5I9PA

Crystal structure of staphylococcal nuclease variant delta+phs t62h at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFHKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5i9pA00
3PMFA 5CC4A 1STGA 4K8IA 1A2UA 3TMEA 3TP8A 1RKNA 4N9TA 4KTAA 5DEHA 3VA5A 4ODGA 4E6IA 2EY2A 2F0PA 3C1FA 3C1EA 1EQVA 1EY9A 1KAAA 2EXZA 2OF1A 1JORA 3ITPA 3NK9A 5J22A 3DMUA 1JOOA 5KYLA 2F0WA 1STNA 4K14A 4N9PA 4K2LA 3OWFA 4QMGA 4J1MA 5EGTA 3V2TA 5C3XA 5C4ZA 1U9RA 2EYHA 3MZ5A 2F0NA 1SNQA 1STHA 4K5XA 4WORA 5IODA 4EVOA 1SYGA 3P1HA 5IGCA 3P75A 4QB4A 3TP7A 5CV4A 2F0UA 3RUZA 3LX0A 4RKLA 2RBMA 1SNCA 4WRDA 4NDXA 5E3FA 4G57A 4EQNA 3NQTA 2F0DA 4HMIA 4S3SA 4TRDA 5KGUA 3D4DA 2F0OA 3S9WA 3EJIA 2F0GA 3NP8A 4IUNA 1AEXA 1STYA 2ENBA 4KY7A 5JOBA 4KV6A 2F0IA 3EROA 4KY6A 3MEHA 4ME5A 2F0VA 2HQEA 2F0QA 5CV7A 2EYLA 2F0LA 1EYDA 5EKLA 3BDLA 5CV6A 5J1ZA 4ID6A 5C5LA 4F7XA 5HGTA 5IGDA 1EY4A 1EY5A 2KHSA 3D6CA 4H7BA 2F0TA 3ERQA 2EY1A 2F0KA 4K6DA 4R8NA 1JOQA 2F0HA 3MXPA 5KRUA 1TT2A 1TR5A 4RKBA 2EY6A 1II3A 3NUCA 3TP5A 4YIJA 5EKKA 5E1FA 4B9WA 5JAVA 4K5VA 3D4WA 3OMCA 4LAAA 5NUCA 5KEEA 4DFAA 1SYEA 2PW5A 2EYMA 2SNSA 4HMJA 1IHZA 3SK6A 3SK4A 3OMGA 1TQOA 2F0EA 2LKVA 2OXPA 5IOCA 5K5PA 3SHLA 4PMCA 1SNOA 3D8GA 3NHHA 2PW7A 4PNYA 2WACA 4NP5A 3E5SA 5CV5A 4DF7A 5IGBA 3T16A 4KJNA 2KQ3A 1EY6A 5DAUA 1JOKA 2PZTA 4B9XA 2M00A 3HZXA 2PZUA 5I9OA 3TP6A 4IZ8A 3NXWA 1SYFA 3SR1A 3QOJA 3R3OA 1EYAA 4DGZA 2F0FA 5CV8A 2F3WA 4KD4A 3QOLA 3SK8A 5J39A 2SOBA 1KDBA 5I6YA 5I9PA 1EZ8A 3OSOA 3BDCA 4NKLA 2PYKA 1EYCA 2RKSA 5KIXA 4EQPA 4EQOA 1SYBA 1A3TA 1SYDA 4HTHA 1F2YA 4QF4A 3MHBA 2EYJA 2SNMA 1SNDA 3T13A 2OEOA 5ISRA 4NMZA 2F3VA 2RDFA 1A3VA 5M9OA 1EY0A 2NUCA 5IGGA 3EVQA 3SXHA 3HEJA 5IGEA 5F2DA 1EY7A 1ENAA 1NSNS 4K5WA 2EYOA 3QB3A 5KYIA 1STBA 4K8JA 2F0SA 3H6MA 4J6HA 3U9OA 4KJOA 2F0JA 1KDAA 5I6WA 5HURA 4ZQ3A 1ENCA 3DHQA 5C6AA 1A3UA 4ZUIA 4ZUJA 2PQEA 4F8MA 5IIFA 2F0MA 4I65A 5IGFA 5C4HA 1SNPA 1STAA 2EYFA 4PMBA 1F2MA 5CV9A 1EZ6A 4KHVA 1NUCA 4MIUA 1A2TA 1EY8A 1KDCA 4KD3A 4KY5A 5C5MA 5CGKA 1F2ZA 4DU9A 2QDBA 3MVVA 2PZWA 3SK5A 1KABA 4K2KA 4IALA 1SNMA 5C3WA 5CR3A 2O4XA 1SYCA 2EY5A 2EYPA 4OL7A
chains in the Genus database with same CATH superfamily
2J0TD 4R4IA 1A2UA 4L63B 1LACA 4BA2I 1SE3A 3CC2A 1VQ6A 3E0JA 3H0GH 1HR0L 2R61A 3HKZE 2CQAA 4XDXA 3G6JB 5C4ZA 3RR5A 1QCBD 4ZYSA 4JI5L 2A73B 3MZ5A 2PQAA 5IODA 4DV1L 3FVQA 4JI6L 3VR4A 1BBXC 3M7NA 3T51B 1TWGH 2F0UA 2PQAB 3R2IA 3HS0C 2B2VC 3QO2A 4NXMQ 3GQBA 2MQHA 3I4NB 2Z4HA 3KLWA 2CHBD 3TREA 5CYUA 1YNJD 4R4CA 1R9TB 5IGDA 1YIJA 2HD3A 1JOQA 4A3FB 3Q6SA 4X6AH 1A62A 4IPGA 2E8GA 4RFBA 3NUCA 5DM63 4KK7A 5E1FA 5FOBB 1ASYA 4R9WA 3Q22A 1UEBA 3J7YW 4I7ZC 3A7LA 4YCWA 4LF8L 3T1HL 1GUWA 4DV2Q 4NXNQ 1IBML 1Q46A 3D8GA 4PZ8A 5FO7B 4DK1A 5JJZA 2MNAA 4DF7A 4JG2A 4BWGB 2LMCB 5M3FH 1JWUD 2A69C 2Y0SB 1Q12A 4RWSC 3R8BA 3BS1A 1G91A 4GNXB 2OQKA 3R3OA 3WDNA 5M5WB 1O7IA 1GM5A 1K83H 2CW0C 2K01A 1WI5A 4IOCA 4DR7Q 1F9SA 1QG7A 1HFNA 1VQBA 2QEJC 1IKLA 1W6KA 1YHQA 5KNCA 5IGEA 1D8LA 1NSNS 4J8QA 3GTMB 4X3TA 4DAMA 2F0JA 1OXVA 3DHQA 3FMCA 4TSSA 4IN3A 1EQQA 1BNZA 1KD1C 2JN4A 3S15H 1RF2D 3S14H 1EY8A 1Y8PB 3E9HA 4EGVA 4CHTB 3A5ZB 4FF1A 2R7ZB 4IALA 5KNBA 5IE8A 3K5OA 2MO1A 3J80i 1QOHA 1PH4A 5LMUL 1NJIC 4C1NK 4FNFA 1J5EL 3FEWX 3GTPH 5AJ3Q 1BBUA 4HR7B 1SMXA 3VA7A 1H9RA 2DJFC 5JVG3 2Q2HA 4MHEA 5IP9H 1VQMA 4RGOS 4LF7L 2Z6KA 4K14A 5D14A 2K5WA 2BE5C 4L5QA 1TWHB 1MHWC 2L11A 1YJ9A 4Z9CB 2F3IA 4LJZC 1WTXA 1K3BC 1WCMH 1HZ9A 4NDXA 3FHWA 1M1KC 1C4QA 1JE5A 3MA2B 4HMIA 3RZOH 3EN2A 1QE6A 4FVMA 3JAMi 3LWEA 4KY6A 3FPPA 1PHJA 3M4YA 2LSSA 2L4NA 2HHHQ 1H9JA 2KEDA 1E24A 2XRSD 1X3GA 3ERQA 4R4QA 5HY6A 2NB0A 4JYAQ 4XT1B 2JA7H 1IYUA 1T5EA 4ZRZA 3OMCA 3HOXB 3J80E 1NR2A 4A3GB 2K32A 4HEDA 4C3JH 1E7ZA 4A3JG 2I0QA 1F9RA 1SNOA 1X6OA 3P20A 1SBBB 4V190 2DUDA 3RLOA 3Q24A 4Y52H 2WP8J 4A3BB 3JAMc 3D0FA 2BH2A 1E2ZA 5CV8A 3I8ZA 4HJ8A 4A3MG 5I6YA 2G5DA 1BF4A 1VQNA 2JJQA 1B2TA 1PFMA 1HJPA 2ZJRA 3JAME 2EYJA 3AB9A 4M8AA 2UU9Q 1A3VA 1YITA 4DV3Q 1C0AA 3GTOH 3T53B 5IYBH 3IFDA 3CCMA 4JI8Q 2M9VA 2AQ2B 3KDFA 1B9NA 4KJOA 2WAQG 2N3SA 5IIFA 2PQEA 5AFWA 4CJ0B 3E9IA 1CA6A 1T9HA 3HOYB 3STBD 3M3YB 2RCFA 1NUCA 4MIUA 1JMCA 5D65A 2EZVA 2E2HH 3I4MG 2IW3A 1C7YA 3TMEA 3TP8A 1VQ9A 2EJFC 3PUYA 2B63H 4QJFA 2B8FA 1IBKQ 2NVQH 2F0PA 1TS5A 3QR8A 1RD9D 2EXDA 2BE5D 1YBYA 2K1BA 4UP8A 3T56B 1CKOA 3S2HB 5FLXc 1K0RA 1ASZA 2WKCA 1PLFA 4LFCQ 1I6HB 1D6EC 2VB2X 3CCUA 1CI3M 3D4DA 4OEMB 3EJIA 4DV6Q 4JI1L 3NELA 1SROA 4A93B 1XNRQ 2F0LA 2VUMB 1L1OA 2E74C 1EY5A 3AQQA 4R8NA 4F87A 1N33Q 5IYDH 3DLLA 5C4JB 5JJKA 1GD7A 4JBMA 3TP5A 4HJ5A 2AKWB 1SYEA 2PW5A 1UE7A 1YVCA 1IHZA 3SK4A 3GTQB 5KNDA 1RTNA 4GLVB 3NSWA 2EJGC 1HZBA 4QIWB 4ZAIA 4DAYB 2CVRA 2N49A 1GUNA 3CQZH 1GXDC 3VR6A 1EIHA 1SYFA 1NR4A 3SR1A 5M5YB 1DCZA 1RHPA 3CD6A 1MSGA 4DV1Q 4JI6Q 1EYCA 2RKSA 4XYQA 2XVSA 3HOZG 1TKWB 1E22A 1ESFA 2SNMA 1SNDA 2E76C 2OEOA 3T13A 4KHPQ 1TIID 2Z8LA 3LNNA 4ILWA 1ENAA 2E2JB 4L6TB 5T1IA 3G4SA 2WIIB 2VXWA 1OXTA 1K3RA 2UUCL 2K52A 5C6AA 1A3UA 2HDMA 4YWMA 3GV3A 3GTLH 1GUOA 5GAGC 4DV0L 2FMCA 2BA0A 4JI3L 1PH7A 2J7ZA 3DEOA 4LF8Q 2D9UA 4DU9A 2GVBA 1JB3A 1LTAD 3A55A 1Q3LA 2RA4A 2EYPA 5EBCA 1VQ7A 4OL7A 4G4KA 2JYOA 1YI2A 4G7HC 4DR3L 2B39A 4J15A 4N9TA 4E6IA 1HFGA 2CQOA 3FKIH 3A0JA 1KTKA 1RL2A 2YTXA 1SR3A 4EX5A 2CWAA 1UWVA 3DMUA 5JVH3 3H3VH 1HA5A 2OTJA 5C3XA 4A3JH 2D2CC 3HOVG 2K03A 5C44G 4QY7A 4DK6C 2XTIA 4JOIA 3LX0A 4CGYB 5E3FA 2GA4B 4KHZA 1V9PA 2ZM6L 3CMEA 3A8KE 1STYA 4A3MH 3S17H 2F0IA 2B8GA 1VF7A 1CT1D 2XN9C 2VL6A 2A6EC 1L0YB 3Q8DA 4DV7L 2B2WA 3HKZB 2KA7A 2RCNA 2XRQD 3FP9A 3UDXA 3BZKA 5JAVA 1WYDA 1GHKA 2IL8A 1JWMD 5FJ8G 4UPAA 3OMGA 2EOTA 3S1NH 1U4RA 2VNUD 3S1RB 3QWNA 2FXQA 4NP5A 3PO2G 3T16A 5M5XH 4GN3B 1I4XA 2PZTA 1UAPA 1I4PA 3HOUB 5TSSA 1B53A 2L1BA 1UNSA 3I4MH 4BBRB 4C1NI 1MBYA 3NBHB 3HOZB 4DV5Q 4IPDA 2HIXA 4MTKA 1NMFA 4AQYL 1KC8C 4A3IG 1K9MC 3W2DA 2I5LX 5M9OA 1FNVA 4C2MH 1PYWD 5F2DA 4U68A 2DY7A 5ELCA 1A15A 4LF5L 4KKUA 2Z6BA 3K81C 1CTMA 1RIPA 4CJ2C 3RMHA 2K5QA 5EJWA 3I72A 2RHSB 2NVYB 3DUZA 3BJUA 2IWHA 1CM9A 1D2BA 4CKBA 4HAEA 3MAQA 5IT9L 3KBGA 4NB3A 4GNXC 3PGZA 2MJ8A 3BYYB 3PUWA 1N36L 1RKNA 3PUVA 1TWCB 4IURA 2KUMA 2JA6H 1VQKA 1LLRD 1HUNA 3AFQA 2B2UA 2OT2A 1LT5D 4GLAC 2JP1A 4ZLTF 3CCSA 1O7LA 1QNUA 1SAPA 2UUBQ 1Y1VG 2YTYA 1PTOH 1HQRD 4BBSH 2R7DA 1U9RA 2X6GA 4YWKA 3HG9A 1VQPA 2K4KA 4B08A 2Z9HA 5A2QE 2NTSA 3I73A 4LW1A 2MUYA 2Z0SA 4RKLA 1PVOA 4A3DG 4FF3A 3Q23A 4QCLA 3S9WA 4HJAA 1VQCA 4KLKA 2Q8IB 1I4QA 1FYCA 5GROA 2NWGA 4BA1I 5JJLA 2A6ED 2OQ0A 3NTIA 3GO5A 4GKJL 1OXUA 4DV4Q 5EKKA 5NUCA 3I3CA 1E1OA 1PH1A 3M4PA 4LMQD 4L5SA 2HQLA 4JI0L 3A8JE 3A8IE 2AUJD 3U50C 3I4NG 2MFIA 4KMUC 1QUQA 5IP7G 3DWAA 5BN5A 2L15A 5I9OA 3TDQA 2Z6KC 3T1YQ 4LFBQ 2HUGA 1DXMA 5J39A 3NENA 2BCOA 4A3FG 3CMAA 3OSOA 4NKLA 4X62L 1GUSA 4DR5L 3I70A 4DUYL 2IT1A 3PIP3 1MJEA 4DPGA 3CKIB 4HCEA 1N9WA 4NMZA 5FO9B 3M4OH 2RDFA 1IKMA 3O13A 2QDLA 1OO9B 3HOVH 4YWLA 1ENCA 2Y0SG 2KCCA 5C44H 2F0MA 3B6YA 2CFMA 4OONA 2CH4A 1X65A 4X65L 3LWUA 1EZ6A 4KHVA 2E75C 4KD3A 1S5BD 1K8MA 1I3QH 2JEAI 1ILQA 2KBNA 4IPHA 3VYTA 4C3HG 1LYLA 1ML0D 5LHY1 3U4ZA 1SFOB 1KAAA 2MO0A 3J7A5 5DLQE 3L0OA 2L5TA 4QMGA 1SLJA 3ER0A 4NW2A 1W3SA 3MXUA 1CUKA 2F0NA 5C3EB 3PO2H 1EQTA 3KF6A 3VR3A 3I55A 4FXDA 2RBMA 2BA1A 2IHEA 2FHTA 2R7ZG 4S3SA 3CCQA 3CCLA 3KYHC 2UUCQ 4IFDG 3MEHA 1NMGA 4O42A 1FGBD 5J1ZA 3S1QB 1B44D 1XMQL 4JI3Q 3OW2A 1V1PA 2C5CA 4H7BA 1KLGD 5GAHC 3J7AV 1MKHA 2GVAA 4A3IH 1GHJA 3PIPA 4UAIA 3TQYA 1TT2A 3R93A 2JQOA 3K7UC 4K5VA 1L0WA 1SRUA 4DAVA 4KKTA 3C2PA 2Z1CA 3D3RA 5T1GA 3KF8A 2B2TA 3SK6A 4DR3Q 1M8AA 2UXDL 2AQ1B 1AP0A 4WJWA 5CV5A 4DR2L 3OIQA 3K57A 1KHIA 4R4TA 1YEZA 4B9XA 1V1QA 1JJCB 1B3QA 3QG1A 3TP6A 1KNAA 2X6LA 5C0XH 3J81L 3GDEA 3QOLA 4IFDI 5D3IB 1D7QA 1NNXA 1D5XC 3BDCA 4P72A 1VQJA 2SEBD 4EQOA 1AZQA 2JE6I 3L7ZC 5IWAL 2LFNA 3HOXG 3PUZA 2ZM6Q 2B3GA 3S14B 4DNRB 4IUQA 4A3GG 1ONLA 3X3NA 1Y1VH 3VYSA 2JA5H 1KAWA 1RDPD 5FKAC 1L1OC 4DV7Q 1TU2B 2NZOA 3CW2C 5COYA 1K8AC 3I56A 4YCVA 1XPRA 1H9SA 1X56A 4R8IA 4A3BG 4RGNA 1DYQA 1ICFB 3CU7A 4A3DH 1SNPA 1H9SB 1SEBD 1Z47A 5E4WC 4IUTA 3OYYA 4HSPA 1HPCA 1EEID 3M4QA 2N8NA 4RH6A 4IPCA 1NTGA 4C3HB 4BS9A 2BDOA 1G8ZD 3KK7A 1VQAA 3D6WA 3RZOB 1U0LA 2NVXH 4IO9A 1AW7A 4PZ6A 4AIMA 4B3MQ 3I7FA 5L37A 2ICIA 4B3RL 2EYHA 3DWPA 3HOYG 1G291 4C3IB 3TN2A 3P1HA 3STBC 2IHFA 3DEPA 4A3EB 3K6OA 1PFBA 1SNCA 1SE8A 1G51A 4G57A 4EQNA 1WTRA 4X3UA 3TBIB 4LF5Q 1R9TH 3GD7A 4C3JB 1DOKA 4A75A 4A3FH 3F2DA 2N88A 1X3EA 2F0QA 1LM0A 1CA5A 2O5JC 5HGTA 1EY4A 4K6DA 2HCIA 4CBVA 2AHOB 4DR4L 3PO3B 1NBWA 