5I9PA

Crystal structure of staphylococcal nuclease variant delta+phs t62h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H at cryogenic temperature
rcsb
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9pA00
3EJIA 2F0SA 3MVVA 4B9WA 5EKLA 1EY9A 1KDBA 3OSOA 2F0UA 1EYCA 4K2LA 3NQTA 4K8IA 4PNYA 4WORA 5CV4A 1NUCA 1ENAA 1JOKA 3MZ5A 4K5VA 4EQPA 4PMCA 2PZTA 3R3OA 4ZQ3A 3TP5A 5C6AA 1SYEA 4RKBA 3MXPA 5KIXA 4KV6A 2F0OA 2SOBA 4B9XA 3NP8A 1STHA 1SNOA 4HTHA 4R8NA 5C5LA 1SNCA 1NSNS 2O4XA 4IZ8A 3DHQA 3E5SA 3SR1A 1KDCA 3TMEA 2F3VA 1JORA 2RKSA 2OF1A 2F0HA 1STGA 2F0QA 1U9RA 1STNA 5IGGA 4ME5A 3BDCA 2F0MA 5EGTA 5I6WA 3EROA 5C3WA 5IIFA 5KYIA 4KY6A 3TP8A 1STBA 3PMFA 2NUCA 5F2DA 5KEEA 5CV8A 5DEHA 3SHLA 2EXZA 3D4DA 2SNSA 4EQNA 4K5WA 4RKLA 4NKLA 2F0GA 5KRUA 2EYJA 1SYFA 3T13A 1EY6A 1F2ZA 1EQVA 1AEXA 4ID6A 4S3SA 5J39A 1TQOA 1STYA 2EYHA 3NXWA 5HGTA 2F0NA 1SNPA 1A3VA 4I65A 4EQOA 1SYCA 1STAA 2F0IA 3BDLA 2RDFA 4HMJA 4QF4A 5JOBA 4E6IA 4F7XA 4IUNA 5M9OA 1ENCA 3SK6A 5C3XA 2SNMA 3OMGA 4K2KA 4QMGA 1JOOA 5NUCA 1EY7A 4NMZA 4IALA 4ZUJA 2PZUA 2F0WA 3V2TA 5I9PA 5IGCA 3D8GA 3LX0A 4YIJA 3TP7A 3U9OA 5CC4A 4NDXA 5CGKA 4KY5A 5IODA 3OWFA 2RBMA 2F0EA 1EY0A 2EYLA 4TRDA 4DF7A 2QDBA 2EYMA 1EYDA 3RUZA 2F3WA 5ISRA 4KJNA 2F0TA 3H6MA 3HEJA 1EY5A 3P75A 3QB3A 4N9PA 4N9TA 2EY6A 3HZXA 4HMIA 1EYAA 3MEHA 5I9OA 4G57A 2F0FA 3TP6A 4KHVA 2EY2A 3C1EA 3SK4A 2EYFA 4KD3A 2F0VA 5DAUA 3D6CA 1JOQA 3QOJA 3VA5A 2EY5A 1F2YA 4PMBA 2KHSA 4KD4A 4KJOA 1SYDA 1SYGA 3D4WA 1SYBA 1EY4A 1TT2A 3NK9A 4QB4A 5CV7A 1KAAA 5EKKA 4DGZA 5IGDA 3OMCA 1EY8A 4DU9A 2WACA 5K5PA 1SNMA 2HQEA 5CR3A 5J22A 5IGEA 4LAAA 5I6YA 2F0PA 2PW7A 3NHHA 5C4HA 4K14A 2F0LA 5E3FA 4K8JA 4MIUA 1SNDA 3MHBA 1II3A 1EZ6A 2PZWA 1A3UA 3C1FA 1TR5A 4KTAA 5CV9A 2F0DA 4F8MA 1A3TA 4J6HA 5KGUA 4K5XA 1KDAA 2F0JA 1KABA 3SK5A 3QOLA 3T16A 5C4ZA 5CV6A 4H7BA 1F2MA 5IGBA 1EZ8A 3ITPA 4NP5A 2EY1A 3P1HA 5C5MA 2PW5A 2PQEA 2F0KA 2LKVA 3SXHA 4EVOA 2ENBA 1A2TA 5HURA 5IGFA 1A2UA 5IOCA 1IHZA 3S9WA 1SNQA 2M00A 5CV5A 4K6DA 4WRDA 3DMUA 2OXPA 5E1FA 2PYKA 4KY7A 4ZUIA 2EYPA 3SK8A 4OL7A 3EVQA 2EYOA 4DFAA 1RKNA 2KQ3A 3ERQA 3NUCA 4ODGA 5KYLA 4J1MA 2OEOA 5J1ZA 5JAVA
chains in the Genus database with same CATH superfamily
5JPMC 1ZXTA 2C5CA 1EY9A 4P74A 3GD7A 3ULJA 4DV1Q 3S24A 5CV4A 1UNSA 4DUZQ 5D3DA 3SGIA 4A3GB 1VQIA 4DXFA 4POGA 2UUBL 1RTOA 1B2TA 2HT1A 1PH9A 2WAQG 4DUYQ 2QKIC 1QCBD 3BVMA 3V05A 4ME5A 1XTCD 3K5MA 4BY7H 3BYYB 1CQFA 1PH5A 1HZCA 2K05A 1AFPA 1GUWA 4A3MB 1EFWA 1SYFA 3A0JA 2NVYH 1X56A 2E74C 2WB1E 3CRKC 1D5XC 1WJJA 1XXGA 1IW7C 3CKIB 4LW1A 4MNOA 1N8RC 2N55A 2FFKB 2KENA 3J7ZC 4LUVA 2SNMA 1WTVA 2Z1CA 4IFDI 4NMZA 4XIGS 4ZUJA 4BXXG 2F0WA 4GKJQ 2IY5B 3GTGH 1VMCA 5T1GA 1N36L 4J15A 4DK3C 1H9JA 3I4MH 4HIMA 3E0JA 4L5QA 2ZXPA 2UUCL 1D7QA 1K83H 3KK7A 2F0FA 4A3KB 2ASBA 4KHVA 2IHEA 4TSSA 1NCVA 2A74C 5K36G 2L5TA 3STBD 2JYOA 3PO3H 3H09A 4P72A 3F8TA 1DOLA 3NTHA 3E6ZX 4KKTA 1YI2A 3HOWG 4B3RL 4X3UA 4LAAA 4JI3Q 2L15A 2JP1A 2QEJC 4JI0L 3S2HH 1QVCA 4DA2A 2F0DA 4DAYA 1B3QA 4GLAC 1DOMA 4AH6A 1BDOA 1TS2A 1W6JA 1N9WA 2F0KA 4YCVA 1KLUD 3QWNA 2R3ZA 3CAMA 3QR8A 3J80L 4G7ZC 3A55A 3FKIH 1C7YA 4KY7A 4OL7A 4X62L 2R7ZH 3NENA 2BA1A 4JPBW 1HUNA 4UDUC 1NR4A 4JBKA 4BWGB 1GUSA 2V1CC 5JAVA 1S5BD 1C8CA 2J0TD 2R92B 2UUBQ 1BOSA 5E7NA 1GUOA 3HOVB 4R4QA 1BVSA 1IYJB 4HIDA 1I4QA 2B2UC 4L5RC 3H91A 2B3GA 4QJFA 4PZ7A 2BCOA 4TVAB 3I4NG 4LF5L 3ZJYC 2JA7G 2F0QA 3UI2A 5IGGA 5EGTA 1WCMH 3S1RH 3RZDH 5FLXL 3SE0A 1V43A 3KLSX 1EU3A 1G6PA 3I72A 3ULLA 2PMZE 1Q90A 2VB2X 1F9SA 2WB1B 1STYA 3FHWA 5C4XH 2EYHA 4RGOS 3S1NB 3M7NA 2HIVA 1Q1EA 5GQOA 1WTOA 4EQOA 1SYCA 3S2DB 1HFNA 1FGUA 4HJ8A 1V8QA 3GO5A 2JA5G 3S1MB 1BKBA 2MJ8A 3E3XA 1NMGA 1K3RA 1EY7A 1QJOA 1N36Q 4C3IB 1I6HB 4A3EH 1UEBA 3U9SA 3A56A 4B3SL 4O0AA 1SMYD 4OONA 2E76C 2QCPX 1I4PA 5M5WB 2UUCQ 3GTJH 1NTGA 2YU9B 1GUGA 1R9TB 2RDHA 3BDOA 2Q2HA 4J8QA 1HFGA 3F2DA 4UP9A 3J7AV 2JA8B 5DAUA 4AYBG 2E2HH 3CCMA 1PTOD 4A3JB 4JI0Q 1B70B 3M4QA 1SNMA 4XT3B 1VCIA 2PW7A 5C3EH 3O13A 1TWGB 1AE3A 3QJYA 4B3ML 1SNDA 1PZKD 3IRBA 1VF5C 2NZOA 3UE0A 1RCVD 3GTPB 4DK1A 1OTCA 1NE3A 2CFMA 5JEAG 4A3BB 3RZOH 2Q2UA 3QIAA 2ZTCA 1LTRD 4ZYSA 3SK8A 4JG2A 3M7GA 5ELFA 2MFIA 1VQLA 3HOXG 5LHY1 1V9PA 3H3VI 5IE8A 1AW7A 3IFTA 4OWTB 5CBAE 3J80E 1IYVA 4A3IG 1KDBA 2AQ2B 1PDQA 2D62A 1EYCA 2RQXA 3WOFA 2FINB 2IJ0A 3D0FA 1RJTA 4DNRB 4KK7A 4PMCA 1EOVA 4LF5Q 1LM0A 1SYEA 3HP3A 2UXDL 5EJWA 1HH2P 1EQTA 3J81L 1UWVA 2LMCB 2OQKA 1K8GA 4GLVB 3SR1A 3BZCA 2F0HA 1QNKA 3JC66 5LMNW 5FK9C 2HQLA 1RIPA 2R93H 4HR7B 3Q23A 3OW2A 4LF4L 1S40A 5F2DA 4HEDA 3X3MA 1YNND 3N6RA 2PMZB 4YWLA 1EY6A 3U4ZA 4GLXA 3TSSA 3M4OB 4PG3A 5FLXE 4HCSA 1A3VA 3W2DA 4AQYL 5G3LF 3KJPA 2RVLA 4L63B 1G91A 4DKAC 2A6EC 4DV7L 1JWMD 2F0EA 1O7YA 1I3QH 2IL8A 1Q7YC 3HG9A 1YJ9A 4A3FB 4LF8L 4HIKA 1CA6A 1VQ6A 3SK4A 3LGJA 4UAIA 3D6CA 1L1OC 1QOHA 4B3MQ 4YHHL 1ILQA 1E3PA 3GQBA 1IW7D 1TVXA 3PUYA 1PZID 1JE5A 5CV9A 1FYCA 3VYUA 3K5OA 4IOCA 4RGNA 4O1NA 4V190 2SDFA 5IP7G 4XYQA 5HURA 4OWXB 4Y52H 2I46A 5J3BA 1SNQA 1TY0A 4K6DA 4R1JA 1IL8A 4C3HH 4MHEA 1U4PA 3FMCA 2XTIA 4ZUIA 2EYOA 1TIID 4F88A 3KOJA 3RNUA 3AQQA 2LY7A 2L4NA 2NVTH 1R4PB 1CHQD 5EBCA 1SN8A 3S14H 2LXJA 1JJ2A 4QQBX 4DV5Q 2G9DA 4B9XA 1TWHH 1STHA 4LJZC 4IZ8A 1CA5A 3PUXA 2YV5A 1CKNB 4DK6C 1MSHA 4IFDG 4IURA 3UE1A 1QNUA 4BY7G 1TWCB 1I50H 4CDFC 1PH3A 2VS1A 4WJWA 3J81E 2B2UA 1H9SB 4A93G 2D0OA 3KF6B 3OHXC 3N52A 1KTKA 2EYJA 3W5OA 4AQYQ 3WOEA 1SXTA 2IX1A 3BVGA 2F0NA 4IUVA 1TWAH 2AQ1B 4KN7C 3CC4A 2VY3A 3KF6A 3KF8A 4RCOA 4QGUA 4DV7Q 4DR3Q 3MA2B 1B3AA 4CGYB 4QMGA 1JOOA 4DN4M 3SDZA 1G2SA 3K0YA 5ELEA 4G4KA 1EY0A 4OHJA 3I4MG 1KQSA 2UXBL 5M3MB 4KKSA 4KJNA 3QB3A 3HGBA 4C2MB 2IT1A 4LF8Q 4BBSH 1LTSD 1CKOA 4JI4L 1Y1WG 2OTJA 3GTMB 4YHHQ 1DZ1A 3QOJA 3PO3G 3NWSA 2RHQB 5ELCA 1DGSA 2N78A 3NE5B 4RHSA 4R4CA 4LF6L 5C0XH 4YCWA 2OCEA 4FF1A 4NPSA 5I6YA 1Q82C 1CHPD 1GHKA 1KNAA 4K14A 2F0LA 4Y7NH 5C3XA 5HGQA 2UU9L 4C3JB 3TDQA 3ULPA 1BCPB 4DV3Q 4NP5A 1X3PA 2L12A 1F9RA 2AUJD 3DEOA 3FKIG 2VQFQ 1I4HA 3DMUA 2OXPA 1K28A 2R7ZG 1JB7A 5C0XI 3TZDA 3S1RB 4FO2A 2AWOA 3HKZE 2B39A 4A3DB 3S15B 4GN4B 3HFZB 1QILA 5J1ZA 3BZDB 1CKMA 1OXUA 4K2LA 4WORA 2I5HA 1E24A 2HDLA 2K50A 3PUWA 3NP8A 4FF3A 3GTQH 4X66Q 1K8OA 2Z4HA 4LF7L 3T53B 3GTLB 2F3VA 2KJXA 2WAQE 2ZTEA 1B50A 1STGA 2XRQD 1WCMG 1A63A 2KEEA 2DY7A 2PQAB 2ES2A 5I6WA 1CSQA 1E7ZA 3ONAB 5JJZA 3HKSA 1DONA 2B8GA 1X3FA 1X65A 1QVFA 3R2IA 4CDEC 2SNSA 3DM3A 4X64L 4YCUA 3FVQA 4ZKBB 1I6VC 1N33Q 5C4XG 4ME3A 1F2ZA 3IL8A 3FDTA 2DNCA 4A3IH 3G4SA 1GD7A 3NXWA 1PLFA 4QIWE 1DJRD 1SE4A 5HGTA 1SNPA 4JOIC 1D5ZC 4DV4Q 1IBKQ 1STAA 1PH4A 4IUNA 3DWQA 2LXKA 3J7A5 4A3EG 4DK0A 5IWAQ 4QCLA 3BYTB 3I91A 3TP7A 1ICFB 4DF7A 1G51A 2Q8IB 4JI4Q 5M3FG 2K5NA 4N9PA 3I55A 3BU2A 3EA6A 2PCFB 1C9OA 2TMPA 2D0PA 2XRSD 3IKJA 1KLGD 4KD3A 3VA5A 4CJ2C 4MZ9A 4MTNA 4KD4A 3NK9A 2F3IA 4IPGA 4JI2Q 5C3EG 1VQAA 4FXDA 2HQEA 3OTOL 1O80A 1TS5A 4UHVA 1U5KA 5I9PA 3U9OA 1TU2B 1Q8KA 1KDAA 3CC7A 1L1OA 1LT6D 3B6YA 5C4ZA 1CUKA 3P1HA 3VYSA 2A6ED 1Y1VB 4LK1C 2K14A 3MXGA 4HSVA 3ZYYX 3EVQA 1EEFD 2KECA 3HKZB 1PFMA 1V1PB 3MFYA 1EWIA 3H0GH 1YJNA 3G6JB 4K8IA 1VQ9A 4JI8L 1JOKA 2DJGC 2JE6I 4RKBA 3BG3A 1RL2A 2B2VC 4DNTB 2SOBA 2WKDA 1HUMA 1NSNS 1SNCA 2O4XA 5LMUL 4QL5A 2R93G 2ZM6L 2WAQB 4BY1G 3AB9A 1CQVA 4C1NI 3A5ZB 4LUZA 3I56A 3BDCA 3GTKB 4IPCA 1TWFB 3CQZH 4RFBA 4A3LH 2N8NA 5JEAJ 2RHSB 5DEHA 3MXNA 5KRUA 4RKLA 1GKHA 3UDIA 5I4DA 3HS0C 2JSOA 4HCEA 4S3SA 3PO2H 1E2VA 5A2QL 4KKUA 3I8ZA 4WJ4A 4QIWB 4ZK9B 1T5EA 4LNQA 1I4GA 2PO4A 1FGBD 1L2FA 2AQ3B 2EJGC 3CPFA 4OWWB 1QB5D 2OTLA 3D3RA 1QG7A 4X65L 4IFDH 1E2ZA 1HZAA 2QDBA 4FYDA 2L9HA 1BO0A 1WI5A 5BN3A 2BH8A 1UAPA 4JI1Q 1WTRA 1QZGA 3I73A 1IYUA 2MO1A 5IP9H 1HA6A 3FPPA 4A93H 5GAGC 2CKZB 3MFGA 5G3LD 5IY0A 4BA1I 1EIYB 5AJ3Q 2FJ2A 1U4RA 3RLNA 3J80i 4DR1Q 2V4DA 4AYBE 4IUPA 3OTOQ 1Q3LA 1CM9A 1LTBD 4QB4A 3TS2A 1AH9A 1EWCA 1VQJA 5K5PA 4U673 5AFWA 3HOWB 2NVTB 1JJGA 1FJGQ 1DYQA 5EPJA 1EQQA 2OWOA 1ASZA 1LABA 2IW3A 1PA6A 1LTGD 4P75A 1ESFA 1PFBA 1A3TA 2IPKD 5ELNA 2BE5C 1N34L 1BXTA 3T16A 5IGBA 2N88A 4L5TA 1SJHD 1HNXQ 3UDFA 4DPGA 1W2BA 4DV2L 1Y1WH 2JEBI 1DCZA 4C3HG 3KYHC 5E1FA 4HJAA 2E2JH 4K0KL 1NMFA 4X3SA 4DAYB 1PMRA 2E2IH 3ERQA 3SVMA 3NUCA 4JI8Q 4XXEA 2JEAI 1AZPA 4CDCC 3U58A 2NTSA 1LT5D 3H94A 3RLOA 2PZTA 3LNNA 3S1QH 1D1KA 2R6GA 1I94Q 1UUPA 1VQEA 3I4NB 1U4LA 2XN9C 3DUZA 1E22A 2JA7B 3HOYH 1STNA 3OIQA 2G9HD 2X69A 3TEHB 2JXMB 3T51B 5D14A 3M3YB 4BBRH 1YEZA 1WD1A 4R9WA 1HQMC 4KLKA 2ZJQA 2M9VA 1TKWB 1TQOA 5CORA 2Z0SA 4I65A 3M4YA 1VQMA 4PZ6A 3PF5A 4XDXA 4X65Q 1I4RA 2R7FA 3HOZH 