;  1VDZ A;  1H9S B;  2OXP A;  1MSH A;  2Z8L A;  4LJZ C;  3D6C A;  1PRT B;  3U9O A;  1J9O A;  4XDX A;  3C1E A;  1UAP A;  2KEE A;  4RKB A;  2F0N A;  2F3W A;  5D14 A;  2RDF A;  1BXT A;  3FMC A;  4MIU A;  4OGQ C;  5IT9 E;  1IKM A;  3FKI B;  2KHS A;  2RSO A;  4PV1 C;  5HGT A;  2A69 D;  3OMG A;  1PTO B;  4MN3 A;  4RAU C;  3M7N A;  5CV4 A;  4KKT A;  4O1N A;  4IFD G;  1TU2 B;  2XVS A;  4NMZ A;  4HCE A;  2B2W C;  1FD7 D;  2BDN A;  4N9T A;  1AN8 A;  5ISR A;  1HCZ A;  2JXM B;  1YNJ C;  2AUJ D;  1EEF D;  4ULL A;  4HED A;  4A3B B;  1U9R A;  3N6R A;  1FGB D;  1GOZ A;  3I72 A;  2RQX A;  3HEJ A;  2DY8 A;  2WB1 B;  1I6V C;  4K2K A;  2RVL A;  1B9M A;  4F88 A;  2F3V A;  2EPB A;  3K59 A;  3GTK B;  2XWB B;  1SYB A;  1SYE A;  3F2U A;  4ID6 A;  2DNC A;  1B1Z A;  3K58 A;  2MGS A;  3LX0 A;  5G3L F;  4PMB A;  5IOD A;  1SNP A;  4QUC A;  4KI0 A;  1V8Q A;  2CHB D;  2KED A;  1E2Z A;  4FNF A;  5FLX E;  4WFN 3;  1CA6 A;  5K5P A;  1O7Z A;  5CV7 A;  1RKN A;  1YNN C;  3ND8 A;  1Y1W B;  2F0P A;  3M4Y A;  3DM1 A;  2NYZ D;  4HMJ A;  1SMY D;  2FMC A;  2NB0 A;  1ESR A;  3ERQ A;  1A3V A;  1Z6H A;  2EDG A;  4ZLT F;  1I6H B;  3HOV B;  4X3U A;  3K57 A;  1CZW A;  3A55 A;  2PQE A;  2SDF A;  5ELD A;  2NUC A;  4IN3 A;  2R93 B;  1AW7 A;  4Y7N B;  4Q5V A;  3OMC A;  3NHH A;  4DFA A;  1PDQ A;  3NUC A;  3TZD A;  1LAC A;  1IL8 A;  1SAP A;  2PNR C;  4TKO B;  4G7Z C;  2PYK A;  4EGV A;  2VB2 X;  1SSO A;  1U4L A;  5IGG A;  1HA5 A;  3ONA B;  1DZ1 A;  2C9O A;  1A2U A;  1CHP D;  2ZXP A;  4UAI A;  1AZP A;  3D4W A;  3VYU A;  2J0T D;  4QCL A;  1PLF A;  1TY2 A;  3H6M A;  3D4D A;  4C3J B;  4FYD A;  3KF8 A;  1V1O A;  3PIO 3;  2A68 D;  1LAB A;  1HUN A;  4IUU A;  1S4Z A;  3KLS X;  1FR3 A;  3HRZ C;  1G2T A;  2BA1 A;  1NR2 A;  3L9A X;  2A6H D;  3NP8 A;  4NW2 A;  1IW7 D;  4KHZ A;  3BG3 A;  4IUV A;  1F2Y A;  2JEA I;  4DAP A;  3KUP A;  3KLS A;  3HS0 C;  4DNR B;  3NE5 B;  4KKS A;  4O42 A;  3QOL A;  3I4N B;  5T1I A;  5ELF A;  1EYC A;  1IKL A;  1R4Q B;  4CBV A;  3VR4 A;  2J4X A;  4KTA A;  3T56 B;  1U4M A;  2B2V A;  2NZ1 D;  3TP8 A;  2EYM A;  1QJO A;  1PXU A;  4LK1 C;  3C3L A;  1NUC A;  3SR1 A;  3S1M B;  1A6X A;  2PMZ B;  1T5E A;  4RGO S;  