5I9SA

Microed structure of proteinase k at 1.75 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
b'AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Modeling truncated pixel values of faint reflections in MicroED images.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5i9sA00
5AVKA 1WMEA 1KDZA 4AKSA 1TM5E 2Z30A 4DWWA 1T1GA 3DDZX 1P7VA 4AKTA 3GCXA 3ZXXA 1MEEA 3F49S 5ARDA 3BGOS 1BFKA 3GCWA 1SCAA 1WMFA 3Q40A 1LW6E 2PRKA 1TM4E 2TECE 1KDVA 4DZTA 3Q5GA 4GI3A 1IC6A 1PFGA 1YJBA 2DQKA 3WIVA 1TK2A 5AVJA 4FONA 3AFGA 5ARBA 3HJRA 3QMPA 2PQ2A 1BE6A 3CNQS 1GA6A 2WUWE 3EIFA 1SN7A 1ST2A 3LXUX 1WVMA 5I9SA 2V8BA 2ID8A 4CG0A 1ZVJA 1C3LA 3DVSX 1TO2E 5JXIA 5AQEA 1Y3FE 2W2QA 2B6NA 1GTJ1 5JXJA 1NDUA 1GTG1 3VTAA 5CW1A 5JXGA 1SCBA 1SUPA 3DW1X 2ID4A 3GT4A 3DYBA 2P4EA 1V5IA 3GT3A 1GT91 2QTWB 3LPDA 4K8RB 1SUDA 1Y48E 4C3UA 1T1EA 2GKOA 5FBZA 1BE8A 2XTJA 1P8JA 1GA4A 3SQOA 1UBNA 2X8JA 2WV7A 1YU6A 4DJ5X 1AV7A 1Y33E 4M1ZA 3F7OA 1S01A 4KG7A 3WHIA 4KB5A 3H42B 2Z57A 5SICE 3I37X 1BJRE 1HT3A 1Y4AE 1Y3CE 3UNXA 5FFNA 2W2PA 3TI7A 1SUBA 3DE6X 4LVOA 1GNVA 4BWGA 1XF1A 3A3NA 1C9MA 1SUEA 3VV2A 2PWBA 2PYZA 3PRKE 1C9JA 3LPCA 1AH2A 3LPAA 2ST1A 3VYVA 1TM1E 4LVNA 1PTKA 1R64A 3A3OA 1GNSA 2HD4A 1GTL1 3DE3X 3L1KA 2WWTA 2Z56A 3DWEX 1Y4DE 3DW3X 3EDYA 2WUVA 1MPTA 3I30X 1AVTA 5JMOA 1SBTA 4C3VA 3QTLA 1WMDA 2ZWPA 4WOBA 2Z2XA 3DE1X 4MZDA 2Z2ZA 1KE1A 1KE2A 1R0RE 1SBHA 4KPGA 4CFZA 1YJCA 1AQNA 3ZXYA 2W2OA 3CO0S 3QFHA 1SELA 1TM3E 1SUCA 2ZWOA 3BPSA 4H6XA 1A2QA 3D43A 3DE7X 4CFYA 1AU9A 4OMDA 4H6VA 3BX1A 1Y34E 1KDYA 3VHQA 2X8JB 1SUAA 1NDQA 1SBIA 1AF4A 1Y9ZA 3TECE 4NE9A 4HVLA 1S02A 1SCNE 2PWAA 1NLUA 1SCDA 3F7MA 1SPBS 3EE6A 5K7SA 1Y1KE 3P5BA 3DVQX 5ARCA 4OMCA 1SBCA 3TI9A 4ZARA 2PMWB 3I34X 1R6VA 1S2NA 4WOCA 4JP8A 3AJ9A 1AK9A 1SCJA 3VSBA 4Z2AA 3A3PA 4ZOQI 3DE2X 1SBNE 3DVRX 5B1EA 3DE4X 1TM7E 1CSEE 1P7WA 1DBIA 4YN3A 1DUIA 4NMXB 1OT5A 2DP4E 2HPZA 5JXHA 2ZRQA 1THMA 4OV6B 3DE0X 5B1DA 1GCIA 1SVNA 2SBTA 1IAVA 1YJAA 1BH6A 1V6CA 2XRMA 2Z2YA 1SH7A 1PJ8A 2IXTA 3DE5X 3VV3A 3WIUA 3D9QX 1JEAA 1SIUA 1CNMA 1ZVKA 1SIBE 3I2YX 1C9NA 4I0WB 3PTLA 1PEKE 5AMXA 2W2NA 3T41A 2IY9A 1ST3A 3SICE 2E1PA 3OSZA 2G4VA 1SIOA 4J94A 1BFUA 2Z58A 1VSBA 2SECE 1Y3BE 1OYOA 4B5LA 4NE7A 2W2MA 1GA1A 1TMGE 4HX2A 1Q5PA 1T1IA 1TECE 1WSDA 1Y3DE 4H6WA 5FAXA 2SNIE 2DUJA 3AJ8A 4RYDA 1OYVA 2SICE 3WQBA 1TO1E 1EGQA 2PKCA 1EA7A
chains in the Genus database with same CATH superfamily
3TKAA 1BH2A 4UBKA 5LYJF 3D0QA 1ISHA 4D4KA 1EI9A 2H59A 1C8KA 1YB7A 2EGHA 2FZLA 2XUQA 4RS3A 4YO7A 1W9MA 3TRHA 2ZXEA 1UWKA 3I73A 2GSWA 3AJEA 3NWJA 3IQGX 1CCWA 2WEKA 3L7LA 5GJVC 3DDZX 2PGLA 4G67A 4Z4CA 1O5TA 3FSEA 2PSSA 1Y6ZA 1C7EA 2HU5A 2I8CA 1JIUA 2KLBA 2H3HA 3A6FA 1Z74A 2FHPA 3EAGA 3JQPA 3PC3A 1V11B 3I5AA 3PRYA 3E5NA 2OXIA 4D4GA 1FQOA 5I3CA 2OEPA 3WRWA 3LT5A 1PZXA 1U9ZA 3SI7A 4HDKB 1QVRA 4RIGA 3V42A 3DKIA 3EIXA 2VYCA 4ZQGA 4QODA 3T9FA 4TKUB 2I80A 3U7GA 5ICFA 4BO6A 1NV9A 3GELA 4IHJF 1GGFA 2A92A 2WSSD 3OPYI 3PTZA 1Y1PA 4O4IF 5HS6A 2WHEA 1J1IA 1M1ZA 3KB6A 4ZU6X 3T3IA 1FDTA 2CXNA 5IZCC 3OIYA 3D1VA 2VJYA 2FA9A 1V39A 4KWCA 1ES9A 2Y0DA 3WP1B 3ZLBA 3TAUA 1T2EA 2VYVA 3I2HA 5K8CA 1AMNA 3HRKA 2WT8A 1KMNA 1K27A 3RIGA 1SBQA 4JBIA 3H8SA 3DH0A 4BB0A 5DGIA 1X1CA 1I4WA 2CKMA 5INTA 3LE8A 1HYGA 2BW0A 2P1RA 3K16A 3OM9A 3ZHYA 3FJ1A 1UPAA 2QEQA 3FZGA 2DQKA 4OY3A 4RJJA 1R00A 1V95A 3K5PA 1CR6A 3A2NA 1P18A 1UPCA 5JCXA 2AC2A 2IZOA 4JOQA 4GYJA 4MOWA 5EP1A 3RVJA 2DEUA 1L4BA 3UAGA 3GGDA 4QQKA 1EEXB 2QBYB 3B6MA 2X5OA 1XLVA 3NVDA 3B9PA 4MR9A 4DR6B 2FR8C 3EIFA 2Q3HA 3A9SA 3KC2A 1L4YA 5JWOA 2GAIA 2D59A 2MSCB 2OPBA 4V3BA 3M8KA 3TN7A 3EHDA 1T8UA 2O8VA 4JJZA 3LY5A 2I2AA 4WT7A 4CN9A 2MYPA 1EGHA 1TD1A 4JUFA 5I9SA 3CLVA 5BVGA 4HEHA 2F8TA 5C4MA 2X9GA 5D2CA 1PX0A 3ESBA 3FYSA 4HSEA 2WP8J 1FCJA 1P5RA 2VF7A 4IX1A 1P60A 2CUZA 3OC0A 1M2JA 4LGCA 221PA 3BUSA 5KNDD 4EJSA 1QF6A 1NVVR 2ZAYA 3ECAA 3T9BA 1BMFA 4YS6A 3OJOA 3OQHA 2VQEB 3IERA 3RSQA 4OJYA 5B1SA 2BC9A 3BMOB 1M2NA 1WULS 1EEHA 1H2AS 1GKUB 4CLXA 4RENA 5HF8A 3O8CA 3W79A 3CVXA 3OY2A 1E3SA 3AVUA 2DHDA 3GVIA 4B45A 5FI5A 1OY1A 3GRYA 5KYTA 4MRAA 2QTFA 5K8TA 1E6EA 2WZDA 3PNOA 1OAOC 3NTUA 2V8OA 2Q4DA 2EIHA 3TSWA 4CT5A 3KWFA 4OQXA 2K87A 3E0QA 4HLQB 2WINI 4XWOA 1JZQA 1Q0LA 3N2NA 3I83A 4TXJA 2P9BA 1Z4JA 1I3OA 2LCIA 3ORHA 1FMCA 1VCOA 4IIEA 2X5XA 5FOWA 1MJ5A 4Z1MD 3N8KA 2AG5A 5KOYA 7REQA 2YH2A 4GE3A 4AWXA 2OCYC 3MSCA 2H52A 3EF1A 5DCWA 4EKDA 1YMVA 2NW6A 1E89A 4QDJA 2H00A 5DVZA 2BGWA 3JD1A 4I08A 4I50B 1FVFA 5IHXA 5HS4A 1HEYA 1X1QA 5AM0A 4EKYA 1UZNA 1VB3A 1DAIA 1JZTA 3NEYA 3KTFA 3PQFA 5A5VA 1BRMA 2KJQA 5HCNA 1TO6A 2CVFA 3DUWA 3IP7A 5KPJA 1NW9B 3QUQA 3E53A 2KSQA 4G8DA 3TLJA 1SUDA 4LV5B 3TS1A 5CFLA 3AF2A 3L6RA 3U7EB 5A5FA 3LBAA 2H7CA 1AGXA 2ISSD 1U7HA 2M1ZA 2XAUA 3T5GA 3V7YA 4C0XA 3B9BA 3O90A 3G8DA 1KERA 5EHNA 4AK9A 4NI5A 4IDCA 1MN6A 2QZ9A 3SLGA 1M2EA 1SO8A 3I9JA 4HTFB 3UO8B 3E7WA 2J9FB 1VPTA 1YRAA 1JHMA 1RYBA 5JS6A 2UUPA 1HSOA 2AFHB 4RK5A 4WW0A 4KAFA 4F3TA 1G2IA 2XGSA 3JU3A 2VJAA 4GNRA 4LNHA 4PWYA 4RAQA 3TXYA 1ORTA 3ID6C 2PKRA 2PY6A 3KWJA 5JVDF 