3F2UA 2JA5B 1M4VA 3RN5A 3HOUH 1LO5D 4HAEA 5A2QE 4TRDA 4Y7NB 2AMCB 1EOTA 1EWHA 2F3WA 4BBSG 2MP1A 4N8FA 3T1YL 2XIWA 1B7YB 3TQYA 1EIFA 4JOIA 4LMQD 4DV0L 1VQCA 4IFDJ 3F1ZA 1NBWA 3PGZA 1PTOB 1GXDC 4XTCS 2F0VA 4R4IA 3E0EA 2KHIA 4IUQA 4AYBB 3CMEA 5C0XG 1SE3A 5IGDA 3NTKA 3RR5A 1VQHA 2N3SA 4H02A 3RN2A 1N34Q 5E3FA 1EIGA 4MIUA 3BZKA 1UE1A 1VQKA 4JYAL 5M3FH 2WINB 3CCEA 1STEA 4H0LC 1VMPA 1A2UA 3J81i 3T1HL 4K0KQ 1PHJA 2JA6H 4WRDA 2B2TC 1GUNA 2Q8TA 2E2DC 4B3RQ 1Q1BA 1OXXK 1RD9D 3DWAA 1KC8C 1X32A 4DR4L 2XSCA 3HOXB 4JI6L 3K57A 3Q22A 1HNZL 1HR0W 1YITA 2ZJRA 1XMOL 2NVQH 2B29A 3H3VH 1J5EL 4A3IB 3AMUA 3K80C 3MZ5A 1VQ8A 4ZQ3A 2K52A 3TP5A 4KV6A 1PRTF 1Q46A 2K75A 1CT1D 2K5VA 3UDGA 4FXKC 4X62Q 2ID0A 4UP7A 2XGTA 4IJLA 4IN3A 2F0MA 2KCCA 1ML0D 3P7JA 2HDMA 2K6AA 3IAYA 5LL6S 5KEEA 4XQNA 2B2VA 2BDNA 1MI2A 3SEBA 2MGSA 3T13A 2N49A 3GTOH 2LSSA 1Q86C 3VYRA 1JMCA 1AP0A 2MNAA 4LFAL 2D2CC 4KHZA 1K9MC 1BUVT 4K2KA 4UPAA 3DXJC 1SLJA 4IPHA 5IGCA 3VDYA 3KBGA 2WKCA 1GM5A 2FMCA 4IUUA 4KY5A 3TZUA 4BY1H 2VW9A 1SBBB 1EYDA 2Q2TA 3A54A 1VQGA 2F4VL 1RODA 2C9OA 2L1BA 3KLWA 2IX3A 1ILPA 2SEBD 2XVSA 3E9HA 1U4MA 3E9IA 3L3OC 1J8IA 2Z9HA 3W1BA 4JBJA 3J81j 3TP6A 1P16A 3Q8DA 3RD4A 2KBNA 1YVCA 5KNCA 1SMXA 3H3VC 2HIXA 4B3SQ 1JT8A 4GOPC 3AEVA 1CFMA 3PIP3 1E2WA 4DU9A 2WACA 2Q2IA 2FMMA 1MIUA 3NHHA 4JYAQ 4TQUS 3JAMi 5DLQE 4A3CH 3L7ZC 1SFOB 1KABA 1VF7A 4P2CB 2CCZA 3NPPA 5FKAC 2DGYA 2B63G 3AU7A 1KL9A 2DN8A 5IGFA 5IOCA 4JW0A 2K03A 1KD1C 2M00A 4DR4Q 1PRTC 2KEDA 4JI6Q 4JC0A 1EIHA 1QVGA 5M5XH 1V1OA 1XMOQ 2EOTA 3LWUA 3WDNA 2B2YC 3I4OA 1J5EQ 2FHTA 4DXGA 2HHHL 3S17H 3H0GG 2NWGA 5KYLA 3S16H 4L5SA 3EROA 5JJIA 2EE1A 1IBLL 1D2BA 3I70A 4OX9L 1Y8OB 3NQTA 2PPBC 4EQPA 1NUCA 3OWEB 1JWSD 4IPDA 5C6AA 4PZ8A 4GNXC 2F0OA 4LFCL 4A3GH 1SNOA 4V0BA 1PVOA 1JORA 1OXVA 4BY7B 1Q12A 4A3LG 5GROA 2BE5D 5BN4A 3K8AA 3TP8A 3K0XA 3DLLA 3CD6A 1S72A 1LACA 3A8IE 2IHFA 4A93B 2NVYB 4A3MH 4LFAQ 1XJVA 3PO2G 1JICA 2UXDQ 3NQIA 1EQVA 1AEXA 4GKKL 1S5DD 2Z6KC 4RGMA 4CDDC 4P71A 4JI5L 5M9OA 4OIKA 4UP8A 4HIOA 4LF4Q 4IALA 2Y0SG 3GTGB 1XNQL 3PQIA 3AYHB 2WIIB 1IBML 3NELA 4CKEA 2XWJB 3RUZA 2QGQA 3MC0B 3I4MB 2I0QA 5IP9G 1J6QA 2CH4W 3DWPA 3OW7A 4DR6L 1Z9FA 4HJ7A 4NXML 1D1IA 3KF8B 1C4QA 1K83B 5IT9L 2HUGA 1ZYRC 1Y1WB 1SE8A 1JE4A 1KIXA 2EY2A 3C1EA 3M9BA 2OT2A 4A3KH 4I7AA 4OGQC 1JOQA 4CBVA 3PO3B 4PQXA 1O7IA 1GUTA 2E2IB 2K5DA 1Q8IA 3OMCA 2WV6D 3TRZA 1PH7A 1WTPA 2F0PA 3S2HB 1II3A 3UDXA 1A3UA 4J6HA 4L8JA 3S1QB 3QOLA 3WWVA 4H7BA 2EY1A 4OIJA 1NNXA 2K5WA 1Y8NB 3RLFA 1X55A 1SE2A 3PF4A 3FKIB 2R7DA 1N32L 3D31A 1M90C 2R7ZB 4LUOA 3I3CA 1IBLQ 2EQSA 4OX9Q 4J1MA 3HRZC 4ZAIA 3MVVA 2F0SA 1YJWA 4B3TL 5JOBA 4LFCQ 4K5VA 5CYUA 2R92H 4FVMA 2YYZA 2B2TA 2A6HC 4O42A 4YWKA 4EGVA 2YTXA 3NTIA 2O5IC 4R8NA 1B53A 1SDFA 2ICIA 2K1BA 3HOYG 3K7UC 1ICWA 1K73C 3ERSX 3VR2A 2KHJA 1WCMB 4DAPA 3RZDB 2A19A 5C3WA 2YTYA 4BBRG 5IIFA 3BS1A 1J9OA 1VQOA 1AN8A 5BR8L 3PMFA 2QILA 4GKKQ 2Z4IA 3FPUB 4P73A 4K5WA 1XNRL 1MSGA 4WJ3M 2LS01 4JI5Q 5GAEC 2QDLA 5C4XB 2NN6H 2L0CA 1VQ4A 5ELDA 3S1NH 1ESRA 3HOZG 4FDBA 1Y69U 3BDLA 1XNQQ 2RDFA 4BS9A 3S2DH 1IBMQ 3HOUG 3SK6A 1B1ZA 1LTID 4NW2A 2F03A 1YBYA 3S1MH 3CCLA 3L0OA 4A3EB 5CC4A 1D6EC 1A15A 4DR6Q 4C3IH 1I6HH 5JJKA 2H4OA 2EYLA 1YIJA 1VQ5A 5C44G 2EYMA 3GTJB 5M5WH 3MEFA 3H6MA 1WFQA 2F0TA 1FR3A 2TSSA 3TN2A 5M3FB 1B9MA 3W1GA 2YU9H 1H9KA 3HZXA 2NN6I 3L2PA 1LUZA 3NEMA 3KUPA 1H9RA 1KHIA 4GS3A 5A35A 2EYFA 3G7LA 2E2HB 2KCTA 4U68A 1CZGA 1VS0A 3ICEA 2BOSA 1M8AA 1SYBA 5ELOA 2KCMA 5IT9E 2Z8LA 2UXBQ 4GN3B 4A3JH 2CQOA 5C3EB 1NY4A 5GAHC 2UXCL 3IFDA 3A5UA 1TWGH 3C3LA 1W6KA 1KNEA 5KGUA 2CWPA 5GADC 2AKWB 2CHBD 1GJXA 4DV1L 3RZOB 4EVOA 2JA6G 4A3BH 4DUZL 4GOPA 1PH2A 1HJPA 5CV5A 1X3GA 4LF6Q 3EBEA 5DNFA 4RA8A 2JQOA 1G291 4DR7L 3I2ZA 4X3KA 1I4XA 4DUYL 1KXLA 1WYDA 1L1OB 4XQQA 4A75A 2UU9Q 1G2TA 3CU7A 2GN5A 2GA4B 5I2XA 3OSOA 2JN4A 1JQYD 3PIPA 4CJ1B 4ILWA 5EPLA 5C0XJ 1BBXC 1HCZA 5KIXA 1WTQA 4LFBL 1O7LA 5C5LA 5E4WC 1PZJD 3G71A 2B2YA 2B63H 3TMEA 2RKSA 2ATWA 5BR8Q 2PNRC 2R93B 4BY1B 2BA0A 2GVBA 2DUDA 3R2TA 1K0SA 1XNRQ 4GKJL 1HZBA 1STBA 3PSIA 2EXZA 3M85A 2VUMG 4N8X1 2EXDA 1ASYA 1TS4A 5IYCH 1PRTD 2JJQA 1BF4A 5J39A 4CJ0B 1SAPA 1X3QA 4LF7Q 1EUJA 1MJCA 2RCFA 1IZ6A 2WP8J 5D3IB 3M4OH 2ICEC 1FD7D 3DM1A 3EIVA 2QEXA 1ENCA 4OO1I 4F7XA 1GHJA 3A8KE 1CZWA 3MXNB 5NUCA 4JV5L 4NDXA 5CGKA 1JWUD 2UUAL 2RBMA 4X64Q 1I3QB 2XWBB 3A74A 1S3OA 2Z6KA 4JI3L 4YWMA 1CK1A 4N9TA 2I5LX 5I2YA 4DV6L 4KI0A 4K6LA 5FO8B 3VR6A 1GO3E 3CF5A 4A3FH 2A69C 2E75C 2KVMA 3KFUA 1WTHA 5M5XB 4FNFA 4KJOA 1YNXA 4DGZA 3S16B 1F9QA 2OQ0A 1XPOA 2AWNA 4A3CG 1D8LA 1E0BA 1EZ6A 1SEBD 5CBEE 1FVIA 3RMHA 2A8VA 2NZHA 2KUMA 4CKBA 1CTMA 4WFN3 1MGSA 2MPMA 2K7VA 3ITPA 3OYYA 3CCRA 2RCNA 3SXHA 1WTXA 4IJHA 4RHRA 3S9WA 4C3HB 4DR7Q 2MO0A 2PI2A 3R8BA 2PYKA 2K32A 3CCSA 2RSOA 3KBXA 4X3TA 4JBMA 3K6OA 5TSSA 3MWYW 1ZYRD 4C56C 3S14B 1SR3A 4RCNA 4LFBQ 2NBFA 1HHVA 1M1KC 4POFA 1SROA 4RWSC 2XNAC 3M4PA 4A3GG 1HNWL 1TWHB 3U4VA 5EQ0A 3CMAA 2L55A 2K5QA 2CW0C 1NJIC 5JVH3 1VQNA 3KDFB 1G6ZA 1I50B 4HSPA 2NZ1D 2DNEA 1ENFA 1BR9A 1TWCH 3JAMc 2ZXOA 2F1MA 4A3MG 3KDFA 3I7FA 1P8LA 1YHAA 2L11A 1LTTD 5IT9c 2ALYB 3G6EA 2JK8A 3NSWA 4OXPA 4ALPA 5LMUQ 1TWAB 1FNUA 2RA4A 2ZM6Q 4JV5Q 4HMJA 2VNUD 4E6IA 4ZRZA 2UUAQ 3OMGA 1YHBA 2I07B 2PZUA 1IL2A 1VQBA 3LX0A 3CC2A 2Q8RE 2K01A 2A6HD 1OO9B 4HJ5A 4ABNA 4DV6Q 1VQFA 4BBSB 1KRSA 5M3MH 2KCNA 4C2MH 1BNZA 1EYAA 3FEWX 3CCUA 1HA5A 4A3KG 1FL0A 5COYA 2NVXH 1VQDA 5EAYA 1A6XA 2E5LL 1XPUA 1KAWA 1X3EA 3DEPA 3GTMH 1F2YA 1DXMA 1FNVA 1S5ED 2KHSA 2EVBA 1BCPF 1JJCB 1EY8A 1BBUA 2I5MX 1XMQL 2KOLA 3CW2C 3R93A 4ZCKA 2K33A 5C44H 5C4JH 1VQ7A 2O5JC 4C3JH 4RGTA 3LWEA 4EX5A 5I9OA 1LTAD 2PW5A 2PQEA 5JVG3 2LKVA 2ENBA 1E1TA 3F2BA 1PH6A 4ULLA 3MXUA 1XX8A 3FP9A 3NBIA 2HCCA 4JBWA 1OXSC 4A3DH 1PFNA 1DD2A 3J7AF 1EYGA 3S15H 2R92G 1HNWQ 5H1SE 1XTDA 5FLMH 2EJFC 3MAQA 4NXNL 1Y14B 1ET6A 4DV2Q 3HOVG 3R3OA 1EU4A 5EKIA 4DAVA 4QUFA 2P5ZX 3GTQB 3F2CA 4H13C 5KNDA 5CMDA 2X6LA 3DHQA 2EPBA 1KDCA 2OF1A 1PYSB 3ND9A 3GTLH 1HPCA 5FO9B 3EQLC 5KYIA 1I5FA 1LT4D 1V1QA 3VYTA 4KN4C 3X3NA 5FJ8H 1ZEQX 3CXCA 3VR5A 1CI3M 1TXYA 2F0GA 4DR2L 2NN6G 1T9HA 2WB1G 4ID6A 2CH4A 1Z47A 4C1NK 1BQQT 3A8JE 4A76A 4G7OC 3FRPB 2EZVA 1RF2D 2M2LA 5IYDH 2Y0SE 4C3IG 3ND8A 3D4RA 4M1UB 5DM63 1BCPC 2EJMA 5JPNC 2DY8A 1WTWA 1EY5A 4XYOA 1DOKA 5BN5A 2EIFA 2E5LQ 1EQRA 1LTLA 5M5YH 2VUMH 1RDPD 4MTKA 1MJEA 2JA8G 1JCKB 5DM73 1MBYA 5E4XA 4Z9CB 1D5MC 1SYDA 1SYGA 5EKKA 5EPKA 1EY4A 5J22A 1IKLA 2K28A 2KA7A 1KAAA 4A3JG 1Y8PB 1XMQQ 1XYIA 4R8IA 3T1YQ 1NR2A 3I90A 4XT1B 1T5XD 1HRJA 4DV0Q 4FXGC 1R4QB 1RTNA 2K04A 4A3BG 2A68C 5IYBH 5C5MA 4DV5L 2B63B 2VB3X 2D9UA 3L9AX 1Y1VH 1UE7A 1LLRD 4B08A 3NWTA 2J4XA 2QA4A 4NXNQ 1YNJC 2H1EA 3H0GB 3CCQA 2A69D 1ET9A 4B9WA 2BDOA 4DNIA 3W3AA 2RF4A 3K5LA 2F52A 1ENAA 1TY2A 1Z7TA 1K8AC 3K7AH 1HXYD 1WOCA 3T1HQ 3PV0A 4HTHA 1S4ZA 4G7HC 3ER0A 1GOZA 1LT3D 3GP7A 4QY7A 3PIO3 2ZTDA 5KNBA 3E5SA 1C0AA 4OO1G 1A8VA 3GV6A 1MD2D 2AHOB 1UEAB 1HNZQ 4EQ5A 4DR3L 3CQZB 2ZXRA 3GTKH 3OOCA 4H44C 4DR2Q 4RMFA 1TWFH 3SHLA 1LYLA 2PNHA 5IYCG 1U0LA 1RHPA 1K0RA 3PO2B 3C46A 1XWEA 4JK1C 4RAUC 2A73B 1S5FD 2NB0A 4LWCA 4KHPL 2F0IA 4LF9L 2X6GA 4QF4A 3K59A 2YTVA 3CRLC 3U50C 2Y0SB 3D8GA 4ZKCB 2A1AA 4YIJA 1JC7A 4BXXH 1H95A 2MQHA 4NB3A 5ISRA 3CCVA 1S5CD 2QF7A 3HEJA 1IXRA 1TS3A 3T56B 2CW0D 1E1OA 3MEHA 4A3FG 4R4TA 3GV3A 3MTSA 1PYBA 2H5XA 1K3BC 4DV3L 4DAMA 1LV9A 1MHWC 2VQFL 5K36H 5FOBB 1TT2A 3G48A 5CR3A 5IGEA 2F4VQ 3JAML 1UE5A 5D65A 3HOWH 2HCIA 5C4HA 2B2WC 2PZWA 4KTAA 2WFWA 4PMWA 1TR5A 2Z6BA 3CCJA 3KLRA 1HR0L 2F0JA 3SK5A 1X9NA 1F2MA 2F4IA 2VXWA 1KRTA 4UY8C 1BBWA 3D6WA 4BA2I 1IHZA 2E2JB 5JJLA 3K81C 4X66L 1XPRA 4DFAA 1RKNA 2B8FA 1CKNA 1AE2A 1HTLD 4FF2A 1ONLA 1MKHA 4ODGA 4HJ9A 4QUCA 1QUQB 3EJIA 2J7ZA 5EKLA 1VDZA 1O7ZA 1Q81C 3BJUA 4PV1C 1EL0A 3MXPA 4IUTA 1NAPA 2GVAA 1L0WA 4OEMB 2K4KA 1N33L 1H9SA 1QUQA 1H9MA 4IQZA 1JR0D 1SRUA 4YY3L 3EFXD 3HOYB 3TREA 3I4NH 2RDGA 2HHHQ 1U9RA 4DV4L 1IBKL 4GZYC 4IO9A 2JA7H 3CHBD 3V96A 3OPOA 4A4IA 4BBRB 5IWAL 5LMNL 3KLSA 3STBC 3D4DA 3M3YH 4EQNA 4Q0FA 2NVXB 4KHPQ 2VQEL 2VZAA 4DR5L 4LF9Q 3I4LA 3HOVH 3J80c 4JI7L 5FO7B 5HY6A 2VL6A 3HOZB 2AUKA 3HOUB 4ZLTF 1PFSA 2JA5H 3P20A 4CKCA 1PTOF 5IODA 3OWFA 1ZKOA 3A7AB 2JA9A 4XQJA 5M3MG 2ZJPA 4JI2L 5C4JB 5C44B 1HZ9A 3URYA 1B44D 3BVZA 4Q5VA 2EY6A 4HMIA 1B4OA 1EFID 1QE6A 2IWHA 3CP0A 1OXTA 3KJOA 2E8GA 1PTOH 2NYZD 4PMBA 2CWAA 1QWYA 4I7ZC 4X6AH 5T1IA 3OIPA 5FLXc 3K58A 4NXMQ 1HR0Q 2D5DA 4K8JA 3MHBA 4C3JG 3C1FA 1HQRD 2CVRA 4F8MA 4K5XA 5CV6A 1K8MA 1EZ8A 2HD3A 1R9TH 3TBIB 1HTPA 2MUYA 1CSPA 1A2TA 3Q6SA 3JAME 5JEAH 2JA6B 1W3SA 1BCPD 1PYWD 1A0IA 1YZ6A 2JA8H 5ELBA 1AZQA 2EYPA 1L0YB 4OELB 3AFQA 4A3DG 1B8AA 2KQ3A 3VR4A 4RG1A 5FLMG 3HOXH 2NVQB 2OEOA 1UE6A 2LFNA 4GOPB 2F0UA 2PQAA 4PNYA 5EBDA 2A5HA 2PI2E 3TS0A 4AIMA 4TKOB 1SMYC 3QG1A 4YY3Q 3QO2A 2BH2A 4MN3A 3GTPH 2ZT9C 4FP5D 3Q0AA 1N32Q 1DM0B 2NTTA 3GDEA 1A62A 2RSNA 5LMNQ 5FJ8G 1WD0A 2EDGA 4KY6A 4B3TQ 2A68D 1PRTB 2NUCA 1VQPA 1QZHA 5CV8A 2VQEQ 4DR5Q 1PTOC 1O78A 3CPWA 3Q24A 4NKLA 2VUMB 5M5YB 3GTOB 4JI7Q 4JI1L 4RH6A 4L6TB 2MHVA 3AFPA 5L37A 1C48A 1X54A 1YNJD 2C35B 5IYDG 5AJ3L 1WVLA 4FF4A 2R61A 4DR1L 3V2TA 1PH1A 1F2LA 4GNXB 1SSOA 4OO1H 1L0XB 4APVA 3T4AC 3PUZA 1X6OA 3PIOA 3A7LA 4F87A 3P75A 1B9NA 1FJGL 4GNXA 3VR3A 4R4OA 1G8ZD 1FNWA 2O2LD 4G57A 1F9PA 4JVZA 3PCOB 1PV4A 1JB3A 3J81c 1GVPA 1HNXL 4HN7A 3J7YW 2EY5A 4M8AA 1YHQA 3PUVA 5CV7A 3D4WA 4IOAA 3VA7A 3EN2A 4O2DA 1PXUA 2FXQA 1IKMA 1F77A 3K7AB 2DJFC 3H15A 5IYBG 2CQAA 1SFOH 1V1PA 1EEID 2K5HA 3C2PA 1Z6HA 5IP7H 1Y1VG 1YNNC 2IX0A 3NBHB 1PH8A 4JCVE 1SJED 5LL6X 2QW7A 4CHTB 1I94L 4KMUC 2B2WA 2UXCQ 3S17B 3HKZG 3K5NA 2G5DA 3NBHA 4GN5A