3DEO A;  3P1H A;  1ZYR C;  2OT2 A;  2A6E D;  1DOL A;  1EYD A;  1O78 A;  5BN4 A;  2K7V A;  5IGE A;  1K8O A;  4ILW A;  1SYD A;  2RA4 A;  4XQJ A;  1HXY D;  1JQY D;  1HQM C;  3U9S A;  1ICW A;  1PTO C;  3R2I A;  5DAU A;  1B53 A;  3A8K E;  3S9W A;  5F2D A;  2MHV A;  4HTH A;  4Q0F A;  3VA5 A;  1SBB B;  2PPB C;  4EQO A;  1VCI A;  1AZQ A;  2B2Y A;  1LT3 D;  2BCO A;  4OO1 G;  2H1E A;  5LL6 S;  4GZY C;  3PUX A;  4J1M A;  4RKL A;  4RA8 A;  3OOC A;  4G7O C;  4QF4 A;  3GP7 A;  3GTO B;  3S2D B;  2R3Z A;  4BA2 I;  3HOZ B;  4EVO A;  1BCP B;  1B50 A;  5NUC A;  4CKC A;  3I3C A;  3M85 A;  3BVM A;  4IFD I;  1HA6 A;  4QMG A;  1O80 A;  1CI3 M;  2F0V A;  2EYO A;  2LY7 A;  2B39 A;  1GUS A;  3AU7 A;  1H9M A;  2YYZ A;  1KLG D;  5JJZ A;  4MHE A;  1A3U A;  5J22 A;  4K2L A;  5FLX L;  1PRT C;  1RHP A;  1WD0 A;  3MA2 B;  1F9S A;  2HUG A;  2D2C C;  4XT1 B;  1V43 A;  2K04 A;  4BBR B;  4I65 A;  1HTP A;  3HOW B;  2IPK D;  5E1F A;  5JEA G;  4DAY A;  4J6H A;  1ENC A;  3Q0A A;  4RHS A;  5I4D A;  4ZUJ A;  2F0K A;  4A3J B;  2F0S A;  3L7Z C;  3OSO A;  3X3N A;  3X3M A;  4FF4 A;  2EY6 A;  2F0D A;  3G7L A;  1H9K A;  4F7X A;  2Q8R E;  4C3H G;  2F0J A;  4R8I A;  1SDF A;  4XQN A;  5EQ0 A;  4CJ0 B;  4IUQ A;  3CKI B;  1TWF B;  2QIL A;  5C0X J;  1XYI A;  3VYT A;  2KCC A;  1K83 B;  1HFN A;  5C44 B;  2O5J C;  3DEP A;  3H3V C;  4OO1 I;  1ENF A;  1LT5 D;  2EYJ A;  5CV9 A;  5FKA C;  2A74 C;  3IAY A;  4K8I A;  1JIC A;  3OW7 A;  1Q1E A;  1BCP C;  1NSN S;  4E6I A;  2ZXO A;  2LS0 1;  2FFK B;  1RD9 D;  1SJE D;  5IGD A;  1M8A A;  1VMP A;  1PZJ D;  2I46 A;  2MPM A;  1IHZ A;  3BYT B;  1I4X A;  4ZYS A;  4TRD A;  2RBM A;  1ILQ A;  1XTC D;  2MP1 A;  5BN3 A;  1EY0 A;  5EGT A;  2K33 A;  3PUY A;  3V2T A;  1EY6 A;  1Y8O B;  1I50 B;  5E4X A;  1DOM A;  4HCS A;  1UUP A;  2QKI C;  1SMY C;  1LTA D;  4K5V A;  3P7J A;  1BBX C;  2AWN A;  4KJN A;  4XYO A;  4HR7 B;  1W6K A;  4X3S A;  3D31 A;  4DGZ A;  1SNO A;  1BNZ A;  3MXN A;  1CK1 A;  2K03 A;  1GUN A;  2IWH A;  3OWE B;  5CGK A;  4DAV A;  1Y69 U;  3PUW A;  2F03 A;  5C4H A;  2NN6 I;  5DNF A;  4RGT A;  5KNB A;  1I4R A;  3SE0 A;  1STG A;  1TT2 A;  2E2I B;  1BQQ T;  3BDL A;  2F0H A;  2EY2 A;  