3A9WA 3LL4A 3PICA 3UT0A 1VJRA 2HQSA 5K3SA 3CNNA 2BHTA 2ZSJA 3M2TA 1PK7A 2O7VA 3MTAA 1P3DA 1T2DA 1ZMOA 3K72B 2QUJA 5A7HA 1GYQA 5L9AA 3HP1A 2OGUA 1KEZA 2W6QA 4E08A 1HDEA 1KK0A 3H2YA 2QKYA 1U2TA 4L85A 3VGJA 4IOKA 3ER9A 1Y6FA 2R3SA 4BDSA 1Y3CE 2HWWA 4J7UA 4IW3B 1E9SA 5FFNA 4MICA 1YAJA 2Y9MB 2BMVA 3OQJA 5HF9A 1TFRA 1OUMA 3EZ6A 3Q9UA 5LCXA 4D8TA 4TZ6A 4HXEB 1GPBA 1EVYA 4M0FA 4L15A 4BFZA 2H2GA 3EG9A 1WUJS 4GI5A 3E84A 4K9RA 3O4JA 1C0LA 2JL1A 1M2OA 3RBVA 2JNWA 3ZJ4A 2DPHA 3THRA 2Q8QA 2PZEA 2VBIA 4KRXA 2W9XA 2NU8A 3VJLA 4CBVA 3F6PA 3C41J 1FDOA 1KFKB 3C6QA 3MUOA 3NI2A 5DNWA 3WDKA 4IEIA 4QNNA 1J33A 4DIUA 4JYPA 3FPLA 1QE3A 4UCFA 3DOIA 1SU6A 2X2FA 4O3FA 5ITWA 1ZP6A 2ZRDA 3I1IA 2PYZA 1C80A 3WL4A 1Z88A 3DD1A 3VHRA 1KGDA 1KMIY 2JGRA 2A3NA 1THZA 4NY1A 1RACA 3FAZA 3O4IA 5GGYA 3K6RA 4B7ZA 4TM8A 3KU1A 1ZK3A 4LY9A 2ST1A 3FTFA 3RBAA 1KHHA 3D0RA 3E6AA 1U7WA 3HYSA 3HJCA 1E0SA 5EP3A 1THGA 1LTKA 1XKXA 2X58A 2XMPA 2YNMA 5B58C 4HLDA 4YY3B 3KRTA 4IX9A 2GXQA 4I5DA 3O82A 1WUIS 1A5AB 1GZVA 4MR9B 4E6PA 2G9ZA 2X7XA 4JOSA 2ERYA 3ML1A 1PQYA 2C04A 5FOTA 2CT8A 4GHWA 5HPYB 3DVLA 1SVWA 2AEEA 3KQUA 4LG1A 4IHQA 1ZW6A 1LSOA 1H1DA 3WLNA 2XY4A 1WXQA 4H77A 3LVFO 3P96A 4QC2A 2A9VA 5BVGB 1KWKA 1HLPA 4BZZA 4RIHA 4WCDA 3QX7A 4ITUA 2JLRA 1ZUIA 1RI4A 4FU0A 1TQDA 1L5VA 2XGOA 4P3YA 4R51A 4WL0A 3URKA 3DEIA 4H1TA 1BHQ1 3IEKA 4EAQA 3MWFA 4K6GA 3RIXA 1X80A 3VO1A 4EJSB 1M6YA 2VT3A 2EARA 2ONZA 1TT5A 1V3UA 2GTHA 4I4IA 2Q8PA 4TZKA 1KP2A 2X0RA 1UXKA 2CYCA 2XYRA 5BO5A 1UJ5A 2WNSA 2EQAA 4ZZ3A 3LOPA 1J6UA 1E1QA 1E8NA 1FU4A 1PO7A 1XWFA 1F0NA 2VA8A 3LX5A 4RSRA 5ALJA 1MQAA 2YN2A 4FYKA 4TSFD 5ALZA 4YYZA 4B3MB 1ILWA 5F9MA 1KEKA 4YAGA 3WYBA 1G63A 1EZ4A 4Q1AA 3N87A 4RCZA 2XHEA 2BD0A 2OHXA 5DTEA 4B6GA 1JLLA 1WS6A 2Y0PA 4F8YA 5KNBD 1MMFB 3GA5A 4X6XA 5DH9A 5EPOA 2XCSB 1HTTA 1VL1A 2A84A 2W6JD 5CLQA 4ND4A 4I6JA 1DQZA 1QF7A 1T35A 2GCOA 4FQ8A 4JVSB 4I1IA 2ZYRA 1JR4A 4ALIA 4DAOA 5HZMA 3TLMA 7REQB 4LAFA 3JQ9A 4OF4A 1J8MF 1OTYA 1JHAA 4DA9A 5IP5A 1XO1A 3PX3A 6ADHA 1WOYA 3B3QA 1PYGA 4UPVA 1SUCA 1VGVA 3EZ2A 3F46A 3HBFA 1YJ5A 4P92A 1SIWA 3TO5A 1UJ4A 3OZVA 5IM5A 5LKAA 1H5NA 1A7AA 2BEUA 1BRTA 2CBZA 3D43A 3DSRA 4HQ6A 4V03A 2EZ9A 3H83A 3HCEA 2D2FA 5J5VA 1PJZA 1S9DA 1FYDA 1Q1BA 3BULA 1CQIA 2JFFA 3OFND 3OY7A 4WZZA 1PFYA 2OSVA 4XXHA 5HIMA 3VPBA 4OPMA 3KKNA 4AZSA 2P7IA 4QFDA 4EG5A 1JH8A 3A7EA 4J2TA 2FR1A 5BQPA 3SX2A 4B40A 1Q57A 5AKZA 1UMCA 2OD9A 2CFSA 5JYDA 3R9XA 3BX1A 2X42A 5FB3A 4M60A 4D57A 1HDGO 4UARA 3AXTA 2AZMA 3FYUA 2OESA 3K7EA 2BCEA 3GGCA 3N07A 4PXSA 4EFNA 2CV1A 3Q4GA 1PD0A 2CHVA 3JWHA 4OYRA 4HF7A 2AJDA 4URVR 4RF3A 1GARA 1RQLA 2IA5A 5AP9A 2YMPA 4WPGA 3QPCA 1L8QA 4R7ZA 1RYFA 4KN5A 1VKNA 3RSFA 4W1QA 2R8RA 4OQQA 2Z8ZA 4O2RA 4D9HA 1LBEA 4B47A 2HF8A 2C9YA 3HZRA 3MXTA 2I71A 1YHYA 2H5LA 3N58A 3QVJA 1AS2A 4QXMA 4H15A 4R1MA 2ORIA 3IXMA 3VZRA 1Y81A 2RSLA 1I1OA 3GOQA 4D99A 1H6BA 1Y1KE 3LBFA 2Q4TA 3QLUC 4YECA 4QOFA 1JQEA 2BE7A 1ORWA 3C97A 3QZUA 4HQOA 1RKBA 3GH1A 3W77A 1G9TA 1T0PA 4OQMA 3U5ZB 1NYLA 3JZIA 1G8FA 4US0R 1VPVA 3EG9B 3TLKA 5HUHA 1FQWA 1M2OB 3OETA 4O08A 1LX6A 1S2NA 1RQXA 2IH5A 1NUAA 3KPWA 1MXHA 5TQ0A 2NU8B 5CA1B 2ACKA 3JYLA 5FPHA 4HEJA 1TKBA 1E5DA 5C46F 4CCSA 2GZ3A 1DSSG 1VE9A 1SRRA 2QNIA 1Z7GA 5CXSA 1U8EA 3DLAA 3H8WA 5L95A 3LZCA 4K88A 1EDEA 1KVSA 5EZYA 4PC6A 4CEHA 4XUDA 4X1YA 3EYAA 1BU8A 3HHEA 1SBNE 3L82B 3LVRE 3WL6A 1Z0UA 3LHKA 1P1HA 3DFIA 5JAOA 1G8PA 3U56A 4YT8A 4IIXA 4B4DA 3L06A 4EKIA 2XRYA 3FTQA 1K3TA 4LMAA 1P7WA 4CMAA 4YRDA 1M0EA 3V8BA 4ZK2A 2RHCA 1YNSA 3TSYA 3GDFA 2OCDA 4IRXA 3I5YA 1BZYA 1Z4PX 1J8DA 1WXWA 1C7RA 1MA0A 5LVAA 1OT5A 2HGZA 4S3MA 3SLRA 4DCGA 3QY9A 4WA8A 3ZWAA 1OGYA 4EPYA 3ISJA 3JW8A 1ZAKA 1CR1A 2CNWD 2IXFA 1J5EB 4DDKA 4MQMA 5H68A 1NUSA 1THMA 1Z62A 2GPNA 2GJKA 2Q50A 3NBUA 4BX0A 4U02A 5LZ7A 5J4HA 2REXB 4L74A 2QTZA 2HNAA 3LPMA 1DZ3A 3L49A 2VZ9A 1PUIA 1QUEA 4FFPA 4RADA 4EJMA 5LKRA 5KPDA 1E7SA 5DK6A 1OF1A 5EWLA 1T8RA 1AXEA 1WCYA 5TR9A 3TVYA 2H06A 2QROA 5IT0A 4AY6A 1A98A 1X80B 3E9RA 4FNMA 3RREA 4CM3A 2XRMA 4NK5A 4O4HF 3KKEA 5DHAA 1NUUA 1QBGA 1L6IA 2IELA 3ACCA 2PRJA 3ROKA 1TT5B 1XMJA 2WMDA 2FXVA 1PJCA 2A2ZA 3IKVA 3K2BA 3NR2A 4WDRA 5LOVF 2CMHA 3PWTA 4XFDA 5JH7F 1EINA 2P6UA 3L93A 1QRTA 4JC0A 3V1TC 1IEQA 1YZGA 1AM4D 2BBWA 3ZBTA 4B3JA 2WABA 3M6MD 1PG0A 2C5AA 3M83A 3CKLA 1OB5A 1TC1A 3VO9A 2PMKA 3WLEA 1XC7A 1JLLB 1CNMA 2JIPA 2WMYA 3BIFA 4MNTA 5CLGA 4E30A 2JFXA 3OJWA 5DN6D 3IQDB 2GCOB 2P6PA 3HA3A 4EW3A 4JMLA 1P39A 1ZH2A 4LOKA 5AKEA 5K0TA 1G19A 2YY6A 2ZUSA 3FNHA 1E7MA 2RH9B 2B8EA 4X97A 3DV0A 5A71A 2HXSA 5KSYA 1U0GA 2JLYA 1DC5A 3ZDBA 5FOQA 3K3PA 4FFNA 1SZDA 2BEUB 2O52A 3T5MA 4MW0A 1HTBA 4JB3A 3TZCA 1ZCBA 5L45A 1EE2A 4QHSA 1CQIB 1Q91A 2JKVA 3DKPA 4Y18A 4OA5A 3RHZA 3RUIA 1HX7A 4XM0A 4ZCLA 1UK6A 4Q37A 3V97A 3B2QA 2JGIA 3TW0A 4ENSA 3WGMA 2C9CA 2JHPA 4I1SA 1Z08A 3DL2A 1UMCB 1HFKA 4EO7A 3LY8A 3R9XB 3KOZA 2DBVO 1QXSA 4X93A 3DZHA 3A05A 4EUFA 3PGA1 4IS3A 3FYUB 4CEJA 2WAAA 2L19A 4JEIA 2Q1YA 1B0PA 4RZIA 5SY9A 1NP7A 3LSTA 2Y6UA 1GAQA 3CLSC 2CXQA 2EWWA 3QWBA 4J9VA 4UNSA 2JZOA 4ZT6A 2R8OA 4ZDIA 3ZE9A 