chains in the Genus database with same CATH topology
5JPMC 1ZXTA 2C5CA 1EY9A 3GD7A 5CV4A 1UNSA 5D3DA 4A3GB 4DXFA 1RTOA 1B2TA 2QKIC 1QCBD 3BVMA 3V05A 4ME5A 1XTCD 3K5MA 3BYYB 1CQFA 2K05A 1AFPA 1GUWA 4A3MB 1SYFA 3CKIB 2E74C 3CRKC 1D5XC 1XXGA 1IW7C 2N55A 2FFKB 2SNMA 1WTVA 2Z1CA 4IFDI 4NMZA 4XIGS 4ZUJA 2F0WA 1VMCA 5T1GA 1H9JA 3E0JA 2ZXPA 3KK7A 2F0FA 4A3KB 4KHVA 4TSSA 1NCVA 2A74C 5K36G 2L5TA 2JYOA 3H09A 1DOLA 3NTHA 3E6ZX 4KKTA 4X3UA 4LAAA 2QEJC 2JP1A 4DA2A 2F0DA 4DAYA 1DOMA 1BDOA 1TS2A 1W6JA 2F0KA 1KLUD 3QWNA 2R3ZA 3J80L 4G7ZC 3A55A 4KY7A 4OL7A 2BA1A 1HUNA 4UDUC 1NR4A 4BWGB 1GUSA 5JAVA 1S5BD 1C8CA 2J0TD 2R92B 1BOSA 1GUOA 3HOVB 1I4QA 2B2UC 3H91A 2BCOA 2F0QA 3UI2A 5IGGA 5EGTA 5FLXL 3SE0A 1V43A 3KLSX 1EU3A 3I72A 1Q90A 2VB2X 1F9SA 2WB1B 1STYA 2EYHA 4RGOS 3S1NB 3M7NA 1Q1EA 1WTOA 4EQOA 1SYCA 3S2DB 1HFNA 1V8QA 3GO5A 3S1MB 2MJ8A 1EY7A 1QJOA 4C3IB 1I6HB 3U9SA 3A56A 1SMYD 5M5WB 2E76C 2QCPX 1I4PA 2YU9B 1GUGA 1R9TB 2RDHA 3BDOA 4J8QA 1HFGA 3J7AV 2JA8B 5DAUA 1PTOD 4A3JB 4XT3B 1SNMA 1VCIA 2PW7A 3O13A 1TWGB 3QJYA 1SNDA 1PZKD 1VF5C 1RCVD 3GTPB 4DK1A 4A3BB 5JEAG 3QIAA 1LTRD 4ZYSA 3SK8A 3M7GA 5ELFA 5LHY1 1AW7A 3IFTA 3J80E 5CBAE 1IYVA 1KDBA 2AQ2B 1PDQA 2D62A 1EYCA 2RQXA 3WOFA 2FINB 2IJ0A 4DNRB 1RJTA 4KK7A 4PMCA 1SYEA 3HP3A 5EJWA 1EQTA 3J81L 2LMCB 3SR1A 2F0HA 1QNKA 5FK9C 4HR7B 3Q23A 5F2DA 4HEDA 3X3MA 1YNND 3N6RA 2PMZB 1EY6A 3TSSA 3M4OB 5FLXE 4HCSA 1A3VA 3W2DA 5G3LF 2RVLA 4L63B 1G91A 2A6EC 1JWMD 2F0EA 1O7YA 2IL8A 3HG9A 4A3FB 1CA6A 3SK4A 4UAIA 3D6CA 1QOHA 1ILQA 3GQBA 1IW7D 1TVXA 3PUYA 1PZID 5CV9A 1FYCA 3VYUA 3K5OA 4RGNA 4O1NA 4V190 2SDFA 4XYQA 5HURA 2I46A 1SNQA 1TY0A 4K6DA 1IL8A 4MHEA 1U4PA 3FMCA 4ZUIA 2EYOA 1TIID 4F88A 2LY7A 2L4NA 1R4PB 1CHQD 5EBCA 2G9DA 4B9XA 1STHA 4LJZC 4IZ8A 1CA5A 3PUXA 1MSHA 4IFDG 4IURA 1QNUA 1TWCB 4WJWA 3J81E 2B2UA 1H9SB 3OHXC 3N52A 1KTKA 2EYJA 3WOEA 1SXTA 2IX1A 3BVGA 2F0NA 4IUVA 2AQ1B 4KN7C 3KF8A 4RCOA 3MA2B 1B3AA 4CGYB 4QMGA 1JOOA 4DN4M 3SDZA 1G2SA 3K0YA 5ELEA 4G4KA 1EY0A 4OHJA 5M3MB 4KKSA 4KJNA 3QB3A 3HGBA 4C2MB 2IT1A 1LTSD 3GTMB 1DZ1A 3QOJA 3NWSA 5ELCA 3NE5B 4RHSA 5C0XH 4FF1A 5I6YA 1CHPD 1GHKA 1KNAA 4K14A 2F0LA 5C3XA 4C3JB 3TDQA 1BCPB 4NP5A 1X3PA 1F9RA 2L12A 2AUJD 3DEOA 1I4HA 3DMUA 2OXPA 5C0XI 3TZDA 3S1RB 4FO2A 2AWOA 2B39A 4A3DB 3S15B 1QILA 5J1ZA 3BZDB 1OXUA 4K2LA 4WORA 2HDLA 3PUWA 3NP8A 4FF3A 1K8OA 2Z4HA 3T53B 3GTLB 2F3VA 2KJXA 1B50A 1STGA 2XRQD 2KEEA 2DY7A 5I6WA 3ONAB 5JJZA 1DONA 2B8GA 3R2IA 2SNSA 3FVQA 4ZKBB 1I6VC 1F2ZA 2DNCA 3IL8A 3FDTA 3NXWA 1PLFA 5HGTA 1DJRD 1SE4A 1SNPA 1D5ZC 1STAA 4IUNA 3DWQA 4DK0A 4QCLA 3BYTB 3I91A 3TP7A 4DF7A 2Q8IB 4N9PA 3EA6A 2PCFB 2TMPA 2XRSD 3IKJA 1KLGD 4KD3A 3VA5A 4CJ2C 4KD4A 3NK9A 4FXDA 2HQEA 1O80A 1TS5A 5I9PA 3U9OA 1TU2B 1KDAA 1LT6D 5C4ZA 3P1HA 3VYSA 2A6ED 1Y1VB 4LK1C 3MXGA 4HSVA 3ZYYX 3EVQA 1EEFD 2KECA 3HKZB 1PFMA 1V1PB 3MFYA 3G6JB 4K8IA 1JOKA 2JE6I 4RKBA 3BG3A 2B2VC 4DNTB 2SOBA 2WKDA 1HUMA 1NSNS 1SNCA 2O4XA 2WAQB 3AB9A 1CQVA 4C1NI 3BDCA 3GTKB 1TWFB 4RFBA 5JEAJ 5DEHA 3MXNA 5KRUA 4RKLA 5I4DA 3HS0C 2JSOA 4HCEA 4S3SA 1E2VA 5A2QL 4KKUA 3I8ZA 4QIWB 4ZK9B 1T5EA 1I4GA 2PO4A 1FGBD 2AQ3B 2EJGC 1QB5D 3D3RA 1QG7A 4IFDH 1E2ZA 2QDBA 4FYDA 2L9HA 1BO0A 5BN3A 1WTRA 1UAPA 3I73A 1IYUA 1HA6A 3FPPA 3MFGA 5G3LD 4BA1I 2FJ2A 1U4RA 2V4DA 4IUPA 1Q3LA 1CM9A 1LTBD 4QB4A 1EWCA 5K5PA 4U673 5AFWA 3HOWB 2NVTB 1DYQA 5EPJA 1LABA 2IW3A 1LTGD 1ESFA 1PFBA 1A3TA 2IPKD 2BE5C 1BXTA 3T16A 5IGBA 2N88A 1SJHD 2JEBI 1DCZA 4C3HG 5E1FA 4X3SA 1PMRA 3ERQA 3SVMA 3NUCA 4XXEA 2JEAI 1AZPA 2NTSA 1LT5D 3H94A 2PZTA 3LNNA 1D1KA 2R6GA 1UUPA 3I4NB 1U4LA 2XN9C 3DUZA 2JA7B 1STNA 3OIQA 2G9HD 2X69A 2JXMB 3T51B 5D14A 3M3YB 1WD1A 4R9WA 1HQMC 2M9VA 1TKWB 1TQOA 5CORA 4I65A 3M4YA 4XDXA 1I4RA 3F2UA 2JA5B 1M4VA 1LO5D 4HAEA 5A2QE 4TRDA 4Y7NB 1EOTA 1EWHA 2F3WA 2MP1A 2XIWA 4LMQD 4IFDJ 1PTOB 1GXDC 4XTCS 2F0VA 4IUQA 4AYBB 5C0XG 1SE3A 5IGDA 3NTKA 5E3FA 1EIGA 4MIUA 2WINB 1STEA 4H0LC 1VMPA 1A2UA 4WRDA 2B2TC 1GUNA 2Q8TA 2E2DC 1Q1BA 1OXXK 1RD9D 3DWAA 1X32A 2XSCA 3HOXB 3K57A 3Q22A 4A3IB 3AMUA 3MZ5A 4ZQ3A 3TP5A 4KV6A 1PRTF 1CT1D 4FXKC 2ID0A 4IN3A 2F0MA 2KCCA 1ML0D 3P7JA 2HDMA 2K6AA 3IAYA 5LL6S 5KEEA 4XQNA 2B2VA 2BDNA 1MI2A 3SEBA 2MGSA 3T13A 3VYRA 1AP0A 2D2CC 4KHZA 1BUVT 4K2KA 3DXJC 5IGCA 3KBGA 2WKCA 2FMCA 4IUUA 4KY5A 3TZUA 1SBBB 1EYDA 3A54A 1RODA 2C9OA 2L1BA 2IX3A 1ILPA 2SEBD 2XVSA 1U4MA 1J8IA 3L3OC 3TP6A 3RD4A 5KNCA 3H3VC 1CFMA 3PIP3 1E2WA 4DU9A 2WACA 2FMMA 3NHHA 4TQUS 3L7ZC 1SFOB 1KABA 1VF7A 4P2CB 3NPPA 5FKAC 3AU7A 2DN8A 5IGFA 5IOCA 2K03A 2M00A 1PRTC 2KEDA 1EIHA 1V1OA 2EOTA 3LWUA 3WDNA 2B2YC 2FHTA 4DXGA 2NWGA 5KYLA 3EROA 2EE1A 1D2BA 3I70A 1Y8OB 3NQTA 2PPBC 4EQPA 1NUCA 3OWEB 1JWSD 5C6AA 2F0OA 1SNOA 4V0BA 1JORA 1OXVA 4BY7B 1Q12A 2BE5D 5BN4A 3TP8A 1LACA 3A8IE 4A93B 2NVYB 1JICA 3NQIA 1EQVA 1AEXA 1S5DD 4RGMA 5M9OA 4OIKA 4IALA 3GTGB 2WIIB 4CKEA 2XWJB 3RUZA 3MC0B 3I4MB 3DWPA 3OW7A 1D1IA 1C4QA 1K83B 5IT9L 2HUGA 1ZYRC 1Y1WB 1JE4A 2EY2A 3C1EA 2OT2A 4OGQC 1JOQA 4CBVA 3PO3B 4PQXA 1GUTA 2E2IB 2K5DA 1Q8IA 3OMCA 2WV6D 1WTPA 2F0PA 3S2HB 1II3A 1A3UA 4J6HA 4L8JA 3S1QB 3QOLA 4H7BA 2EY1A 4OIJA 2K5WA 1Y8NB 3RLFA 1SE2A 3FKIB 3D31A 2R7ZB 3I3CA 4J1MA 3HRZC 4ZAIA 3MVVA 2F0SA 5JOBA 4K5VA 5CYUA 4FVMA 2YYZA 2B2TA 2A6HC 4O42A 4EGVA 3NTIA 2O5IC 4R8NA 1B53A 1SDFA 2ICIA 2K1BA 1ICWA 3VR2A 1WCMB 4DAPA 3RZDB 5C3WA 5IIFA 3BS1A 1J9OA 1AN8A 3PMFA 2QILA 2Z4IA 3FPUB 4K5WA 1MSGA 2LS01 5C4XB 2NN6H 2L0CA 5ELDA 1ESRA 1Y69U 3BDLA 2RDFA 4BS9A 3SK6A 1B1ZA 1LTID 4NW2A 2F03A 4A3EB 5CC4A 1D6EC 1A15A 2H4OA 2EYLA 2EYMA 3GTJB 2F0TA 1FR3A 3H6MA 3TN2A 2TSSA 5M3FB 1B9MA 1H9KA 3HZXA 2NN6I 3KUPA 1H9RA 5A35A 2EYFA 3G7LA 2E2HB 4U68A 1CZGA 2BOSA 1M8AA 1SYBA 5IT9E 2Z8LA 5C3EB 3IFDA 3C3LA 1W6KA 1KNEA 5KGUA 2CHBD 1GJXA 3RZOB 4EVOA 5CV5A 5DNFA 4RA8A 1G291 4X3KA 1I4XA 4XQQA 1G2TA 3CU7A 2GA4B 5I2XA 3OSOA 1JQYD 4CJ1B 4ILWA 5EPLA 5C0XJ 1BBXC 1HCZA 5KIXA 1WTQA 1O7LA 5C5LA 5E4WC 1PZJD 2B2YA 3TMEA 2RKSA 2PNRC 2R93B 4BY1B 2BA0A 3R2TA 1STBA 2EXZA 3M85A 1TS4A 1PRTD 1BF4A 5J39A 4CJ0B 1SAPA 1X3QA 2WP8J 5D3IB 2ICEC 1FD7D 3DM1A 1ENCA 4OO1I 4F7XA 1GHJA 3A8KE 1CZWA 5NUCA 4NDXA 5CGKA 1JWUD 2RBMA 1I3QB 2XWBB 1CK1A 4N9TA 5I2YA 4KI0A 4K6LA 5FO8B 3VR6A 2A69C 2E75C 2KVMA 5M5XB 4FNFA 4KJOA 4DGZA 3S16B 1F9QA 2AWNA 1E0BA 1EZ6A 5CBEE 1SEBD 3RMHA 2KUMA 4CKBA 1CTMA 4WFN3 1MGSA 2MPMA 2K7VA 3ITPA 3SXHA 1WTXA 4RHRA 3S9WA 4C3HB 3R8BA 2PYKA 2K32A 2RSOA 3KBXA 4X3TA 3K6OA 5TSSA 3MWYW 1ZYRD 4C56C 3S14B 4RCNA 2NBFA 1HHVA 4RWSC 2XNAC 1TWHB 5EQ0A 2L55A 2K5QA 2CW0C 5JVH3 1G6ZA 1I50B 4HSPA 2NZ1D 2DNEA 1ENFA 1BR9A 2ZXOA 2F1MA 2L11A 1LTTD 3NSWA 1TWAB 1FNUA 2RA4A 4HMJA 2VNUD 4E6IA 4ZRZA 3OMGA 2I07B 2PZUA 3LX0A 2Q8RE 2K01A 2A6HD 1OO9B 4ABNA 4BBSB 2KCNA 1BNZA 1EYAA 3FEWX 1HA5A 5COYA 1A6XA 3DEPA 1F2YA 1DXMA 1FNVA 1S5ED 2KHSA 2EVBA 1BCPF 1EY8A 2KOLA 3R93A 2K33A 2O5JC 4RGTA 3LWEA 5I9OA 1LTAD 2PW5A 2PQEA 5JVG3 2LKVA 2ENBA 4ULLA 3MXUA 1XX8A 3NBIA 2HCCA 4JBWA 1OXSC 1PFNA 1DD2A 3J7AF 2EJFC 3MAQA 1ET6A 3R3OA 1EU4A 5EKIA 4DAVA 4QUFA 3GTQB 4H13C 5KNDA 5CMDA 2X6LA 3DHQA 2EPBA 1KDCA 2OF1A 3ND9A 1HPCA 5FO9B 3EQLC 5KYIA 1LT4D 3VYTA 4KN4C 3X3NA 1ZEQX 3VR5A 1CI3M 2F0GA 2NN6G 4ID6A 1Z47A 4C1NK 1BQQT 3A8JE 4G7OC 3FRPB 2EZVA 1RF2D 2M2LA 4C3IG 3ND8A 3D4RA 4M1UB 5DM63 1BCPC 2EJMA 5JPNC 2DY8A 1WTWA 1EY5A 4XYOA 1DOKA 5BN5A 1RDPD 1JCKB 5DM73 1MBYA 5E4XA 4Z9CB 1D5MC 1SYDA 1SYGA 5EKKA 5EPKA 1EY4A 5J22A 1IKLA 2K28A 2KA7A 1KAAA 1Y8PB 1XYIA 4R8IA 1NR2A 3I90A 