3SVMA 4TVAB 4QUCA 1N36Q 2O2LD 3MXNA 3NWTA 2KENA 4PQXA 5C4XH 3NTKA 4LFAQ 5K36G 2PW7A 1U4MA 4JI4Q 5M5WH 3F8TA 1S72A 1TWFH 1EY6A 4JPBW 3J80c 4A93G 1JR0D 3NXWA 2VUMG 3HOWB 2F3WA 3A74A 1LT3D 1FL0A 4LNQA 5I9PA 4G7ZC 1EZ8A 1UE6A 5KIXA 1MIUA 2JA8H 3K7AH 2ZJPA 4JOIC 1QJOA 1VQDA 4AYBE 4DNTB 1TS4A 1H9KA 3GTMH 2L55A 4UP7A 1Q8IA 4RA8A 1K73C 1VCIA 3HEJA 2KOLA 3UDIA 3OPOA 3QB3A 3H6MA 4HJ9A 2WB1E 4A3CG 5LMNW 3F2BA 2WV6D 3QJYA 1GO3E 1VQ4A 4POFA 2B63B 3G6EA 2NVQB 2KCMA 5M3MB 3ICEA 4GZYC 2EYFA 1LO5D 2WKDA 1EYGA 2R93H 1MI2A 3RZDH 1KDCA 4KY5A 1PFSA 1WTOA 1QVGA 1Q90A 4OWXB 4JI0Q 1Y8NB 1KABA 3BVMA 1GOZA 1ET9A 3MFYA 1CK1A 2F4VL 4X66L 2DN8A 4B3SL 1HTPA 3PF4A 3NPPA 1E2WA 3OTOL 3BYTB 3F2CA 2F4IA 3TEHB 3BVGA 1TVXA 1MSHA 5FO8B 4X62Q 1XTDA 3KDFB 4DUYQ 1STNA 1XMOL 5EGTA 3WWVA 3ZYYX 2LXJA 1LTBD 3EQLC 4EVOA 1LT6D 3ULLA 2LY7A 2BH8A 2TSSA 1STEA 1U5KA 1TWAB 4WRDA 2UXBQ 1MD2D 2QCPX 1LTRD 3TZUA 1A8VA 3DM3A 2ES2A 1I94L 5CV7A 2HQEA 1BVSA 1AFPA 1O80A 2KECA 4DXGA 1B9MA 1X3FA 2NBFA 1CZGA 3DXJC 3HOXH 2F0TA 4X65Q 4CJ1B 4F88A 2IY5B 3TZDA 4Q5VA 4N8FA 3CRLC 1PH3A 1L0XB 5EBDA 1GKHA 4UP9A 3OHXC 2KVMA 4FF4A 2B2VA 3BZCA 3CCJA 4A3BH 2WACA 1PH6A 1PXUA 2B2UC 1Q1EA 1VQEA 1HQMC 5EPJA 5C0XJ 3L9AX 3RD4A 2IX3A 1HUMA 4APVA 1KDBA 3F2UA 3HKZG 1L1OB 3OIPA 4P73A 3AMUA 3MXGA 5DNFA 3OWEB 3GTLB 3KLRA 3E3XA 4QF4A 5ELBA 1VQOA 2E5LL 4PMWA 1EY0A 3HGBA 2NZHA 3SXHA 4KI0A 2EYOA 4KKSA 2ZTCA 1N32L 1IXRA 1HR0Q 1Q86C 3MEFA 3HOYH 1VQIA 5I6WA 3FPUB 1OXXK 4CKCA 4F8MA 2D0PA 3J7ZC 1WTPA 2MPMA 4DAPA 3HOUG 4CKEA 4JI5Q 3EFXD 3FKIB 3KJOA 1PZKD 4BBRG 2PO4A 1U4PA 2UXDQ 1V8QA 4OGQC 1G2SA 2E2IH 4FYDA 2F52A 4DXFA 4DR2Q 4UHVA 1X3QA 4K8IA 3S16H 2QGQA 5DEHA 1H95A 2HCCA 1I4GA 3C1EA 3M9BA 2F03A 3DWQA 3S17B 2OWOA 3S2HH 2F0WA 1KXLA 5IWAQ 1ENFA 1FVIA 1Y1WB 2JSOA 1I6HH 1JT8A 3M7GA 3GTGB 3PSIA 2K5HA 5A35A 3T1HQ 1B70B 3W3AA 5CV4A 4I7AA 1TXYA 4A93H 1PRTD 1IBMQ 1BKBA 4RCOA 4CDFC 1S3OA 4DKAC 1CQFA 4JCVE 4GN5A 3GTJH 1D5MC 3S1NB 5C4JH 1HNXL 2MGSA 2AQ3B 2OCEA 4LUVA 3I4OA 1D1KA 3NWSA 4ZK9B 1KL9A 1JICA 2EY1A 3MXPA 5CBEE 2UXCL 1G6PA 2H1EA 2H5XA 1PRTF 3GTQH 4B3TL 4FP5D 1JJ2A 2SNSA 4A3CH 5FLXL 3CXCA 3K59A 1VQLA 3MWYW 4IUVA 4YCUA 5JPMC 5ELOA 3NBIA 2JA9A 4C2MB 5DAUA 5IT9E 5JJIA 1CHQD 4IZ8A 4HIMA 4BY1B 4B3RQ 4DN4M 1L2FA 1JB7A 1XNQL 3SK8A 3IKJA 1QZGA 2IX0A 1IYVA 1AE2A 4EQPA 5IYCG 2XWBB 1SYBA 1HXYD 1KRSA 1BQQT 4YHHL 2QEXA 3NE5B 1B3AA 2E2JH 3CCEA 4IOAA 1WD0A 1F77A 4RG1A 1HZCA 2KHJA 5LMUQ 1STBA 1J5EQ 2FJ2A 3IL8A 4LF7Q 1I50H 3W5OA 2IPKD 4DR4Q 2JK8A 1Y14B 2JA6B 3LGJA 4MZ9A 2PMZE 2XWJB 5EQ0A 4ULLA 1SXTA 5ELNA 1B7YB 2B2TC 1A2TA 2FINB 3AYHB 4BBSB 4P74A 3MVVA 1CKNA 3S2DH 4Y7NB 1RCVD 1STGA 4OWTB 5EAYA 4YY3L 2L0CA 1HZAA 2NN6G 3UDFA 1JC7A 4DUZL 1EQVA 2K33A 1AZPA 2NVTH 1PRTB 1VMCA 1P8LA 4A3KB 3U9SA 1M4VA 3A56A 4JK1C 1ZEQX 2EE1A 1XJVA 4QB4A 3AFPA 3IFTA 3RUZA 4JC0A 1JJGA 2DNCA 2FFKB 2F0OA 1EQRA 3BZDB 1LT4D 3I90A 3P7JA 1UE5A 3EBEA 4ME5A 2EYLA 5CV6A 3GV6A 1D5ZC 2QA4A 2I5MX 5AJ3L 1YJWA 1HRJA 1MJCA 2F0HA 2NN6I 4HIDA 2RQXA 2D62A 4O2DA 2Q8TA 2CH4W 3K5MA 3GP7A 1LTTD 1GUTA 3WOEA 5KEEA 3Q0AA 3S1RH 1PA6A 5C3EG 2AMCB 1RODA 4HMJA 4XYOA 1BDOA 1EU4A 2F4VQ 4LF4L 4H02A 2Q8RE 5K5PA 2R3ZA 4B3SQ 3SE0A 3HOUH 5IGBA 1FJGL 2OTLA 1SJED 1GJXA 4BY7B 5JPNC 2AUKA 1I6VC 3HOZH 1VF5C 3PQIA 4DGZA 1EYAA 4JBWA 1ZYRD 1BBWA 4KD4A 1WFQA 1HTLD 4XXEA 2E2DC 3I91A 1N8RC 2HIVA 1X32A 1YZ6A 3HP3A 4O1NA 2BDNA 3D4RA 1UEAB 2VY3A 4RAUC 2K14A 3J81i 5HGQA 1HHVA 2EJMA 1AH9A 1FGUA 3AU7A 3H09A 2R92B 4ZUIA 1PH5A 1LV9A 2K5NA 2NVYH 1WTHA 4X3KA 1QUQB 4XIGS 5J3BA 1I5FA 5CGKA 4AYBB 4QGUA 3CC4A 1Z9FA 2C9OA 1XWEA 1TWCH 4A3LG 1SYCA 4JI1Q 1LUZA 5CC4A 2LXKA 1TY0A 2XSCA 4KTAA 5LL6X 2WB1B 3C1FA 2AWOA 3NEMA 1E0BA 1PZID 3K58A 1IW7C 1A63A 3H0GB 3CC7A 1STHA 1Z7TA 4WORA 1P16A 4PV1C 5LL6S 2E5LQ 3J81E 2ZTDA 1HNWL 4MTNA 2I5HA 4DK3C 2F0DA 4IUNA 2K5VA 1TWGB 1KIXA 2WAQE 2N55A 1F9QA 2KHIA 5IYCH 1YNNC 4OWWB 5EKLA 2PI2A 3RN5A 5EPLA 1BCPD 2YU9H 3DM1A 5ELDA 5FJ8H 2EY6A 1II3A 2EVBA 3D4WA 1FNWA 2K05A 5E4XA 3J81j 3R2TA 4C3IG 1EFWA 2VQEL 1VQ5A 2LKVA 3KLSA 1IYJB 4A3EG 1VQHA 3S1MH 5LMNL 2VW9A 4PNYA 2K7VA 3KF6B 1BCPF 3UDGA 4XTCS 4C3JG 4WJ3M 1HH2P 2JA5B 4DV0Q 1YHAA 3KOJA 2I07B 5M3FB 3TRZA 2K50A 1V1PB 2D5DA 2MP1A 4XQJA 1QVFA 1CHPD 1CZWA 2C35B 3PO3G 4ME3A 3BDOA 4OHJA 2NN6H 1A3TA 4DR1L 1K83B 1S40A 4HIOA 2F3VA 5I4DA 4JVZA 1HNXQ 3KF8B 4JI7L 1A0IA 2PNRC 4UDUC 3V96A 2UXCQ 5IYBG 1DJRD 4B3TQ 3K80C 4R1JA 3HOWG 4GOPA 2NVXB 1STAA 2NYZD 4PMBA 1OTCA 3GTKH 1EFID 4GOPB 3EIVA 1LABA 4JV5L 3SK5A 2P5ZX 1SMYC 3S15B 1QNKA 2EY5A 1SFOH 4KHPL 4KN7C 4U673 2A74C 3ERSX 1KNEA 4UY8C 1EWIA 1SN8A 4LF9L 1X55A 4ZKBB 1V1OA 1SE4A 4IJHA 1XNQQ 4JBJA 3RLFA 5C3EH 1SDFA 4X64L 3HRZC 4N9PA 1IW7D 3OWFA 4J1MA 2B63G 4YHHQ 1N34L 1TY2A 1XPUA 3NTHA 5M3MG 1HNZL 3GTPB 1R4PB 1I4HA 1I4RA 1WD1A 4OELB 2PPBC 1E1TA 2EQSA 2A5HA 3C3LA 1BCPB 1EIFA 1WTQA 3NQTA 4JI2L 5KGUA 4MNOA 1C8CA 4GNXA 3S1QH 4FXKC 2F0GA 3NP8A 4KY7A 1WCMB 2RHQB 4LF6L 1CSQA 1YNND 2A6HC 3X3MA 3KUPA 5C4XB 1IZ6A 4N8X1 3A7AB 3S24A 3H3VC 4F7XA 1TWFB 3OW7A 5BR8L 5JEAG 4WJ4A 4YIJA 4LAAA 4AQYQ 3TS2A 5IYDG 3KFUA 1EIGA 1BOSA 4IUPA 3I4NH 3HFZB 2JA8B 2JA7B 3K7AB 1S4ZA 2KEEA 5IP7H 1TQOA 2F0EA 4YY3Q 1JE4A 2R7FA 3NHHA 4DUZQ 1JWSD 3ULPA 4QQBX 1EEFD 1PYSB 4KJNA 4DR6L 1IL8A 3G48A 2KJXA 1JOKA 3E0EA 2AWNA 1XPOA 4FF2A 3QOJA 2F0FA 4A3LH 1B4OA 1F9PA 1ET6A 4LK1C 2KCTA 4G7OC 2R93B 3C46A 5ISRA 3RZDB 3VR5A 3IAYA 3CF5A 3PIO3 3CPWA 3JC66 3MXNB 5EPKA 3U9OA 3CP0A 5IY0A 1KDAA 2XGTA 1WTWA 3ND8A 3UE1A 3GTOB 4KN4C 5I2XA 1UUPA 3TSSA 3OOCA 1J8IA 2QILA 4AH6A 5C4HA 1S5FD 4HN7A 4TKOB 5CV9A 3SGIA 4C3HH 4LF4Q 2LS01 3UI2A 2Z4IA 4DV5L 1SMYD 2QDBA 1FJGQ 5CR3A 2YYZA 2SDFA 5FK9C 1YJNA 4HCSA 1Y8OB 2E2HB 4HSVA 1S5DD 3VA5A 4RMFA 4FDBA 1JORA 2B2WC 5ELEA 2OF1A 1U4LA 4GKJQ 1PDQA 3VDYA 4C3IH 2ID0A 2K5DA 1JOOA 3PCOB 2WFWA 1XYIA 1BUVT 1IBLL 4A3EH 2B2YA 2PMZB 3FKIG 2R7ZH 3N6RA 3PUXA 1QB5D 3P75A 4IFDH 2G9DA 4R4OA 4OX9L 1JCKB 1Q7YC 4K0KL 4LWCA 5BN4A 4OXPA 1AEXA 2A69D 2A6HD 2IJ0A 2QW7A 4M1UB 2EIFA 1DOLA 2UUAL 2NTTA 4JW0A 2A8VA 3PO3H 5C5LA 1PV4A 1PTOC 2KHSA 4OO1G 4A4IA 2CW0D 4GKKL 1TWHH 4DR5Q 1HR0W 2UUBL 2PI2E 4B9WA 3H15A 1Y1WG 4IJLA 3VYRA 2YV5A 1K0SA 1Q81C 3PIOA 3SHLA 1EUJA 1PRTC 3VYUA 3H3VI 3HOWH 1XX8A 4RHRA 1LTLA 2ZXRA 1EOVA 4TQUS 5FLMG 5CORA 3K0YA 4A3GH 3CQZB 1ILPA 1EU3A 4DV4L 5ELFA 1HNWQ 4OO1I 1O78A 1EY7A 1LTSD 4K5WA 4GS3A 2E2IB 2ZXPA 2X69A 5M3MH 2EPBA 4P75A 1EL0A 1XTCD 3S16B 3J80L 3CAMA 3T1YL 1EWCA 4BY1G 4P2CB 3V05A 4LFBL 3RLNA 1QWYA 2VQEQ 1R4QB 1XXGA 2QKIC 5LMNQ 4ALPA 4ZQ3A 2MHVA 1DGSA 2RDHA 3RNUA 3PMFA 1H9MA 4ZKCB 5GADC 3CRKC 1NY4A 5JEAH 4ODGA 1XMQQ 5FLXE 1EY9A 2JXMB 3GTJB 3M3YH 3JAML 4K2LA 4H0LC 2JA6G 4LUOA 1TWAH 1NCVA 4DR1Q 2GN5A 3I2ZA 2K28A 3EA6A 4A3JB 4DAYA 4BBSG 1NAPA 4JI7Q 2JEBI 1VS0A 2ENBA 2K04A 4CDEC 2Y0SE 2VQFL 1PTOD 4A3MB 1TS2A 1KQSA 3BVZA 2F0KA 4L5TA 1AN8A 1DZ1A 1TR5A 1W2BA 1X9NA 4JV5Q 3E6ZX 4IQZA 4A3KG 4GLXA 5K36H 1Q8KA 1J6QA 2EYMA 4OIKA 2Q2TA 5IOCA 1ESRA 1PTOF 3TS0A 1EOTA 4LF9Q 3G7LA 2VUMH 3T4AC 3U4VA 1VQ8A 2CCZA 2ZXOA 1X3PA 4X64Q 2WAQB 2WINB 4GN4B 5CBAE 3I4LA 4BXXG 1TS3A 3D31A 1N34Q 1W6JA 1HNZQ 3A54A 1QZHA 5M5XB 1PMRA 2SOBA 4CDDC 1C48A 1I50B 1T5XD 1GUGA 2PYKA 2H4OA 5H1SE 4O0AA 4JBKA 2J4XA 4JI2Q 3I4MB 1F2YA 5IT9c 1G2TA 3MHBA 1LTID 2CWPA 1YHBA 1ZXTA 5G3LD 3VR2A 4LF6Q 5IGGA 2HT1A 1PH9A 2DGYA 5KYIA 5M5YH 4NXML 3S2DB 5E7NA 2RF4A 4EQ5A 5BR8Q 5HURA 4BY7G 1DM0B 1B1ZA 2A1AA 2ICEC 2ZJQA 3K5NA 1PH2A 2VZAA 1Y69U 1MGSA 3PV0A 4OIJA 2TMPA 1HCZA 1WOCA 1ZYRC 3KLSX 3J7AF 2NVTB 5G3LF 3W1GA 2HDLA 5I2YA 2N78A 1AE3A 5C3WA 3SEBA 4IUUA 4DR6Q 5EKIA 4OO1H 4DV2L 4HIKA 3WOFA 4NXNL 3AEVA 1IL2A 4XQQA 1Y1WH 3NK9A 3HKSA 5J22A 3GTGH 2R92G 5KYLA 1BO0A 3F1ZA 3V2TA 5CMDA 4QUFA 1O7YA 2DY8A 1SNQA 1SYGA 5IGCA 4C56C 1PTOB 4IFDJ 3TP7A 4RGMA 3KJPA 4POGA 4AYBG 3PF5A 3W1BA 4X3SA 4DR7L 3H91A 2D0OA 3L2PA 2RSNA 5FLMH 1WTVA 4K6LA 2KCNA 3QIAA 1CKNB 3K5LA 2O5IC 1CSPA 2F0VA 4QL5A 2WB1G 4ID6A 3NBHA 3ULJA 4GOPC 3D6CA 5BN3A 1CKMA 5KRUA 1KLUD 1RTOA 2A68C 4PG3A 1EIYB 4B3ML 3CCRA 1B50A 2L9HA 3H0GG 2ASBA 4DFAA 2PCFB 2XNAC 5DM73 4H13C 1S5CD 1J9OA 2A19A 4PMCA 1O7ZA 1Q1BA 2M2LA 4RHSA 1FNUA 1E3PA 2RVLA 3E5SA 4NPSA 4BY1H 1E2VA 1QILA 3N52A 2ZT9C 3CHBD 3NQIA 3HZXA 1X54A 3U58A 4DK0A 3MC0B 1IBLQ 4RCNA 4L8JA 4XT3B 1ICWA 2BOSA 3RN2A 1BCPC 4WFN3 4OX9Q 3A5UA 5C0XG 4K0KQ 3IRBA 3ONAB 4RGTA 4V0BA 1SYDA 1A6XA 3FDTA 1DOMA 1K28A 2IX1A 4MN3A 4DA2A 2NUCA 4X66Q 2UUAQ 2ATWA 4H44C 2G9HD 2PNHA 2F0SA 3OTOQ 1BXTA 2DJGC 4LFAL 3M4OB 1PFNA 4JI4L 4GKKQ 4BBRH 1UE1A 2B29A 1VDZA 1XMOQ 2JA5G 3KBXA 4I65A 2HHHL 1GVPA 5IGFA 4Q0FA 3HOVB 5M3FG 3MFGA 2R6GA 1CQVA 1F2MA 4LUZA 1HA6A 2RSOA 5C44B 2RDGA 1Q82C 4Y7NH 4JYAL 5C5MA 1F2ZA 4CDCC 3BG3A 4K2KA 2O4XA 3UE0A 2EDGA 5C0XI 1YNXA 2Q2IA 3H94A 1I94Q 1K8OA 1QVCA 1I3QB 5JEAJ 3BU2A 2EY2A 1PZJD 1VQFA 1VQGA 2EXZA 4A3KH 3ITPA 4P71A 2Q2UA 1F2LA 4A76A 1NE3A 2ALYB 1FR3A 1D1IA 4K5XA 1SE2A 1C9OA 3SDZA 1DONA 2YU9B 2NZ1D 4BXXH 2K75A 2VB3X 4TRDA 3PO2B 1WJJA 4QIWE 2UU9L 5JOBA 4KV6A 3EROA 2YTVA 4DV3L 4L5RC 1LTGD 3S1MB 1EYDA 3BDLA 1YNJC 4JI8L 3J81c 5GQOA 4PZ7A 1ZKOA 2A68D 4FO2A 4RKBA 3L3OC 3FRPB 1M90C 1VMPA 4FXGC 2FMMA 4A3IB 3K8AA 3MTSA 4ABNA 5IP9G 5D3DA 1Z6HA 4BY7H 2VS1A 3CPFA 2OXPA 2F1MA 1N32Q 1EWHA 4DNIA 4ZCKA 2UXBL 5GAEC 1OXSC 2V4DA 3G71A 4XQNA 1G6ZA 3ZJYC 2KQ3A 1WCMG 2M00A 2PZUA 3K0XA 1JQYD 5C4XG 3ND9A 1IBKL 2B2YC 5A2QL 1WVLA 1SJHD 2I46A 2L12A 1KRTA 1K8GA 4HTHA 2CKZB 1V43A 3GTKB 4HJ7A 1FD7D 2DNEA 3EVQA 2JA7G 2JA8G 2QF7A 2R92H 4LFCL 2VQFQ 3CCVA 4K8JA 1RJTA 4J6HA 3M85A 4DV6L 2XIWA 1Y1VB 4ZUJA 1XNRL 1DD2A 1PYBA 1SSOA 1N33L 1S5ED 1B8AA 1CFMA 2ZTEA 3URYA 4A3DB 2PZWA 1SNMA 1BR9A 1PH8A 2R93G 2K6AA 2V1CC