5IAOA 2FG6C 2C9DA 4YV7A 3WNCA 2WM8A 5D1NA 5HP4A 4OIMA 4Z8XA 2BOVA 2LGJA 1PJBA 4GMFA 4CIWA 5ICEA 2NVUA 2ZB4A 4Z3OA 2CY0A 3I9OA 1DKNA 1UKBA 5C7LO 2VNJA 3WGYA 4FYXA 4B6OA 1QUFA 1EHYA 1MAWA 2FHSA 5CW2A 4F6RA 3RVMA 4AJPA 1RWNA 3JD2A 1NONA 3MQ4A 3WJ2A 3SC2A 1ONNA 3SFVA 2DGDA 1MW9X 2FN4A 2I6FA 3F2IA 3W5BA 1XXHA 3LQ1A 4I9HA 3NKVA 2BHRA 2CE2X 2XV1A 3VHXA 5TQ0B 3J7AC 3NIGB 4LE1A 4W5NA 1RP1A 1Y42X 2VSOA 1UBGA 3M81A 3VZCA 4B73A 3NRJA 4TWIA 3GOHA 5FPSA 5ESRA 5CD9A 2QRLA 1QE5A 3AF1A 2GRAA 4PNHA 4HB0A 3WSVA 3ABOB 5EZYB 4EL0A 1GVHA 4P34A 2EHDA 4CEHB 3GFVA 4N4AA 5AHKA 2V1XA 2X14A 4X1YB 1IN8A 1II8A 2I3DA 3DMYA 4TXHA 5JAPA 4FEYA 4FOSA 1BKSB 3OFSA 3HCWA 1NG9A 4FUQA 2O2GA 3C2QA 1L7NA 2GJ4A 4KSYA 4EGFA 4FNAA 2R86A 3EEBA 2P3SA 3FIJA 2OV6A 4Y2RA 1PJTA 2BFFA 3R3JA 4QRDA 4US1R 4WLOA 1CVIA 1JT9A 3EIEA 2XWPA 1IDN1 3GUVA 2GYYA 3IAAA 3JZFA 3Q7TA 4G0YA 4M3NA 2VCYA 5D3MA 2G76A 2IWHA 3RLFA 3F67A 3T06B 4DCTA 1AN9A 2BONA 3SEAA 1KZYC 1OTXA 5E4TA 2V65A 3OTQA 3STHA 2VUUA 3PFHA 2CLIB 1XCJA 4FPXA 2O8EA 2EJTA 3GNLA 1ZD5A 2IHYA 3HSKA 5CDHA 1SVSA 4RACA 2AI2A 3ZXIA 1XJCA 2YWDA 4Y2QA 2DPMA 1NOKA 4LBWA 4J0CA 4IDDA 4QTUB 4AX4A 1RKQA 2AX4A 5C35A 3GT0A 1UQUA 3T1QA 4FYMA 4ZREA 1SJ9A 4QELA 4RIEA 1Z17A 2HMVA 5EWLB 2W4QA 3IUPA 2GTPA 4OSOA 4HG2A 1KH3A 1Z28A 4HNQA 4YUAA 1U8UA 2V7QA 4P32A 1PT6A 4ESVA 1MGOA 1X3SA 3O1IC 4U39A 2WIFA 2H4ZA 4WVLA 3VOTA 2COKA 3UUFA 5CIYA 1T3HA 2PMDA 2I5PO 2QENA 4FLFA 4ZD6A 4FD3A 8GPBA 5AQEA 3FRJA 1VP9A 3HKBA 3BN3A 4MW6A 3NBQA 3WMEA 4YAFA 2UUAB 2B6NA 3MWDA 4EF4A 1WSWA 4G3XA 1WWKA 2W6ZA 3VKFA 1DOHA 2LIPA 4HMPA 4IDBA 4JGIA 1W19A 4UZSA 3AR6A 3UAOA 1LBIA 3GBSA 1L5YA 5L3SA 1CLUA 1R0BA 3IUJA 1D0VA 1DL5A 3L0BA 4WH0A 1Y9AA 2OCAA 3DW1X 5BOVA 2PJZA 2O9JA 3ZWPA 5ECYA 4EAAA 4J3NA 2I66A 4A27A 1YBHA 2BHNA 1SXHA 1P81A 5DXFA 4C0JA 2QPLA 3GGGA 2MJLA 3ESYA 1X9HA 2ZTLA 1Z83A 3AKDA 4GO1A 4KUHA 4N5LA 5TPWA 3DV0B 3WLPA 3WJ1A 4ZZ2A 3X1DA 2W6JA 5KYGA 1KEWA 4Y7DA 4YASA 1OOEA 1XP5A 5GAJA 2EG5A 4G84A 2VOEA 4GWLA 4K3UA 1JDJA 3C1UA 1YDGA 2WU3A 3V7FA 3N53A 1BW9A 2JCXA 5C1PA 4RD2A 3O4RA 3FMFA 2W0SA 3EVAA 5FPKA 4PM4A 4QVGA 1ZIDA 3U3ZA 4DM4A 2QSJA 3HB7A 5AI9A 1QIKA 4FFLA 4Y3UA 6PFKA 4PLWA 5AKYA 1JF8A 4A03A 4DLSA 2G17A 4FEAA 2AVDA 3I3OA 3K0FB 3RGGA 3S29A 3DLTA 3P9ZA 1MV5A 3JRXA 2YYSA 3UF0A 4CEJB 1V43A 4RTJA 3S2ZA 4FEGA 1B4DA 5TARA 1S9HA 3ADPA 2H9YA 4RK0A 3KSAC 1VMIA 3F8TA 5BURA 4IR7A 1Z07A 2PHZA 5DLPA 4OX9B 1TYCA 2ZUDA 1HLFA 1VKRA 1Z0SA 3VVCA 2C2KA 1Y6QA 1KU6A 1J1ZA 1LDGA 1ZA2A 4MCAA 4WLVA 4ZT5A 3ICPA 4ANFA 4PO9A 1UT6A 3MJHA 3PT9A 5CFNA 1GG8A 1JHVA 1I4DD 3QXXA 4S05A 4HVTA 4EHJA 2NVUB 2Y1FA 3DQZA 3PGJA 2GAJA 3I6ZA 5CX4A 3C5HA 3OE1A 1FFEA 3G2JA 1W35A 1DWOA 4TKLA 4F6RB 2IGBA 2P91A 4NBUA 3CVUA 2H1OA 4YCBA 1P0FA 4G0MA 3LQQA 5ERGB 1RWMA 4BMSA 3SC2B 2X4LA 1ZX1A 2B30A 3A2KA 4G0WA 2PFGA 3BORA 1XXHB 4RETA 2ZE8A 3B13B 4H4EA 2QW0X 3E1GA 3VHXB 2WJYA 1UJBA 4PAQA 4PHHA 2IV2X 4GMKA 3REFA 4DEVA 3ETGA 2HJGA 4TQGA 2LVBA 4IZOA 2AMJA 4FYPA 4LX8A 3B3JA 4ENTA 3VH3A 1G6Q1 3ZWYA 4G8JA 4CMJA 2Y71A 3VR6D 1E2LA 3QA3E 5GY7A 2PEYA 1WUYA 1NXOA 3FI0A 3OZXA 4XGKA 2WOJA 3V8RA 5LP6F 1O94A 1MB0A 4Y6RA 1XF1A 2PSEA 3H75A 4DADA 2XWBF 3UXHA 1II8B 1H8ED 4PHGA 3ROFA 4C7VA 2C2HA 3SHOA 1FFDA 4TRJA 2WAMA 2VH5R 2JFNA 4HH3C 4JSRA 1DXOA 1Y7PA 2O7QA 2AG6A 1M5RA 2WZCA 2P3LA 3PQ3A 5B2EA 3M2PA 2BFFB 4AKHA 1GRNA 5D3MB 3RWMB 5BQFA 3D3WA 5AVUA 5E3IA 3K31A 1AD2A 3SCZA 4CODB 4D26A 2JLAA 1ZS9A 1OWMA 3L7IA 4M86A 4L3VA 3FR7A 4P2BA 1QIIA 4ZZ1A 1KAMA 1D7AA 4RMHA 2O8EB 3HBLA 5AVZA 5JRJA 1WO8A 3AFNA 2FR0A 5CHEA 1G2PA 1L3IA 1N4DA 2IYYA 3TYXA 4OB7A 3LQ2A 4UM8B 4DG9A 5KYWA 2QDKA 3DG9A 4HDQB 4CR7A 1U94A 4ZGBA 3V48A 3TEFA 1GGVA 1B42A 2CNWA 2Z1MA 3HGMA 1Y8RA 2RIPA 4JIMA 3PX7A 3MG9A 4LE2A 2BR5A 1P4RA 4N18A 5CK4A 3LQYA 3T7JA 5BPHA 5L7TA 4CU2A 3KHSA 4AZ0A 4HUTA 1C9YA 2H48A 3NGMA 1N0WA 1P33A 1O95D 2PN1A 3OU6A 1RR6A 1W1UA 1E7WA 1XEWY 1SBTA 3D8TA 2WR8A 4L4UA 2CWDA 3R1IA 1NVBA 4LUCA 4NZPA 4EL5A 1H2ZA 1KJWA 2B5VA 3C6XA 4LZNA 4QBTA 3HKBB 4JLVA 1VRVA 3MWDB 3YASA 4HBZA 3HDYA 1PGNA 3JQ6A 4HNRA 2H5EA 4RH0A 2Z08A 4UHHA 3RUEA 3UOWA 4D4JA 4BVJA 1C41A 2G83A 4IVRA 5ICMA 4K9NA 5L3SB 4X44A 2QXUA 2Y4NA 1ODCA 1JZSA 1VG9B 1TYAE 3SOZA 4F04A 5JS7A 5L8VA 2R6HA 1M8PA 2BI8A 3HZZA 3DBVO 1SOMA 3SD7A 3KOXA 2E1RA 1ATIA 2G4LA 2Q0XA 2R6AA 3B78A 3MF4A 4GS5A 4Q3LA 1T1SA 1DE0A 3AB7A 2E48A 3B89A 3L92A 4GDMA 3WV4A 1JFFA 2VDNB 3DV9A 3GFQA 2IQ5A 5TPWB 4CT4B 5F3WB 2C03A 3QFHA 4LJ6A 2CF6A 4EY5A 3NBFA 4BB9A 4C89A 2REQA 4RSHA 3RK4A 3STWA 4XVCA 1BW9B 4Z7QB 1P1JA 2GVZC 1EWYA 3Q6NA 4DVJA 3JD4A 1G3MA 3CG4A 4MPDA 3S40A 3PQ8A 4WCFA 4EYSA 2G67A 1YB6A 3GRZA 3OKFA 4GEGA 4JC8A 5H9VA 5TT1A 2Q07A 3PHIA 4DC1A 3EVBA 4FW9A 1KVUA 5AUQA 3AUKA 1GPKA 4IWXA 2AJ8A 1L5SA 2VLBA 4RBNA 3SG0A 1PP4A 5U4XA 4DMFA 2SKDA 1ZGZA 1OFGA 3LCMA 5B4VA 4EPWA 5HJEA 4R83A 1UJNA 3AI3A 4QBHA 1RBQA 1FX0A 3CZ4A 3DMPA 4UATA 1ZI9A 1TVEA 2CDBA 3SR4A 2CB9A 3ZK8A 2ZE7A 5KTMA 2AL7A 4Q03A 4UBOA 2ZIXA 3TGPA 2ZCVA 1SBZA 1FXWF 1KDYA 2B83A 3IBSA 2I9KA 3FWHA 2MIIA 3GY0A 1QQTA 1U99A 4JLSA 5LA6F 3HRHA 1PGOA 3PFIA 2BTQA 4YUYA 4EH1A 3NHRA 