4XT1B 1T5XD 1HRJA 4FXGC 1R4QB 1RTNA 2K04A 2A68C 5C5MA 2B63B 2VB3X 2D9UA 3L9AX 1LLRD 4B08A 3NWTA 2J4XA 1YNJC 2H1EA 3H0GB 2A69D 1ET9A 4B9WA 2BDOA 3W3AA 3K5LA 1ENAA 1TY2A 1Z7TA 1HXYD 3PV0A 4HTHA 1S4ZA 4G7HC 1GOZA 1LT3D 3GP7A 3PIO3 5KNBA 3E5SA 4OO1G 3GV6A 1MD2D 1UEAB 3CQZB 2ZXRA 3OOCA 4H44C 3SHLA 1RHPA 3PO2B 3C46A 1XWEA 4JK1C 4RAUC 2A73B 1S5FD 2NB0A 2F0IA 2X6GA 4QF4A 3K59A 3CRLC 2Y0SB 3D8GA 4ZKCB 4YIJA 1JC7A 5ISRA 1S5CD 2QF7A 3HEJA 1TS3A 3T56B 2CW0D 3MEHA 3GV3A 3MTSA 1LV9A 5K36H 5FOBB 1TT2A 5CR3A 5IGEA 3JAML 5D65A 2HCIA 5C4HA 2B2WC 2PZWA 4KTAA 4PMWA 1TR5A 3KLRA 2F0JA 3SK5A 1F2MA 2F4IA 2VXWA 3D6WA 4BA2I 1IHZA 2E2JB 4DFAA 1RKNA 2B8FA 1HTLD 4FF2A 1ONLA 4ODGA 4QUCA 3EJIA 2J7ZA 5EKLA 1VDZA 1O7ZA 4PV1C 1EL0A 3MXPA 4IUTA 1NAPA 1H9SA 1H9MA 4IQZA 1JR0D 3EFXD 3HOYB 2RDGA 1U9RA 4GZYC 3CHBD 3V96A 3OPOA 4BBRB 3KLSA 3D4DA 4EQNA 4Q0FA 2NVXB 3I4LA 5FO7B 3HOZB 2AUKA 3HOUB 4ZLTF 3P20A 4CKCA 1PTOF 5IODA 3OWFA 1ZKOA 3A7AB 4XQJA 5C4JB 5C44B 3URYA 1B44D 3BVZA 4Q5VA 2EY6A 4HMIA 1B4OA 1EFID 1QE6A 2IWHA 1OXTA 1PTOH 2NYZD 4PMBA 1QWYA 4I7ZC 5T1IA 3OIPA 3K58A 2D5DA 4K8JA 3MHBA 4C3JG 3C1FA 1HQRD 2CVRA 4F8MA 4K5XA 5CV6A 1K8MA 1EZ8A 3TBIB 1HTPA 2MUYA 1A2TA 3Q6SA 3JAME 5JEAH 2JA6B 1BCPD 1PYWD 5ELBA 1AZQA 2EYPA 1L0YB 2KQ3A 3VR4A 2NVQB 2OEOA 2LFNA 2F0UA 5EBDA 4PNYA 2A5HA 4TKOB 1SMYC 3QG1A 3QO2A 4MN3A 2ZT9C 4FP5D 3Q0AA 1DM0B 2NTTA 2RSNA 1WD0A 2EDGA 4KY6A 2A68D 1PRTB 2NUCA 5CV8A 1PTOC 1O78A 3Q24A 4NKLA 2VUMB 5M5YB 3GTOB 4RH6A 4L6TB 2MHVA 1C48A 1YNJD 1WVLA 4FF4A 2R61A 3V2TA 1F2LA 1SSOA 4OO1H 1L0XB 3T4AC 3PUZA 3A7LA 4F87A 3P75A 1B9NA 3VR3A 1G8ZD 1FNWA 2O2LD 4G57A 1F9PA 1JB3A 4HN7A 3J7YW 2EY5A 4M8AA 3PUVA 5CV7A 3D4WA 3VA7A 1PXUA 1IKMA 1F77A 3K7AB 2CQAA 1V1PA 1EEID 3C2PA 1Z6HA 1YNNC 2IX0A 1SJED 5LL6X 4CHTB 4KMUC 2B2WA 3S17B 3K5NA 3NBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EJI A;  2F0S A;  3MVV A;  4B9W A;  5EKL A;  1EY9 A;  1KDB A;  3OSO A;  2F0U A;  1EYC A;  4K2L A;  3NQT A;  4K8I A;  4PNY A;  4WOR A;  5CV4 A;  1NUC A;  1ENA A;  1JOK A;  3MZ5 A;  4K5V A;  4EQP A;  4PMC A;  2PZT A;  3R3O A;  4ZQ3 A;  3TP5 A;  5C6A A;  1SYE A;  4RKB A;  3MXP A;  5KIX A;  4KV6 A;  2F0O A;  2SOB A;  4B9X A;  3NP8 A;  1STH A;  1SNO A;  4HTH A;  4R8N A;  5C5L A;  1SNC A;  1NSN S;  2O4X A;  4IZ8 A;  3DHQ A;  3E5S A;  3SR1 A;  1KDC A;  3TME A;  2F3V A;  1JOR A;  2RKS A;  2OF1 A;  2F0H A;  1STG A;  2F0Q A;  1U9R A;  1STN A;  5IGG A;  4ME5 A;  3BDC A;  2F0M A;  5EGT A;  5I6W A;  3ERO A;  5C3W A;  5IIF A;  5KYI A;  4KY6 A;  3TP8 A;  1STB A;  3PMF A;  2NUC A;  5F2D A;  5KEE A;  5CV8 A;  5DEH A;  3SHL A;  2EXZ A;  3D4D A;  2SNS A;  4EQN A;  4K5W A;  4RKL A;  4NKL A;  2F0G A;  5KRU A;  2EYJ A;  1SYF A;  3T13 A;  1EY6 A;  1F2Z A;  1EQV A;  1AEX A;  4ID6 A;  4S3S A;  5J39 A;  1TQO A;  1STY A;  2EYH A;  3NXW A;  5HGT A;  2F0N A;  1SNP A;  1A3V A;  4I65 A;  4EQO A;  1SYC A;  1STA A;  2F0I A;  3BDL A;  2RDF A;  4HMJ A;  4QF4 A;  5JOB A;  4E6I A;  4F7X A;  4IUN A;  5M9O A;  1ENC A;  3SK6 A;  5C3X A;  2SNM A;  3OMG A;  4K2K A;  4QMG A;  1JOO A;  5NUC A;  1EY7 A;  4NMZ A;  4IAL A;  4ZUJ A;  2PZU A;  2F0W A;  3V2T A;  5I9P A;  5IGC A;  3D8G A;  3LX0 A;  4YIJ A;  3TP7 A;  3U9O A;  5CC4 A;  4NDX A;  5CGK A;  4KY5 A;  5IOD A;  3OWF A;  2RBM A;  2F0E A;  1EY0 A;  2EYL A;  4TRD A;  4DF7 A;  2QDB A;  2EYM A;  1EYD A;  3RUZ A;  2F3W A;  5ISR A;  4KJN A;  2F0T A;  3H6M A;  3HEJ A;  1EY5 A;  3P75 A;  3QB3 A;  4N9P A;  4N9T A;  2EY6 A;  3HZX A;  4HMI A;  1EYA A;  3MEH A;  5I9O A;  4G57 A;  2F0F A;  3TP6 A;  4KHV A;  2EY2 A;  3C1E A;  3SK4 A;  2EYF A;  4KD3 A;  2F0V A;  5DAU A;  3D6C A;  1JOQ A;  3QOJ A;  3VA5 A;  2EY5 A;  1F2Y A;  4PMB A;  2KHS A;  4KD4 A;  4KJO A;  1SYD A;  1SYG A;  3D4W A;  1SYB A;  1EY4 A;  1TT2 A;  3NK9 A;  4QB4 A;  5CV7 A;  1KAA A;  5EKK A;  4DGZ A;  5IGD A;  3OMC A;  1EY8 A;  4DU9 A;  2WAC A;  5K5P A;  1SNM A;  2HQE A;  5CR3 A;  5J22 A;  5IGE A;  4LAA A;  5I6Y A;  2F0P A;  2PW7 A;  3NHH A;  5C4H A;  4K14 A;  2F0L A;  5E3F A;  4K8J A;  4MIU A;  1SND A;  3MHB A;  1II3 A;  1EZ6 A;  2PZW A;  1A3U A;  3C1F A;  1TR5 A;  4KTA A;  5CV9 A;  2F0D A;  4F8M A;  1A3T A;  4J6H A;  5KGU A;  4K5X A;  1KDA A;  2F0J A;  1KAB A;  3SK5 A;  3QOL A;  3T16 A;  5C4Z A;  5CV6 A;  4H7B A;  1F2M A;  5IGB A;  1EZ8 A;  3ITP A;  4NP5 A;  2EY1 A;  3P1H A;  5C5M A;  2PW5 A;  2PQE A;  2F0K A;  2LKV A;  3SXH A;  4EVO A;  2ENB A;  1A2T A;  5HUR A;  5IGF A;  1A2U A;  5IOC A;  1IHZ A;  3S9W A;  1SNQ A;  2M00 A;  5CV5 A;  4K6D A;  4WRD A;  3DMU A;  2OXP A;  5E1F A;  2PYK A;  4KY7 A;  4ZUI A;  2EYP A;  3SK8 A;  4OL7 A;  3EVQ A;  2EYO A;  4DFA A;  1RKN A;  2KQ3 A;  3ERQ A;  3NUC A;  4ODG A;  5KYL A;  4J1M A;  2OEO A;  5J1Z A;  5JAV A; 
#chains in the Genus database with same CATH topology
 5JPM C;  1ZXT A;  2C5C A;  1EY9 A;  4P74 A;  3GD7 A;  3ULJ A;  4DV1 Q;  3S24 A;  5CV4 A;  1UNS A;  4DUZ Q;  5D3D A;  3SGI A;  4A3G B;  1VQI A;  4DXF A;  4POG A;  2UUB L;  1RTO A;  1B2T A;  2HT1 A;  1PH9 A;  2WAQ G;  4DUY Q;  2QKI C;  1QCB D;  3BVM A;  3V05 A;  4ME5 A;  1XTC D;  3K5M A;  4BY7 H;  3BYY B;  1CQF A;  1PH5 A;  1HZC A;  2K05 A;  1AFP A;  1GUW A;  4A3M B;  1EFW A;  1SYF A;  3A0J A;  2NVY H;  1X56 A;  2E74 C;  2WB1 E;  3CRK C;  1D5X C;  1WJJ A;  1XXG A;  1IW7 C;  3CKI B;  4LW1 A;  4MNO A;  1N8R C;  2N55 A;  2FFK B;  2KEN A;  3J7Z C;  4LUV A;  2SNM A;  1WTV A;  2Z1C A;  4IFD I;  4NMZ A;  4XIG S;  4ZUJ A;  4BXX G;  2F0W A;  4GKJ Q;  2IY5 B;  3GTG H;  1VMC A;  5T1G A;  1N36 L;  4J15 A;  4DK3 C;  1H9J A;  3I4M H;  4HIM A;  3E0J A;  4L5Q A;  2ZXP A;  2UUC L;  1D7Q A;  1K83 H;  3KK7 A;  2F0F A;  4A3K B;  2ASB A;  4KHV A;  2IHE A;  4TSS A;  1NCV A;  2A74 C;  5K36 G;  2L5T A;  3STB D;  2JYO A;  3PO3 H;  3H09 A;  4P72 A;  3F8T A;  1DOL A;  3NTH A;  3E6Z X;  4KKT A;  1YI2 A;  3HOW G;  4B3R L;  4X3U A;  4LAA A;  4JI3 Q;  2L15 A;  2JP1 A;  2QEJ C;  4JI0 L;  3S2H H;  1QVC A;  4DA2 A;  2F0D A;  4DAY A;  1B3Q A;  4GLA C;  1DOM A;  4AH6 A;  1BDO A;  1TS2 A;  1W6J A;  1N9W A;  2F0K A;  4YCV A;  1KLU D;  3QWN A;  2R3Z A;  3CAM A;  3QR8 A;  3J80 L;  4G7Z C;  3A55 A;  3FKI H;  1C7Y A;  4KY7 A;  4OL7 A;  4X62 L;  2R7Z H;  3NEN A;  2BA1 A;  4JPB W;  1HUN A;  4UDU C;  1NR4 A;  4JBK A;  4BWG B;  1GUS A;  2V1C C;  5JAV A;  1S5B D;  1C8C A;  2J0T D;  2R92 B;  2UUB Q;  1BOS A;  5E7N A;  1GUO A;  3HOV B;  4R4Q A;  1BVS A;  1IYJ B;  4HID A;  1I4Q A;  2B2U C;  4L5R C;  3H91 A;  2B3G A;  4QJF A;  4PZ7 A;  2BCO A;  4TVA B;  3I4N G;  4LF5 L;  3ZJY C;  2JA7 G;  2F0Q A;  3UI2 A;  5IGG A;  5EGT A;  1WCM H;  3S1R H;  3RZD H;  5FLX L;  3SE0 A;  1V43 A;  3KLS X;  1EU3 A;  1G6P A;  3I72 A;  3ULL A;  2PMZ E;  1Q90 A;  2VB2 X;  1F9S A;  2WB1 B;  1STY A;  3FHW A;  5C4X H;  2EYH A;  4RGO S;  3S1N B;  3M7N A;  2HIV A;  1Q1E A;  5GQO A;  1WTO A;  4EQO A;  1SYC A;  3S2D B;  1HFN A;  1FGU A;  4HJ8 A;  1V8Q A;  3GO5 A;  2JA5 G;  3S1M B;  1BKB A;  2MJ8 A;  3E3X A;  1NMG A;  1K3R A;  1EY7 A;  1QJO A;  1N36 Q;  4C3I B;  1I6H B;  4A3E H;  1UEB A;  3U9S A;  3A56 A;  4B3S L;  4O0A A;  1SMY D;  4OON A;  2E76 C;  2QCP X;  1I4P A;  5M5W B;  2UUC Q;  3GTJ H;  1NTG A;  2YU9 B;  1GUG A;  1R9T B;  2RDH A;  3BDO A;  2Q2H A;  4J8Q A;  1HFG A;  3F2D A;  4UP9 A;  3J7A V;  2JA8 B;  5DAU A;  4AYB G;  2E2H H;  3CCM A;  1PTO D;  4A3J B;  4JI0 Q;  1B70 B;  3M4Q A;  1SNM A;  4XT3 B;  1VCI A;  2PW7 A;  5C3E H;  3O13 A;  1TWG B;  1AE3 A;  3QJY A;  4B3M L;  1SND A;  1PZK D;  3IRB A;  1VF5 C;  2NZO A;  3UE0 A;  1RCV D;  3GTP B;  4DK1 A;  1OTC A;  1NE3 A;  2CFM A;  5JEA G;  4A3B B;  3RZO H;  2Q2U A;  3QIA A;  2ZTC A;  1LTR D;  4ZYS A;  3SK8 A;  4JG2 A;  3M7G A;  5ELF A;  2MFI A;  1VQL A;  3HOX G;  5LHY 1;  1V9P A;  3H3V I;  5IE8 A;  1AW7 A;  3IFT A;  4OWT B;  5CBA E;  3J80 E;  1IYV A;  4A3I G;  1KDB A;  2AQ2 B;  1PDQ A;  2D62 A;  1EYC A;  2RQX A;  3WOF A;  2FIN B;  2IJ0 A;  3D0F A;  1RJT A;  4DNR B;  4KK7 A;  4PMC A;  1EOV A;  4LF5 Q;  1LM0 A;  1SYE A;  3HP3 A;  2UXD L;  5EJW A;  1HH2 P;  1EQT A;  3J81 L;  1UWV A;  2LMC B;  2OQK A;  1K8G A;  4GLV B;  3SR1 A;  3BZC A;  2F0H A;  1QNK A;  3JC6 6;  5LMN W;  5FK9 C;  2HQL A;  1RIP A;  2R93 H;  4HR7 B;  3Q23 A;  3OW2 A;  4LF4 L;  1S40 A;  5F2D A;  4HED A;  3X3M A;  1YNN D;  3N6R A;  2PMZ B;  4YWL A;  1EY6 A;  3U4Z A;  4GLX A;  3TSS A;  3M4O B;  4PG3 A;  5FLX E;  4HCS A;  1A3V A;  3W2D A;  4AQY L;  5G3L F;  3KJP A;  2RVL