chains in the Genus database with same CATH topology
2J0TD 1A2UA 4L63B 1LACA 4BA2I 1SE3A 3E0JA 2R61A 2CQAA 4XDXA 3G6JB 5C4ZA 1QCBD 4ZYSA 2A73B 3MZ5A 5IODA 3FVQA 3VR4A 1BBXC 3M7NA 3T51B 2F0UA 3R2IA 3HS0C 2B2VC 3QO2A 3GQBA 3I4NB 2Z4HA 2CHBD 5CYUA 1YNJD 1R9TB 5IGDA 1JOQA 4A3FB 3Q6SA 4RFBA 3NUCA 5DM63 4KK7A 5E1FA 5FOBB 4R9WA 3Q22A 3J7YW 4I7ZC 3A7LA 1GUWA 3D8GA 5FO7B 4DK1A 5JJZA 4DF7A 4BWGB 2LMCB 1G91A 1JWUD 2A69C 2Y0SB 1Q12A 4RWSC 3R8BA 3BS1A 3R3OA 3WDNA 5M5WB 2CW0C 2K01A 1F9SA 1QG7A 1HFNA 2QEJC 1IKLA 1W6KA 5KNCA 5IGEA 1NSNS 4J8QA 3GTMB 4X3TA 2F0JA 1OXVA 3DHQA 3FMCA 4TSSA 4IN3A 1BNZA 1RF2D 1EY8A 1Y8PB 4EGVA 4CHTB 4FF1A 2R7ZB 4IALA 5KNBA 3K5OA 1QOHA 4C1NK 4FNFA 3FEWX 4HR7B 3VA7A 1H9RA 5JVG3 4MHEA 4RGOS 4K14A 5D14A 2K5WA 2BE5C 1TWHB 2L11A 4Z9CB 4LJZC 1WTXA 4NDXA 1C4QA 3MA2B 4HMIA 1QE6A 4FVMA 3LWEA 4KY6A 3FPPA 3M4YA 2L4NA 1H9JA 2KEDA 2XRSD 3ERQA 2NB0A 4XT1B 1IYUA 1T5EA 4ZRZA 3OMCA 3HOXB 3J80E 1NR2A 4A3GB 2K32A 4HEDA 1F9RA 1SNOA 3P20A 1SBBB 4V190 3Q24A 2WP8J 4A3BB 1E2ZA 5CV8A 3I8ZA 5I6YA 1BF4A 1B2TA 1PFMA 3JAME 2EYJA 3AB9A 4M8AA 1A3VA 3T53B 3IFDA 2M9VA 2AQ2B 1B9NA 4KJOA 5IIFA 2PQEA 5AFWA 4CJ0B 1CA6A 3HOYB 3M3YB 1NUCA 4MIUA 5D65A 2EZVA 2IW3A 3TMEA 3TP8A 2EJFC 3PUYA 2B8FA 2F0PA 1TS5A 1RD9D 2BE5D 2K1BA 3T56B 3S2HB 2WKCA 1PLFA 1I6HB 1D6EC 2VB2X 1CI3M 3D4DA 3EJIA 4A93B 2F0LA 2VUMB 2E74C 1EY5A 4F87A 4R8NA 5C4JB 3TP5A 1SYEA 2PW5A 1IHZA 3SK4A 3GTQB 5KNDA 1RTNA 3NSWA 4ZAIA 2EJGC 4QIWB 2CVRA 1GUNA 1GXDC 3VR6A 1EIHA 1SYFA 1NR4A 3SR1A 5M5YB 1DCZA 1RHPA 1MSGA 1EYCA 2RKSA 4XYQA 2XVSA 1TKWB 1ESFA 2SNMA 1SNDA 2E76C 2OEOA 3T13A 1TIID 2Z8LA 3LNNA 4ILWA 1ENAA 2E2JB 4L6TB 5T1IA 2WIIB 2VXWA 1OXTA 5C6AA 1A3UA 2HDMA 3GV3A 1GUOA 2FMCA 2BA0A 2J7ZA 3DEOA 2D9UA 4DU9A 1JB3A 1LTAD 3A55A 1Q3LA 2RA4A 2EYPA 5EBCA 4OL7A 4G4KA 2JYOA 4G7HC 2B39A 4N9TA 4E6IA 1HFGA 1KTKA 3DMUA 5JVH3 1HA5A 5C3XA 2D2CC 2K03A 3LX0A 4CGYB 5E3FA 2GA4B 4KHZA 3A8KE 1STYA 2F0IA 2B8GA 1VF7A 1CT1D 2XN9C 2A6EC 1L0YB 2B2WA 3HKZB 2KA7A 2XRQD 5JAVA 1GHKA 2IL8A 1JWMD 3OMGA 2EOTA 1U4RA 2VNUD 3S1RB 3QWNA 4NP5A 3T16A 1I4XA 2PZTA 1UAPA 1I4PA 3HOUB 5TSSA 1B53A 2L1BA 1UNSA 4BBRB 4C1NI 1MBYA 3HOZB 3W2DA 5M9OA 1FNVA 1PYWD 5F2DA 4U68A 2DY7A 5ELCA 1A15A 4KKUA 1CTMA 4CJ2C 3RMHA 2K5QA 5EJWA 3I72A 2NVYB 3DUZA 2IWHA 1CM9A 1D2BA 4CKBA 4HAEA 3MAQA 5IT9L 3KBGA 2MJ8A 3BYYB 3PUWA 1RKNA 3PUVA 1TWCB 4IURA 2KUMA 1HUNA 1LLRD 2B2UA 2OT2A 1LT5D 2JP1A 4ZLTF 1O7LA 1QNUA 1SAPA 1PTOH 1HQRD 1U9RA 2X6GA 3HG9A 4B08A 5A2QE 2NTSA 3I73A 2MUYA 4RKLA 4FF3A 3Q23A 4QCLA 3S9WA 2Q8IB 1I4QA 1FYCA 2NWGA 4BA1I 2A6ED 3NTIA 3GO5A 1OXUA 5EKKA 5NUCA 3I3CA 4LMQD 3A8JE 3A8IE 2AUJD 4KMUC 3DWAA 5BN5A 5I9OA 3TDQA 2HUGA 1DXMA 5J39A 2BCOA 3OSOA 4NKLA 1GUSA 3I70A 2IT1A 3PIP3 3CKIB 4HCEA 4NMZA 5FO9B 2RDFA 1IKMA 3O13A 1OO9B 1ENCA 2KCCA 2F0MA 3LWUA 1EZ6A 2E75C 4KD3A 1S5BD 1K8MA 2JEAI 1ILQA 3VYTA 4C3HG 1ML0D 5LHY1 1SFOB 1KAAA 2L5TA 4QMGA 4NW2A 3MXUA 2F0NA 5C3EB 1EQTA 3VR3A 4FXDA 2RBMA 2BA1A 2FHTA 4S3SA 4IFDG 3MEHA 4O42A 1FGBD 5J1ZA 3S1QB 1B44D 1V1PA 2C5CA 4H7BA 1KLGD 3J7AV 1GHJA 4UAIA 1TT2A 3R93A 4K5VA 4DAVA 4KKTA 3C2PA 2Z1CA 3D3RA 5T1GA 3KF8A 2B2TA 3SK6A 1M8AA 2AQ1B 1AP0A 4WJWA 5CV5A 3OIQA 3K57A 4B9XA 3QG1A 3TP6A 1KNAA 2X6LA 5C0XH 3J81L 4IFDI 3QOLA 5D3IB 1D5XC 3BDCA 2SEBD 4EQOA 1AZQA 2JE6I 3L7ZC 2LFNA 3PUZA 3S14B 4DNRB 4IUQA 1ONLA 3X3NA 3VYSA 1RDPD 5FKAC 1TU2B 5COYA 1H9SA 4R8IA 4RGNA 1DYQA 3CU7A 1SNPA 1H9SB 1SEBD 1Z47A 5E4WC 4IUTA 4HSPA 1HPCA 1EEID 4RH6A 4C3HB 4BS9A 2BDOA 1G8ZD 3KK7A 3D6WA 3RZOB 1AW7A 2ICIA 2EYHA 3DWPA 1G291 4C3IB 3TN2A 3P1HA 3DEPA 4A3EB 3K6OA 1PFBA 1SNCA 4G57A 4EQNA 1WTRA 4X3UA 3TBIB 3GD7A 4C3JB 1DOKA 2N88A 2F0QA 1CA5A 2O5JC 5HGTA 1EY4A 4K6DA 2HCIA 4CBVA 3PO3B 3SVMA 4QUCA 2O2LD 3MXNA 3NWTA 4PQXA 3NTKA 5K36G 2PW7A 1U4MA 1EY6A 1JR0D 3NXWA 3HOWB 2F3WA 1LT3D 5I9PA 4G7ZC 1EZ8A 5KIXA 1QJOA 4DNTB 1TS4A 1H9KA 2L55A 1Q8IA 4RA8A 1VCIA 3HEJA 2KOLA 3OPOA 3QB3A 3H6MA 2WV6D 3QJYA 2B63B 2NVQB 5M3MB 4GZYC 2EYFA 1LO5D 2WKDA 1MI2A 1KDCA 4KY5A 1WTOA 1Q90A 1Y8NB 1KABA 3BVMA 1GOZA 1ET9A 3MFYA 1CK1A 2DN8A 1HTPA 3NPPA 1E2WA 3BYTB 2F4IA 3BVGA 1TVXA 1MSHA 5FO8B 1STNA 5EGTA 3ZYYX 1LTBD 3EQLC 4EVOA 1LT6D 2LY7A 2TSSA 1STEA 1TWAB 4WRDA 1MD2D 2QCPX 1LTRD 3TZUA 5CV7A 2HQEA 1AFPA 1O80A 2KECA 4DXGA 1B9MA 2NBFA 1CZGA 3DXJC 2F0TA 4CJ1B 4F88A 3TZDA 4Q5VA 3CRLC 1L0XB 5EBDA 3OHXC 2KVMA 4FF4A 2B2VA 2WACA 1PXUA 2B2UC 1Q1EA 1HQMC 5EPJA 5C0XJ 3L9AX 3RD4A 2IX3A 1HUMA 1KDBA 3F2UA 3OIPA 3AMUA 3MXGA 5DNFA 3OWEB 3GTLB 3KLRA 4QF4A 5ELBA 4PMWA 1EY0A 3HGBA 3SXHA 4KI0A 2EYOA 4KKSA 5I6WA 3FPUB 1OXXK 4CKCA 4F8MA 1WTPA 2MPMA 4DAPA 4CKEA 3EFXD 3FKIB 1PZKD 2PO4A 1U4PA 1V8QA 4OGQC 1G2SA 4FYDA 4DXFA 1X3QA 4K8IA 5DEHA 2HCCA 1I4GA 3C1EA 2F03A 3DWQA 3S17B 2F0WA 1ENFA 1Y1WB 2JSOA 3M7GA 3GTGB 5A35A 3W3AA 5CV4A 1PRTD 4RCOA 1CQFA 1D5MC 3S1NB 2MGSA 2AQ3B 1D1KA 3NWSA 4ZK9B 1JICA 2EY1A 3MXPA 5CBEE 2H1EA 1PRTF 4FP5D 2SNSA 5FLXL 3K59A 3MWYW 4IUVA 5JPMC 3NBIA 4C2MB 5DAUA 5IT9E 1CHQD 4IZ8A 4BY1B 4DN4M 3SK8A 3IKJA 2IX0A 1IYVA 4EQPA 2XWBB 1SYBA 1HXYD 1BQQT 3NE5B 1B3AA 1WD0A 1F77A 1STBA 2FJ2A 3IL8A 2IPKD 2JA6B 2XWJB 5EQ0A 4ULLA 1SXTA 2B2TC 1A2TA 2FINB 4BBSB 3MVVA 4Y7NB 1RCVD 1STGA 2L0CA 2NN6G 1JC7A 1EQVA 2K33A 1AZPA 1PRTB 1VMCA 4A3KB 3U9SA 1M4VA 3A56A 4JK1C 1ZEQX 2EE1A 4QB4A 3IFTA 3RUZA 2DNCA 2FFKB 2F0OA 3BZDB 1LT4D 3I90A 3P7JA 4ME5A 2EYLA 5CV6A 3GV6A 1D5ZC 1HRJA 2F0HA 2NN6I 2RQXA 2D62A 2Q8TA 3K5MA 3GP7A 2K6AA 1LTTD 1GUTA 3WOEA 5KEEA 3Q0AA 4HMJA 1RODA 4XYOA 1BDOA 1EU4A 2Q8RE 5K5PA 2R3ZA 3SE0A 5IGBA 1SJED 1GJXA 4BY7B 5JPNC 2AUKA 1I6VC 1VF5C 4DGZA 1EYAA 4JBWA 1ZYRD 4KD4A 1HTLD 4XXEA 2E2DC 3I91A 1X32A 3HP3A 4O1NA 2BDNA 3D4RA 1UEAB 4RAUC 1HHVA 2EJMA 3AU7A 3H09A 2R92B 4ZUIA 1LV9A 4X3KA 4XIGS 5CGKA 4AYBB 2C9OA 1XWEA 1SYCA 5CC4A 1TY0A 2XSCA 4KTAA 5LL6X 2WB1B 3C1FA 2AWOA 1E0BA 1PZID 3K58A 1IW7C 3H0GB 1STHA 1Z7TA 4WORA 4PV1C 5LL6S 3J81E 2F0DA 4IUNA 1TWGB 2N55A 1F9QA 1YNNC 5EKLA 5EPLA 1BCPD 3DM1A 5ELDA 2EY6A 1II3A 2EVBA 3D4WA 1FNWA 2K05A 5E4XA 3R2TA 4C3IG 2LKVA 3KLSA 4PNYA 2K7VA 1BCPF 4XTCS 4C3JG 2JA5B 2I07B 5M3FB 1V1PB 2D5DA 2MP1A 4XQJA 1CHPD 1CZWA 3BDOA 4OHJA 1A3TA 2NN6H 1K83B 2F3VA 5I4DA 2PNRC 4UDUC 3V96A 1DJRD 2NVXB 1STAA 2NYZD 4PMBA 1EFID 1LABA 3SK5A 1SMYC 3S15B 1QNKA 2EY5A 4KN7C 4U673 2A74C 1KNEA 4ZKBB 1V1OA 1SE4A 3RLFA 1SDFA 3HRZC 4N9PA 1IW7D 3OWFA 4J1MA 3GTPB 1TY2A 3NTHA 1R4PB 1I4HA 1I4RA 1WD1A 2PPBC 2A5HA 3C3LA 1BCPB 1WTQA 3NQTA 5KGUA 1C8CA 4FXKC 2F0GA 3NP8A 4KY7A 1WCMB 1YNND 2A6HC 3X3MA 3KUPA 5C4XB 3A7AB 3H3VC 4F7XA 1TWFB 3OW7A 5JEAG 4YIJA 4LAAA 1EIGA 1BOSA 4IUPA 2JA8B 2JA7B 3K7AB 1S4ZA 2KEEA 1TQOA 2F0EA 1JE4A 3NHHA 1JWSD 1EEFD 4KJNA 1IL8A 2KJXA 1JOKA 2AWNA 4FF2A 3QOJA 2F0FA 1B4OA 1F9PA 1ET6A 4LK1C 4G7OC 2R93B 3C46A 5ISRA 3RZDB 3VR5A 3IAYA 3PIO3 5EPKA 3U9OA 1KDAA 1WTWA 3ND8A 3GTOB 4KN4C 5I2XA 1UUPA 3TSSA 3OOCA 1J8IA 2QILA 5C4HA 1S5FD 4HN7A 4TKOB 5CV9A 2LS01 3UI2A 2Z4IA 1SMYD 2QDBA 5CR3A 2YYZA 2SDFA 5FK9C 4HCSA 1Y8OB 2E2HB 4HSVA 1S5DD 3VA5A 1JORA 2B2WC 5ELEA 2OF1A 1U4LA 1PDQA 2ID0A 2K5DA 1JOOA 1XYIA 1BUVT 2B2YA 2PMZB 3N6RA 3PUXA 1QB5D 3P75A 4IFDH 2G9DA 1JCKB 5BN4A 1AEXA 2A69D 2A6HD 2IJ0A 4M1UB 1DOLA 2NTTA 5C5LA 1PTOC 2KHSA 4OO1G 2CW0D 4B9WA 3VYRA 3SHLA 1PRTC 3VYUA 1XX8A 4RHRA 2ZXRA 4TQUS 5CORA 3K0YA 3CQZB 1ILPA 1EU3A 5ELFA 4OO1I 1O78A 1EY7A 1LTSD 4K5WA 2E2IB 2ZXPA 2X69A 1EL0A 2EPBA 1XTCD 3S16B 3J80L 1EWCA 4P2CB 3V05A 1QWYA 1R4QB 1XXGA 2QKIC 4ZQ3A 2MHVA 2RDHA 3PMFA 1H9MA 4ZKCB 3CRKC 