4LQLA 3W2EA 5B2FA 1DKMA 3N74A 3Q2KA 2D1YA 1ZITA 4ER5A 4Q9JA 2VFAA 4MHOA 5A4DA 2GTIA 4ZQBA 5FAKA 3GJQA 3GP5A 3AX6A 2YJ4A 3OEYA 4CF5A 4IEFB 1KPHA 2HJHA 5EXEA 5D3ZA 3EPHA 1ECLA 3CEJA 3B5EA 3FX2A 1YRBA 4FZ5A 1KZ6A 3I8OA 2VP3A 4LYEA 4PW0A 1UBSB 4IOLA 4Y2JA 3TMKA 1W1IA 4K8OA 4HUJA 4RMNA 4X92A 1USWA 1HZZC 3CN9A 3L0DA 5B6PA 2ANBA 4ZVOA 2VJMA 2BH2A 1NMSA 3PFFA 1DCTA 5K8IA 4FBGA 3WLMA 2PJUA 5EESA 3QWAA 1P5HA 4CEIA 1VXRA 3OPMA 3O0DA 1VCNA 1AK9A 1J2TA 2AFIE 3IUNA 1WY5A 3NXSA 1Y89A 5D00A 3O2QB 1LU9A 3K05A 4L50A 4Z9FA 521PA 4LMRA 3VSBA 3Q0IA 5BWNA 4AG5A 2ID7A 3PYMA 2VKQA 2R68A 3HI6A 4K6CA 3ZPXA 4RIIA 1P9NA 4QU8A 3F8SA 4R0VA 3VFDA 4DXHA 3CQ9A 4ZT7A 1PLJA 3NYRA 4HLUA 2O3QA 3K0KA 2YWXA 4C87A 3GBPA 1TYDE 2XX3A 3FUCA 4HGZA 3HBJA 3WWZA 2J3QA 3D3WB 5BT8A 3CUTA 2H51A 2F4NA 4UVIA 1ENPA 3BE8A 5HKLA 4OTZA 3WRYC 5HFNA 2WQ6A 5BXQC 3AIMA 4NAHA 1I0LA 1JAHA 3KD2A 2CFIA 2BKLA 5LMZA 1Y1TA 3CZQA 2WUDA 5E2IA 1YZKA 4L72A 4MKFA 3TRKA 4JBNA 3GGOA 1L1QA 1RI2A 4O1MA 5KYWB 2I65A 1VA4A 5CBKA 3X1WA 4D8VA 4MVJP 5ALDA 5DTRA 1UK7A 3KE8A 1ISPA 1DBRA 3FLAA 2DP4E 2EGUA 2GZ2A 2PRZA 1H23A 2WICA 1HSZA 3AFOA 3H8VA 3IAS6 1TZMA 3K92A 4UTXA 3RT9A 1Y8RB 3T61A 4UFNA 5L40A 4GWKA 2F1KA 4OGFA 1NYRA 5JZMA 1XMVA 3HSSA 4Z9BA 3ILHA 3IIIA 1TQ2A 3AR3A 3H9BA 4GSLA 1YFJA 1JALA 2ZUBA 3TD9A 1R0KA 5B1DA 3VSDA 2ZVJA 3C70A 3ZGVA 3PG5A 4Q24A 4AZ0B 3H5OA 2AC4A 4P7GA 3WB1A 4YR7A 5E2AA 3TGWA 1ILEA 1YGPA 1B8VA 4B6EA 4PLTA 5GM1A 5HZHA 7YASA 3ECCA 3R4CA 2OYCA 1W52X 2E6UX 3WB9A 3NHMA 3QU2A 1XIVA 4IGFA 4YIHA 2OECA 1TJNA 3A9TA 4I8DA 3FHJA 4QU9A 1HT1E 1XQYA 3SZGA 3OZSA 1QH1A 2AXPA 2G1PA 3BRCA 1K8RA 2IHNA 4KPYA 2XDYA 1B2RA 1SVKA 1G8YA 1RD4A 4KMRA 4BP9A 1FTWA 1E2HA 5A4MS 4ZV7A 4IXDA 1WAMA 3OA2A 1KAOA 1QPBA 1JEAA 2P67A 2ZUTA 1MIOA 1ENZA 1JFFB 4IUDS 4NAVA 1ZBQA 1WM1A 4L2IA 4AG6A 1PEYA 1Z0AA 2EU8A 3PUZA 4EB8A 5C1OA 3F47A 5E6SA 2YKGA 1PEKE 3TDMA 2Q1UA 4TV9A 1E3TA 2E4AA 1XJ0A 2HRZA 1JR3E 2QYSA 2REQB 3HG7A 2Y6VA 3JYOA 5C7IO 7MDHA 2RGAA 4YRAA 3ZDAA 2YOGA 1C2TA 5JADA 3BH0A 4X64B 3CR7A 1ZZGA 4NS1A 2QLMA 3EA5A 4WCFB 1VXOA 1P73A 1V7ZA 1T9GR 1Z8DA 2IFTA 5TMDA 4JI5B 4DYDA 2GQ0A 1XN1A 2R0QC 4GDFA 3UQZA 3T7KA 1VDZA 1TKRA 3S0JA 2ZKLA 3L01A 4EMBA 1IK4A 5JJ5A 4Y98A 1ZRMA 4N82A 3ZEAA 3FD8A 3PXDA 3ND8A 2JGLA 3EMKA 5HKAA 3SHWA 3P2IA 4J0HA 4IFTA 2VDPB 1MB9A 1AKWA 4GRAA 1FX0B 4HDAA 3OPVA 3PD7A 4GPBA 1F4PA 1TECE 3BH7A 3AGPA 1B6RA 1OJ7A 2ZIXB 1PS8A 3C6MA 3H5IA 2ZI3A 2VJLA 4AIIA 5FNVF 5BN4A 1ZKDA 4HC4A 2HXYA 2HNKA 2VKTA 2VEOA 4TKMA 3OFVA 1UP6A 1P2VA 2C7PA 4PX3A 1VG8A 4TQUS 5H70A 1LJLA 1RWPA 2BTQB 2FQ1A 1DHRA 4JD5A 3RCBA 1UIRA 4BMPB 1T4GA 1NVXQ 2IXGA 2PZAA 4BFUA 1P2GA 3HY4A 1A27A 4TMFA 1XEWX 4NU5A 3TL6A 2WZQA 4G1UC 4RTMA 2JBWA 4NF2A 1MQSA 3WNDA 1R0CA 2DHQA 4MVJE 3FFBA 1U5CA 3IR7A 3CWCA 5C4GB 3RANA 4ZAZA 1HOXA 1VI2A 4C20A 1II0A 5D84A 4RQAA 4RNCA 2DBZA 1NATA 5C18A 1GUBA 4X0EA 2HU2A 1FYFA 1KQPA 2AD1A 3X1XA 4DQ0A 3V46A 4OJQA 3GF4A 1SM4A 4GE0A 4XKJA 2BGMA 2VJMB 3L8CA 4Q9HA 1KQGA 3FW1A 5CNJA 1JAIA 2OE2A 1ZCAA 4OK3A 5GVSA 4OATA 2AS0A 3U3XA 1XK6A 1GHTA 4C6SA 2XIJA 1E3JA 3IBTA 3OKAA 4JC5A 1GGMA 1EQ2A 1LPNA 4CEIB 4YXWD 3VR3A 4EBBA 1E6UA 5JD4A 3AMVA 1T6BY 2ASEA 4MMZB 3WGJA 5HVNA 1WCWA 3IAUA 3WNBA 2NPOA 3M1IA 4TVSA 1HDXA 4RQBA 1Z4OA 3Q40A 3BK1A 2V59A 2BY4A 2OM6A 2PEZA 5BORA 2V9PA 5CTJA 4XD7A 1F8XA 5KVSA 1G7SA 1MH1A 1GITA 4NBRA 3WKBA 4BNZA 4HNHA 4YJ3F 5ALVA 5J4LA 1Z2EA 2TMKA 1KXJA 2OCLA 2QMYA 5EXPA 3VAZA 1TZ2A 1U2ZA 3ORYA 1ZM4A 4Q05A 5LM3A 1OREA 1MC4A 3QP9A 5C81A 1P7CA 5K0EA 1XCOA 2VZEA 4LKOA 5EP4A 1I80A 3MLEA 2RAVA 3AR2A 3LUAA 1I7QB 4RPLA 7ABPA 3H19A 2JAXA 3V4SA 1DUSA 4NCJA 1WJGA 1ZOLA 2X9NA 5CFZA 1DGQA 4MKXA 1PV1A 3O8LA 4X24A 3RADC 1Z6YA 4MROA 1SQGA 3NWOA 5CIQA 1BE6A 1K4MA 2RHMA 3I52A 5AYVA 3LL7A 1LA2A 4FGUA 4V2IA 4JYMA 5A2GA 1WBBA 4RZXA 5A4IS 2J3HA 5AXDA 1U0TA 3M4NA 1I36A 2D1FA 4Y67A 2XZDA 1QV9A 2W2TA 2ATCA 2ICAA 4DIKA 1YULA 5BPFA 1B41A 1D4ZA 3FPCA 3O1LA 4FJ2A 4WSOA 4XQGA 2DKFA 1IXZA 3HCNA 4ATNA 3ZD6A 3NWEA 4U63A 4EJ2A 4BIMA 3IX7A 4FHGA 1QGZA 1Z0ZA 4PC2A 2FQXA 1NBHA 4X85A 4AL4A 5DNUA 1R8YA 5LDHA 1VJCA 2VZ0A 1O95A 3FSRA 1LD3A 1EE1A 3MTJA 2OQIA 2ZUWA 3F71A 4H31A 4JL6A 4QWMA 4RXTA 4D1YA 1QH1B 1V3TA 3KPJA 3W6UA 2BP7A 1PR2A 3EXIA 3KB8A 2W2QA 4TMTA 3R2JA 2AUMA 4EZEA 7ADHA 1DRJA 2M2IA 4IDFA 1GSIA 1GY8A 2P9QA 2W48A 3LLVA 3UMYA 2OCBA 3TZHA 3U1BA 3ZC3A 2CV2A 1Z5NA 5JMTA 1UBTS 1MIOB 2BF4A 4RVHA 5CPFA 2JAUA 4QYTA 5DCYA 5BNFA 2P9EA 2CVZA 4L2IB 4B33A 3WXMA 1RSZA 5E6SB 4BWFB 3GLIA 3L9XA 1Z0DA 1HR0B 1YUNA 3B7PA 5F23A 3HFGA 4TV9B 1BE0A 3WDSA 1MP0A 2ZUEA 5FBVB 2VUHB 3A1WA 4A2CA 4C7BA 3AOGA 4QGFA 4FHDA 2CB0A 3R7NA 2WIJA 1RM3A 3CB2A 1MDFA 2HMWA 3ANMA 5F52A 4QPDA 3R7DA 1H2YA 3UK2A 3ICCA 2D7JA 3B8EA 1LS6A 2XNJA 1O4WA 2P9GA 4HAWA 4HGNA 4ME6A 2ZM5A 3BRQA 3CH4B 2ZTHA 4PX9A 4Q6WA 1PZGA 4K9DA 2JFYA 4HKTA 5GWXA 5KNBH 2YZMA 2BKEA 1BOOA 3LUBA 4P31A 2ZUFA 4EG6A 4OHMA 5CXQA 3F96A 1DQSA 2IUSA 1QC5A 1Z3IX 3LPLA 1JDZA 5JBNA 1GU7A 4BMVA 3CPSA 2PPLA 5CYGA 3MTBA 1NF8A 2Q3LA 1D1SA 5EJAA 4UTVA 3T95A 3TRIA 1NGSA 2FCAA 2QMHA 3D7RA 4MO9A 3N7UA 1P8JA 1R16A 1XVAA 