A;  4L63 B;  1G91 A;  4DKA C;  2A6E C;  4DV7 L;  1JWM D;  2F0E A;  1O7Y A;  1I3Q H;  2IL8 A;  1Q7Y C;  3HG9 A;  1YJ9 A;  4A3F B;  4LF8 L;  4HIK A;  1CA6 A;  1VQ6 A;  3SK4 A;  3LGJ A;  4UAI A;  3D6C A;  1L1O C;  1QOH A;  4B3M Q;  4YHH L;  1ILQ A;  1E3P A;  3GQB A;  1IW7 D;  1TVX A;  3PUY A;  1PZI D;  1JE5 A;  5CV9 A;  1FYC A;  3VYU A;  3K5O A;  4IOC A;  4RGN A;  4O1N A;  4V19 0;  2SDF A;  5IP7 G;  4XYQ A;  5HUR A;  4OWX B;  4Y52 H;  2I46 A;  5J3B A;  1SNQ A;  1TY0 A;  4K6D A;  4R1J A;  1IL8 A;  4C3H H;  4MHE A;  1U4P A;  3FMC A;  2XTI A;  4ZUI A;  2EYO A;  1TII D;  4F88 A;  3KOJ A;  3RNU A;  3AQQ A;  2LY7 A;  2L4N A;  2NVT H;  1R4P B;  1CHQ D;  5EBC A;  1SN8 A;  3S14 H;  2LXJ A;  1JJ2 A;  4QQB X;  4DV5 Q;  2G9D A;  4B9X A;  1TWH H;  1STH A;  4LJZ C;  4IZ8 A;  1CA5 A;  3PUX A;  2YV5 A;  1CKN B;  4DK6 C;  1MSH A;  4IFD G;  4IUR A;  3UE1 A;  1QNU A;  4BY7 G;  1TWC B;  1I50 H;  4CDF C;  1PH3 A;  2VS1 A;  4WJW A;  3J81 E;  2B2U A;  1H9S B;  4A93 G;  2D0O A;  3KF6 B;  3OHX C;  3N52 A;  1KTK A;  2EYJ A;  3W5O A;  4AQY Q;  3WOE A;  1SXT A;  2IX1 A;  3BVG A;  2F0N A;  4IUV A;  1TWA H;  2AQ1 B;  4KN7 C;  3CC4 A;  2VY3 A;  3KF6 A;  3KF8 A;  4RCO A;  4QGU A;  4DV7 Q;  4DR3 Q;  3MA2 B;  1B3A A;  4CGY B;  4QMG A;  1JOO A;  4DN4 M;  3SDZ A;  1G2S A;  3K0Y A;  5ELE A;  4G4K A;  1EY0 A;  4OHJ A;  3I4M G;  1KQS A;  2UXB L;  5M3M B;  4KKS A;  4KJN A;  3QB3 A;  3HGB A;  4C2M B;  2IT1 A;  4LF8 Q;  4BBS H;  1LTS D;  1CKO A;  4JI4 L;  1Y1W G;  2OTJ A;  3GTM B;  4YHH Q;  1DZ1 A;  3QOJ A;  3PO3 G;  3NWS A;  2RHQ B;  5ELC A;  1DGS A;  2N78 A;  3NE5 B;  4RHS A;  4R4C A;  4LF6 L;  5C0X H;  4YCW A;  2OCE A;  4FF1 A;  4NPS A;  5I6Y A;  1Q82 C;  1CHP D;  1GHK A;  1KNA A;  4K14 A;  2F0L A;  4Y7N H;  5C3X A;  5HGQ A;  2UU9 L;  4C3J B;  3TDQ A;  3ULP A;  1BCP B;  4DV3 Q;  4NP5 A;  1X3P A;  2L12 A;  1F9R A;  2AUJ D;  3DEO A;  3FKI G;  2VQF Q;  1I4H A;  3DMU A;  2OXP A;  1K28 A;  2R7Z G;  1JB7 A;  5C0X I;  3TZD A;  3S1R B;  4FO2 A;  2AWO A;  3HKZ E;  2B39 A;  4A3D B;  3S15 B;  4GN4 B;  3HFZ B;  1QIL A;  5J1Z A;  3BZD B;  1CKM A;  1OXU A;  4K2L A;  4WOR A;  2I5H A;  1E24 A;  2HDL A;  2K50 A;  3PUW A;  3NP8 A;  4FF3 A;  3GTQ H;  4X66 Q;  1K8O A;  2Z4H A;  4LF7 L;  3T53 B;  3GTL B;  2F3V A;  2KJX A;  2WAQ E;  2ZTE A;  1B50 A;  1STG A;  2XRQ D;  1WCM G;  1A63 A;  2KEE A;  2DY7 A;  2PQA B;  2ES2 A;  5I6W A;  1CSQ A;  1E7Z A;  3ONA B;  5JJZ A;  3HKS A;  1DON A;  2B8G A;  1X3F A;  1X65 A;  1QVF A;  3R2I A;  4CDE C;  2SNS A;  3DM3 A;  4X64 L;  4YCU A;  3FVQ A;  4ZKB B;  1I6V C;  1N33 Q;  5C4X G;  4ME3 A;  1F2Z A;  3IL8 A;  3FDT A;  2DNC A;  4A3I H;  3G4S A;  1GD7 A;  3NXW A;  1PLF A;  4QIW E;  1DJR D;  1SE4 A;  5HGT A;  1SNP A;  4JOI C;  1D5Z C;  4DV4 Q;  1IBK Q;  1STA A;  1PH4 A;  4IUN A;  3DWQ A;  2LXK A;  3J7A 5;  4A3E G;  4DK0 A;  5IWA Q;  4QCL A;  3BYT B;  3I91 A;  3TP7 A;  1ICF B;  4DF7 A;  1G51 A;  2Q8I B;  4JI4 Q;  5M3F G;  2K5N A;  4N9P A;  3I55 A;  3BU2 A;  3EA6 A;  2PCF B;  1C9O A;  2TMP A;  2D0P A;  2XRS D;  3IKJ A;  1KLG D;  4KD3 A;  3VA5 A;  4CJ2 C;  4MZ9 A;  4MTN A;  4KD4 A;  3NK9 A;  2F3I A;  4IPG A;  4JI2 Q;  5C3E G;  1VQA A;  4FXD A;  2HQE A;  3OTO L;  1O80 A;  1TS5 A;  4UHV A;  1U5K A;  5I9P A;  3U9O A;  1TU2 B;  1Q8K A;  1KDA A;  3CC7 A;  1L1O A;  1LT6 D;  3B6Y A;  5C4Z A;  1CUK A;  3P1H A;  3VYS A;  2A6E D;  1Y1V B;  4LK1 C;  2K14 A;  3MXG A;  4HSV A;  3ZYY X;  3EVQ A;  1EEF D;  2KEC A;  3HKZ B;  1PFM A;  1V1P B;  3MFY A;  1EWI A;  3H0G H;  1YJN A;  3G6J B;  4K8I A;  1VQ9 A;  4JI8 L;  1JOK A;  2DJG C;  2JE6 I;  4RKB A;  3BG3 A;  1RL2 A;  2B2V C;  4DNT B;  2SOB A;  2WKD A;  1HUM A;  1NSN S;  1SNC A;  2O4X A;  5LMU L;  4QL5 A;  2R93 G;  2ZM6 L;  2WAQ B;  4BY1 G;  3AB9 A;  1CQV A;  4C1N I;  3A5Z B;  4LUZ A;  3I56 A;  3BDC A;  3GTK B;  4IPC A;  1TWF B;  3CQZ H;  4RFB A;  4A3L H;  2N8N A;  5JEA J;  2RHS B;  5DEH A;  3MXN A;  5KRU A;  4RKL A;  1GKH A;  3UDI A;  5I4D A;  3HS0 C;  2JSO A;  4HCE A;  4S3S A;  3PO2 H;  1E2V A;  5A2Q L;  4KKU A;  3I8Z A;  4WJ4 A;  4QIW B;  4ZK9 B;  1T5E A;  4LNQ A;  1I4G A;  2PO4 A;  1FGB D;  1L2F A;  2AQ3 B;  2EJG C;  3CPF A;  4OWW B;  1QB5 D;  2OTL A;  3D3R A;  1QG7 A;  4X65 L;  4IFD H;  1E2Z A;  1HZA A;  2QDB A;  4FYD A;  2L9H A;  1BO0 A;  1WI5 A;  5BN3 A;  2BH8 A;  1UAP A;  4JI1 Q;  1WTR A;  1QZG A;  3I73 A;  1IYU A;  2MO1 A;  5IP9 H;  1HA6 A;  3FPP A;  4A93 H;  5GAG C;  2CKZ B;  3MFG A;  5G3L D;  5IY0 A;  4BA1 I;  1EIY B;  5AJ3 Q;  2FJ2 A;  1U4R A;  3RLN A;  3J80 i;  4DR1 Q;  2V4D A;  4AYB E;  4IUP A;  3OTO Q;  1Q3L A;  1CM9 A;  1LTB D;  4QB4 A;  3TS2 A;  1AH9 A;  1EWC A;  1VQJ A;  5K5P A;  4U67 3;  5AFW A;  3HOW B;  2NVT B;  1JJG A;  1FJG Q;  1DYQ A;  5EPJ A;  1EQQ A;  2OWO A;  1ASZ A;  1LAB A;  2IW3 A;  1PA6 A;  1LTG D;  4P75 A;  1ESF A;  1PFB A;  1A3T A;  2IPK D;  5ELN A;  2BE5 C;  1N34 L;  1BXT A;  3T16 A;  5IGB A;  2N88 A;  4L5T A;  1SJH D;  1HNX Q;  3UDF A;  4DPG A;  1W2B A;  4DV2 L;  1Y1W H;  2JEB I;  1DCZ A;  4C3H G;  3KYH C;  5E1F A;  4HJA A;  2E2J H;  4K0K L;  1NMF A;  4X3S A;  4DAY B;  1PMR A;  2E2I H;  3ERQ A;  3SVM A;  3NUC A;  4JI8 Q;  4XXE A;  2JEA I;  1AZP A;  4CDC C;  3U58 A;  2NTS A;  1LT5 D;  3H94 A;  3RLO A;  2PZT A;  3LNN A;  3S1Q H;  1D1K A;  2R6G A;  1I94 Q;  1UUP A;  1VQE A;  3I4N B;  1U4L A;  2XN9 C;  3DUZ A;  1E22 A;  2JA7 B;  3HOY H;  1STN A;  3OIQ A;  2G9H D;  2X69 A;  3TEH B;  2JXM B;  3T51 B;  5D14 A;  3M3Y B;  4BBR H;  1YEZ A;  1WD1 A;  4R9W A;  1HQM C;  4KLK A;  2ZJQ A;  2M9V A;  1TKW B;  1TQO A;  5COR A;  2Z0S A;  4I65 A;  3M4Y A;  1VQM A;  4PZ6 A;  3PF5 A;  4XDX A;  4X65 Q;  1I4R A;  2R7F A;  3HOZ H;  3F2U A;  2JA5 B;  1M4V A;  3RN5 A;  3HOU H;  1LO5 D;  4HAE A;  5A2Q E;  4TRD A;  4Y7N B;  2AMC B;  1EOT A;  1EWH A;  2F3W A;  4BBS G;  2MP1 A;  4N8F A;  3T1Y L;  2XIW A;  1B7Y B;  3TQY A;  1EIF A;  4JOI A;  4LMQ D;  4DV0 L;  1VQC A;  4IFD J;  3F1Z A;  1NBW A;  3PGZ A;  1PTO B;  1GXD C;  4XTC S;  2F0V A;  4R4I A;  3E0E A;  2KHI A;  4IUQ A;  4AYB B;  3CME A;  5C0X G;  1SE3 A;  5IGD A;  3NTK A;  3RR5 A;  1VQH A;  2N3S A;  4H02 A;  3RN2 A;  1N34 Q;  5E3F A;  1EIG A;  4MIU A;  3BZK A;  1UE1 A;  1VQK A;  4JYA L;  5M3F H;  2WIN B;  3CCE A;  1STE A;  4H0L C;  1VMP A;  1A2U A;  3J81 i;  3T1H L;  4K0K Q;  1PHJ A;  2JA6 H;  4WRD A;  2B2T C;  1GUN A;  2Q8T A;  2E2D C;  4B3R Q;  1Q1B A;  1OXX K;  1RD9 D;  3DWA A;  1KC8 C;  1X32 A;  4DR4 L;  2XSC A;  3HOX B;  4JI6 L;  3K57 A;  3Q22 A;  1HNZ L;  1HR0 W;  1YIT A;  2ZJR A;  1XMO L;  2NVQ H;  2B29 A;  3H3V H;  1J5E L;  4A3I B;  3AMU A;  3K80 C;  3MZ5 A;  1VQ8 A;  4ZQ3 A;  2K52 A;  3TP5 A;  4KV6 A;  1PRT F;  1Q46 A;  2K75 A;  1CT1 D;  2K5V A;  3UDG A;  4FXK C;  4X62 Q;  2ID0 A;  4UP7 A;  2XGT A;  4IJL A;  4IN3 A;  2F0M A;  2KCC A;  1ML0 D;  3P7J A;  2HDM A;  2K6A A;  3IAY A;  5LL6 S;  5KEE A;  4XQN A;  2B2V A;  2BDN A;  1MI2 A;  3SEB A;  2MGS A;  3T13 A;  2N49 A;  3GTO H;  2LSS A;  1Q86 C;  3VYR A;  1JMC A;  1AP0 A;  2MNA A;  4LFA L;  2D2C C;  4KHZ A;  1K9M C;  1BUV T;  4K2K A;  4UPA A;  3DXJ C;  1SLJ A;  4IPH A;  5IGC A;  3VDY A;  3KBG A;  2WKC A;  1GM5 A;  2FMC A;  4IUU A;  4KY5 A;  3TZU A;  4BY1 H;  2VW9 A;  1SBB B;  1EYD A;  2Q2T A;  3A54 A;  1VQG A;  2F4V L;  1ROD A;  2C9O A;  2L1B A;  3KLW A;  2IX3 A;  1ILP A;  2SEB D;  2XVS A;  3E9H A;  1U4M A;  3E9I A;  3L3O C;  1J8I A;  2Z9H A;  3W1B A;  4JBJ A;  3J81 j;  3TP6 A;  1P16 A;  3Q8D A;  3RD4 A;  2KBN A;  1YVC A;  5KNC A;  1SMX A;  3H3V C;  2HIX A;  4B3S Q;  1JT8 A;  4GOP C;  3AEV A;  1CFM A;  3PIP 3;  1E2W A;  4DU9 A;  2WAC A;  2Q2I A;  2FMM A;  1MIU A;  3NHH A;  4JYA Q;  4TQU S;  3JAM i;  5DLQ E;  4A3C H;  3L7Z C;  1SFO B;  1KAB A;  1VF7 A;  4P2C B;  2CCZ A;  3NPP A;  5FKA C;  2DGY A;  2B63 G;  3AU7 A;  1KL9 A;  2DN8 A;  5IGF A;  5IOC A;  4JW0 A;  2K03 A;  1KD1 C;  2M00 A;  4DR4 Q;  1PRT C;  2KED A;  4JI6 Q;  4JC0 A;  1EIH A;  1QVG A;  5M5X H;  1V1O A;  1XMO Q;  2EOT A;  3LWU A;  3WDN A;  2B2Y C;  3I4O A;  1J5E Q;  2FHT A;  4DXG A;  2HHH L;  3S17 H;  3H0G G;  2NWG A;  5KYL A;  3S16 H;  4L5S A;  3ERO A;  5JJI A;  2EE1 A;  1IBL L;  1D2B A;  3I70 A;  4OX9 L;  1Y8O B;  3NQT A;  2PPB C;  4EQP A;  1NUC A;  3OWE B;  1JWS D;  4IPD A;  5C6A A;  4PZ8 A;  4GNX C;  2F0O A;  4LFC L;  4A3G H;  1SNO A;  4V0B A;  1PVO A;  1JOR A;  1OXV A;  4BY7 B;  1Q12 A;  4A3L G;  5GRO A;  2BE5 D;  