5JEAH 4ODGA 5FLXE 1EY9A 2JXMB 3GTJB 3JAML 4K2LA 4H0LC 1NCVA 2K28A 3EA6A 4A3JB 4DAYA 1NAPA 2JEBI 2ENBA 2K04A 1PTOD 4A3MB 1TS2A 3BVZA 2F0KA 1AN8A 1DZ1A 1TR5A 3E6ZX 4IQZA 5K36H 4OIKA 2EYMA 5IOCA 1ESRA 1PTOF 1EOTA 3G7LA 3T4AC 2ZXOA 1X3PA 2WAQB 2WINB 5CBAE 3I4LA 1TS3A 3D31A 1W6JA 3A54A 5M5XB 1PMRA 2SOBA 1C48A 1T5XD 1I50B 1GUGA 2PYKA 2H4OA 2J4XA 3I4MB 1F2YA 1G2TA 1LTID 3MHBA 1ZXTA 5G3LD 3VR2A 5IGGA 5KYIA 3S2DB 5HURA 1DM0B 1B1ZA 2ICEC 3K5NA 1Y69U 1MGSA 3PV0A 4OIJA 2TMPA 1HCZA 1ZYRC 3KLSX 3J7AF 2NVTB 5G3LF 2HDLA 5I2YA 5C3WA 3SEBA 4IUUA 5EKIA 4OO1H 3WOFA 4XQQA 3NK9A 5J22A 5KYLA 1BO0A 3V2TA 5CMDA 4QUFA 1O7YA 2DY8A 1SNQA 1SYGA 5IGCA 4C56C 1PTOB 4IFDJ 3TP7A 4RGMA 4X3SA 3H91A 2RSNA 1WTVA 4K6LA 2KCNA 3QIAA 3K5LA 2O5IC 2F0VA 4ID6A 3NBHA 3D6CA 5BN3A 5KRUA 1KLUD 1RTOA 2A68C 1B50A 2L9HA 4DFAA 2PCFB 2XNAC 5DM73 4H13C 1S5CD 1J9OA 4PMCA 1O7ZA 1Q1BA 2M2LA 4RHSA 1FNUA 2RVLA 3E5SA 1E2VA 1QILA 3N52A 2ZT9C 3CHBD 3NQIA 3HZXA 4DK0A 3MC0B 4RCNA 4L8JA 4XT3B 1ICWA 2BOSA 1BCPC 4WFN3 5C0XG 3ONAB 4RGTA 4V0BA 1SYDA 1A6XA 1DOMA 3FDTA 2IX1A 4MN3A 4DA2A 2NUCA 4H44C 2G9HD 2F0SA 1BXTA 3M4OB 1PFNA 1VDZA 3KBXA 4I65A 3HOVB 5IGFA 4Q0FA 3MFGA 2R6GA 1CQVA 1F2MA 1HA6A 2RSOA 5C44B 2RDGA 5C5MA 1F2ZA 3BG3A 4K2KA 2O4XA 2EDGA 5C0XI 3H94A 1K8OA 1I3QB 5JEAJ 1PZJD 2EY2A 2EXZA 3ITPA 1F2LA 1FR3A 1D1IA 4K5XA 1SE2A 3SDZA 1DONA 2YU9B 2NZ1D 2VB3X 4TRDA 3PO2B 5JOBA 4KV6A 3EROA 1LTGD 3S1MB 1EYDA 1YNJC 3BDLA 1ZKOA 2A68D 4FO2A 4RKBA 3L3OC 3FRPB 1VMPA 4FXGC 2FMMA 4A3IB 3MTSA 4ABNA 5D3DA 1Z6HA 2OXPA 2F1MA 1EWHA 1OXSC 2V4DA 4XQNA 1G6ZA 2KQ3A 2M00A 2PZUA 1JQYD 3ND9A 2B2YC 5A2QL 1WVLA 1SJHD 2I46A 2L12A 4HTHA 1V43A 3GTKB 1FD7D 2DNEA 3EVQA 2QF7A 4K8JA 1RJTA 4J6HA 3M85A 2XIWA 1Y1VB 4ZUJA 1DD2A 1SSOA 1S5ED 1CFMA 3URYA 4A3DB 2PZWA 1SNMA 1BR9A 4KHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMF A;  5CC4 A;  1STG A;  4K8I A;  1A2U A;  3TME A;  3TP8 A;  1RKN A;  4N9T A;  4KTA A;  5DEH A;  3VA5 A;  4ODG A;  4E6I A;  2EY2 A;  2F0P A;  3C1F A;  3C1E A;  1EQV A;  1EY9 A;  1KAA A;  2EXZ A;  2OF1 A;  1JOR A;  3ITP A;  3NK9 A;  5J22 A;  3DMU A;  1JOO A;  5KYL A;  2F0W A;  1STN A;  4K14 A;  4N9P A;  4K2L A;  3OWF A;  4QMG A;  4J1M A;  5EGT A;  3V2T A;  5C3X A;  5C4Z A;  1U9R A;  2EYH A;  3MZ5 A;  2F0N A;  1SNQ A;  1STH A;  4K5X A;  4WOR A;  5IOD A;  4EVO A;  1SYG A;  3P1H A;  5IGC A;  3P75 A;  4QB4 A;  3TP7 A;  5CV4 A;  2F0U A;  3RUZ A;  3LX0 A;  4RKL A;  2RBM A;  1SNC A;  4WRD A;  4NDX A;  5E3F A;  4G57 A;  4EQN A;  3NQT A;  2F0D A;  4HMI A;  4S3S A;  4TRD A;  5KGU A;  3D4D A;  2F0O A;  3S9W A;  3EJI A;  2F0G A;  3NP8 A;  4IUN A;  1AEX A;  1STY A;  2ENB A;  4KY7 A;  5JOB A;  4KV6 A;  2F0I A;  3ERO A;  4KY6 A;  3MEH A;  4ME5 A;  2F0V A;  2HQE A;  2F0Q A;  5CV7 A;  2EYL A;  2F0L A;  1EYD A;  5EKL A;  3BDL A;  5CV6 A;  5J1Z A;  4ID6 A;  5C5L A;  4F7X A;  5HGT A;  5IGD A;  1EY4 A;  1EY5 A;  2KHS A;  3D6C A;  4H7B A;  2F0T A;  3ERQ A;  2EY1 A;  2F0K A;  4K6D A;  4R8N A;  1JOQ A;  2F0H A;  3MXP A;  5KRU A;  1TT2 A;  1TR5 A;  4RKB A;  2EY6 A;  1II3 A;  3NUC A;  3TP5 A;  4YIJ A;  5EKK A;  5E1F A;  4B9W A;  5JAV A;  4K5V A;  3D4W A;  3OMC A;  4LAA A;  5NUC A;  5KEE A;  4DFA A;  1SYE A;  2PW5 A;  2EYM A;  2SNS A;  4HMJ A;  1IHZ A;  3SK6 A;  3SK4 A;  3OMG A;  1TQO A;  2F0E A;  2LKV A;  2OXP A;  5IOC A;  5K5P A;  3SHL A;  4PMC A;  1SNO A;  3D8G A;  3NHH A;  2PW7 A;  4PNY A;  2WAC A;  4NP5 A;  3E5S A;  5CV5 A;  4DF7 A;  5IGB A;  3T16 A;  4KJN A;  2KQ3 A;  1EY6 A;  5DAU A;  1JOK A;  2PZT A;  4B9X A;  2M00 A;  3HZX A;  2PZU A;  5I9O A;  3TP6 A;  4IZ8 A;  3NXW A;  1SYF A;  3SR1 A;  3QOJ A;  3R3O A;  1EYA A;  4DGZ A;  2F0F A;  5CV8 A;  2F3W A;  4KD4 A;  3QOL A;  3SK8 A;  5J39 A;  2SOB A;  1KDB A;  5I6Y A;  5I9P A;  1EZ8 A;  3OSO A;  3BDC A;  4NKL A;  2PYK A;  1EYC A;  2RKS A;  5KIX A;  4EQP A;  4EQO A;  1SYB A;  1A3T A;  1SYD A;  4HTH A;  1F2Y A;  4QF4 A;  3MHB A;  2EYJ A;  2SNM A;  1SND A;  3T13 A;  2OEO A;  5ISR A;  4NMZ A;  2F3V A;  2RDF A;  1A3V A;  5M9O A;  1EY0 A;  2NUC A;  5IGG A;  3EVQ A;  3SXH A;  3HEJ A;  5IGE A;  5F2D A;  1EY7 A;  1ENA A;  1NSN S;  4K5W A;  2EYO A;  3QB3 A;  5KYI A;  1STB A;  4K8J A;  2F0S A;  3H6M A;  4J6H A;  3U9O A;  4KJO A;  2F0J A;  1KDA A;  5I6W A;  5HUR A;  4ZQ3 A;  1ENC A;  3DHQ A;  5C6A A;  1A3U A;  4ZUI A;  4ZUJ A;  2PQE A;  4F8M A;  5IIF A;  2F0M A;  4I65 A;  5IGF A;  5C4H A;  1SNP A;  1STA A;  2EYF A;  4PMB A;  1F2M A;  5CV9 A;  1EZ6 A;  4KHV A;  1NUC A;  4MIU A;  1A2T A;  1EY8 A;  1KDC A;  4KD3 A;  4KY5 A;  5C5M A;  5CGK A;  1F2Z A;  4DU9 A;  2QDB A;  3MVV A;  2PZW A;  3SK5 A;  1KAB A;  4K2K A;  4IAL A;  1SNM A;  5C3W A;  5CR3 A;  2O4X A;  1SYC A;  2EY5 A;  2EYP A;  4OL7 A; 
#chains in the Genus database with same CATH topology
 2J0T D;  4R4I A;  1A2U A;  4L63 B;  1LAC A;  4BA2 I;  1SE3 A;  3CC2 A;  1VQ6 A;  3E0J A;  3H0G H;  1HR0 L;  2R61 A;  3HKZ E;  2CQA A;  4XDX A;  3G6J B;  5C4Z A;  3RR5 A;  1QCB D;  4ZYS A;  4JI5 L;  2A73 B;  3MZ5 A;  2PQA A;  5IOD A;  4DV1 L;  3FVQ A;  4JI6 L;  3VR4 A;  1BBX C;  3M7N A;  3T51 B;  1TWG H;  2F0U A;  2PQA B;  3R2I A;  3HS0 C;  2B2V C;  3QO2 A;  4NXM Q;  3GQB A;  2MQH A;  3I4N B;  2Z4H A;  3KLW A;  2CHB D;  3TRE A;  5CYU A;  1YNJ D;  4R4C A;  1R9T B;  5IGD A;  1YIJ A;  2HD3 A;  1JOQ A;  4A3F B;  3Q6S A;  4X6A H;  1A62 A;  4IPG A;  2E8G A;  4RFB A;  3NUC A;  5DM6 3;  4KK7 A;  5E1F A;  5FOB B;  1ASY A;  4R9W A;  3Q22 A;  1UEB A;  3J7Y W;  4I7Z C;  3A7L A;  4YCW A;  4LF8 L;  3T1H L;  1GUW A;  4DV2 Q;  4NXN Q;  1IBM L;  1Q46 A;  3D8G A;  4PZ8 A;  5FO7 B;  4DK1 A;  5JJZ A;  2MNA A;  4DF7 A;  4JG2 A;  4BWG B;  2LMC B;  5M3F H;  1JWU D;  2A69 C;  2Y0S B;  1Q12 A;  4RWS C;  3R8B A;  3BS1 A;  1G91 A;  4GNX B;  2OQK A;  3R3O A;  3WDN A;  5M5W B;  1O7I A;  1GM5 A;  1K83 H;  2CW0 C;  2K01 A;  1WI5 A;  4IOC A;  4DR7 Q;  1F9S A;  1QG7 A;  1HFN A;  1VQB A;  2QEJ C;  1IKL A;  1W6K A;  1YHQ A;  5KNC A;  5IGE A;  1D8L A;  1NSN S;  4J8Q A;  3GTM B;  4X3T A;  4DAM A;  2F0J A;  1OXV A;  3DHQ A;  3FMC A;  4TSS A;  4IN3 A;  1EQQ A;  1BNZ A;  1KD1 C;  2JN4 A;  3S15 H;  1RF2 D;  3S14 H;  1EY8 A;  1Y8P B;  3E9H A;  4EGV A;  4CHT B;  3A5Z B;  4FF1 A;  2R7Z B;  4IAL A;  5KNB A;  5IE8 A;  3K5O A;  2MO1 A;  3J80 i;  1QOH A;  1PH4 A;  5LMU L;  1NJI C;  4C1N K;  4FNF A;  1J5E L;  3FEW X;  3GTP H;  5AJ3 Q;  1BBU A;  4HR7 B;  1SMX A;  3VA7 A;  1H9R A;  2DJF C;  5JVG 3;  2Q2H A;  4MHE A;  5IP9 H;  1VQM A;  4RGO S;  4LF7 L;  2Z6K A;  4K14 A;  5D14 A;  2K5W A;  2BE5 C;  4L5Q A;  1TWH B;  1MHW C;  2L11 A;  1YJ9 A;  4Z9C B;  2F3I A;  4LJZ C;  1WTX A;  1K3B C;  1WCM H;  1HZ9 A;  4NDX A;  3FHW A;  1M1K C;  1C4Q A;  1JE5 A;  3MA2 B;  4HMI A;  3RZO H;  3EN2 A;  1QE6 A;  4FVM A;  3JAM i;  3LWE A;  4KY6 A;  3FPP A;  1PHJ A;  3M4Y A;  2LSS A;  2L4N A;  2HHH Q;  1H9J A;  2KED A;  1E24 A;  2XRS D;  1X3G A;  3ERQ A;  4R4Q A;  5HY6 A;  2NB0 A;  4JYA Q;  4XT1 B;  2JA7 H;  1IYU A;  1T5E A;  4ZRZ A;  3OMC A;  3HOX B;  3J80 E;  1NR2 A;  4A3G B;  2K32 A;  4HED A;  4C3J H;  1E7Z A;  4A3J G;  2I0Q A;  1F9R A;  1SNO A;  1X6O A;  3P20 A;  1SBB B;  4V19 0;  2DUD A;  3RLO A;  3Q24 A;  4Y52 H;  2WP8 J;  4A3B B;  3JAM c;  3D0F A;  2BH2 A;  1E2Z A;  5CV8 A;  3I8Z A;  4HJ8 A;  4A3M G;  5I6Y A;  2G5D A;  1BF4 A;  1VQN A;  2JJQ A;  1B2T A;  1PFM A;  1HJP A;  2ZJR A;  3JAM E;  2EYJ A;  3AB9 A;  4M8A A;  2UU9 Q;  1A3V A;  1YIT A;  4DV3 Q;  1C0A A;  3GTO H;  3T53 B;  5IYB H;  3IFD A;  3CCM A;  4JI8 Q;  2M9V A;  2AQ2 B;  3KDF A;  1B9N A;  4KJO A;  2WAQ G;  2N3S A;  5IIF A;  2PQE A;  5AFW A;  4CJ0 B;  3E9I A;  1CA6 A;  1T9H A;  3HOY B;  3STB D;  3M3Y B;  2RCF A;  1NUC A;  4MIU A;  1JMC A;  5D65 A;  2EZV A;  2E2H H;  3I4M G;  2IW3 A;  1C7Y A;  3TME A;  3TP8 A;  1VQ9 A;  2EJF C;  3PUY A;  2B63 H;  4QJF A;  2B8F A;  1IBK Q;  2NVQ H;  2F0P A;  1TS5 A;  3QR8 A;  1RD9 D;  2EXD A;  2BE5 D;  1YBY A;  2K1B A;  4UP8 A;  3T56 B;  1CKO A;  3S2H B;  5FLX c;  1K0R A;  1ASZ A;  2WKC A;  1PLF A;  4LFC Q;  1I6H B;  1D6E C;  2VB2 X;  3CCU A;  1CI3 M;  3D4D A;  4OEM B;  3EJI A;  4DV6 Q;  4JI1 L;  3NEL A;  1SRO A;  4A93 B;  1XNR Q;  2F0L A;  2VUM B;  1L1O A;  2E74 C;  1EY5 A;  3AQQ A;  4R8N A;  4F87 A;  1N33 Q;  5IYD H;  3DLL A;  5C4J B;  5JJK A;  1GD7 A;  4JBM A;  3TP5 A;  4HJ5 A;  2AKW B;  1SYE A;  2PW5 A;  1UE7 A;  1YVC A;  1IHZ A;  3SK4 A;  3GTQ B;  5KND A;  1RTN A;  4GLV B;  3NSW A;  