3TW4A 2QAGA 3TOVA 1J7JA 3VR2A 1JNYA 3E05A 2BEVA 4UTPA 1FQJA 3EQ2A 1X86B 4QXQA 3VYTB 1B73A 1IWOA 2L2QA 2UZ0A 4YMHA 3HJBA 4IOMA 1R4ZA 1JYSA 3II6X 1EJ2A 4OFZA 4ZVTA 4NP6A 4DCJA 3C14C 4MLPA 3F6CA 4JT4A 1BNCA 2A4MA 2EX1A 3RBZA 2FMHA 3QVXA 1KOLA 4F5WA 3ZWDA 3M3HA 3NH6A 5CDFE 2V4MA 2C4NA 4W8GA 3IDQA 3N0RA 3VU9A 1L5WA 3KUDA 2AI1A 1RRCA 2D2EA 4CUKA 2ZSEA 1HYBA 1BGVA 3SYTA 3P9KA 4M9SA 2WWHA 5JWRA 5HIKA 4PZUA 3AUUA 1QYCA 3RAPR 3T7AA 4ON9A 4OI0A 4C4RA 3HDVA 4F91B 2VK2A 3KAJA 2X0JA 1Z8HA 3HXKA 2SHKA 5EPEA 1J06A 2OB2A 4YLGA 1EBFA 2I3ZA 4J6EA 1KJ9A 4P7BA 4PHFA 2ZBGA 4WAUA 5KWSA 3SP1A 1A2BA 3BFXA 3EGDA 3GEDA 4WXMA 2C4HA 3IOYA 2P79A 4URYR 1VSVA 2JIBA 3M5CA 4GVPA 4K26A 5I9TA 1IY1A 5JOQA 2BM1A 1S2GA 1TF7A 1K7YA 4O0MA 1P74A 4QVIA 2FWMX 4GQAA 5E1DA 1ZJJA 4Q7JB 5EE9A 1PVDA 4HS9A 3TZEA 1OXKB 3V7NA 3B6KA 4BFXA 5LQCA 4BLVA 2G1AA 1STOA 1M66A 4UE6A 3B1WA 3SJ7A 5IZCA 1ADJA 1ABBA 4GPEA 3ZJTA 3BH6A 2VK4A 2GF2A 2QZPA 4TS1A 2WTMA 4A2WA 2XT6A 5B3LA 4H1UA 3ETEA 4DW8A 2BRUC 2FWBA 3GROA 4M7WA 3ZE0B 4R68A 1JSXA 4IVPA 3P8ZA 1SU7A 5AW1A 4LVNA 3KP1A 4B83A 3HVUA 5IK2D 4RDCA 2PUEA 1U6JA 1IHPA 5FV7A 1GQFA 3KSBC 4BO1A 3FI9A 1L9XA 3KHKA 5FA6A 1TAHA 2I2WA 4QYXA 2OUIA 3H2JA 5AM4A 4KO2S 3SQNA 5F35A 4EX7A 4YCSA 4UNQA 4YUVA 3GLGE 1IZ8A 3DWEX 3IQHX 4I1UA 2FR8A 2XH8A 3IA7A 4ISBA 4C4OA 4DMUB 3R74A 3U80A 5G0TA 4BE4A 3KV1A 1EVJA 5A9SA 1F2UA 2PH1A 2C00A 1AQYA 1JTVA 3E4DA 2WUVA 3EDYA 4D3YA 3CVYA 1YBAA 4WE3A 4K9LA 4ZVSA 4GL4A 4HQNA 3E27A 5CLFA 4UBJA 1WMDA 1EG2A 1NW5A 2ZWIA 4G5XA 4JI3B 4FYHA 2BP7B 3EXIB 1JIIA 1RMYA 3MS7A 4Q5IA 5DGXA 4YT2A 1DJMA 3L46A 1AUVA 4AUNA 1EFCA 1ZH6A 4FI3C 3LAWA 4RY8A 5T6BA 3TVTA 5F5NA 3GHHA 1FFGA 1I4EB 3NXKA 3C3PA 3IA2A 5BUQA 3P9NA 1QZUA 1OIVA 4X3PA 4XX1A 3S7ZA 5FWNA 1ARZA 1WLSA 2BZGA 3MELA 2PD3A 5HZKA 4OXNA 5IF9A 3CNEA 4NZZA 3GLIB 3U3MA 4DMKA 2QD5A 2XSZA 2YZ2A 1J7KA 1K7FB 2QP9X 1BG6A 1QQAA 2O07A 1J99A 3LT2A 4U9HS 1OAOA 3OQPA 5LLSA 3L0YA 1SCIA 1VA5A 1KJZA 1JJIA 3VPGA 4J0FA 2WLSA 3T4EA 3FMOB 4FOPA 2WNHA 3QE9Y 3OKCA 1V3VA 1G8SA 3P9RA 3AZOA 2NAFA 1RC1A 4OLJA 2I76A 1R5BA 3UTDA 2VAVA 1PFQA 2ZJ6A 3CY6A 4NBSA 5EXDA 1SHKA 2OHGA 3OTIA 3PKJA 3O2JA 1MB3A 4G1MB 1A2QA 4KQJA 5F73A 4D8WA 2DR0A 3KKQA 1WXGA 3QVOA 3GT7A 2ZYHA 1LK0A 1LTQA 2W7TA 4HFRA 1W59A 2IYUA 4PCUA 3JQAA 1QC5B 1QPGA 4GXQA 1ZH8A 4QATA 2BEKA 3RT7A 3H2ZA 1DO8A 5EA2A 4K9KA 4FM9A 5THKA 3CNOA 3E9EA 2YHUA 3QLVC 1VGRA 1NXSA 3ZHQA 1XRRA 1S4QA 2QAGB 3BEDA 2H8KA 1H65A 2OL4A 1ADBA 1YJXA 5JPIA 3RUPA 5IVHA 2PAFA 1YZYA 2BEVB 2Y1XA 4GR4A 3OJLA 1NRWA 4MUYA 4G9EA 1JR2A 2VJKA 1Z45A 3Q12A 4XOIA 1RWBA 1EWRA 5AVOA 1IG0A 4C43A 2FETA 1UEIA 4G81A 4JQCA 3PF9A 5BQ5A 2J48A 4BKPA 1BCRA 2DTDA 2BHSA 3PR2B 4RXUA 1BYIA 4GX0A 5CH3A 5AD1A 5KREA 5LR6A 3A6KA 4RM2A 2AR0A 1SCNE 4WY8A 1N3LA 4ETMA 5IJ9A 5KS2A 1USVA 1W48A 2G3YA 5FPQA 3VU9B 5JAMA 1ZLYA 2I4OA 1JL3A 3KR9A 5HTKA 1ZEMA 4IUBS 4B9EA 3R23A 1NE7A 5KQPA 4MV7A 3C5CA 2WTAA 4RGQA 4RWEA 4W9NA 4MS4A 1YFLA 1DEAA 3I92A 1M2WA 1YHNA 3MJCA 2YQZA 5HM6A 4UM5A 5IRCD 3JS5A 3JATB 1KSJA 4MV6A 3A9VA 3EC2A 2PX3A 2D5LA 2VWGA 1OT3A 3UK1A 5ITZA 1DC3A 1ZGJA 1T9BA 3ND9A 3EGDB 3HMQA 4MPTA 3V1UA 1WMSA 1RQNA 2D1RA 3RJMA 1ZVVA 4JASB 1FTSA 4RS4A 3OO1A 4JP8A 2LD4A 3IVGA 5C8XA 1Y8QA 1MO5A 1EVQA 2NSYA 2K4MA 2Z6UA 1SU4A 2J33A 1LRLA 2PAAA 4PE5B 4X8LA 4IZIA 4NHEA 4NR0A 4NWIA 3PR3A 3TR0A 3ZWMA 3DV2A 4J03A 4F96A 3A8TA 3Q72A 1NJ6A 4GM1A 5AOCA 1KR2A 4XFJA 4CTKA 3IEVA 1G41A 3I4CA 1VG1A 4UTRA 2HDHA 2VQFB 1N2ZA 1ZUHA 3CVWA 3G0OA 5A7FA 4NKRA 1T6ZA 3RSCA 4JFAA 2JA1A 4LXXA 1M3SA 1U7OA 1OZGA 3BTSA 1CUYA 3KKPA 3PITA 1VLVA 1J0CA 2I03A 4I50F 1W36C 4C5BA 1LY1A 4PVCA 3LLMA 1NG1A 3FWNA 4MV5A 3ZZTA 2YR0A 4IXMA 1NMQA 4OL0A 5ECDA 1CR4A 4RH3A 5LC1A 4X95A 4IICA 2D0OB 2GJ8A 1AKNA 1SU8A 1TMYA 2EYQA 3HR8A 4FGJA 1I7DA 3GJ7A 2C84A 1V41E 1E9DA 2J6BA 5HK8A 4PTZA 2HPZA 2ZS8A 3DPUA 4YAJA 5JXHA 3PYLA 4TLEA 1DX6A 1R4NA 4RKQA 3WWOA 5ITSA 5L3VA 3MK31 2OYRA 1E2BA 4MA4A 1T34A 3REOA 3JRNA 4LDPA 5A9SB 4EA9A 3R6DA 5IT9A 3OOYA 5KZMB 1Y6GA 2FJPA 3WK7A 5KKCA 1CZKA 2P4HX 2ZB7A 1K06A 3NHSA 3AM3A 1LBSA 5JI2E 3OPXA 4Z51A 1IAVA 1YJAA 4JDUA 1ADYA 1IHDA 4CQLA 3ADOA 5JC8A 5HMLA 5CG1A 1FPQA 3RU3A 1XGKA 5HBRA 1HYEA 2GJ9A 4QDKA 2GEFA 1TVKA 3PD1A 4MVJM 2QZJA 1ISJA 5JQGF 1TEHA 1ZESA 3ONNA 1EAYA 2ZRGA 4H7EA 1GPNA 4BN0A 4BGUA 3M6AA 1WB5A 1X70A 3INNA 4Q3OA 4ARUA 4GX1A 2FZWA 1ZNQO 3N8DA 3WP0A 2IITA 4F46A 4B46A 2YVUA 4BEJA 2EBUA 3CEAA 4FWTA 2IIBA 3KOOA 3FHOA 2V7VA 3LNCA 4I5EA 4UEJA 5BSMA 1QHFA 2YYYA 4JODA 3CRNA 3MGAA 4RDIA 4CKXA 1XPUA 3EQZA 2CBXA 4NQZA 2WT4A 1DG1G 4XYGA 2R6GA 3I2YX 4ZDWA 4ZKDA 1JU9A 4QGHA 4LFBB 2EOAA 4QJ3A 3V3KA 1QFXA 2YJTD 1EB9A 2AV6A 2J31A 3D8NA 5EUQB 2W2NA 1MBZA 2ZDHA 3MJRA 3IUBA 4L6IA 3OOHA 5BYKA 4O59O 3DVAA 2X40A 3OD1A 1GP2A 4HGYA 4KBFA 2MYNA 1E9EA 4ETNA 3H65A 2AOTA 2E1PA 4YVFA 1P91A 3HCPA 2J9YB 4F6CA 4YV1A 3UMFA 1U3WA 3NJ8A 4GMXA 4DILA 5FYDA 2A57A 3C45A 3IL2A 2FZVA 5HE8A 2WPDA 3FPSA 1UFOA 4BO0A 2HA5A 1QKJA 3AKEA 3GGSA 3JQAB 5K3AA 3WFIA 5FH9A 3FFTA 4IV5A 4AM8A 3ZWBA 3CGWA 2OGSA 1IBMB 2ZKIA 3DFFA 1GA1A 3OFKA 4L5JA 3JYNA 2PZLA 1V35A 3COVA 