5BN4 A;  3K8A A;  3TP8 A;  3K0X A;  3DLL A;  3CD6 A;  1S72 A;  1LAC A;  3A8I E;  2IHF A;  4A93 B;  2NVY B;  4A3M H;  4LFA Q;  1XJV A;  3PO2 G;  1JIC A;  2UXD Q;  3NQI A;  1EQV A;  1AEX A;  4GKK L;  1S5D D;  2Z6K C;  4RGM A;  4CDD C;  4P71 A;  4JI5 L;  5M9O A;  4OIK A;  4UP8 A;  4HIO A;  4LF4 Q;  4IAL A;  2Y0S G;  3GTG B;  1XNQ L;  3PQI A;  3AYH B;  2WII B;  1IBM L;  3NEL A;  4CKE A;  2XWJ B;  3RUZ A;  2QGQ A;  3MC0 B;  3I4M B;  2I0Q A;  5IP9 G;  1J6Q A;  2CH4 W;  3DWP A;  3OW7 A;  4DR6 L;  1Z9F A;  4HJ7 A;  4NXM L;  1D1I A;  3KF8 B;  1C4Q A;  1K83 B;  5IT9 L;  2HUG A;  1ZYR C;  1Y1W B;  1SE8 A;  1JE4 A;  1KIX A;  2EY2 A;  3C1E A;  3M9B A;  2OT2 A;  4A3K H;  4I7A A;  4OGQ C;  1JOQ A;  4CBV A;  3PO3 B;  4PQX A;  1O7I A;  1GUT A;  2E2I B;  2K5D A;  1Q8I A;  3OMC A;  2WV6 D;  3TRZ A;  1PH7 A;  1WTP A;  2F0P A;  3S2H B;  1II3 A;  3UDX A;  1A3U A;  4J6H A;  4L8J A;  3S1Q B;  3QOL A;  3WWV A;  4H7B A;  2EY1 A;  4OIJ A;  1NNX A;  2K5W A;  1Y8N B;  3RLF A;  1X55 A;  1SE2 A;  3PF4 A;  3FKI B;  2R7D A;  1N32 L;  3D31 A;  1M90 C;  2R7Z B;  4LUO A;  3I3C A;  1IBL Q;  2EQS A;  4OX9 Q;  4J1M A;  3HRZ C;  4ZAI A;  3MVV A;  2F0S A;  1YJW A;  4B3T L;  5JOB A;  4LFC Q;  4K5V A;  5CYU A;  2R92 H;  4FVM A;  2YYZ A;  2B2T A;  2A6H C;  4O42 A;  4YWK A;  4EGV A;  2YTX A;  3NTI A;  2O5I C;  4R8N A;  1B53 A;  1SDF A;  2ICI A;  2K1B A;  3HOY G;  3K7U C;  1ICW A;  1K73 C;  3ERS X;  3VR2 A;  2KHJ A;  1WCM B;  4DAP A;  3RZD B;  2A19 A;  5C3W A;  2YTY A;  4BBR G;  5IIF A;  3BS1 A;  1J9O A;  1VQO A;  1AN8 A;  5BR8 L;  3PMF A;  2QIL A;  4GKK Q;  2Z4I A;  3FPU B;  4P73 A;  4K5W A;  1XNR L;  1MSG A;  4WJ3 M;  2LS0 1;  4JI5 Q;  5GAE C;  2QDL A;  5C4X B;  2NN6 H;  2L0C A;  1VQ4 A;  5ELD A;  3S1N H;  1ESR A;  3HOZ G;  4FDB A;  1Y69 U;  3BDL A;  1XNQ Q;  2RDF A;  4BS9 A;  3S2D H;  1IBM Q;  3HOU G;  3SK6 A;  1B1Z A;  1LTI D;  4NW2 A;  2F03 A;  1YBY A;  3S1M H;  3CCL A;  3L0O A;  4A3E B;  5CC4 A;  1D6E C;  1A15 A;  4DR6 Q;  4C3I H;  1I6H H;  5JJK A;  2H4O A;  2EYL A;  1YIJ A;  1VQ5 A;  5C44 G;  2EYM A;  3GTJ B;  5M5W H;  3MEF A;  3H6M A;  1WFQ A;  2F0T A;  1FR3 A;  2TSS A;  3TN2 A;  5M3F B;  1B9M A;  3W1G A;  2YU9 H;  1H9K A;  3HZX A;  2NN6 I;  3L2P A;  1LUZ A;  3NEM A;  3KUP A;  1H9R A;  1KHI A;  4GS3 A;  5A35 A;  2EYF A;  3G7L A;  2E2H B;  2KCT A;  4U68 A;  1CZG A;  1VS0 A;  3ICE A;  2BOS A;  1M8A A;  1SYB A;  5ELO A;  2KCM A;  5IT9 E;  2Z8L A;  2UXB Q;  4GN3 B;  4A3J H;  2CQO A;  5C3E B;  1NY4 A;  5GAH C;  2UXC L;  3IFD A;  3A5U A;  1TWG H;  3C3L A;  1W6K A;  1KNE A;  5KGU A;  2CWP A;  5GAD C;  2AKW B;  2CHB D;  1GJX A;  4DV1 L;  3RZO B;  4EVO A;  2JA6 G;  4A3B H;  4DUZ L;  4GOP A;  1PH2 A;  1HJP A;  5CV5 A;  1X3G A;  4LF6 Q;  3EBE A;  5DNF A;  4RA8 A;  2JQO A;  1G29 1;  4DR7 L;  3I2Z A;  4X3K A;  1I4X A;  4DUY L;  1KXL A;  1WYD A;  1L1O B;  4XQQ A;  4A75 A;  2UU9 Q;  1G2T A;  3CU7 A;  2GN5 A;  2GA4 B;  5I2X A;  3OSO A;  2JN4 A;  1JQY D;  3PIP A;  4CJ1 B;  4ILW A;  5EPL A;  5C0X J;  1BBX C;  1HCZ A;  5KIX A;  1WTQ A;  4LFB L;  1O7L A;  5C5L A;  5E4W C;  1PZJ D;  3G71 A;  2B2Y A;  2B63 H;  3TME A;  2RKS A;  2ATW A;  5BR8 Q;  2PNR C;  2R93 B;  4BY1 B;  2BA0 A;  2GVB A;  2DUD A;  3R2T A;  1K0S A;  1XNR Q;  4GKJ L;  1HZB A;  1STB A;  3PSI A;  2EXZ A;  3M85 A;  2VUM G;  4N8X 1;  2EXD A;  1ASY A;  1TS4 A;  5IYC H;  1PRT D;  2JJQ A;  1BF4 A;  5J39 A;  4CJ0 B;  1SAP A;  1X3Q A;  4LF7 Q;  1EUJ A;  1MJC A;  2RCF A;  1IZ6 A;  2WP8 J;  5D3I B;  3M4O H;  2ICE C;  1FD7 D;  3DM1 A;  3EIV A;  2QEX A;  1ENC A;  4OO1 I;  4F7X A;  1GHJ A;  3A8K E;  1CZW A;  3MXN B;  5NUC A;  4JV5 L;  4NDX A;  5CGK A;  1JWU D;  2UUA L;  2RBM A;  4X64 Q;  1I3Q B;  2XWB B;  3A74 A;  1S3O A;  2Z6K A;  4JI3 L;  4YWM A;  1CK1 A;  4N9T A;  2I5L X;  5I2Y A;  4DV6 L;  4KI0 A;  4K6L A;  5FO8 B;  3VR6 A;  1GO3 E;  3CF5 A;  4A3F H;  2A69 C;  2E75 C;  2KVM A;  3KFU A;  1WTH A;  5M5X B;  4FNF A;  4KJO A;  1YNX A;  4DGZ A;  3S16 B;  1F9Q A;  2OQ0 A;  1XPO A;  2AWN A;  4A3C G;  1D8L A;  1E0B A;  1EZ6 A;  1SEB D;  5CBE E;  1FVI A;  3RMH A;  2A8V A;  2NZH A;  2KUM A;  4CKB A;  1CTM A;  4WFN 3;  1MGS A;  2MPM A;  2K7V A;  3ITP A;  3OYY A;  3CCR A;  2RCN A;  3SXH A;  1WTX A;  4IJH A;  4RHR A;  3S9W A;  4C3H B;  4DR7 Q;  2MO0 A;  2PI2 A;  3R8B A;  2PYK A;  2K32 A;  3CCS A;  2RSO A;  3KBX A;  4X3T A;  4JBM A;  3K6O A;  5TSS A;  3MWY W;  1ZYR D;  4C56 C;  3S14 B;  1SR3 A;  4RCN A;  4LFB Q;  2NBF A;  1HHV A;  1M1K C;  4POF A;  1SRO A;  4RWS C;  2XNA C;  3M4P A;  4A3G G;  1HNW L;  1TWH B;  3U4V A;  5EQ0 A;  3CMA A;  2L55 A;  2K5Q A;  2CW0 C;  1NJI C;  5JVH 3;  1VQN A;  3KDF B;  1G6Z A;  1I50 B;  4HSP A;  2NZ1 D;  2DNE A;  1ENF A;  1BR9 A;  1TWC H;  3JAM c;  2ZXO A;  2F1M A;  4A3M G;  3KDF A;  3I7F A;  1P8L A;  1YHA A;  2L11 A;  1LTT D;  5IT9 c;  2ALY B;  3G6E A;  2JK8 A;  3NSW A;  4OXP A;  4ALP A;  5LMU Q;  1TWA B;  1FNU A;  2RA4 A;  2ZM6 Q;  4JV5 Q;  4HMJ A;  2VNU D;  4E6I A;  4ZRZ A;  2UUA Q;  3OMG A;  1YHB A;  2I07 B;  2PZU A;  1IL2 A;  1VQB A;  3LX0 A;  3CC2 A;  2Q8R E;  2K01 A;  2A6H D;  1OO9 B;  4HJ5 A;  4ABN A;  4DV6 Q;  1VQF A;  4BBS B;  1KRS A;  5M3M H;  2KCN A;  4C2M H;  1BNZ A;  1EYA A;  3FEW X;  3CCU A;  1HA5 A;  4A3K G;  1FL0 A;  5COY A;  2NVX H;  1VQD A;  5EAY A;  1A6X A;  2E5L L;  1XPU A;  1KAW A;  1X3E A;  3DEP A;  3GTM H;  1F2Y A;  1DXM A;  1FNV A;  1S5E D;  2KHS A;  2EVB A;  1BCP F;  1JJC B;  1EY8 A;  1BBU A;  2I5M X;  1XMQ L;  2KOL A;  3CW2 C;  3R93 A;  4ZCK A;  2K33 A;  5C44 H;  5C4J H;  1VQ7 A;  2O5J C;  4C3J H;  4RGT A;  3LWE A;  4EX5 A;  5I9O A;  1LTA D;  2PW5 A;  2PQE A;  5JVG 3;  2LKV A;  2ENB A;  1E1T A;  3F2B A;  1PH6 A;  4ULL A;  3MXU A;  1XX8 A;  3FP9 A;  3NBI A;  2HCC A;  4JBW A;  1OXS C;  4A3D H;  1PFN A;  1DD2 A;  3J7A F;  1EYG A;  3S15 H;  2R92 G;  1HNW Q;  5H1S E;  1XTD A;  5FLM H;  2EJF C;  3MAQ A;  4NXN L;  1Y14 B;  1ET6 A;  4DV2 Q;  3HOV G;  3R3O A;  1EU4 A;  5EKI A;  4DAV A;  4QUF A;  2P5Z X;  3GTQ B;  3F2C A;  4H13 C;  5KND A;  5CMD A;  2X6L A;  3DHQ A;  2EPB A;  1KDC A;  2OF1 A;  1PYS B;  3ND9 A;  3GTL H;  1HPC A;  5FO9 B;  3EQL C;  5KYI A;  1I5F A;  1LT4 D;  1V1Q A;  3VYT A;  4KN4 C;  3X3N A;  5FJ8 H;  1ZEQ X;  3CXC A;  3VR5 A;  1CI3 M;  1TXY A;  2F0G A;  4DR2 L;  2NN6 G;  1T9H A;  2WB1 G;  4ID6 A;  2CH4 A;  1Z47 A;  4C1N K;  1BQQ T;  3A8J E;  4A76 A;  4G7O C;  3FRP B;  2EZV A;  1RF2 D;  2M2L A;  5IYD H;  2Y0S E;  4C3I G;  3ND8 A;  3D4R A;  4M1U B;  5DM6 3;  1BCP C;  2EJM A;  5JPN C;  2DY8 A;  1WTW A;  1EY5 A;  4XYO A;  1DOK A;  5BN5 A;  2EIF A;  2E5L Q;  1EQR A;  1LTL A;  5M5Y H;  2VUM H;  1RDP D;  4MTK A;  1MJE A;  2JA8 G;  1JCK B;  5DM7 3;  1MBY A;  5E4X A;  4Z9C B;  1D5M C;  1SYD A;  1SYG A;  5EKK A;  5EPK A;  1EY4 A;  5J22 A;  1IKL A;  2K28 A;  2KA7 A;  1KAA A;  4A3J G;  1Y8P B;  1XMQ Q;  1XYI A;  4R8I A;  3T1Y Q;  1NR2 A;  3I90 A;  4XT1 B;  1T5X D;  1HRJ A;  4DV0 Q;  4FXG C;  1R4Q B;  1RTN A;  2K04 A;  4A3B G;  2A68 C;  5IYB H;  5C5M A;  4DV5 L;  2B63 B;  2VB3 X;  2D9U A;  3L9A X;  1Y1V H;  1UE7 A;  1LLR D;  4B08 A;  3NWT A;  2J4X A;  2QA4 A;  4NXN Q;  1YNJ C;  2H1E A;  3H0G B;  3CCQ A;  2A69 D;  1ET9 A;  4B9W A;  2BDO A;  4DNI A;  3W3A A;  2RF4 A;  3K5L A;  2F52 A;  1ENA A;  1TY2 A;  1Z7T A;  1K8A C;  3K7A H;  1HXY D;  1WOC A;  3T1H Q;  3PV0 A;  4HTH A;  1S4Z A;  4G7H C;  3ER0 A;  1GOZ A;  1LT3 D;  3GP7 A;  4QY7 A;  3PIO 3;  2ZTD A;  5KNB A;  3E5S A;  1C0A A;  4OO1 G;  1A8V A;  3GV6 A;  1MD2 D;  2AHO B;  1UEA B;  1HNZ Q;  4EQ5 A;  4DR3 L;  3CQZ B;  2ZXR A;  3GTK H;  3OOC A;  4H44 C;  4DR2 Q;  4RMF A;  1TWF H;  3SHL A;  1LYL A;  2PNH A;  5IYC G;  1U0L A;  1RHP A;  1K0R A;  3PO2 B;  3C46 A;  1XWE A;  4JK1 C;  4RAU C;  2A73 B;  1S5F D;  2NB0 A;  4LWC A;  4KHP L;  2F0I A;  4LF9 L;  2X6G A;  4QF4 A;  3K59 A;  2YTV A;  3CRL C;  3U50 C;  2Y0S B;  3D8G A;  4ZKC B;  2A1A A;  4YIJ A;  1JC7 A;  4BXX H;  1H95 A;  2MQH A;  4NB3 A;  5ISR A;  3CCV A;  1S5C D;  2QF7 A;  3HEJ A;  1IXR A;  1TS3 A;  3T56 B;  2CW0 D;  1E1O A;  3MEH A;  4A3F G;  4R4T A;  3GV3 A;  3MTS A;  1PYB A;  2H5X A;  1K3B C;  4DV3 L;  4DAM A;  1LV9 A;  1MHW C;  2VQF L;  5K36 H;  5FOB B;  1TT2 A;  3G48 A;  5CR3 A;  5IGE A;  2F4V Q;  3JAM L;  1UE5 A;  5D65 A;  3HOW H;  2HCI A;  5C4H A;  2B2W C;  2PZW A;  4KTA A;  2WFW A;  4PMW A;  1TR5 A;  2Z6B A;  3CCJ A;  3KLR A;  1HR0 L;  2F0J A;  3SK5 