2EJG C;  1HZB A;  4QIW B;  4ZAI A;  4DAY B;  2CVR A;  2N49 A;  1GUN A;  3CQZ H;  1GXD C;  3VR6 A;  1EIH A;  1SYF A;  1NR4 A;  3SR1 A;  5M5Y B;  1DCZ A;  1RHP A;  3CD6 A;  1MSG A;  4DV1 Q;  4JI6 Q;  1EYC A;  2RKS A;  4XYQ A;  2XVS A;  3HOZ G;  1TKW B;  1E22 A;  1ESF A;  2SNM A;  1SND A;  2E76 C;  2OEO A;  3T13 A;  4KHP Q;  1TII D;  2Z8L A;  3LNN A;  4ILW A;  1ENA A;  2E2J B;  4L6T B;  5T1I A;  3G4S A;  2WII B;  2VXW A;  1OXT A;  1K3R A;  2UUC L;  2K52 A;  5C6A A;  1A3U A;  2HDM A;  4YWM A;  3GV3 A;  3GTL H;  1GUO A;  5GAG C;  4DV0 L;  2FMC A;  2BA0 A;  4JI3 L;  1PH7 A;  2J7Z A;  3DEO A;  4LF8 Q;  2D9U A;  4DU9 A;  2GVB A;  1JB3 A;  1LTA D;  3A55 A;  1Q3L A;  2RA4 A;  2EYP A;  5EBC A;  1VQ7 A;  4OL7 A;  4G4K A;  2JYO A;  1YI2 A;  4G7H C;  4DR3 L;  2B39 A;  4J15 A;  4N9T A;  4E6I A;  1HFG A;  2CQO A;  3FKI H;  3A0J A;  1KTK A;  1RL2 A;  2YTX A;  1SR3 A;  4EX5 A;  2CWA A;  1UWV A;  3DMU A;  5JVH 3;  3H3V H;  1HA5 A;  2OTJ A;  5C3X A;  4A3J H;  2D2C C;  3HOV G;  2K03 A;  5C44 G;  4QY7 A;  4DK6 C;  2XTI A;  4JOI A;  3LX0 A;  4CGY B;  5E3F A;  2GA4 B;  4KHZ A;  1V9P A;  2ZM6 L;  3CME A;  3A8K E;  1STY A;  4A3M H;  3S17 H;  2F0I A;  2B8G A;  1VF7 A;  1CT1 D;  2XN9 C;  2VL6 A;  2A6E C;  1L0Y B;  3Q8D A;  4DV7 L;  2B2W A;  3HKZ B;  2KA7 A;  2RCN A;  2XRQ D;  3FP9 A;  3UDX A;  3BZK A;  5JAV A;  1WYD A;  1GHK A;  2IL8 A;  1JWM D;  5FJ8 G;  4UPA A;  3OMG A;  2EOT A;  3S1N H;  1U4R A;  2VNU D;  3S1R B;  3QWN A;  2FXQ A;  4NP5 A;  3PO2 G;  3T16 A;  5M5X H;  4GN3 B;  1I4X A;  2PZT A;  1UAP A;  1I4P A;  3HOU B;  5TSS A;  1B53 A;  2L1B A;  1UNS A;  3I4M H;  4BBR B;  4C1N I;  1MBY A;  3NBH B;  3HOZ B;  4DV5 Q;  4IPD A;  2HIX A;  4MTK A;  1NMF A;  4AQY L;  1KC8 C;  4A3I G;  1K9M C;  3W2D A;  2I5L X;  5M9O A;  1FNV A;  4C2M H;  1PYW D;  5F2D A;  4U68 A;  2DY7 A;  5ELC A;  1A15 A;  4LF5 L;  4KKU A;  2Z6B A;  3K81 C;  1CTM A;  1RIP A;  4CJ2 C;  3RMH A;  2K5Q A;  5EJW A;  3I72 A;  2RHS B;  2NVY B;  3DUZ A;  3BJU A;  2IWH A;  1CM9 A;  1D2B A;  4CKB A;  4HAE A;  3MAQ A;  5IT9 L;  3KBG A;  4NB3 A;  4GNX C;  3PGZ A;  2MJ8 A;  3BYY B;  3PUW A;  1N36 L;  1RKN A;  3PUV A;  1TWC B;  4IUR A;  2KUM A;  2JA6 H;  1VQK A;  1LLR D;  1HUN A;  3AFQ A;  2B2U A;  2OT2 A;  1LT5 D;  4GLA C;  2JP1 A;  4ZLT F;  3CCS A;  1O7L A;  1QNU A;  1SAP A;  2UUB Q;  1Y1V G;  2YTY A;  1PTO H;  1HQR D;  4BBS H;  2R7D A;  1U9R A;  2X6G A;  4YWK A;  3HG9 A;  1VQP A;  2K4K A;  4B08 A;  2Z9H A;  5A2Q E;  2NTS A;  3I73 A;  4LW1 A;  2MUY A;  2Z0S A;  4RKL A;  1PVO A;  4A3D G;  4FF3 A;  3Q23 A;  4QCL A;  3S9W A;  4HJA A;  1VQC A;  4KLK A;  2Q8I B;  1I4Q A;  1FYC A;  5GRO A;  2NWG A;  4BA1 I;  5JJL A;  2A6E D;  2OQ0 A;  3NTI A;  3GO5 A;  4GKJ L;  1OXU A;  4DV4 Q;  5EKK A;  5NUC A;  3I3C A;  1E1O A;  1PH1 A;  3M4P A;  4LMQ D;  4L5S A;  2HQL A;  4JI0 L;  3A8J E;  3A8I E;  2AUJ D;  3U50 C;  3I4N G;  2MFI A;  4KMU C;  1QUQ A;  5IP7 G;  3DWA A;  5BN5 A;  2L15 A;  5I9O A;  3TDQ A;  2Z6K C;  3T1Y Q;  4LFB Q;  2HUG A;  1DXM A;  5J39 A;  3NEN A;  2BCO A;  4A3F G;  3CMA A;  3OSO A;  4NKL A;  4X62 L;  1GUS A;  4DR5 L;  3I70 A;  4DUY L;  2IT1 A;  3PIP 3;  1MJE A;  4DPG A;  3CKI B;  4HCE A;  1N9W A;  4NMZ A;  5FO9 B;  3M4O H;  2RDF A;  1IKM A;  3O13 A;  2QDL A;  1OO9 B;  3HOV H;  4YWL A;  1ENC A;  2Y0S G;  2KCC A;  5C44 H;  2F0M A;  3B6Y A;  2CFM A;  4OON A;  2CH4 A;  1X65 A;  4X65 L;  3LWU A;  1EZ6 A;  4KHV A;  2E75 C;  4KD3 A;  1S5B D;  1K8M A;  1I3Q H;  2JEA I;  1ILQ A;  2KBN A;  4IPH A;  3VYT A;  4C3H G;  1LYL A;  1ML0 D;  5LHY 1;  3U4Z A;  1SFO B;  1KAA A;  2MO0 A;  3J7A 5;  5DLQ E;  3L0O A;  2L5T A;  4QMG A;  1SLJ A;  3ER0 A;  4NW2 A;  1W3S A;  3MXU A;  1CUK A;  2F0N A;  5C3E B;  3PO2 H;  1EQT A;  3KF6 A;  3VR3 A;  3I55 A;  4FXD A;  2RBM A;  2BA1 A;  2IHE A;  2FHT A;  2R7Z G;  4S3S A;  3CCQ A;  3CCL A;  3KYH C;  2UUC Q;  4IFD G;  3MEH A;  1NMG A;  4O42 A;  1FGB D;  5J1Z A;  3S1Q B;  1B44 D;  1XMQ L;  4JI3 Q;  3OW2 A;  1V1P A;  2C5C A;  4H7B A;  1KLG D;  5GAH C;  3J7A V;  1MKH A;  2GVA A;  4A3I H;  1GHJ A;  3PIP A;  4UAI A;  3TQY A;  1TT2 A;  3R93 A;  2JQO A;  3K7U C;  4K5V A;  1L0W A;  1SRU A;  4DAV A;  4KKT A;  3C2P A;  2Z1C A;  3D3R A;  5T1G A;  3KF8 A;  2B2T A;  3SK6 A;  4DR3 Q;  1M8A A;  2UXD L;  2AQ1 B;  1AP0 A;  4WJW A;  5CV5 A;  4DR2 L;  3OIQ A;  3K57 A;  1KHI A;  4R4T A;  1YEZ A;  4B9X A;  1V1Q A;  1JJC B;  1B3Q A;  3QG1 A;  3TP6 A;  1KNA A;  2X6L A;  5C0X H;  3J81 L;  3GDE A;  3QOL A;  4IFD I;  5D3I B;  1D7Q A;  1NNX A;  1D5X C;  3BDC A;  4P72 A;  1VQJ A;  2SEB D;  4EQO A;  1AZQ A;  2JE6 I;  3L7Z C;  5IWA L;  2LFN A;  3HOX G;  3PUZ A;  2ZM6 Q;  2B3G A;  3S14 B;  4DNR B;  4IUQ A;  4A3G G;  1ONL A;  3X3N A;  1Y1V H;  3VYS A;  2JA5 H;  1KAW A;  1RDP D;  5FKA C;  1L1O C;  4DV7 Q;  1TU2 B;  2NZO A;  3CW2 C;  5COY A;  1K8A C;  3I56 A;  4YCV A;  1XPR A;  1H9S A;  1X56 A;  4R8I A;  4A3B G;  4RGN A;  1DYQ A;  1ICF B;  3CU7 A;  4A3D H;  1SNP A;  1H9S B;  1SEB D;  1Z47 A;  5E4W C;  4IUT A;  3OYY A;  4HSP A;  1HPC A;  1EEI D;  3M4Q A;  2N8N A;  4RH6 A;  4IPC A;  1NTG A;  4C3H B;  4BS9 A;  2BDO A;  1G8Z D;  3KK7 A;  1VQA A;  3D6W A;  3RZO B;  1U0L A;  2NVX H;  4IO9 A;  1AW7 A;  4PZ6 A;  4AIM A;  4B3M Q;  3I7F A;  5L37 A;  2ICI A;  4B3R L;  2EYH A;  3DWP A;  3HOY G;  1G29 1;  4C3I B;  3TN2 A;  3P1H A;  3STB C;  2IHF A;  3DEP A;  4A3E B;  3K6O A;  1PFB A;  1SNC A;  1SE8 A;  1G51 A;  4G57 A;  4EQN A;  1WTR A;  4X3U A;  3TBI B;  4LF5 Q;  1R9T H;  3GD7 A;  4C3J B;  1DOK A;  4A75 A;  4A3F H;  3F2D A;  2N88 A;  1X3E A;  2F0Q A;  1LM0 A;  1CA5 A;  2O5J C;  5HGT A;  1EY4 A;  4K6D A;  2HCI A;  4CBV A;  2AHO B;  4DR4 L;  3PO3 B;  1NBW A;  3SVM A;  4TVA B;  4QUC A;  1N36 Q;  2O2L D;  3MXN A;  3NWT A;  2KEN A;  4PQX A;  5C4X H;  3NTK A;  4LFA Q;  5K36 G;  2PW7 A;  1U4M A;  4JI4 Q;  5M5W H;  3F8T A;  1S72 A;  1TWF H;  1EY6 A;  4JPB W;  3J80 c;  4A93 G;  1JR0 D;  3NXW A;  2VUM G;  3HOW B;  2F3W A;  3A74 A;  1LT3 D;  1FL0 A;  4LNQ A;  5I9P A;  4G7Z C;  1EZ8 A;  1UE6 A;  5KIX A;  1MIU A;  2JA8 H;  3K7A H;  2ZJP A;  4JOI C;  1QJO A;  1VQD A;  4AYB E;  4DNT B;  1TS4 A;  1H9K A;  3GTM H;  2L55 A;  4UP7 A;  1Q8I A;  4RA8 A;  1K73 C;  1VCI A;  3HEJ A;  2KOL A;  3UDI A;  3OPO A;  3QB3 A;  3H6M A;  4HJ9 A;  2WB1 E;  4A3C G;  5LMN W;  3F2B A;  2WV6 D;  3QJY A;  1GO3 E;  1VQ4 A;  4POF A;  2B63 B;  3G6E A;  2NVQ B;  2KCM A;  5M3M B;  3ICE A;  4GZY C;  2EYF A;  1LO5 D;  2WKD A;  1EYG A;  2R93 H;  1MI2 A;  3RZD H;  1KDC A;  4KY5 A;  1PFS A;  1WTO A;  1QVG A;  1Q90 A;  4OWX B;  4JI0 Q;  1Y8N B;  1KAB A;  3BVM A;  1GOZ A;  1ET9 A;  3MFY A;  1CK1 A;  2F4V L;  4X66 L;  2DN8 A;  4B3S L;  1HTP A;  3PF4 A;  3NPP A;  1E2W A;  3OTO L;  3BYT B;  3F2C A;  2F4I A;  3TEH B;  3BVG A;  1TVX A;  1MSH A;  5FO8 B;  4X62 Q;  1XTD A;  3KDF B;  4DUY Q;  1STN A;  1XMO L;  5EGT A;  3WWV A;  3ZYY X;  2LXJ A;  1LTB D;  3EQL C;  4EVO A;  1LT6 D;  3ULL A;  2LY7 A;  2BH8 A;  2TSS A;  1STE A;  1U5K A;  1TWA B;  4WRD A;  2UXB Q;  1MD2 D;  2QCP X;  1LTR D;  3TZU A;  1A8V A;  3DM3 A;  2ES2 A;  1I94 L;  5CV7 A;  2HQE A;  1BVS A;  1AFP A;  1O80 A;  2KEC A;  4DXG A;  1B9M A;  1X3F A;  2NBF A;  1CZG A;  3DXJ C;  3HOX H;  2F0T A;  4X65 Q;  4CJ1 B;  4F88 A;  2IY5 B;  3TZD A;  4Q5V A;  4N8F A;  3CRL C;  1PH3 A;  1L0X B;  5EBD A;  1GKH A;  4UP9 A;  3OHX C;  2KVM A;  4FF4 A;  2B2V A;  3BZC A;  3CCJ A;  4A3B H;  2WAC A;  1PH6 A;  1PXU A;  2B2U C;  1Q1E A;  1VQE A;  1HQM C;  5EPJ A;  5C0X J;  3L9A X;  3RD4 A;  2IX3 A;  1HUM A;  4APV A;  1KDB A;  3F2U A;  3HKZ G;  1L1O B;  3OIP A;  4P73 A;  3AMU A;  3MXG A;  5DNF A;  3OWE B;  3GTL B;  3KLR A;  3E3X A;  4QF4 A;  5ELB A;  1VQO A;  2E5L L;  4PMW A;  1EY0 A;  3HGB A;  2NZH A;  3SXH A;  4KI0 A;  2EYO A;  4KKS A;  2ZTC A;  1N32 L;  1IXR A;  1HR0 Q;  1Q86 C;  3MEF A;  3HOY H;  1VQI A;  5I6W A;  3FPU B;  1OXX K;  4CKC A;  4F8M A;  2D0P A;  3J7Z C;  1WTP A;  2MPM A;  4DAP A;  3HOU G;  4CKE A;  4JI5 Q;  3EFX D;  3FKI B;  3KJO A;  1PZK D;  4BBR G;  2PO4 A;  1U4P A;  2UXD Q;  1V8Q A;  4OGQ C;  1G2S A;  2E2I H;  4FYD A;  2F52 A;  4DXF A;  4DR2 Q;  4UHV A;  1X3Q A;  4K8I A;  3S16 H;  2QGQ A;  5DEH A;  1H95 A;  2HCC A;  1I4G A;  3C1E A;  3M9B A;  2F03 A;  3DWQ A;  3S17 B;  2OWO A;  3S2H H;  2F0W A;  1KXL A;  5IWA Q;  1ENF A;  1FVI A;  1Y1W B;  2JSO A;  1I6H H;  1JT8 A;  3M7G A;  3GTG B;  3PSI A;  