5ALHA 5D01A 1XB2A 4B9AA 1N1EA 2EP5A 1CQXA 2SNIE 3C48A 4H6WA 2MR6A 4J76A 4LQ4A 2DUJA 4R1SA 3RTCA 1DOZA 3AJ8A 4ALMA 5LB2A 1CQPA 3M0EA 1TCCA 4DEYA 3WHLA 2JIDA 3W7BA 3LD9A 2D3TA 1GKIA 1CHNA 1C5KA 3LCRA 1Z6AA 2VHJA 4I4CA 4WGFA 1HL7A 4ZO6A 1H2WA 2CFTA 2GM4A 1KRXA 1BCRB 2ZRKA 1DKOA 1SKYE 2BGIA 2GO1A 4J91A 4AB1A 3ZW8A 1RAGA 5IJ9B 3ENVA 2VTKA 2WYHA 3BK7A 3D5TA 3L8ZA 3OCWA 2AOXA 4TPKA 3RSOA 4ZJPA 3L7CA 2GZRA 4YV2A 5CFOA 3B82A 2QJFA 1YFKA 2PU5A 1YZ3A 4MS4B 1EFTA 3SNKA 3VSCA 3SF0A 5FFMA 2CXRA 2HSGA 5IVPA 3G9TA 4DWWA 1TTHA 2ZS7A 1P0QA 3WK4A 4ER6A 3D54D 4KGDA 4IS2A 2OSBA 4LJ4A 3QLUA 3T9EA 3OT1A 4ZU3A 1W0CA 5ITZB 3GCXA 5EIFA 4KDRA 2GI4A 5F7JA 1OFIA 4WLEA 2FXIA 1TIKA 1Q11A 2YW2A 4NFHA 2X23A 1Y8QB 2J7KA 1U31A 4D3FA 1M5UA 4TYWA 5AVVA 5AJZA 4IXNA 5EEHA 4GI2A 3F98A 1QK3A 4WTOA 1RWKA 3V2GA 3UJAA 4GI7A 4ZI3A 3GXOA 3FZQA 4K6HA 2C59A 5LWHA 4DV7B 1RJWA 1PJSA 2V1UA 2DR2A 1X94A 1YRQA 4ZI7A 3H2GA 3H9UA 2RHDA 2XYVA 3RK1A 4PRLA 1M0WA 1KYXA 1S89A 2X1LA 1C3EA 2C3MA 1HRKA 3RW9A 5AVRA 3W06A 4MRPA 1N6IA 1HOTA 1FUIA 1JECA 4PPQA 2AKAB 5HZGA 1HF3A 4RHXA 4DTCA 5FV4A 1KKUA 1TM2A 1ZH4A 2KM1A 2H0RA 2VYND 3VDMA 3NDBB 4GYYA 1P6QA 1N5KA 2X13A 4NCKA 3FTEA 1FLDA 1POWA 4V1CA 2ODBA 3QUAA 4P4SA 3VR1A 1QYIA 1B6GA 1RXVA 1TUBA 3TLCA 4EF6A 1R4NB 3EZFA 1VLLA 3NYWA 4RZHA 1JFVA 3DBHA 3SSMA 1MG0A 5CR9A 5CVVA 4KQ2A 4D8YA 1YU9A 2AZDA 1TD9A 2D13A 3MPOA 1M2VA 4FDVA 3PQEA 4KLCA 4L02A 4NVRA 2A14A 1E3WA 1GZ6A 3DEAA 1HTWA 1LTHR 4CQLB 4S1VA 1JN0A 1VMDA 3PI7A 1ZHHA 1ACLA 5HKBA 2DTEA 3OLXA 4YRZA 5MGNA 1TVKB 2V96A 1Z4IA 2ON6A 4BAUA 4CM8A 5A4JA 1XMIA 5TVKA 3BWMA 1KYVA 4NCAA 1IBRA 2BMJA 2HSJA 1QAQA 1X0VA 2AT1A 2YZ7A 4ICIA 4AZWA 2PKYX 4YRGA 2AXQA 2KI5A 2ZCJA 4IEEA 1MT0A 3O95A 1L5GB 4L5YA 1G5QA 3PQCA 3HP7A 2D54A 1Q6ZA 2IYVA 3QVTA 3GNSA 5AKIA 1GTJ1 5A04A 1VSUA 5KYYA 1B8PA 3AR9A 4KX3A 1RHQA 2P8JA 3M6VA 2IYQA 2QF7A 4BMOB 7AT1A 1ZI8A 2WB4A 1VRCA 3P2JA 3MFYA 3P9QA 4AWBA 5L4LA 4MYSA 1AGNA 1R9NA 4EITA 2FX5A 2HO5A 4C29A 1ZJZA 2VTVA 4TMZA 3DYBA 1JI3A 4EUEA 1W29A 1D6JA 3DVAB 1OWLA 3M6LA 3B3FA 3NORA 4FOOA 1BDBA 2F90A 4L4SA 5JSQA 5HOEA 2OLJA 3WK9A 1EDBA 1XMPA 2AOTB 3D4LA 4B48A 2HXGA 3NUGA 2P7HA 4TYPA 2ZZKA 2MYUA 2AFRA 1W46A 2R87A 5IWCA 1QRDA 3CINA 3IQZA 3OIWA 2PS1A 2UYGA 2C2ZA 3MJTA 5HDQA 2GLXA 1C0IA 4FOLA 1W2WB 2OORC 2XYHA 3NM4A 3O6VA 3SIWA 3V00A 3W1EA 3WIBA 5IBQA 3X2SA 4AJJA 4GKAA 1NNUA 1BA3A 1XQVA 1JRLA 3EIOA 2RI0A 3F5SA 3IIJA 4BLSA 1HT2E 1O9HA 1O6CA 2Q6VA 3AR5A 1NFQA 2OY0A 4YACA 1CEYA 3W5JA 4BQQA 3FKQA 4C3UA 1NE2A 2DH6A 2GBLA 4E5NA 1H2EA 4OX9Y 2WKSA 1E5VA 3D8HA 4BO2A 4LHXA 1W85A 1TXGA 4ND3A 4BLQA 1NP6A 3DXZA 5DGHA 5CDTA 4ZDKA 3W5AA 3FDZA 3F7TA 5B58T 2QYHA 3KZMA 1II9A 1PZMA 5I8WA 2Y76A 1H94A 1H4SA 1U2GC 1OI4A 2RBKA 2YQ4A 3NV9A 5AI6A 2H17A 5DLQC 1E62A 1NJFA 2VOJA 5E4FA 4B17A 1N0IA 2OGTA 2ZT7A 2J3DA 3OX2A 5LWQA 1N8SA 1QYVA 2I7CA 3DCYA 3A1DA 3LPNA 2Z1NA 3D4BA 3IT2A 4M9UA 3T3GA 4B3BA 2VF2A 1EFAA 3EVDA 4DWVA 4P84A 2ZULA 2ZYDA 4YWJA 3OM0A 3ZCTA 4PRKA 5CDGA 2HIAA 3WGOA 2G9NA 1CZUA 1UP7A 1AKUA 1SEPA 2VHQA 1MRNA 2F1HA 1C4KA 3NHYA 1UWLA 5AI5A 4ZOLA 3H7AA 5GGXA 3KLPX 3OT1B 5B55A 4YMGA 1JHOA 1BE1A 4YRLA 1X7DA 2VXCA 3QXCA 4HGRA 2ZBQA 1QZZA 2GPSA 1H85A 5EJ9A 2R84A 3MCTA 2JLXA 4LGMA 2Q7XA 4UBMA 1JFSA 1I7NA 1OBFO 3MTIA 2AZ4A 5I4BA 1NRIA 5E9QA 3W5CA 2MSWA 4PYMA 2IYEA 4LVOA 1LPBB 4EKNB 4KR6A 1C3XA 1FNMA 2G1JA 4E15A 4EUHA 1P4GA 1YE8A 1Y37A 1BKDR 1JA0A 2Q49A 3BG5A 3H1FA 3K32A 4QPPA 3U1VA 1GTRA 3H11A 1BMQA 1YL5A 4JXZA 2WJGA 2NV6A 3MAAC 4ZI7B 2EBWA 1I32A 3MJSA 3STXA 4ERNA 3BMQA 1N5RA 4O6VA 2EWMA 5H1YA 1N3IA 2I62A 5TQVA 5DEIA 5GQSA 5SZKB 1ZUNA 1H4TA 1YZNA 3IP3A 3A1SA 1LDMA 3EZYA 4REMA 2CDAA 3IKMB 5D3QA 6ABPA 1WZCA 2IYLD 1PW7A 3CZRA 3DZKA 4ILKA 1D04A 3C24A 4JGBA 4D7AA 1ZHOA 4X90A 1ECCA 3UENA 2H1LA 1E2UA 1EK6A 1LLDA 2BH9A 4WEQA 5I7EA 2XCIA 5G2OA 2OZVA 1S4MA 3KSDO 1NV8A 1N2GA 4V1CB 4D81A 1H9AA 4P4SB 4FQ5A 4W63A 5AI4A 2I3GA 4YMSA 1TUBB 1I6LA 3F4BA 4ZI5A 2WPNA 2WYWA 4G2NA 3DBHB 3KL4A 3L1KA 4HY3A 3SIXA 3ZNQA 3KYDA 1QG2A 4UEWA 3CISA 4IJKA 5J3JA 2O06A 2ZBVA 1JXQA 2J5KA 2V98A 2Z56A 1M2VB 3L1IA 2QVYX 5FUQA 3B6JA 4JITA 4NDNE 1E3WB 4FUTA 2J3LA 3LRTA 4N9WA 4C0LA 3WIEA 2RBGA 3X0DA 4EY6A 2FN3A 4GQBA 3CCFA 1CUGA 2WYUA 3KJEA 1MX3A 3DCNA 5JMOA 1O0CA 4CM8B 2QUKA 1YWGO 3ME5A 4TTIA 1DTWA 1JR3D 1RW4A 1DEOA 3FFAA 3RVNA 2CLEB 4OKNA 4REQA 1NQVA 1K6MA 1VFPA 5KYYB 1FK8A 2NXNA 3K2EA 3SC6A 5EXXA 4JXJA 1SOVA 5DIZA 3G17A 1CUHA 2BJVA 2RGGA 4POAA 4EUKA 4F4IA 2XOXA 2Z1DA 4CL3A 2VHWA 3PC2A 4TL9A 2CJWB 3EGXA 3JXEA 4ZV4A 5EUMA 1TC2A 2BKVA 4Q7KA 1UXHA 3ZZ0A 1I3CA 5TEWA 2W2OA 4RLSA 5AK3A 1LLFA 4HYEA 4F6LA 3Q11A 3IQFA 4N9QA 3HLYA 2WVAA 3DAHA 4RW0A 5K3DA 5EZYF 4D42A 1OB2A 1Q2XA 5EOVA 2VSQA 1S0UA 4X00A 1R0LA 1RJEA 3KQKA 1O97D 3AHEA 2W83A 3MTQA 3SAJA 1S3SA 1Z6QA 3NHFA 4LXQA 3ZN2A 5U9CA 1IMJA 3M6WA 2PXHA 3U4AA 5C53B 3UFXA 3OE7A 1PG2A 3KQWA 2QXTA 4MVJD 3KQVA 4DA6A 1YACA 4C0AC 5AQ1A 4HH0A 1Y3AA 1VP3A 4HQ0A 4DSTA 2H5IA 4IDOA 4PC3A 3ZU5A 2ZI7A 3CLHA 1W85B 2HQRA 3O83A 3FMGA 2PZ8A 1UBEA 3FDZB 5G1NA 1VBFA 3E15A 3OHMA 4HOYA 3T3OA 4HEA1 3FH0A 4LVUA 5K8JB 