3MXU A;  1QNU A;  1STE A;  2NN6 G;  2AQ1 B;  1PFM A;  3J81 E;  3M7G A;  1LT6 D;  2F0G A;  4KJO A;  2KOL A;  3PO3 B;  4KD4 A;  3W2D A;  2NTT A;  1B9N A;  1D5Z C;  2HCI A;  1JB3 A;  3E0J A;  4CHT B;  4RGN A;  1B4O A;  2JA7 B;  2Q8T A;  2JP1 A;  2HCC A;  5M3M B;  3QOJ A;  5C3W A;  2A5H A;  2FMM A;  1TII D;  4OHJ A;  3VYR A;  3HOX B;  3TME A;  3Q24 A;  1RDP D;  4S3S A;  2XIW A;  1TWG B;  4FO2 A;  4L63 B;  2A68 C;  2O2L D;  2N88 A;  5M9O A;  5C3X A;  1WTP A;  3R2T A;  4IUN A;  2R7Z B;  5DM7 3;  5C6A A;  1ENA A;  3I4M B;  3MVV A;  1IYU A;  2RDG A;  2NBF A;  1OXT A;  5JOB A;  3VYS A;  5C5L A;  3TZU A;  5JVH 3;  5C4Z A;  2NVY B;  4B9X A;  5D3I B;  2F1M A;  4IUT A;  5M5Y B;  3D4R A;  1GUG A;  3ERO A;  1SND A;  3K5L A;  1NAP A;  5I2X A;  3MHB A;  2NN6 H;  2CW0 D;  2F0E A;  2XWJ B;  4RWS C;  1Y8N B;  3CHB D;  1EEI D;  3O13 A;  4C56 C;  2E76 C;  2EJF C;  2KCN A;  4FVM A;  2SNM A;  1EY5 A;  4KK7 A;  5CYU A;  2CW0 C;  4RFB A;  3D3R A;  1EYA A;  3PIP 3;  4BY7 B;  1DOK A;  4K8J A;  5I6Y A;  3AB9 A;  3S1Q B;  1A3T A;  1S5B D;  5CMD A;  1FNU A;  3QJY A;  3KBX A;  2BE5 D;  3CU7 A;  3NSW A;  1PRT F;  5C4X B;  2M2L A;  1NR4 A;  2K5Q A;  2LMC B;  4C1N K;  4G7H C;  1JOR A;  2KUM A;  4B08 A;  3A7L A;  1EY8 A;  4X3K A;  1A15 A;  2K5W A;  1QE6 A;  1DYQ A;  1LTG D;  3K6O A;  3NBH A;  1VMC A;  4KV6 A;  3BS1 A;  2F0M A;  1PYW D;  3NK9 A;  1R4P B;  4C1N I;  2ID0 A;  2K6A A;  3GQB A;  2F0O A;  1LO5 D;  1S5C D;  3MFY A;  1O7Y A;  1U4P A;  4RCN A;  1EY4 A;  4FP5 D;  1BO0 A;  1F2M A;  2MUY A;  4A3D B;  1TWC B;  3GTP B;  3LWU A;  3S1N B;  4FXD A;  2FJ2 A;  4DN4 M;  3MFG A;  3C2P A;  1B2T A;  1LTS D;  4KHV A;  1BF4 A;  3DWP A;  2QEJ C;  1L0Y B;  3M3Y B;  4KY6 A;  3BDC A;  3HGB A;  2PO4 A;  5KNC A;  4C3J G;  1MGS A;  4LAA A;  4BWG B;  1I4G A;  3MC0 B;  4C2M B;  1BUV T;  2F0F A;  3GV6 A;  3SHL A;  5I9P A;  2A6E C;  3S2H B;  4KY5 A;  4DK0 A;  3KK7 A;  1QOH A;  3VR6 A;  3M4O B;  1ET9 A;  5AFW A;  3V96 A;  5EPK A;  2FHT A;  4L8J A;  2AWO A;  1F9Q A;  3L3O C;  1X3P A;  1L0X B;  1F77 A;  1TS5 A;  3SK8 A;  1H9R A;  3GTL B;  2KEC A;  4H7B A;  4CKE A;  4PMW A;  2PW5 A;  2R92 B;  3RUZ A;  1CQF A;  1AEX A;  2EY5 