A;  1X9N A;  1F2M A;  2F4I A;  2VXW A;  1KRT A;  4UY8 C;  1BBW A;  3D6W A;  4BA2 I;  1IHZ A;  2E2J B;  5JJL A;  3K81 C;  4X66 L;  1XPR A;  4DFA A;  1RKN A;  2B8F A;  1CKN A;  1AE2 A;  1HTL D;  4FF2 A;  1ONL A;  1MKH A;  4ODG A;  4HJ9 A;  4QUC A;  1QUQ B;  3EJI A;  2J7Z A;  5EKL A;  1VDZ A;  1O7Z A;  1Q81 C;  3BJU A;  4PV1 C;  1EL0 A;  3MXP A;  4IUT A;  1NAP A;  2GVA A;  1L0W A;  4OEM B;  2K4K A;  1N33 L;  1H9S A;  1QUQ A;  1H9M A;  4IQZ A;  1JR0 D;  1SRU A;  4YY3 L;  3EFX D;  3HOY B;  3TRE A;  3I4N H;  2RDG A;  2HHH Q;  1U9R A;  4DV4 L;  1IBK L;  4GZY C;  4IO9 A;  2JA7 H;  3CHB D;  3V96 A;  3OPO A;  4A4I A;  4BBR B;  5IWA L;  5LMN L;  3KLS A;  3STB C;  3D4D A;  3M3Y H;  4EQN A;  4Q0F A;  2NVX B;  4KHP Q;  2VQE L;  2VZA A;  4DR5 L;  4LF9 Q;  3I4L A;  3HOV H;  3J80 c;  4JI7 L;  5FO7 B;  5HY6 A;  2VL6 A;  3HOZ B;  2AUK A;  3HOU B;  4ZLT F;  1PFS A;  2JA5 H;  3P20 A;  4CKC A;  1PTO F;  5IOD A;  3OWF A;  1ZKO A;  3A7A B;  2JA9 A;  4XQJ A;  5M3M G;  2ZJP A;  4JI2 L;  5C4J B;  5C44 B;  1HZ9 A;  3URY A;  1B44 D;  3BVZ A;  4Q5V A;  2EY6 A;  4HMI A;  1B4O A;  1EFI D;  1QE6 A;  2IWH A;  3CP0 A;  1OXT A;  3KJO A;  2E8G A;  1PTO H;  2NYZ D;  4PMB A;  2CWA A;  1QWY A;  4I7Z C;  4X6A H;  5T1I A;  3OIP A;  5FLX c;  3K58 A;  4NXM Q;  1HR0 Q;  2D5D A;  4K8J A;  3MHB A;  4C3J G;  3C1F A;  1HQR D;  2CVR A;  4F8M A;  4K5X A;  5CV6 A;  1K8M A;  1EZ8 A;  2HD3 A;  1R9T H;  3TBI B;  1HTP A;  2MUY A;  1CSP A;  1A2T A;  3Q6S A;  3JAM E;  5JEA H;  2JA6 B;  1W3S A;  1BCP D;  1PYW D;  1A0I A;  1YZ6 A;  2JA8 H;  5ELB A;  1AZQ A;  2EYP A;  1L0Y B;  4OEL B;  3AFQ A;  4A3D G;  1B8A A;  2KQ3 A;  3VR4 A;  4RG1 A;  5FLM G;  3HOX H;  2NVQ B;  2OEO A;  1UE6 A;  2LFN A;  4GOP B;  2F0U A;  2PQA A;  4PNY A;  5EBD A;  2A5H A;  2PI2 E;  3TS0 A;  4AIM A;  4TKO B;  1SMY C;  3QG1 A;  4YY3 Q;  3QO2 A;  2BH2 A;  4MN3 A;  3GTP H;  2ZT9 C;  4FP5 D;  3Q0A A;  1N32 Q;  1DM0 B;  2NTT A;  3GDE A;  1A62 A;  2RSN A;  5LMN Q;  5FJ8 G;  1WD0 A;  2EDG A;  4KY6 A;  4B3T Q;  2A68 D;  1PRT B;  2NUC A;  1VQP A;  1QZH A;  5CV8 A;  2VQE Q;  4DR5 Q;  1PTO C;  1O78 A;  3CPW A;  3Q24 A;  4NKL A;  2VUM B;  5M5Y B;  3GTO B;  4JI7 Q;  4JI1 L;  4RH6 A;  4L6T B;  2MHV A;  3AFP A;  5L37 A;  1C48 A;  1X54 A;  1YNJ D;  2C35 B;  5IYD G;  5AJ3 L;  1WVL A;  4FF4 A;  2R61 A;  4DR1 L;  3V2T A;  1PH1 A;  1F2L A;  4GNX B;  1SSO A;  4OO1 H;  1L0X B;  4APV A;  3T4A C;  3PUZ A;  1X6O A;  3PIO A;  3A7L A;  4F87 A;  3P75 A;  1B9N A;  1FJG L;  4GNX A;  3VR3 A;  4R4O A;  1G8Z D;  1FNW A;  2O2L D;  4G57 A;  1F9P A;  4JVZ A;  3PCO B;  1PV4 A;  1JB3 A;  3J81 c;  1GVP A;  1HNX L;  4HN7 A;  3J7Y W;  2EY5 A;  4M8A A;  1YHQ A;  3PUV A;  5CV7 A;  3D4W A;  4IOA A;  3VA7 A;  3EN2 A;  4O2D A;  1PXU A;  2FXQ A;  1IKM A;  1F77 A;  3K7A B;  2DJF C;  3H15 A;  5IYB G;  2CQA A;  1SFO H;  1V1P A;  1EEI D;  2K5H A;  3C2P A;  1Z6H A;  5IP7 H;  1Y1V G;  1YNN C;  2IX0 A;  3NBH B;  1PH8 A;  4JCV E;  1SJE D;  5LL6 X;  2QW7 A;  4CHT B;  1I94 L;  4KMU C;  2B2W A;  2UXC Q;  3S17 B;  3HKZ G;  3K5N A;  2G5D A;  3NBH A;  4GN5 A; 
#chains in the Genus database with same CATH homology
 5JPM C;  1ZXT A;  2C5C A;  1EY9 A;  3GD7 A;  5CV4 A;  1UNS A;  5D3D A;  4A3G B;  4DXF A;  1RTO A;  1B2T A;  2QKI C;  1QCB D;  3BVM A;  3V05 A;  4ME5 A;  1XTC D;  3K5M A;  3BYY B;  1CQF A;  2K05 A;  1AFP A;  1GUW A;  4A3M B;  1SYF A;  3CKI B;  2E74 C;  3CRK C;  1D5X C;  1XXG A;  1IW7 C;  2N55 A;  2FFK B;  2SNM A;  1WTV A;  2Z1C A;  4IFD I;  4NMZ A;  4XIG S;  4ZUJ A;  2F0W A;  1VMC A;  5T1G A;  1H9J A;  3E0J A;  2ZXP A;  3KK7 A;  2F0F A;  4A3K B;  4KHV A;  4TSS A;  1NCV A;  2A74 C;  5K36 G;  2L5T A;  2JYO A;  3H09 A;  1DOL A;  3NTH A;  3E6Z X;  4KKT A;  4X3U A;  4LAA A;  2QEJ C;  2JP1 A;  4DA2 A;  2F0D A;  4DAY A;  1DOM A;  1BDO A;  1TS2 A;  1W6J A;  2F0K A;  1KLU D;  3QWN A;  2R3Z A;  3J80 L;  4G7Z C;  3A55 A;  4KY7 A;  4OL7 A;  2BA1 A;  1HUN A;  4UDU C;  1NR4 A;  4BWG B;  1GUS A;  5JAV A;  1S5B D;  1C8C A;  2J0T D;  2R92 B;  1BOS A;  1GUO A;  3HOV B;  1I4Q A;  2B2U C;  3H91 A;  2BCO A;  2F0Q A;  3UI2 A;  5IGG A;  5EGT A;  5FLX L;  3SE0 A;  1V43 A;  3KLS X;  1EU3 A;  3I72 A;  1Q90 A;  2VB2 X;  1F9S A;  2WB1 B;  1STY A;  2EYH A;  4RGO S;  3S1N B;  3M7N A;  1Q1E A;  1WTO A;  4EQO A;  1SYC A;  3S2D B;  1HFN A;  1V8Q A;  3GO5 A;  3S1M B;  2MJ8 A;  1EY7 A;  1QJO A;  4C3I B;  1I6H B;  3U9S A;  3A56 A;  1SMY D;  5M5W B;  2E76 C;  2QCP X;  1I4P A;  2YU9 B;  1GUG A;  1R9T B;  2RDH A;  3BDO A;  4J8Q A;  1HFG A;  3J7A V;  2JA8 B;  5DAU A;  1PTO D;  4A3J B;  4XT3 B;  1SNM A;  1VCI A;  2PW7 A;  3O13 A;  1TWG B;  3QJY A;  1SND A;  1PZK D;  1VF5 C;  1RCV D;  3GTP B;  4DK1 A;  4A3B B;  5JEA G;  3QIA A;  1LTR D;  4ZYS A;  3SK8 A;  3M7G A;  5ELF A;  5LHY 1;  1AW7 A;  3IFT A;  3J80 E;  5CBA E;  1IYV A;  1KDB A;  2AQ2 B;  1PDQ A;  2D62 A;  1EYC A;  2RQX A;  3WOF A;  2FIN B;  2IJ0 A;  4DNR B;  1RJT A;  4KK7 A;  4PMC A;  1SYE A;  3HP3 A;  5EJW A;  1EQT A;  3J81 L;  2LMC B;  3SR1 A;  2F0H A;  1QNK A;  5FK9 C;  4HR7 B;  3Q23 A;  5F2D A;  4HED A;  3X3M A;  1YNN D;  3N6R A;  2PMZ B;  1EY6 A;  3TSS A;  3M4O B;  5FLX E;  4HCS A;  1A3V A;  3W2D A;  5G3L F;  2RVL A;  4L63 B;  1G91 A;  2A6E C;  1JWM D;  2F0E A;  1O7Y A;  2IL8 A;  3HG9 A;  4A3F B;  1CA6 A;  3SK4 A;  4UAI A;  3D6C A;  1QOH A;  1ILQ A;  3GQB A;  1IW7 D;  1TVX A;  3PUY A;  1PZI D;  5CV9 A;  1FYC A;  3VYU A;  3K5O A;  4RGN A;  4O1N A;  4V19 0;  2SDF A;  4XYQ A;  5HUR A;  2I46 A;  1SNQ A;  1TY0 A;  4K6D A;  1IL8 A;  4MHE A;  1U4P A;  3FMC A;  4ZUI A;  2EYO A;  1TII D;  4F88 A;  2LY7 A;  2L4N A;  1R4P B;  1CHQ D;  5EBC A;  2G9D A;  4B9X A;  1STH A;  4LJZ C;  4IZ8 A;  1CA5 A;  3PUX A;  1MSH A;  4IFD G;  4IUR A;  1QNU A;  1TWC B;  4WJW A;  3J81 E;  2B2U A;  1H9S B;  3OHX C;  3N52 A;  1KTK A;  2EYJ A;  3WOE A;  1SXT A;  2IX1 A;  3BVG A;  2F0N A;  4IUV A;  2AQ1 B;  4KN7 C;  3KF8 A;  4RCO A;  3MA2 B;  1B3A A;  4CGY B;  4QMG A;  1JOO A;  4DN4 M;  3SDZ A;  1G2S A;  3K0Y A;  5ELE A;  4G4K A;  1EY0 A;  4OHJ A;  5M3M B;  4KKS A;  4KJN A;  3QB3 A;  3HGB A;  4C2M B;  2IT1 A;  1LTS D;  3GTM B;  1DZ1 A;  3QOJ A;  3NWS A;  5ELC A;  3NE5 B;  4RHS A;  5C0X H;  4FF1 A;  5I6Y A;  1CHP D;  1GHK A;  1KNA A;  4K14 A;  2F0L A;  5C3X A;  4C3J B;  3TDQ A;  1BCP B;  4NP5 A;  1X3P A;  1F9R A;  2L12 A;  2AUJ D;  3DEO A;  1I4H A;  3DMU A;  2OXP A;  5C0X I;  3TZD A;  3S1R B;  4FO2 A;  2AWO A;  2B39 A;  4A3D B;  3S15 B;  1QIL A;  5J1Z A;  3BZD B;  1OXU A;  4K2L A;  4WOR A;  2HDL A;  3PUW A;  3NP8 A;  4FF3 A;  1K8O A;  2Z4H A;  3T53 B;  3GTL B;  2F3V A;  2KJX A;  1B50 A;  1STG A;  2XRQ D;  2KEE A;  2DY7 A;  5I6W A;  3ONA B;  5JJZ A;  1DON A;  2B8G A;  3R2I A;  2SNS A;  3FVQ A;  4ZKB B;  1I6V C;  1F2Z A;  2DNC A;  3IL8 A;  3FDT A;  3NXW A;  1PLF A;  5HGT A;  1DJR D;  1SE4 A;  1SNP A;  1D5Z C;  1STA A;  4IUN A;  3DWQ A;  4DK0 A;  4QCL A;  3BYT B;  3I91 A;  3TP7 A;  4DF7 A;  2Q8I B;  4N9P A;  3EA6 A;  2PCF B;  2TMP A;  2XRS D;  3IKJ A;  1KLG D;  4KD3 A;  3VA5 A;  4CJ2 C;  4KD4 A;  3NK9 A;  4FXD A;  2HQE A;  1O80 A;  1TS5 A;  5I9P A;  3U9O A;  1TU2 B;  1KDA A;  1LT6 D;  5C4Z A;  3P1H A;  3VYS A;  2A6E D;  1Y1V B;  4LK1 C;  3MXG A;  4HSV A;  3ZYY X;  3EVQ A;  1EEF D;  2KEC A;  3HKZ B;  1PFM A;  1V1P B;  3MFY A;  3G6J B;  4K8I A;  1JOK A;  2JE6 I;  4RKB A;  3BG3 A;  2B2V C;  4DNT B;  2SOB A;  2WKD A;  1HUM A;  1NSN S;  1SNC A;  2O4X A;  2WAQ B;  3AB9 A;  1CQV A;  4C1N I;  3BDC A;  3GTK B;  1TWF B;  4RFB A;  5JEA J;  5DEH A;  3MXN A;  5KRU A;  4RKL A;  5I4D A;  3HS0 C;  2JSO A;  4HCE A;  4S3S A;  1E2V A;  5A2Q L;  4KKU A;  3I8Z A;  4QIW B;  4ZK9 B;  1T5E A;  1I4G A;  2PO4 A;  1FGB D;  2AQ3 B;  2EJG C;  1QB5 D;  3D3R A;  1QG7 A;  4IFD H;  1E2Z A;  2QDB A;  4FYD A;  2L9H A;  1BO0 A;  5BN3 A;  1WTR A;  1UAP A;  3I73 A;  1IYU A;  1HA6 A;  3FPP A;  3MFG A;  5G3L D;  4BA1 I;  2FJ2 A;  1U4R A;  2V4D A;  4IUP A;  1Q3L A;  1CM9 A;  1LTB D;  4QB4 A;  1EWC A;  5K5P A;  4U67 3;  5AFW A;  3HOW B;  2NVT B;  1DYQ A;  5EPJ A;  1LAB A;  2IW3 A;  1LTG D;  1ESF A;  1PFB A;  1A3T A;  2IPK D;  2BE5 C;  1BXT A;  3T16 A;  5IGB A;  2N88 A;  1SJH D;  2JEB I;  1DCZ A;  4C3H G;  5E1F A;  4X3S A;  1PMR A;  3ERQ A;  3SVM A;  3NUC A;  4XXE A;  2JEA I;  1AZP A;  2NTS A;  1LT5 D;  3H94 A;  2PZT A;  3LNN A;  1D1K A;  2R6G A;  1UUP A;  3I4N B;  1U4L A;  2XN9 C;  3DUZ A;  