3A4YA 5EWMA 3ORFA 1TI7A 4C6RA 2BT4A 2PRYA 3KM0A 2UV8A 3WTCA 4WZBE 2O0KA 4KWEA 4YPOA 3V4FA 4D8XA 1WBDA 1B76A 1JKFA 2C42A 3K4PA 4QREA 5EZ6B 2CXPA 1OXMA 3VPCA 2ZG6A 1QO0D 5EZQA 2WWWA 2X8BA 3W2FA 1YR7A 4Y2HA 1C7ZA 4UE3S 2ARKA 5J5CA 3KQNA 1DRVA 1KAEA 4KGZA 3FVWA 3BT7A 1QTNA 1NM5A 2YINC 4INAA 4XE5A 4ZOLB 1QG4A 2P2DA 2E87A 3M9WA 4HI0E 4QA9A 3ZNPA 1LS1A 1YIAA 4KK4A 3EFHA 1KMMA 1RAAA 1JDSA 4KW7A 1E9RA 4HRAA 3U4GA 1W0JD 2CDRA 3I09A 4HDRA 5BR7A 2MWMA 1D1TA 1MO4A 1IK6A 1GUZA 1L5LA 2ZI5A 3DO6A 3UGTA 2GT1A 4J4BA 5CFRA 2FZ4A 3ZWVA 2IS4A 5D6NA 3RSZA 2OWDA 2D2VA 4TYQA 4F2HA 1GPDG 2PK3A 1T5LA 1XRLA 1GJRA 3W7AA 3T5TA 3HVKA 1EP2B 4UEKA 3V2UA 3EPRA 1LVGA 2XBMA 2X15A 4JOBA 4BTEA 5KINB 4WV3A 1MCZA 2AWNA 1L1FA 3ACDA 3FJYA 3WKAA 3H11B 3Q8MA 2RONA 4M7OA 3DHVA 4ND2A 4L8FA 3AWIA 3HB5X 3VQTA 3KTDA 3ZWOA 3BMQB 3ER6A 1QNLA 4JXKA 3KZNA 1DVRA 1I24A 3DHWC 4X1KA 4ND5A 4R16A 5KYXA 1P5JA 1ULTA 3KZVA 3WYNA 1ZUNB 1AKTA 3PQ5A 4Y1GA 3LU1A 4KITB 1MOZA 5JJIA 2Q41A 3WAKA 2CZGA 1D4AA 3DE4X 2W00A 2HLPA 2BJHA 2DBYA 3QK7A 4X5OA 1YFZA 2ZJ8A 4I2VA 4D4MA 3ANNA 2DXIA 3MVEA 1T2NA 3HFSA 5IBRA 3QITA 1EFRA 1CIJA 4G56A 1Z56C 5CK5A 4M1KA 4DQKA 4B81A 5J43A 3R9IA 2VZ8A 5BN4B 1WHSA 4C6HA 3KYDB 3VM6A 1BCSA 3OQVA 5H3LA 4U5QA 1S3GA 4IH4A 1CNEA 5LZ9A 3DBLA 3HJNA 3OFJA 3HUEA 2JI4A 3R3ZA 4MV3A 1U7UA 2G70A 4WZ6A 4C4ZA 3G6KA 2Z5LA 3RS0A 1RYMA 4BZPA 1GDTA 4WN9A 4JNKA 5B57C 4F5YA 1L5ZA 2P9YA 1UDCA 2RB5A 3SFTA 4EFDA 3W6NA 1LRJA 4G36A 3VDQA 4ZQEA 2ZZMA 4JUBA 5D3KA 4R8SA 2W70A 3VYRB 4PPFA 4REQB 2D06A 4UC0A 1WKBA 4G0UA 3D3EA 2L69A 4JSTA 1VJ1A 3DDCA 3IR6A 5DE3A 3L1HA 3AF0A 3IPLA 1E6KA 1OC4A 3GBVA 2W6CX 4XVUA 1I3LA 1LQTA 2PSDA 1AXGA 1ZD4A 3WIUA 1FOEB 3CG0A 2XUHA 4XFKA 4Z0NA 3W04A 3EGXB 1YE5A 1SIUA 2PX8A 2WSYB 4QJ5A 1JW9B 4XB2A 1T5IA 2ZSDA 4FE4A 4D0GA 2CJFA 3D2LA 3M6FA 3U4HA 2QT9A 1SZPA 1E2EA 3A9UA 4QPNA 5HNKA 3GQBA 3PNLA 3TSAA 2F9FA 1Y0BA 2B8NA 4L0CA 4R9NA 2N42A 5CYPA 1US8A 4BIIA 5EWJA 1ZPDA 1JHQA 3W5UA 1EFUA 3UWDA 5JHHB 2N75A 1AQJA 1LZLA 2HHHB 1G8JA 4Y9SA 3K70C 5CT4A 4PGFA 2QW1A 2BMFA 2WM3A 3ZZMA 3UFXB 2GO7A 1SZCA 1CS4C 4I6EA 4C4SA 1KMCA 3EUAA 3NS7A 3PPIA 2BISA 4PR0A 2AYYA 5A03A 1NXPA 2UZ3A 2ZDGA 2C77A 4B0PA 1R18A 2O7RA 4TTJA 1Y3BE 1KF0A 3O3NB 4GF5A 2C3UA 1TQHA 2F8LA 5JNRA 3N0TA 2Z5GA 3WWCA 2R1UA 2YHSA 3PA8A 3R40A 2CL0X 1WPQA 3LNTA 3RKUA 3C6KA 1N9ZA 3GIDA 3B8HA 5EWMB 3AHHA 4CTMA 1OFHA 4NARA 3QXGA 1JLSA 4DIMA 4NOMA 4TV8A 3EBPA 5EJ7A 4DMGA 5KTRA 3BMNA 3ON5A 1PFKA 4INPA 4J49A 2QAJA 4C0BA 4CV2A 4ZCTA 1TB4A 3U26A 2WIAA 1YB2A 4AJHA 3H5WA 1K97A 4X60A 4QZVA 3KKLA 2HGSA 4EHIA 2FSHA 3MMSA 3AG5A 1QFSA 2C20A 3OJXA 5K1ZA 2BMEA 4B2IA 2C2YA 3CX7A 2QHXA 2P78A 2AFIA 2J9XB 3IP6A 5HW0A 3BWXA 4RPIA 1UBLS 4MUIA 1SRQA 1TM5E 2H1WA 1HE3A 1CETA 1P4JA 3KKKA 4J29A 4CLEA 3LWZA 2FPOA 4HDRB 4LPKA 4ETWA 1Q83A 2RMKA 2GEVA 2FW9A 2WU4A 4MWBA 4RD1A 4W82A 3AVTA 1P7VA 2BFBA 5K2MA 3GP8A 4OQFA 3TTVA 4BVKA 5MFZA 3JD0A 1XFDA 5JYEA 5KWIA 4LGYA 1HZZA 3NKLA 3PUVA 4PZYA 4YWHA 3BGOS 5KVCA 5CLHA 3PEFA 4YJDA 1Z38A 5DM1A 2WRZA 2XNKA 2WSLA 4ENVA 1LPSA 2OK7A 4BFYA 2P9FA 4QJ4A 2XTMA 1VI5A 4IV8A 2UXCB 5CFQA 2QSYA 1FFXA 4BLPA 2ZETA 3DWGA 3X1JA 2G63A 2CHFA 1OXSC 4X1KB 2NU6A 5KYXB 3QGMA 5FBHA 1G98A 3HDGA 2J30A 3N2LA 3PHHA 5D1HA 1ZJ4A 5MN5A 4G5GA 3LT1A 1P4AA 4MPRA 2YIMA 2R8EA 3DXXA 4HGQA 4Q21A 1UDXA 2ZRIA 4MP8A 4C1NA 4Z49A 1V6SA 1GPYA 1WXXA 1KEVA 2HJVA 2VS1A 4PHTA 4W8HA 1OBHA 1PFGA 3D8SA 3SR3A 3WRYA 3AF4A 1TK2A 1MAHA 4P82A 5TX7A 2XQVA 4UHFA 4F0JA 1WHSB 3QHQA 3IVRA 4NLLA 3OIVA 1BCSB 1AHIA 4D41A 3DBLB 4HQKA 1FFWA 1ZD9A 3CNQS 1G2OA 3VBCA 4KQ6A 2ZB3A 4KXMA 3BFPA 3U37A 4QJBA 1DWQA 4A8TA 4WN9B 3BM5A 1G5FA 2YN4A 2FLKA 3IT0A 4Z7JA 4QRHA 3NEJA 3PXGA 4BUCA 1QHEA 3M82A 3BWEA 4JJ4A 5H3CA 3P26A 5AHRA 5BNZA 4IGKA 1HZJA 4M0UA 1R0XA 4RE5A 1KRHA 3U6KA 4G37A 5CD1A 5IANA 2CK3A 1X77A 2V54A 4LTNA 2CCKA 3TG2A 2WA2A 4AQYB 3A37A 5T4FA 2KBEA 2PZFA 5IFKA 2VBFA 1KSGA 4HPJB 3LBNA 3M4JA 2Q29A 3ZXXA 2CV0A 3QA9A 3HY6A 2DKOA 1N1DA 1IDOA 2PQMA 3K15A 3MUFA 4LIPD 3TQSA 4L76A 3CURA 1NUQA 3EK2A 4LJ5A 4MUKA 5SV2A 1JR3A 2DE0X 1GAWA 3O91A 1KEUA 3I8XA 4KYUA 1WVIA 3P71T 4I99A 4QQFA 4YNBA 3TCNA 2C97A 1NVGA 1ISIA 3GLKA 3HCCA 3O21A 4EQZA 2XDWA 3V32A 1JS1X 4LDZA 1TQ4A 2FMTA 2OBFA 2R85A 2CHQA 4X8HA 5ESDA 1JDTA 3DR3A 2Q3MA 2J3JA 1E1YA 3EDOA 1RWWA 1O57A 3LQRA 3BXEA 3MTEA 4C9BA 1OFUX 2ZIVB 1SUPA 4IYRA 3L4BA 4PYRA 3GQBB 3ZX4A 2VCEA 1BYUA 5KNCA 2AJCA 1NBOA 1NSTA 3AHIA 3EUFA 4ENQA 2YFKA 1RJDA 1US8B 3L2OB 5EWJB 3DT9A 4LHWA 3NFYA 1DXQA 1H66A 3JQ7A 4LDQA 2QTAA 1ECGA 3EEOA 5LU8A 3ASYA 3MRSA 1KVTA 3OMLA 2PQ6A 5JZVA 3K6SA 4JT2A 6Q21A 1KJIA 1WUKS 2B34A 3DQQA 4LWQA 5EVCA 2R6CA 5F51A 5IJXA 2DPYA 2FRDC 1JILA 1K08A 1VSQA 2YJ5A 1JH9A 3CEPB 2J9ZB 1C9EA 3C0KA 1TLLA 1PS0A 4HAXA 4MVJA 4AS3A 2HU7A 2FW8A 4PIMA 1JKXA 1I01A 1Z0JA 3ED5A 4K46A 5CHYA 1S8AA 1DP4A 1DIRA 1GT6A 2GN9A 2QRUA 1D2EA 1FTQA 1RJFA 1Q20A 4TV8B 4DC9A 1SKUA 5ADUS 3BMNB 2CFRA 2KHZA 2F1RA 4OIFA 3TXXA 5JR3A 1K7SN 3B1KA 3KJIA 1QP8A 3D6JA 4DLAA 1C81A 3QF4A 5T6MA 1U1GA 2R66A 1J20A 5KQGA 1ONBA 3U44A 2F1OA 5FQOA 2QVZX 3ODPA 4PSVA 1AV7A 1KAQA 