2K5H A;  5A35 A;  3T1H Q;  1B70 B;  3W3A A;  5CV4 A;  4I7A A;  1TXY A;  4A93 H;  1PRT D;  1IBM Q;  1BKB A;  4RCO A;  4CDF C;  1S3O A;  4DKA C;  1CQF A;  4JCV E;  4GN5 A;  3GTJ H;  1D5M C;  3S1N B;  5C4J H;  1HNX L;  2MGS A;  2AQ3 B;  2OCE A;  4LUV A;  3I4O A;  1D1K A;  3NWS A;  4ZK9 B;  1KL9 A;  1JIC A;  2EY1 A;  3MXP A;  5CBE E;  2UXC L;  1G6P A;  2H1E A;  2H5X A;  1PRT F;  3GTQ H;  4B3T L;  4FP5 D;  1JJ2 A;  2SNS A;  4A3C H;  5FLX L;  3CXC A;  3K59 A;  1VQL A;  3MWY W;  4IUV A;  4YCU A;  5JPM C;  5ELO A;  3NBI A;  2JA9 A;  4C2M B;  5DAU A;  5IT9 E;  5JJI A;  1CHQ D;  4IZ8 A;  4HIM A;  4BY1 B;  4B3R Q;  4DN4 M;  1L2F A;  1JB7 A;  1XNQ L;  3SK8 A;  3IKJ A;  1QZG A;  2IX0 A;  1IYV A;  1AE2 A;  4EQP A;  5IYC G;  2XWB B;  1SYB A;  1HXY D;  1KRS A;  1BQQ T;  4YHH L;  2QEX A;  3NE5 B;  1B3A A;  2E2J H;  3CCE A;  4IOA A;  1WD0 A;  1F77 A;  4RG1 A;  1HZC A;  2KHJ A;  5LMU Q;  1STB A;  1J5E Q;  2FJ2 A;  3IL8 A;  4LF7 Q;  1I50 H;  3W5O A;  2IPK D;  4DR4 Q;  2JK8 A;  1Y14 B;  2JA6 B;  3LGJ A;  4MZ9 A;  2PMZ E;  2XWJ B;  5EQ0 A;  4ULL A;  1SXT A;  5ELN A;  1B7Y B;  2B2T C;  1A2T A;  2FIN B;  3AYH B;  4BBS B;  4P74 A;  3MVV A;  1CKN A;  3S2D H;  4Y7N B;  1RCV D;  1STG A;  4OWT B;  5EAY A;  4YY3 L;  2L0C A;  1HZA A;  2NN6 G;  3UDF A;  1JC7 A;  4DUZ L;  1EQV A;  2K33 A;  1AZP A;  2NVT H;  1PRT B;  1VMC A;  1P8L A;  4A3K B;  3U9S A;  1M4V A;  3A56 A;  4JK1 C;  1ZEQ X;  2EE1 A;  1XJV A;  4QB4 A;  3AFP A;  3IFT A;  3RUZ A;  4JC0 A;  1JJG A;  2DNC A;  2FFK B;  2F0O A;  1EQR A;  3BZD B;  1LT4 D;  3I90 A;  3P7J A;  1UE5 A;  3EBE A;  4ME5 A;  2EYL A;  5CV6 A;  3GV6 A;  1D5Z C;  2QA4 A;  2I5M X;  5AJ3 L;  1YJW A;  1HRJ A;  1MJC A;  2F0H A;  2NN6 I;  4HID A;  2RQX A;  2D62 A;  4O2D A;  2Q8T A;  2CH4 W;  3K5M A;  3GP7 A;  1LTT D;  1GUT A;  3WOE A;  5KEE A;  3Q0A A;  3S1R H;  1PA6 A;  5C3E G;  2AMC B;  1ROD A;  4HMJ A;  4XYO A;  1BDO A;  1EU4 A;  2F4V Q;  4LF4 L;  4H02 A;  2Q8R E;  5K5P A;  2R3Z A;  4B3S Q;  3SE0 A;  3HOU H;  5IGB A;  1FJG L;  2OTL A;  1SJE D;  1GJX A;  4BY7 B;  5JPN C;  2AUK A;  1I6V C;  3HOZ H;  1VF5 C;  3PQI A;  4DGZ A;  1EYA A;  4JBW A;  1ZYR D;  1BBW A;  4KD4 A;  1WFQ A;  1HTL D;  4XXE A;  2E2D C;  3I91 A;  1N8R C;  2HIV A;  1X32 A;  1YZ6 A;  3HP3 A;  4O1N A;  2BDN A;  3D4R A;  1UEA B;  2VY3 A;  4RAU C;  2K14 A;  3J81 i;  5HGQ A;  1HHV A;  2EJM A;  1AH9 A;  1FGU A;  3AU7 A;  3H09 A;  2R92 B;  4ZUI A;  1PH5 A;  1LV9 A;  2K5N A;  2NVY H;  1WTH A;  4X3K A;  1QUQ B;  4XIG S;  5J3B A;  1I5F A;  5CGK A;  4AYB B;  4QGU A;  3CC4 A;  1Z9F A;  2C9O A;  1XWE A;  1TWC H;  4A3L G;  1SYC A;  4JI1 Q;  1LUZ A;  5CC4 A;  2LXK A;  1TY0 A;  2XSC A;  4KTA A;  5LL6 X;  2WB1 B;  3C1F A;  2AWO A;  3NEM A;  1E0B A;  1PZI D;  3K58 A;  1IW7 C;  1A63 A;  3H0G B;  3CC7 A;  1STH A;  1Z7T A;  4WOR A;  1P16 A;  4PV1 C;  5LL6 S;  2E5L Q;  3J81 E;  2ZTD A;  1HNW L;  4MTN A;  2I5H A;  4DK3 C;  2F0D A;  4IUN A;  2K5V A;  1TWG B;  1KIX A;  2WAQ E;  2N55 A;  1F9Q A;  2KHI A;  5IYC H;  1YNN C;  4OWW B;  5EKL A;  2PI2 A;  3RN5 A;  5EPL A;  1BCP D;  2YU9 H;  3DM1 A;  5ELD A;  5FJ8 H;  2EY6 A;  1II3 A;  2EVB A;  3D4W A;  1FNW A;  2K05 A;  5E4X A;  3J81 j;  3R2T A;  4C3I G;  1EFW A;  2VQE L;  1VQ5 A;  2LKV A;  3KLS A;  1IYJ B;  4A3E G;  1VQH A;  3S1M H;  5LMN L;  2VW9 A;  4PNY A;  2K7V A;  3KF6 B;  1BCP F;  3UDG A;  4XTC S;  4C3J G;  4WJ3 M;  1HH2 P;  2JA5 B;  4DV0 Q;  1YHA A;  3KOJ A;  2I07 B;  5M3F B;  3TRZ A;  2K50 A;  1V1P B;  2D5D A;  2MP1 A;  4XQJ A;  1QVF A;  1CHP D;  1CZW A;  2C35 B;  3PO3 G;  4ME3 A;  3BDO A;  4OHJ A;  2NN6 H;  1A3T A;  4DR1 L;  1K83 B;  1S40 A;  4HIO A;  2F3V A;  5I4D A;  4JVZ A;  1HNX Q;  3KF8 B;  4JI7 L;  1A0I A;  2PNR C;  4UDU C;  3V96 A;  2UXC Q;  5IYB G;  1DJR D;  4B3T Q;  3K80 C;  4R1J A;  3HOW G;  4GOP A;  2NVX B;  1STA A;  2NYZ D;  4PMB A;  1OTC A;  3GTK H;  1EFI D;  4GOP B;  3EIV A;  1LAB A;  4JV5 L;  3SK5 A;  2P5Z X;  1SMY C;  3S15 B;  1QNK A;  2EY5 A;  1SFO H;  4KHP L;  4KN7 C;  4U67 3;  2A74 C;  3ERS X;  1KNE A;  4UY8 C;  1EWI A;  1SN8 A;  4LF9 L;  1X55 A;  4ZKB B;  1V1O A;  1SE4 A;  4IJH A;  1XNQ Q;  4JBJ A;  3RLF A;  5C3E H;  1SDF A;  4X64 L;  3HRZ C;  4N9P A;  1IW7 D;  3OWF A;  4J1M A;  2B63 G;  4YHH Q;  1N34 L;  1TY2 A;  1XPU A;  3NTH A;  5M3M G;  1HNZ L;  3GTP B;  1R4P B;  1I4H A;  1I4R A;  1WD1 A;  4OEL B;  2PPB C;  1E1T A;  2EQS A;  2A5H A;  3C3L A;  1BCP B;  1EIF A;  1WTQ A;  3NQT A;  4JI2 L;  5KGU A;  4MNO A;  1C8C A;  4GNX A;  3S1Q H;  4FXK C;  2F0G A;  3NP8 A;  4KY7 A;  1WCM B;  2RHQ B;  4LF6 L;  1CSQ A;  1YNN D;  2A6H C;  3X3M A;  3KUP A;  5C4X B;  1IZ6 A;  4N8X 1;  3A7A B;  3S24 A;  3H3V C;  4F7X A;  1TWF B;  3OW7 A;  5BR8 L;  5JEA G;  4WJ4 A;  4YIJ A;  4LAA A;  4AQY Q;  3TS2 A;  5IYD G;  3KFU A;  1EIG A;  1BOS A;  4IUP A;  3I4N H;  3HFZ B;  2JA8 B;  2JA7 B;  3K7A B;  1S4Z A;  2KEE A;  5IP7 H;  1TQO A;  2F0E A;  4YY3 Q;  1JE4 A;  2R7F A;  3NHH A;  4DUZ Q;  1JWS D;  3ULP A;  4QQB X;  1EEF D;  1PYS B;  4KJN A;  4DR6 L;  1IL8 A;  3G48 A;  2KJX A;  1JOK A;  3E0E A;  2AWN A;  1XPO A;  4FF2 A;  3QOJ A;  2F0F A;  4A3L H;  1B4O A;  1F9P A;  1ET6 A;  4LK1 C;  2KCT A;  4G7O C;  2R93 B;  3C46 A;  5ISR A;  3RZD B;  3VR5 A;  3IAY A;  3CF5 A;  3PIO 3;  3CPW A;  3JC6 6;  3MXN B;  5EPK A;  3U9O A;  3CP0 A;  5IY0 A;  1KDA A;  2XGT A;  1WTW A;  3ND8 A;  3UE1 A;  3GTO B;  4KN4 C;  5I2X A;  1UUP A;  3TSS A;  3OOC A;  1J8I A;  2QIL A;  4AH6 A;  5C4H A;  1S5F D;  4HN7 A;  4TKO B;  5CV9 A;  3SGI A;  4C3H H;  4LF4 Q;  2LS0 1;  3UI2 A;  2Z4I A;  4DV5 L;  1SMY D;  2QDB A;  1FJG Q;  5CR3 A;  2YYZ A;  2SDF A;  5FK9 C;  1YJN A;  4HCS A;  1Y8O B;  2E2H B;  4HSV A;  1S5D D;  3VA5 A;  4RMF A;  4FDB A;  1JOR A;  2B2W C;  5ELE A;  2OF1 A;  1U4L A;  4GKJ Q;  1PDQ A;  3VDY A;  4C3I H;  2ID0 A;  2K5D A;  1JOO A;  3PCO B;  2WFW A;  1XYI A;  1BUV T;  1IBL L;  4A3E H;  2B2Y A;  2PMZ B;  3FKI G;  2R7Z H;  3N6R A;  3PUX A;  1QB5 D;  3P75 A;  4IFD H;  2G9D A;  4R4O A;  4OX9 L;  1JCK B;  1Q7Y C;  4K0K L;  4LWC A;  5BN4 A;  4OXP A;  1AEX A;  2A69 D;  2A6H D;  2IJ0 A;  2QW7 A;  4M1U B;  2EIF A;  1DOL A;  2UUA L;  2NTT A;  4JW0 A;  2A8V A;  3PO3 H;  5C5L A;  1PV4 A;  1PTO C;  2KHS A;  4OO1 G;  4A4I A;  2CW0 D;  4GKK L;  1TWH H;  4DR5 Q;  1HR0 W;  2UUB L;  2PI2 E;  4B9W A;  3H15 A;  1Y1W G;  4IJL A;  3VYR A;  2YV5 A;  1K0S A;  1Q81 C;  3PIO A;  3SHL A;  1EUJ A;  1PRT C;  3VYU A;  3H3V I;  3HOW H;  1XX8 A;  4RHR A;  1LTL A;  2ZXR A;  1EOV A;  4TQU S;  5FLM G;  5COR A;  3K0Y A;  4A3G H;  3CQZ B;  1ILP A;  1EU3 A;  4DV4 L;  5ELF A;  1HNW Q;  4OO1 I;  1O78 A;  1EY7 A;  1LTS D;  4K5W A;  4GS3 A;  2E2I B;  2ZXP A;  2X69 A;  5M3M H;  2EPB A;  4P75 A;  1EL0 A;  1XTC D;  3S16 B;  3J80 L;  3CAM A;  3T1Y L;  1EWC A;  4BY1 G;  4P2C B;  3V05 A;  4LFB L;  3RLN A;  1QWY A;  2VQE Q;  1R4Q B;  1XXG A;  2QKI C;  5LMN Q;  4ALP A;  4ZQ3 A;  2MHV A;  1DGS A;  2RDH A;  3RNU A;  3PMF A;  1H9M A;  4ZKC B;  5GAD C;  3CRK C;  1NY4 A;  5JEA H;  4ODG A;  1XMQ Q;  5FLX E;  1EY9 A;  2JXM B;  3GTJ B;  3M3Y H;  3JAM L;  4K2L A;  4H0L C;  2JA6 G;  4LUO A;  1TWA H;  1NCV A;  4DR1 Q;  2GN5 A;  3I2Z A;  2K28 A;  3EA6 A;  4A3J B;  4DAY A;  4BBS G;  1NAP A;  4JI7 Q;  2JEB I;  1VS0 A;  2ENB A;  2K04 A;  4CDE C;  2Y0S E;  2VQF L;  1PTO D;  4A3M B;  1TS2 A;  1KQS A;  3BVZ A;  2F0K A;  4L5T A;  1AN8 A;  1DZ1 A;  1TR5 A;  1W2B A;  1X9N A;  4JV5 Q;  3E6Z X;  4IQZ A;  4A3K G;  4GLX A;  5K36 H;  1Q8K A;  1J6Q A;  2EYM A;  4OIK A;  2Q2T A;  5IOC A;  1ESR A;  1PTO F;  3TS0 A;  1EOT A;  4LF9 Q;  3G7L A;  2VUM H;  3T4A C;  3U4V A;  1VQ8 A;  2CCZ A;  2ZXO A;  1X3P A;  4X64 Q;  2WAQ B;  2WIN B;  4GN4 B;  5CBA E;  3I4L A;  4BXX G;  1TS3 A;  3D31 A;  1N34 Q;  1W6J A;  1HNZ Q;  3A54 A;  1QZH A;  5M5X B;  1PMR A;  2SOB A;  4CDD C;  1C48 A;  1I50 B;  1T5X D;  1GUG A;  2PYK A;  2H4O A;  5H1S E;  4O0A A;  4JBK A;  2J4X A;  4JI2 Q;  3I4M B;  1F2Y A;  5IT9 c;  1G2T A;  3MHB A;  1LTI D;  2CWP A;  1YHB A;  1ZXT A;  5G3L D;  3VR2 A;  4LF6 Q;  5IGG A;  2HT1 A;  1PH9 A;  2DGY A;  5KYI A;  5M5Y H;  4NXM L;  3S2D B;  5E7N A;  2RF4 A;  4EQ5 A;  5BR8 Q;  5HUR A;  4BY7 G;  1DM0 B;  1B1Z A;  2A1A A;  2ICE C;  2ZJQ A;  3K5N A;  1PH2 A;  2VZA A;  1Y69 U;  1MGS A;  3PV0 A;  4OIJ A;  2TMP A;  1HCZ A;  1WOC A;  1ZYR C;  3KLS X;  3J7A F;  2NVT B;  5G3L F;  3W1G A;  2HDL A;  5I2Y A;  2N78 A;  1AE3 A;  5C3W