2JA7 B;  1STN A;  3OIQ A;  2G9H D;  2X69 A;  2JXM B;  3T51 B;  5D14 A;  3M3Y B;  1WD1 A;  4R9W A;  1HQM C;  2M9V A;  1TKW B;  1TQO A;  5COR A;  4I65 A;  3M4Y A;  4XDX A;  1I4R A;  3F2U A;  2JA5 B;  1M4V A;  1LO5 D;  4HAE A;  5A2Q E;  4TRD A;  4Y7N B;  1EOT A;  1EWH A;  2F3W A;  2MP1 A;  2XIW A;  4LMQ D;  4IFD J;  1PTO B;  1GXD C;  4XTC S;  2F0V A;  4IUQ A;  4AYB B;  5C0X G;  1SE3 A;  5IGD A;  3NTK A;  5E3F A;  1EIG A;  4MIU A;  2WIN B;  1STE A;  4H0L C;  1VMP A;  1A2U A;  4WRD A;  2B2T C;  1GUN A;  2Q8T A;  2E2D C;  1Q1B A;  1OXX K;  1RD9 D;  3DWA A;  1X32 A;  2XSC A;  3HOX B;  3K57 A;  3Q22 A;  4A3I B;  3AMU A;  3MZ5 A;  4ZQ3 A;  3TP5 A;  4KV6 A;  1PRT F;  1CT1 D;  4FXK C;  2ID0 A;  4IN3 A;  2F0M A;  2KCC A;  1ML0 D;  3P7J A;  2HDM A;  2K6A A;  3IAY A;  5LL6 S;  5KEE A;  4XQN A;  2B2V A;  2BDN A;  1MI2 A;  3SEB A;  2MGS A;  3T13 A;  3VYR A;  1AP0 A;  2D2C C;  4KHZ A;  1BUV T;  4K2K A;  3DXJ C;  5IGC A;  3KBG A;  2WKC A;  2FMC A;  4IUU A;  4KY5 A;  3TZU A;  1SBB B;  1EYD A;  3A54 A;  1ROD A;  2C9O A;  2L1B A;  2IX3 A;  1ILP A;  2SEB D;  2XVS A;  1U4M A;  1J8I A;  3L3O C;  3TP6 A;  3RD4 A;  5KNC A;  3H3V C;  1CFM A;  3PIP 3;  1E2W A;  4DU9 A;  2WAC A;  2FMM A;  3NHH A;  4TQU S;  3L7Z C;  1SFO B;  1KAB A;  1VF7 A;  4P2C B;  3NPP A;  5FKA C;  3AU7 A;  2DN8 A;  5IGF A;  5IOC A;  2K03 A;  2M00 A;  1PRT C;  2KED A;  1EIH A;  1V1O A;  2EOT A;  3LWU A;  3WDN A;  2B2Y C;  2FHT A;  4DXG A;  2NWG A;  5KYL A;  3ERO A;  2EE1 A;  1D2B A;  3I70 A;  1Y8O B;  3NQT A;  2PPB C;  4EQP A;  1NUC A;  3OWE B;  1JWS D;  5C6A A;  2F0O A;  1SNO A;  4V0B A;  1JOR A;  1OXV A;  4BY7 B;  1Q12 A;  2BE5 D;  5BN4 A;  3TP8 A;  1LAC A;  3A8I E;  4A93 B;  2NVY B;  1JIC A;  3NQI A;  1EQV A;  1AEX A;  1S5D D;  4RGM A;  5M9O A;  4OIK A;  4IAL A;  3GTG B;  2WII B;  4CKE A;  2XWJ B;  3RUZ A;  3MC0 B;  3I4M B;  3DWP A;  3OW7 A;  1D1I A;  1C4Q A;  1K83 B;  5IT9 L;  2HUG A;  1ZYR C;  1Y1W B;  1JE4 A;  2EY2 A;  3C1E A;  2OT2 A;  4OGQ C;  1JOQ A;  4CBV A;  3PO3 B;  4PQX A;  1GUT A;  2E2I B;  2K5D A;  1Q8I A;  3OMC A;  2WV6 D;  1WTP A;  2F0P A;  3S2H B;  1II3 A;  1A3U A;  4J6H A;  4L8J A;  3S1Q B;  3QOL A;  4H7B A;  2EY1 A;  4OIJ A;  2K5W A;  1Y8N B;  3RLF A;  1SE2 A;  3FKI B;  3D31 A;  2R7Z B;  3I3C A;  4J1M A;  3HRZ C;  4ZAI A;  3MVV A;  2F0S A;  5JOB A;  4K5V A;  5CYU A;  4FVM A;  2YYZ A;  2B2T A;  2A6H C;  4O42 A;  4EGV A;  3NTI A;  2O5I C;  4R8N A;  1B53 A;  1SDF A;  2ICI A;  2K1B A;  1ICW A;  3VR2 A;  1WCM B;  4DAP A;  3RZD B;  5C3W A;  5IIF A;  3BS1 A;  1J9O A;  1AN8 A;  3PMF A;  2QIL A;  2Z4I A;  3FPU B;  4K5W A;  1MSG A;  2LS0 1;  5C4X B;  2NN6 H;  2L0C A;  5ELD A;  1ESR A;  1Y69 U;  3BDL A;  2RDF A;  4BS9 A;  3SK6 A;  1B1Z A;  1LTI D;  4NW2 A;  2F03 A;  4A3E B;  5CC4 A;  1D6E C;  1A15 A;  2H4O A;  2EYL A;  2EYM A;  3GTJ B;  2F0T A;  1FR3 A;  3H6M A;  3TN2 A;  2TSS A;  5M3F B;  1B9M A;  1H9K A;  3HZX A;  2NN6 I;  3KUP A;  1H9R A;  5A35 A;  2EYF A;  3G7L A;  2E2H B;  4U68 A;  1CZG A;  2BOS A;  1M8A A;  1SYB A;  5IT9 E;  2Z8L A;  5C3E B;  3IFD A;  3C3L A;  1W6K A;  1KNE A;  5KGU A;  2CHB D;  1GJX A;  3RZO B;  4EVO A;  5CV5 A;  5DNF A;  4RA8 A;  1G29 1;  4X3K A;  1I4X A;  4XQQ A;  1G2T A;  3CU7 A;  2GA4 B;  5I2X A;  3OSO A;  1JQY D;  4CJ1 B;  4ILW A;  5EPL A;  5C0X J;  1BBX C;  1HCZ A;  5KIX A;  1WTQ A;  1O7L A;  5C5L A;  5E4W C;  1PZJ D;  2B2Y A;  3TME A;  2RKS A;  2PNR C;  2R93 B;  4BY1 B;  2BA0 A;  3R2T A;  1STB A;  2EXZ A;  3M85 A;  1TS4 A;  1PRT D;  1BF4 A;  5J39 A;  4CJ0 B;  1SAP A;  1X3Q A;  2WP8 J;  5D3I B;  2ICE C;  1FD7 D;  3DM1 A;  1ENC A;  4OO1 I;  4F7X A;  1GHJ A;  3A8K E;  1CZW A;  5NUC A;  4NDX A;  5CGK A;  1JWU D;  2RBM A;  1I3Q B;  2XWB B;  1CK1 A;  4N9T A;  5I2Y A;  4KI0 A;  4K6L A;  5FO8 B;  3VR6 A;  2A69 C;  2E75 C;  2KVM A;  5M5X B;  4FNF A;  4KJO A;  4DGZ A;  3S16 B;  1F9Q A;  2AWN A;  1E0B A;  1EZ6 A;  5CBE E;  1SEB D;  3RMH A;  2KUM A;  4CKB A;  1CTM A;  4WFN 3;  1MGS A;  2MPM A;  2K7V A;  3ITP A;  3SXH A;  1WTX A;  4RHR A;  3S9W A;  4C3H B;  3R8B A;  2PYK A;  2K32 A;  2RSO A;  3KBX A;  4X3T A;  3K6O A;  5TSS A;  3MWY W;  1ZYR D;  4C56 C;  3S14 B;  4RCN A;  2NBF A;  1HHV A;  4RWS C;  2XNA C;  1TWH B;  5EQ0 A;  2L55 A;  2K5Q A;  2CW0 C;  5JVH 3;  1G6Z A;  1I50 B;  4HSP A;  2NZ1 D;  2DNE A;  1ENF A;  1BR9 A;  2ZXO A;  2F1M A;  2L11 A;  1LTT D;  3NSW A;  1TWA B;  1FNU A;  2RA4 A;  4HMJ A;  2VNU D;  4E6I A;  4ZRZ A;  3OMG A;  2I07 B;  2PZU A;  3LX0 A;  2Q8R E;  2K01 A;  2A6H D;  1OO9 B;  4ABN A;  4BBS B;  2KCN A;  1BNZ A;  1EYA A;  3FEW X;  1HA5 A;  5COY A;  1A6X A;  3DEP A;  1F2Y A;  1DXM A;  1FNV A;  1S5E D;  2KHS A;  2EVB A;  1BCP F;  1EY8 A;  2KOL A;  3R93 A;  2K33 A;  2O5J C;  4RGT A;  3LWE A;  5I9O A;  1LTA D;  2PW5 A;  2PQE A;  5JVG 3;  2LKV A;  2ENB A;  4ULL A;  3MXU A;  1XX8 A;  3NBI A;  2HCC A;  4JBW A;  1OXS C;  1PFN A;  1DD2 A;  3J7A F;  2EJF C;  3MAQ A;  1ET6 A;  3R3O A;  1EU4 A;  5EKI A;  4DAV A;  4QUF A;  3GTQ B;  4H13 C;  5KND A;  5CMD A;  2X6L A;  3DHQ A;  2EPB A;  1KDC A;  2OF1 A;  3ND9 A;  1HPC A;  5FO9 B;  3EQL C;  5KYI A;  1LT4 D;  3VYT A;  4KN4 C;  3X3N A;  1ZEQ X;  3VR5 A;  1CI3 M;  2F0G A;  2NN6 G;  4ID6 A;  1Z47 A;  4C1N K;  1BQQ T;  3A8J E;  4G7O C;  3FRP B;  2EZV A;  1RF2 D;  2M2L A;  4C3I G;  3ND8 A;  3D4R A;  4M1U B;  5DM6 3;  1BCP C;  2EJM A;  5JPN C;  2DY8 A;  1WTW A;  1EY5 A;  4XYO A;  1DOK A;  5BN5 A;  1RDP D;  1JCK B;  5DM7 3;  1MBY A;  5E4X A;  4Z9C B;  1D5M C;  1SYD A;  1SYG A;  5EKK A;  5EPK A;  1EY4 A;  5J22 A;  1IKL A;  2K28 A;  2KA7 A;  1KAA A;  1Y8P B;  1XYI A;  4R8I A;  1NR2 A;  3I90 A;  4XT1 B;  1T5X D;  1HRJ A;  4FXG C;  1R4Q B;  1RTN A;  2K04 A;  2A68 C;  5C5M A;  2B63 B;  2VB3 X;  2D9U A;  3L9A X;  1LLR D;  4B08 A;  3NWT A;  2J4X A;  1YNJ C;  2H1E A;  3H0G B;  2A69 D;  1ET9 A;  4B9W A;  2BDO A;  3W3A A;  3K5L A;  1ENA A;  1TY2 A;  1Z7T A;  1HXY D;  3PV0 A;  4HTH A;  1S4Z A;  4G7H C;  1GOZ A;  1LT3 D;  3GP7 A;  3PIO 3;  5KNB A;  3E5S A;  4OO1 G;  3GV6 A;  1MD2 D;  1UEA B;  3CQZ B;  2ZXR A;  3OOC A;  4H44 C;  3SHL A;  1RHP A;  3PO2 B;  3C46 A;  1XWE A;  4JK1 C;  4RAU C;  2A73 B;  1S5F D;  2NB0 A;  2F0I A;  2X6G A;  4QF4 A;  3K59 A;  3CRL C;  2Y0S B;  3D8G A;  4ZKC B;  4YIJ A;  1JC7 A;  5ISR A;  1S5C D;  2QF7 A;  3HEJ A;  1TS3 A;  3T56 B;  2CW0 D;  3MEH A;  3GV3 A;  3MTS A;  1LV9 A;  5K36 H;  5FOB B;  1TT2 A;  5CR3 A;  5IGE A;  3JAM L;  5D65 A;  2HCI A;  5C4H A;  2B2W C;  2PZW A;  4KTA A;  4PMW A;  1TR5 A;  3KLR A;  2F0J A;  3SK5 A;  1F2M A;  2F4I A;  2VXW A;  3D6W A;  4BA2 I;  1IHZ A;  2E2J B;  4DFA A;  1RKN A;  2B8F A;  1HTL D;  4FF2 A;  1ONL A;  4ODG A;  4QUC A;  3EJI A;  2J7Z A;  5EKL A;  1VDZ A;  1O7Z A;  4PV1 C;  1EL0 A;  3MXP A;  4IUT A;  1NAP A;  1H9S A;  1H9M A;  4IQZ A;  1JR0 D;  3EFX D;  3HOY B;  2RDG A;  1U9R A;  4GZY C;  3CHB D;  3V96 A;  3OPO A;  4BBR B;  3KLS A;  3D4D A;  4EQN A;  4Q0F A;  2NVX B;  3I4L A;  5FO7 B;  3HOZ B;  2AUK A;  3HOU B;  4ZLT F;  3P20 A;  4CKC A;  1PTO F;  5IOD A;  3OWF A;  1ZKO A;  3A7A B;  4XQJ A;  5C4J B;  5C44 B;  3URY A;  1B44 D;  3BVZ A;  4Q5V A;  2EY6 A;  4HMI A;  1B4O A;  1EFI D;  1QE6 A;  2IWH A;  1OXT A;  1PTO H;  2NYZ D;  4PMB A;  1QWY A;  4I7Z C;  5T1I A;  3OIP A;  3K58 A;  2D5D A;  4K8J A;  3MHB A;  4C3J G;  3C1F A;  1HQR D;  2CVR A;  4F8M A;  4K5X A;  5CV6 A;  1K8M A;  1EZ8 A;  3TBI B;  1HTP A;  2MUY A;  1A2T A;  3Q6S A;  3JAM E;  5JEA H;  2JA6 B;  1BCP D;  1PYW D;  5ELB A;  1AZQ A;  2EYP A;  1L0Y B;  2KQ3 A;  3VR4 A;  2NVQ B;  2OEO A;  2LFN A;  2F0U A;  5EBD A;  4PNY A;  2A5H A;  4TKO B;  1SMY C;  3QG1 A;  3QO2 A;  4MN3 A;  2ZT9 C;  4FP5 D;  3Q0A A;  1DM0 B;  2NTT A;  2RSN A;  1WD0 A;  2EDG A;  4KY6 A;  2A68 D;  1PRT B;  2NUC A;  5CV8 A;  1PTO C;  1O78 A;  3Q24 A;  4NKL A;  2VUM B;  5M5Y B;  3GTO B;  4RH6 A;  4L6T B;  2MHV A;  1C48 A;  1YNJ D;  1WVL A;  4FF4 A;  2R61 A;  3V2T A;  1F2L A;  1SSO A;  4OO1 H;  1L0X B;  3T4A C;  3PUZ A;  3A7L A;  4F87 A;  3P75 A;  1B9N A;  3VR3 A;  1G8Z D;  1FNW A;  2O2L D;  4G57 A;  1F9P A;  1JB3 A;  4HN7 A;  3J7Y W;  2EY5 A;  4M8A A;  3PUV A;  5CV7 A;  3D4W A;  3VA7 A;  1PXU A;  1IKM A;  1F77 A;  3K7A B;  2CQA A;  1V1P A;  1EEI D;  3C2P A;  1Z6H A;  1YNN C;  2IX0 A;  1SJE D;  5LL6 X;  4CHT B;  4KMU C;  2B2W A;  3S17 B;  3K5N A;  3NBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...