2W2VA 4A0HA 2AFIB 1JIKA 4JJAA 4DR7B 1LBTA 4LMBA 3M3DA 5IXJA 2F43A 2FW0A 3H04A 3ZBUA 3PKIA 5CH5A 2RI1A 4RGVA 1LNQA 4R0MA 2YJ6A 3I37X 3WYEA 4YLYA 4NZOA 2BFBB 5AW7A 5JMWA 5AK4A 1U80A 1U11A 4ISCA 4DHEA 2COEA 1IB6A 3JWEA 4BMCA 1ZXXA 4MUFA 3UNXA 2NZXA 3EEIA 1KY2A 3IJEB 4ZAXA 5I7AA 1QRUA 1ZU5A 1NLMA 2FPXA 2ADFA 4O2AF 5K3FA 5ABPA 2Q6LA 5KOHB 4UHDA 3NC4A 2BJWA 4EG0A 3VAAA 2ZR9A 2W5UA 1VJDA 4UM9D 3USZA 3BGDA 1QVVA 3AVQA 1S8NA 1GNVA 5JNSA 1W8DA 3IHWA 1ID8A 1EX1A 4BBJA 1E60A 1FFXB 2W6MA 5TMEA 1DIOB 2A58A 2NU6B 3KPUA 2AK2A 2OHJA 3ILYA 1XZEA 2BFMA 3L7AA 3NBZC 2FV8A 4L5BA 2VPTA 4XSVA 3T15A 4BQPA 2HRDA 1T2FA 3A3KA 4J16C 4IDQA 5IMBA 5JCJA 1GGHA 1K4YA 2AG1A 1OQAA 1CPYA 4HR7A 3VO2A 1X7GA 2RDMA 2JFZA 4I66A 1GDDA 3HKCA 1P3Y1 1RTTA 1Z82A 3IKLA 4QUBA 4W7HA 4E13A 1MB2A 3PKZA 2F6RA 2HMSA 2PBFA 1FMTA 3MWYW 4XX0A 3TZ6A 2JGMA 2RGBA 2FX2A 1RLOA 3P4XA 5FCDA 1IFXA 3N3AC 2A5JA 3JVDA 1ENOA 1NBME 3P9SA 1VE1A 2PUFA 4XWGA 4BY9E 1OROA 4DJEC 2OV8A 5AM5A 1ODKA 3G2QA 1SC6A 2AMLA 3OCVA 4L3WA 5DOZA 3JYQA 3USCS 5K8VA 4HAYA 2GAAA 3PVZA 4KE8A 4FMCB 4PICA 3PP8A 4FS3A 1P2SA 4J3FA 3CT4A 4RZUA 1E9FA 3E3MA 2WWTA 2DT8A 1AUQA 3H1TA 1QBKC 3Q2IA 1ZXLA 3EIUA 3QNWA 2EDAA 3RVQA 1I7SB 5DYTA 3S6JA 3TINA 5BV7A 5ELMA 2O8BA 2CYAA 4N0QA 3EAFA 1OZHA 4EFKA 3AKCA 3IE0A 5BOSA 2LR0A 3T7RA 1RNLA 1AXRA 5FD8A 1SKMA 1EWTA 1IAQA 1K8ZB 3MSXA 4GFDA 2OLKA 2P5UA 1PRYA 4DREA 2CNNA 2RGDA 2FUEA 3UW1A 1YI8A 2JAPA 5C5DA 4IIJA 1H8HD 1NX9A 1JU3A 1T8YA 1J97A 3OSUA 2IVFA 5F7OA 1QZXA 1KA9H 1DG3A 1A9ZA 1VYHA 1F8UA 1KE2A 4KAAA 5DBGA 1W25A 4UXIA 2HRQA 5GMOA 3SK0A 3TAHA 3H5NA 1CERA 3O2SB 2X5NA 4YI3A 3WDMA 2DRIA 2WJ4A 3DZCA 2FEPA 3INRA 4PYKA 4L78A 3T4UA 4FP9A 1DKLA 3RYTC 4HRYA 5A6SA 3QMWA 1C1XA 3KSRA 1XG5A 3B7WA 4BLOA 4NK4A 4TMXA 1PAUA 2Q1TA 3I4FA 3REGA 5DGTA 4CMKA 1O0BA 1KPGA 2BN4A 4UD6A 3JQ7B 4QPZA 5ILGA 3B53X 4Q18A 3H13A 2RK4A 3KJFA 3RIHA 3HI4A 3ILVA 3U3DA 1BXZA 2VSYA 1YR3A 2QN1A 4KSCA 2FGJA 4N47A 3K6SB 1SXJC 4OAPA 3H6KA 3RFVA 3UYKA 1BROA 4R6WA 2WD8A 3FMVA 3LC1O 3MOSA 2VQ3A 3ADKA 3CLRC 1H93A 2YZKA 3AK4A 4PSUA 1RZUA 5FTNA 4A0SA 1QCZA 1HG1A 2B20A 4B6RA 1S7CA 3JQCA 5JCOC 2C95A 1U8XX 1YR8A 2DQZA 4JJ8A 3AQ4A 2PKXA 5CDFA 2YWRA 3T38A 2IEBA 4MCHA 3QELA 1Z5UA 4MLZA 3OQMA 2OV1A 3WLRA 3BXFA 3TGLA 3Q9NA 1SUAA 3MWJA 3PQ4A 5TRTA 5I4CA 1SXQA 4AKGA 1G0OA 1AHNA 1TZKA 2PD6A 3QF4B 1SXJE 3N8IA 2HBQA 3GPCA 3LUPA 4N3NA 4UU1A 5E7QA 4DG8A 4ECEA 2WU8A 3U44B 5HUQA 1L2TA 1X1RA 1ZVMA 2ISQA 5HCUA 4HNTA 2BMWA 2IOFA 1WQ4A 1CUDA 2I78A 2GCGA 4MLCA 2F43B 4YTEA 4ZP1A 4GLLA 4QFMA 1DIBA 2RHHA 4M1SA 3U40A 4BEBA 5DM0A 3CF0A 3TOSA 1L7EA 4DR4B 4Y2TA 1EXMA 1SPBS 1VZ2A 2I4IA 3O73A 1JP7A 3PZBA 4R6XA 5CXXA 4C03A 5KU7A 2R6ZA 2Z3VA 1PJ2A 2BI4A 2GBCA 2QRZA 3QV1A 5AKJA 5JE8A 3RC3A 2D5CA 3UK7A 2R2GA 4ADSG 4HEA6 1B0AA 4FINA 5BMOA 2ZZNA 1ECPA 2JD2A 4RC9A 3BCRA 5K3FB 3TI9A 3ZWQA 1HORA 2C2MA 1YUBA 4HEQA 1GZ7A 1X9GA 2R47A 4DDMA 2HMAA 2QDXA 2XEXA 2DFDA 1B0UA 2JCGA 3GEIA 3KEOA 4LXGA 4QL3A 5JSKA 8ATCA 3R0VA 1GLNA 4U7FA 1DFIA 1VI6A 1PK9A 4FX2A 1KY3A 4QBGB 4PPYA 3VTFA 3WB2A 1SZJG 4RGBA 4AXBA 2MSLA 1CR2A 4ZKEA 2GD1O 1CJTC 2V5UA 4FFVA 4Z5XA 5LZ4A 1SKAA 3V4ZA 2Q6OA 1YMQA 3AM5A 3QVVA 3EX7C 1M2GA 1RXUA 3ZLTA 1Z6TA 4KODA 4IIGA 3HKCB 3DVRX 4NU6A 5HRAA 5EG5A 1KETA 1P5FA 3C1AA 2DFVA 3JTEA 4L95C 2IIPA 4YJHA 8ABPA 3HPRA 3GLGA 1QIJA 4MUBA 4P3PA 4XX0B 5B5SA 3WZLA 1KJ8A 1CSEE 1FDSA 3UKJA 3NT4A 3P32A 4D4IA 3NAQA 1CY0A 1JJBA 1DJOA 1E0KA 2OO5C 2QVCA 4Q4AA 3MWEA 3UANA 4F9GA 1VOTA 1FY2A 2H4JA 2C94A 1MT3A 1KL7A 2J3KA 2EFEB 5TPZA 2EAUA 2F59A 2R8PA 3LMKA 2Y1OA 1U2DA 3OOJA 3JRWA 1ZZEA 4FFRA 4GM4A 4JAVC 5JG7A 3L7DA 3DQPA 5KC8A 4UHCA 3T0GA 1Z3CA 4P4LA 3E35A 3D1JA 3CGGA 3OZ7A 5AHWA 5KOJA 5MFPA 1PDWA 3PQ2A 5LQUA 4D9NA 2WFAA 5D5QA 3TRJA 4D4HA 4FGLA 2O8BB 1UCFA 1S2MA 1OU4A 4ZYTA 1CY6A 3MS4A 3ZYCA 5BOSB 5ANRB 1J0XO 5ALWA 5KHLB 1T2UA 4RLQA 1QHSA 2I2BA 3SWWA 4I55F 1E3DA 1FFHA 3FNEA 3RS3A 2PUTA 5BW8A 1KYQA 4DLZA 3BREA 4IIJB 4PFSA 1DRUA 1HDOA 3F78A 4LJ7A 5IF3A 1DDOA 2OVBA 1QSGA 1PJ8A 5DU2A 3SBXA 4YAEA 2IXTA 2JAOA 5IAJA 3A9CA 3P0JA 5JNVA 3AJDA 4DNOA 4F85A 2GCEA 3DE5X 4AY3A 4Q1CA 1PFWA 4FGSA 3ZI0A 3OEEA 5FF9A 1M1XB 2O2CA 4YMLA 3I2GA 1XPRA 5A6SB 1C1XB 2H31A 1IIRA 2JF0A 1ZVKA 3LCUA 5C3UA 3VR5H 1ESZA 4KO8A 5ALNA 4FB5A 1J24A 3KL2A 1B3RA 3CTMA 2R5WA 4PNEA 3T41A 4IUCS 1USIA 2XB4A 4DSAA 3VYWA 2QL5A 1DAGA 4IVNA 4PLHA 4LN1A 2VZLA 4KAJA 3LBHA 1BXKA 2G4VA 1NW8A 3JVUA 1M34E 5E0OA 1O5IA 3HS3A 4CNBA 4DCSA 4WJLA 4X61A 1E4VA 1BSVA 5CB4F 1Y63A 5CIWA 1EUCA 1GR1A 1PJQA 1VSBA 1E2JA 2WP0A 3FTDA 4H60A 4B43A 5BNWA 4K6OA 1B8UA 2F9LA 3PI6A 2J0SA 3ZZNA 1OHHA 1V7CA 3WQHA 3K9CA 2Y8EA 4QPCA 3A4TA 3QELB 5MHTA 1VL8A 3F73A 7MHTA 4Y1FA 4PLYA 3KVVA 4YGXB 4AJIA 1QR6A 1AIPA 3HFJA 4F11A 3ELDA 2H1HA 2LDXA 1FIUA 4AF6A 3ETCA 3K6KA 1UBOS 3RTDA 3TNFA 3GA7A 2JJ2A 2HHCA 1E4OA 4PAOA 5FUVA 5KBYA 3I05A 3CZMA 1BOFA 2OD7A 3QJ5A 4QTTB 3R5FA 4PZZA 5A4FS 2ZT8A 3IBYA 2O54A 3OZEA 1SCUA 3UN1A 3E3AA 5FO0A 1I2CA 4AKSA 1MR3F 2HLDD 2E9SA 2O1WA 1L4LA 1SG9A 3A9RA 3AC0A 3BD7A 3GFGA 3HDHA 4M9CA 4GZ5A 4TUYA 2PFKA 1I2ZA 1RM0A 3H4MA 1BVRA 1GZUA 4J7