A;  3SEB A;  4IUU A;  4DR6 Q;  5EKI A;  4OO1 H;  4DV2 L;  4HIK A;  3WOF A;  4NXN L;  3AEV A;  1IL2 A;  4XQQ A;  1Y1W H;  3NK9 A;  3HKS A;  5J22 A;  3GTG H;  2R92 G;  5KYL A;  1BO0 A;  3F1Z A;  3V2T A;  5CMD A;  4QUF A;  1O7Y A;  2DY8 A;  1SNQ A;  1SYG A;  5IGC A;  4C56 C;  1PTO B;  4IFD J;  3TP7 A;  4RGM A;  3KJP A;  4POG A;  4AYB G;  3PF5 A;  3W1B A;  4X3S A;  4DR7 L;  3H91 A;  2D0O A;  3L2P A;  2RSN A;  5FLM H;  1WTV A;  4K6L A;  2KCN A;  3QIA A;  1CKN B;  3K5L A;  2O5I C;  1CSP A;  2F0V A;  4QL5 A;  2WB1 G;  4ID6 A;  3NBH A;  3ULJ A;  4GOP C;  3D6C A;  5BN3 A;  1CKM A;  5KRU A;  1KLU D;  1RTO A;  2A68 C;  4PG3 A;  1EIY B;  4B3M L;  3CCR A;  1B50 A;  2L9H A;  3H0G G;  2ASB A;  4DFA A;  2PCF B;  2XNA C;  5DM7 3;  4H13 C;  1S5C D;  1J9O A;  2A19 A;  4PMC A;  1O7Z A;  1Q1B A;  2M2L A;  4RHS A;  1FNU A;  1E3P A;  2RVL A;  3E5S A;  4NPS A;  4BY1 H;  1E2V A;  1QIL A;  3N52 A;  2ZT9 C;  3CHB D;  3NQI A;  3HZX A;  1X54 A;  3U58 A;  4DK0 A;  3MC0 B;  1IBL Q;  4RCN A;  4L8J A;  4XT3 B;  1ICW A;  2BOS A;  3RN2 A;  1BCP C;  4WFN 3;  4OX9 Q;  3A5U A;  5C0X G;  4K0K Q;  3IRB A;  3ONA B;  4RGT A;  4V0B A;  1SYD A;  1A6X A;  3FDT A;  1DOM A;  1K28 A;  2IX1 A;  4MN3 A;  4DA2 A;  2NUC A;  4X66 Q;  2UUA Q;  2ATW A;  4H44 C;  2G9H D;  2PNH A;  2F0S A;  3OTO Q;  1BXT A;  2DJG C;  4LFA L;  3M4O B;  1PFN A;  4JI4 L;  4GKK Q;  4BBR H;  1UE1 A;  2B29 A;  1VDZ A;  1XMO Q;  2JA5 G;  3KBX A;  4I65 A;  2HHH L;  1GVP A;  5IGF A;  4Q0F A;  3HOV B;  5M3F G;  3MFG A;  2R6G A;  1CQV A;  1F2M A;  4LUZ A;  1HA6 A;  2RSO A;  5C44 B;  2RDG A;  1Q82 C;  4Y7N H;  4JYA L;  5C5M A;  1F2Z A;  4CDC C;  3BG3 A;  4K2K A;  2O4X A;  3UE0 A;  2EDG A;  5C0X I;  1YNX A;  2Q2I A;  3H94 A;  1I94 Q;  1K8O A;  1QVC A;  1I3Q B;  5JEA J;  3BU2 A;  2EY2 A;  1PZJ D;  1VQF A;  1VQG A;  2EXZ A;  4A3K H;  3ITP A;  4P71 A;  2Q2U A;  1F2L A;  4A76 A;  1NE3 A;  2ALY B;  1FR3 A;  1D1I A;  4K5X A;  1SE2 A;  1C9O A;  3SDZ A;  1DON A;  2YU9 B;  2NZ1 D;  4BXX H;  2K75 A;  2VB3 X;  4TRD A;  3PO2 B;  1WJJ A;  4QIW E;  2UU9 L;  5JOB A;  4KV6 A;  3ERO A;  2YTV A;  4DV3 L;  4L5R C;  1LTG D;  3S1M B;  1EYD A;  3BDL A;  1YNJ C;  4JI8 L;  3J81 c;  5GQO A;  4PZ7 A;  1ZKO A;  2A68 D;  4FO2 A;  4RKB A;  3L3O C;  3FRP B;  1M90 C;  1VMP A;  4FXG C;  2FMM A;  4A3I B;  3K8A A;  3MTS A;  4ABN A;  5IP9 G;  5D3D A;  1Z6H A;  4BY7 H;  2VS1 A;  3CPF A;  2OXP A;  2F1M A;  1N32 Q;  1EWH A;  4DNI A;  4ZCK A;  2UXB L;  5GAE C;  1OXS C;  2V4D A;  3G71 A;  4XQN A;  1G6Z A;  3ZJY C;  2KQ3 A;  1WCM G;  2M00 A;  2PZU A;  3K0X A;  1JQY D;  5C4X G;  3ND9 A;  1IBK L;  2B2Y C;  5A2Q L;  1WVL A;  1SJH D;  2I46 A;  2L12 A;  1KRT A;  1K8G A;  4HTH A;  2CKZ B;  1V43 A;  3GTK B;  4HJ7 A;  1FD7 D;  2DNE A;  3EVQ A;  2JA7 G;  2JA8 G;  2QF7 A;  2R92 H;  4LFC L;  2VQF Q;  3CCV A;  4K8J A;  1RJT A;  4J6H A;  3M85 A;  4DV6 L;  2XIW A;  1Y1V B;  4ZUJ A;  1XNR L;  1DD2 A;  1PYB A;  1SSO A;  1N33 L;  1S5E D;  1B8A A;  1CFM A;  2ZTE A;  3URY A;  4A3D B;  2PZW A;  1SNM A;  1BR9 A;  1PH8 A;  2R93 G;  2K6A A;  2V1C C; 
#chains in the Genus database with same CATH homology
 2J0T D;  1A2U A;  4L63 B;  1LAC A;  4BA2 I;  1SE3 A;  3E0J A;  2R61 A;  2CQA A;  4XDX A;  3G6J B;  5C4Z A;  1QCB D;  4ZYS A;  2A73 B;  3MZ5 A;  5IOD A;  3FVQ A;  3VR4 A;  1BBX C;  3M7N A;  3T51 B;  2F0U A;  3R2I A;  3HS0 C;  2B2V C;  3QO2 A;  3GQB A;  3I4N B;  2Z4H A;  2CHB D;  5CYU A;  1YNJ D;  1R9T B;  5IGD A;  1JOQ A;  4A3F B;  3Q6S A;  4RFB A;  3NUC A;  5DM6 3;  4KK7 A;  5E1F A;  5FOB B;  4R9W A;  3Q22 A;  3J7Y W;  4I7Z C;  3A7L A;  1GUW A;  3D8G A;  5FO7 B;  4DK1 A;  5JJZ A;  4DF7 A;  4BWG B;  2LMC B;  1G91 A;  1JWU D;  2A69 C;  2Y0S B;  1Q12 A;  4RWS C;  3R8B A;  3BS1 A;  3R3O A;  3WDN A;  5M5W B;  2CW0 C;  2K01 A;  1F9S A;  1QG7 A;  1HFN A;  2QEJ C;  1IKL A;  1W6K A;  5KNC A;  5IGE A;  1NSN S;  4J8Q A;  3GTM B;  4X3T A;  2F0J A;  1OXV A;  3DHQ A;  3FMC A;  4TSS A;  4IN3 A;  1BNZ A;  1RF2 D;  1EY8 A;  1Y8P B;  4EGV A;  4CHT B;  4FF1 A;  2R7Z B;  4IAL A;  5KNB A;  3K5O A;  1QOH A;  4C1N K;  4FNF A;  3FEW X;  4HR7 B;  3VA7 A;  1H9R A;  5JVG 3;  4MHE A;  4RGO S;  4K14 A;  5D14 A;  2K5W A;  2BE5 C;  1TWH B;  2L11 A;  4Z9C B;  4LJZ C;  1WTX A;  4NDX A;  1C4Q A;  3MA2 B;  4HMI A;  1QE6 A;  4FVM A;  3LWE A;  4KY6 A;  3FPP A;  3M4Y A;  2L4N A;  1H9J A;  2KED A;  2XRS D;  3ERQ A;  2NB0 A;  4XT1 B;  1IYU A;  1T5E A;  4ZRZ A;  3OMC A;  3HOX B;  3J80 E;  1NR2 A;  4A3G B;  2K32 A;  4HED A;  1F9R A;  1SNO A;  3P20 A;  1SBB B;  4V19 0;  3Q24 A;  2WP8 J;  4A3B B;  1E2Z A;  5CV8 A;  3I8Z A;  5I6Y A;  1BF4 A;  1B2T A;  1PFM A;  3JAM E;  2EYJ A;  3AB9 A;  4M8A A;  1A3V A;  3T53 B;  3IFD A;  2M9V A;  2AQ2 B;  1B9N A;  4KJO A;  5IIF A;  2PQE A;  5AFW A;  4CJ0 B;  1CA6 A;  3HOY B;  3M3Y B;  1NUC A;  4MIU A;  5D65 A;  2EZV A;  2IW3 A;  3TME A;  3TP8 A;  2EJF C;  3PUY A;  2B8F A;  2F0P A;  1TS5 A;  1RD9 D;  2BE5 D;  2K1B A;  3T56 B;  3S2H B;  2WKC A;  1PLF A;  1I6H B;  1D6E C;  2VB2 X;  1CI3 M;  3D4D A;  3EJI A;  4A93 B;  2F0L A;  2VUM B;  2E74 C;  1EY5 A;  4F87 A;  4R8N A;  5C4J B;  3TP5 A;  1SYE A;  2PW5 A;  1IHZ A;  3SK4 A;  3GTQ B;  5KND A;  1RTN A;  3NSW A;  4ZAI A;  2EJG C;  4QIW B;  2CVR A;  1GUN A;  1GXD C;  3VR6 A;  1EIH A;  1SYF A;  1NR4 A;  3SR1 A;  5M5Y B;  1DCZ A;  1RHP A;  1MSG A;  1EYC A;  2RKS A;  4XYQ A;  2XVS A;  1TKW B;  1ESF A;  2SNM A;  1SND A;  2E76 C;  2OEO A;  3T13 A;  1TII D;  2Z8L A;  3LNN A;  4ILW A;  1ENA A;  2E2J B;  4L6T B;  5T1I A;  2WII B;  2VXW A;  1OXT A;  5C6A A;  1A3U A;  2HDM A;  3GV3 A;  1GUO A;  2FMC A;  2BA0 A;  2J7Z A;  3DEO A;  2D9U A;  4DU9 A;  1JB3 A;  1LTA D;  3A55 A;  1Q3L A;  2RA4 A;  2EYP A;  5EBC A;  4OL7 A;  4G4K A;  2JYO A;  4G7H C;  2B39 A;  4N9T A;  4E6I A;  1HFG A;  1KTK A;  3DMU A;  5JVH 3;  1HA5 A;  5C3X A;  2D2C C;  2K03 A;  3LX0 A;  4CGY B;  5E3F A;  2GA4 B;  4KHZ A;  3A8K E;  1STY A;  2F0I A;  2B8G A;  1VF7 A;  1CT1 D;  2XN9 C;  2A6E C;  1L0Y B;  2B2W A;  3HKZ B;  2KA7 A;  2XRQ D;  5JAV A;  1GHK A;  2IL8 A;  1JWM D;  3OMG A;  2EOT A;  1U4R A;  2VNU D;  3S1R B;  3QWN A;  4NP5 A;  3T16 A;  1I4X A;  2PZT A;  1UAP A;  1I4P A;  3HOU B;  5TSS A;  1B53 A;  2L1B A;  1UNS A;  4BBR B;  4C1N I;  1MBY A;  3HOZ B;  3W2D A;  5M9O A;  1FNV A;  1PYW D;  5F2D A;  4U68 A;  2DY7 A;  5ELC A;  1A15 A;  4KKU A;  1CTM A;  4CJ2 C;  3RMH A;  2K5Q A;  5EJW A;  3I72 A;  2NVY B;  3DUZ A;  2IWH A;  1CM9 A;  1D2B A;  4CKB A;  4HAE A;  3MAQ A;  5IT9 L;  3KBG A;  2MJ8 A;  3BYY B;  3PUW A;  1RKN A;  3PUV A;  1TWC B;  4IUR A;  2KUM A;  1HUN A;  1LLR D;  2B2U A;  2OT2 A;  1LT5 D;  2JP1 A;  4ZLT F;  1O7L A;  1QNU A;  1SAP A;  1PTO H;  1HQR D;  1U9R A;  2X6G A;  3HG9 A;  4B08 A;  5A2Q E;  2NTS A;  3I73 A;  2MUY A;  4RKL A;  4FF3 A;  3Q23 A;  4QCL A;  3S9W A;  2Q8I B;  1I4Q A;  1FYC A;  2NWG A;  4BA1 I;  2A6E D;  3NTI A;  3GO5 A;  1OXU A;  5EKK A;  5NUC A;  3I3C A;  4LMQ D;  3A8J E;  3A8I E;  2AUJ D;  4KMU C;  3DWA A;  5BN5 A;  5I9O A;  3TDQ A;  2HUG A;  1DXM A;  5J39 A;  2BCO A;  3OSO A;  4NKL A;  1GUS A;  3I70 A;  2IT1 A;  3PIP 3;  3CKI B;  4HCE A;  4NMZ A;  5FO9 B;  2RDF A;  1IKM A;  3O13 A;  1OO9 B;  1ENC A;  2KCC A;  2F0M A;  3LWU A;  1EZ6 A;  2E75 C;  4KD3 A;  1S5B D;  1K8M A;  2JEA I;  1ILQ A;  3VYT A;  4C3H G;  1ML0 D;  5LHY 1;  1SFO B;  1KAA A;  2L5T A;  4QMG A;  4NW2 A;  3MXU A;  2F0N A;  5C3E B;  1EQT A;  3VR3 A;  4FXD A;  2RBM A;  2BA1 A;  2FHT A;  4S3S A;  4IFD G;  3MEH A;  4O42 A;  1FGB D;  5J1Z A;  3S1Q B;  1B44 D;  1V1P A;  2C5C A;  4H7B A;  1KLG D;  3J7A V;  1GHJ A;  4UAI A;  1TT2 A;  3R93 A;  4K5V A;  4DAV A;  4KKT A;  3C2P A;  2Z1C A;  3D3R A;  5T1G A;  3KF8 A;  2B2T A;  3SK6 A;  1M8A A;  2AQ1 B;  1AP0 A;  4WJW A;  5CV5 A;  3OIQ A;  3K57 A;  4B9X A;  3QG1 A;  3TP6 A;  1KNA A;  2X6L A;  5C0X H;  3J81 L;  4IFD I;  3QOL A;  5D3I B;  1D5X C;  3BDC A;  2SEB D;  4EQO A;  1AZQ A;  2JE6 I;  3L7Z C;  2LFN A;  3PUZ A;  3S14 B;  4DNR B;  4IUQ A;  1ONL A;  3X3N A;  3VYS A;  1RDP D;  5FKA C;  1TU2 B;  5COY A;  1H9S A;  4R8I A;  4RGN A;  1DYQ A;  3CU7 A;  1SNP A;  1H9S B;  1SEB D;  1Z47 A;  5E4W C;  4IUT A;  4HSP A;  1HPC A;  1EEI D;  4RH6 A;  4C3H B;  4BS9 A;  2BDO A;  1G8Z D;  3KK7 A;  3D6W A;  3RZO B;  1AW7 A;  2ICI A;  2EYH A;  3DWP A;  1G29 1;  4C3I B;  3TN2 A;  3P1H A;  3DEP A;  4A3E B;  3K6O A;  1PFB A;  1SNC A;  4G57 