A;  1EZ8 A;  4I7Z C;  2PW7 A;  2EJG C;  3JAM E;  3RLF A;  1STY A;  2PZW A;  4ZKC B;  1KDA A;  1EU3 A;  2IJ0 A;  2K32 A;  2EYP A;  3MAQ A;  2DN8 A;  1HFG A;  2XN9 C;  3EFX D;  4C3H B;  3DUZ A;  4X3T A;  5CBA E;  1OO9 B;  1STA A;  4ZK9 B;  3R3O A;  3RZO B;  1D5X C;  3ND9 A;  5IGB A;  3HG9 A;  2HDM A;  5FO9 B;  2JA5 B;  1K8M A;  3NXW A;  2IX3 A;  1F9R A;  3NWT A;  5G3L D;  3OIP A;  4QUF A;  3MZ5 A;  3PMF A;  1S5F D;  1TS3 A;  3QG1 A;  2J7Z A;  1EWH A;  3Q6S A;  1DM0 B;  2R6G A;  4XYQ A;  5KYL A;  1H9J A;  1SYC A;  1HHV A;  1C8C A;  4A3F B;  3A8I E;  2NVX B;  1SJH D;  3NPP A;  1PMR A;  1CHQ D;  3CRK C;  2B2Y C;  2C5C A;  2F0T A;  3A56 A;  3MXP A;  2B8F A;  4ZRZ A;  2VXW A;  1QB5 D;  5E3F A;  2F0U A;  2D62 A;  3NTH A;  3N52 A;  5IOC A;  2O5I C;  1A2T A;  5FK9 C;  2Z1C A;  1LTR D;  3GTJ B;  3SXH A;  5COR A;  4ABN A;  1WTQ A;  3ITP A;  3QO2 A;  1EY7 A;  2B2U C;  1I3Q B;  3BVZ A;  1JWU D;  1X3Q A;  2O4X A;  1TVX A;  1BR9 A;  3OWF A;  3J7A V;  4CKB A;  2F0I A;  3T53 B;  1Y8P B;  1D1I A;  4HAE A;  4JBW A;  1JE4 A;  1W6J A;  3A8J E;  4DA2 A;  3TP7 A;  4G4K A;  1G8Z D;  4NDX A;  4XTC S;  2PZT A;  2I07 B;  3C1F A;  5K36 G;  2WAQ B;  5M5X B;  1JCK B;  1WTO A;  1SEB D;  3UI2 A;  4HMI A;  1D2B A;  4FF1 A;  1BDO A;  3CRL C;  2X6L A;  4L6T B;  2Y0S B;  2K5D A;  3J7Y W;  5J39 A;  5I2Y A;  1S5E D;  4R8N A;  4TSS A;  3LNN A;  2N55 A;  1LV9 A;  3NWS A;  3PUV A;  2V4D A;  3GTQ B;  5IT9 L;  3S17 B;  3MTS A;  1WTV A;  1OXV A;  3I73 A;  4WRD A;  5KEE A;  2F0Q A;  3I4L A;  1KLU D;  1SYF A;  3MEH A;  1Q12 A;  1PTO D;  1Q8I A;  4FF2 A;  2WAC A;  5ELC A;  2M9V A;  2B2U A;  2E75 C;  2EXZ A;  1RF2 D;  1Z47 A;  3D8G A;  4F87 A;  1WTX A;  5CV5 A;  4K5W A;  2K05 A;  2WII B;  5KND A;  1V1P B;  3TSS A;  2XNA C;  5C0X I;  3EJI A;  4M1U B;  2IT1 A;  1AP0 A;  2XRQ D;  2L5T A;  5JPM C;  4ME5 A;  5ELE A;  2XSC A;  1SNC A;  4OIK A;  3T4A C;  4CGY B;  2B2T A;  1HUM A;  4A3I B;  1C48 A;  4A3M B;  2L4N A;  3TDQ A;  1CQV A;  2TSS A;  4ZUI A;  2ZT9 C;  1WTW A;  3GD7 A;  2KA7 A;  1GJX A;  2BDO A;  1G91 A;  3E6Z X;  1FNW A;  2WP8 J;  3IFD A;  3J80 E;  2E74 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...