A;  4EQN A;  1WTR A;  4X3U A;  3TBI B;  3GD7 A;  4C3J B;  1DOK A;  2N88 A;  2F0Q A;  1CA5 A;  2O5J C;  5HGT A;  1EY4 A;  4K6D A;  2HCI A;  4CBV A;  3PO3 B;  3SVM A;  4QUC A;  2O2L D;  3MXN A;  3NWT A;  4PQX A;  3NTK A;  5K36 G;  2PW7 A;  1U4M A;  1EY6 A;  1JR0 D;  3NXW A;  3HOW B;  2F3W A;  1LT3 D;  5I9P A;  4G7Z C;  1EZ8 A;  5KIX A;  1QJO A;  4DNT B;  1TS4 A;  1H9K A;  2L55 A;  1Q8I A;  4RA8 A;  1VCI A;  3HEJ A;  2KOL A;  3OPO A;  3QB3 A;  3H6M A;  2WV6 D;  3QJY A;  2B63 B;  2NVQ B;  5M3M B;  4GZY C;  2EYF A;  1LO5 D;  2WKD A;  1MI2 A;  1KDC A;  4KY5 A;  1WTO A;  1Q90 A;  1Y8N B;  1KAB A;  3BVM A;  1GOZ A;  1ET9 A;  3MFY A;  1CK1 A;  2DN8 A;  1HTP A;  3NPP A;  1E2W A;  3BYT B;  2F4I A;  3BVG A;  1TVX A;  1MSH A;  5FO8 B;  1STN A;  5EGT A;  3ZYY X;  1LTB D;  3EQL C;  4EVO A;  1LT6 D;  2LY7 A;  2TSS A;  1STE A;  1TWA B;  4WRD A;  1MD2 D;  2QCP X;  1LTR D;  3TZU A;  5CV7 A;  2HQE A;  1AFP A;  1O80 A;  2KEC A;  4DXG A;  1B9M A;  2NBF A;  1CZG A;  3DXJ C;  2F0T A;  4CJ1 B;  4F88 A;  3TZD A;  4Q5V A;  3CRL C;  1L0X B;  5EBD A;  3OHX C;  2KVM A;  4FF4 A;  2B2V A;  2WAC A;  1PXU A;  2B2U C;  1Q1E A;  1HQM C;  5EPJ A;  5C0X J;  3L9A X;  3RD4 A;  2IX3 A;  1HUM A;  1KDB A;  3F2U A;  3OIP A;  3AMU A;  3MXG A;  5DNF A;  3OWE B;  3GTL B;  3KLR A;  4QF4 A;  5ELB A;  4PMW A;  1EY0 A;  3HGB A;  3SXH A;  4KI0 A;  2EYO A;  4KKS A;  5I6W A;  3FPU B;  1OXX K;  4CKC A;  4F8M A;  1WTP A;  2MPM A;  4DAP A;  4CKE A;  3EFX D;  3FKI B;  1PZK D;  2PO4 A;  1U4P A;  1V8Q A;  4OGQ C;  1G2S A;  4FYD A;  4DXF A;  1X3Q A;  4K8I A;  5DEH A;  2HCC A;  1I4G A;  3C1E A;  2F03 A;  3DWQ A;  3S17 B;  2F0W A;  1ENF A;  1Y1W B;  2JSO A;  3M7G A;  3GTG B;  5A35 A;  3W3A A;  5CV4 A;  1PRT D;  4RCO A;  1CQF A;  1D5M C;  3S1N B;  2MGS A;  2AQ3 B;  1D1K A;  3NWS A;  4ZK9 B;  1JIC A;  2EY1 A;  3MXP A;  5CBE E;  2H1E A;  1PRT F;  4FP5 D;  2SNS A;  5FLX L;  3K59 A;  3MWY W;  4IUV A;  5JPM C;  3NBI A;  4C2M B;  5DAU A;  5IT9 E;  1CHQ D;  4IZ8 A;  4BY1 B;  4DN4 M;  3SK8 A;  3IKJ A;  2IX0 A;  1IYV A;  4EQP A;  2XWB B;  1SYB A;  1HXY D;  1BQQ T;  3NE5 B;  1B3A A;  1WD0 A;  1F77 A;  1STB A;  2FJ2 A;  3IL8 A;  2IPK D;  2JA6 B;  2XWJ B;  5EQ0 A;  4ULL A;  1SXT A;  2B2T C;  1A2T A;  2FIN B;  4BBS B;  3MVV A;  4Y7N B;  1RCV D;  1STG A;  2L0C A;  2NN6 G;  1JC7 A;  1EQV A;  2K33 A;  1AZP A;  1PRT B;  1VMC A;  4A3K B;  3U9S A;  1M4V A;  3A56 A;  4JK1 C;  1ZEQ X;  2EE1 A;  4QB4 A;  3IFT A;  3RUZ A;  2DNC A;  2FFK B;  2F0O A;  3BZD B;  1LT4 D;  3I90 A;  3P7J A;  4ME5 A;  2EYL A;  5CV6 A;  3GV6 A;  1D5Z C;  1HRJ A;  2F0H A;  2NN6 I;  2RQX A;  2D62 A;  2Q8T A;  3K5M A;  3GP7 A;  2K6A A;  1LTT D;  1GUT A;  3WOE A;  5KEE A;  3Q0A A;  4HMJ A;  1ROD A;  4XYO A;  1BDO A;  1EU4 A;  2Q8R E;  5K5P A;  2R3Z A;  3SE0 A;  5IGB A;  1SJE D;  1GJX A;  4BY7 B;  5JPN C;  2AUK A;  1I6V C;  1VF5 C;  4DGZ A;  1EYA A;  4JBW A;  1ZYR D;  4KD4 A;  1HTL D;  4XXE A;  2E2D C;  3I91 A;  1X32 A;  3HP3 A;  4O1N A;  2BDN A;  3D4R A;  1UEA B;  4RAU C;  1HHV A;  2EJM A;  3AU7 A;  3H09 A;  2R92 B;  4ZUI A;  1LV9 A;  4X3K A;  4XIG S;  5CGK A;  4AYB B;  2C9O A;  1XWE A;  1SYC A;  5CC4 A;  1TY0 A;  2XSC A;  4KTA A;  5LL6 X;  2WB1 B;  3C1F A;  2AWO A;  1E0B A;  1PZI D;  3K58 A;  1IW7 C;  3H0G B;  1STH A;  1Z7T A;  4WOR A;  4PV1 C;  5LL6 S;  3J81 E;  2F0D A;  4IUN A;  1TWG B;  2N55 A;  1F9Q A;  1YNN C;  5EKL A;  5EPL A;  1BCP D;  3DM1 A;  5ELD A;  2EY6 A;  1II3 A;  2EVB A;  3D4W A;  1FNW A;  2K05 A;  5E4X A;  3R2T A;  4C3I G;  2LKV A;  3KLS A;  4PNY A;  2K7V A;  1BCP F;  4XTC S;  4C3J G;  2JA5 B;  2I07 B;  5M3F B;  1V1P B;  2D5D A;  2MP1 A;  4XQJ A;  1CHP D;  1CZW A;  3BDO A;  4OHJ A;  1A3T A;  2NN6 H;  1K83 B;  2F3V A;  5I4D A;  2PNR C;  4UDU C;  3V96 A;  1DJR D;  2NVX B;  1STA A;  2NYZ D;  4PMB A;  1EFI D;  1LAB A;  3SK5 A;  1SMY C;  3S15 B;  1QNK A;  2EY5 A;  4KN7 C;  4U67 3;  2A74 C;  1KNE A;  4ZKB B;  1V1O A;  1SE4 A;  3RLF A;  1SDF A;  3HRZ C;  4N9P A;  1IW7 D;  3OWF A;  4J1M A;  3GTP B;  1TY2 A;  3NTH A;  1R4P B;  1I4H A;  1I4R A;  1WD1 A;  2PPB C;  2A5H A;  3C3L A;  1BCP B;  1WTQ A;  3NQT A;  5KGU A;  1C8C A;  4FXK C;  2F0G A;  3NP8 A;  4KY7 A;  1WCM B;  1YNN D;  2A6H C;  3X3M A;  3KUP A;  5C4X B;  3A7A B;  3H3V C;  4F7X A;  1TWF B;  3OW7 A;  5JEA G;  4YIJ A;  4LAA A;  1EIG A;  1BOS A;  4IUP A;  2JA8 B;  2JA7 B;  3K7A B;  1S4Z A;  2KEE A;  1TQO A;  2F0E A;  1JE4 A;  3NHH A;  1JWS D;  1EEF D;  4KJN A;  1IL8 A;  2KJX A;  1JOK A;  2AWN A;  4FF2 A;  3QOJ A;  2F0F A;  1B4O A;  1F9P A;  1ET6 A;  4LK1 C;  4G7O C;  2R93 B;  3C46 A;  5ISR A;  3RZD B;  3VR5 A;  3IAY A;  3PIO 3;  5EPK A;  3U9O A;  1KDA A;  1WTW A;  3ND8 A;  3GTO B;  4KN4 C;  5I2X A;  1UUP A;  3TSS A;  3OOC A;  1J8I A;  2QIL A;  5C4H A;  1S5F D;  4HN7 A;  4TKO B;  5CV9 A;  2LS0 1;  3UI2 A;  2Z4I A;  1SMY D;  2QDB A;  5CR3 A;  2YYZ A;  2SDF A;  5FK9 C;  4HCS A;  1Y8O B;  2E2H B;  4HSV A;  1S5D D;  3VA5 A;  1JOR A;  2B2W C;  5ELE A;  2OF1 A;  1U4L A;  1PDQ A;  2ID0 A;  2K5D A;  1JOO A;  1XYI A;  1BUV T;  2B2Y A;  2PMZ B;  3N6R A;  3PUX A;  1QB5 D;  3P75 A;  4IFD H;  2G9D A;  1JCK B;  5BN4 A;  1AEX A;  2A69 D;  2A6H D;  2IJ0 A;  4M1U B;  1DOL A;  2NTT A;  5C5L A;  1PTO C;  2KHS A;  4OO1 G;  2CW0 D;  4B9W A;  3VYR A;  3SHL A;  1PRT C;  3VYU A;  1XX8 A;  4RHR A;  2ZXR A;  4TQU S;  5COR A;  3K0Y A;  3CQZ B;  1ILP A;  1EU3 A;  5ELF A;  4OO1 I;  1O78 A;  1EY7 A;  1LTS D;  4K5W A;  2E2I B;  2ZXP A;  2X69 A;  1EL0 A;  2EPB A;  1XTC D;  3S16 B;  3J80 L;  1EWC A;  4P2C B;  3V05 A;  1QWY A;  1R4Q B;  1XXG A;  2QKI C;  4ZQ3 A;  2MHV A;  2RDH A;  3PMF A;  1H9M A;  4ZKC B;  3CRK C;  5JEA H;  4ODG A;  5FLX E;  1EY9 A;  2JXM B;  3GTJ B;  3JAM L;  4K2L A;  4H0L C;  1NCV A;  2K28 A;  3EA6 A;  4A3J B;  4DAY A;  1NAP A;  2JEB I;  2ENB A;  2K04 A;  1PTO D;  4A3M B;  1TS2 A;  3BVZ A;  2F0K A;  1AN8 A;  1DZ1 A;  1TR5 A;  3E6Z X;  4IQZ A;  5K36 H;  4OIK A;  2EYM A;  5IOC A;  1ESR A;  1PTO F;  1EOT A;  3G7L A;  3T4A C;  2ZXO A;  1X3P A;  2WAQ B;  2WIN B;  5CBA E;  3I4L A;  1TS3 A;  3D31 A;  1W6J A;  3A54 A;  5M5X B;  1PMR A;  2SOB A;  1C48 A;  1T5X D;  1I50 B;  1GUG A;  2PYK A;  2H4O A;  2J4X A;  3I4M B;  1F2Y A;  1G2T A;  1LTI D;  3MHB A;  1ZXT A;  5G3L D;  3VR2 A;  5IGG A;  5KYI A;  3S2D B;  5HUR A;  1DM0 B;  1B1Z A;  2ICE C;  3K5N A;  1Y69 U;  1MGS A;  3PV0 A;  4OIJ A;  2TMP A;  1HCZ A;  1ZYR C;  3KLS X;  3J7A F;  2NVT B;  5G3L F;  2HDL A;  5I2Y A;  5C3W A;  3SEB A;  4IUU A;  5EKI A;  4OO1 H;  3WOF A;  4XQQ A;  3NK9 A;  5J22 A;  5KYL A;  1BO0 A;  3V2T A;  5CMD A;  4QUF A;  1O7Y A;  2DY8 A;  1SNQ A;  1SYG A;  5IGC A;  4C56 C;  1PTO B;  4IFD J;  3TP7 A;  4RGM A;  4X3S A;  3H91 A;  2RSN A;  1WTV A;  4K6L A;  2KCN A;  3QIA A;  3K5L A;  2O5I C;  2F0V A;  4ID6 A;  3NBH A;  3D6C A;  5BN3 A;  5KRU A;  1KLU D;  1RTO A;  2A68 C;  1B50 A;  2L9H A;  4DFA A;  2PCF B;  2XNA C;  5DM7 3;  4H13 C;  1S5C D;  1J9O A;  4PMC A;  1O7Z A;  1Q1B A;  2M2L A;  4RHS A;  1FNU A;  2RVL A;  3E5S A;  1E2V A;  1QIL A;  3N52 A;  2ZT9 C;  3CHB D;  3NQI A;  3HZX A;  4DK0 A;  3MC0 B;  4RCN A;  4L8J A;  4XT3 B;  1ICW A;  2BOS A;  1BCP C;  4WFN 3;  5C0X G;  3ONA B;  4RGT A;  4V0B A;  1SYD A;  1A6X A;  1DOM A;  3FDT A;  2IX1 A;  4MN3 A;  4DA2 A;  2NUC A;  4H44 C;  2G9H D;  2F0S A;  1BXT A;  3M4O B;  1PFN A;  1VDZ A;  3KBX A;  4I65 A;  3HOV B;  5IGF A;  4Q0F A;  3MFG A;  2R6G A;  1CQV A;  1F2M A;  1HA6 A;  2RSO A;  5C44 B;  2RDG A;  5C5M A;  1F2Z A;  3BG3 A;  4K2K A;  2O4X A;  2EDG A;  5C0X I;  3H94 A;  1K8O A;  1I3Q B;  5JEA J;  1PZJ D;  2EY2 A;  2EXZ A;  3ITP A;  1F2L A;  1FR3 A;  1D1I A;  4K5X A;  1SE2 A;  3SDZ A;  1DON A;  2YU9 B;  2NZ1 D;  2VB3 X;  4TRD A;  3PO2 B;  5JOB A;  4KV6 A;  3ERO A;  1LTG D;  3S1M B;  1EYD A;  1YNJ C;  3BDL A;  1ZKO A;  2A68 D;  4FO2 A;  4RKB A;  3L3O C;  3FRP B;  1VMP A;  4FXG C;  2FMM A;  4A3I B;  3MTS A;  4ABN A;  5D3D A;  1Z6H A;  2OXP A;  2F1M A;  1EWH A;  1OXS C;  2V4D A;  4XQN A;  1G6Z A;  2KQ3 A;  2M00 A;  2PZU A;  1JQY D;  3ND9 A;  2B2Y C;  5A2Q L;  1WVL A;  1SJH D;  2I46 A;  2L12 A;  4HTH A;  1V43 A;  3GTK B;  1FD7 D;  2DNE A;  3EVQ A;  2QF7 A;  4K8J A;  1RJT A;  4J6H A;  3M85 A;  2XIW A;  1Y1V B;  4ZUJ A;  1DD2 A;  1SSO A;  1S5E D;  1CFM A;  3URY A;  4A3D B;  2PZW A;  1SNM A;  1BR9 A;  4KHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...