5I9SA

Microed structure of proteinase k at 1.75 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTDILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteinase K
publication title Modeling truncated pixel values of faint reflections in MicroED images.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2016-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 5i9sA00
4J94A 5AVKA 3AJ9A 2IY9A 1KE2A 2X8JB 2P4EA 3EDYA 2ST1A 1Y1KE 4WOCA 5AVJA 1NDUA 1C9MA 1T1GA 2Z30A 3DE6X 1KDYA 3AFGA 1WSDA 1WVMA 1THMA 3PRKE 1DBIA 2WUVA 1R0RE 4GI3A 3GCWA 4RYDA 1NLUA 1SCDA 1T1IA 3EIFA 3TECE 1TM7E 1LW6E 4HX2A 1Y4DE 1EGQA 2PWAA 1CNMA 1GTG1 2HPZA 3H42B 4C3UA 4CFZA 1SCJA 1SUDA 1P8JA 5FAXA 2Z2XA 1CSEE 3VV3A 2SBTA 1TO1E 2ZWOA 1GA4A 2DUJA 4DWWA 2PKCA 1BH6A 4MZDA 4KPGA 3Q5GA 3DE4X 1IC6A 3DE7X 2W2OA 3WIVA 1Y3DE 1TECE 1SUAA 3TI7A 4K8RB 4NE7A 5SICE 2PRKA 5JXHA 1BFKA 5ARDA 2SNIE 3VTAA 1BE8A 3DVSX 3OSZA 2DQKA 1SVNA 1YJCA 3DW1X 3Q40A 2V8BA 2W2MA 2WWTA 2HD4A 3LXUX 1KDVA 2ID4A 3ZXYA 4AKSA 1KDZA 1SCBA 2W2QA 3DW3X 4C3VA 5ARBA 1S01A 5JXIA 5JXJA 1OT5A 3VYVA 1SBCA 4HVLA 1JEAA 1AK9A 4KB5A 4LVNA 3DVRX 1EA7A 3DDZX 1SUBA 1ZVJA 3QTLA 1BFUA 1SIUA 1AH2A 1GNSA 3A3OA 3GT4A 1WMEA 4I0WB 1AV7A 2Z2ZA 1SBIA 1Y4AE 1TMGE 1TM1E 3PTLA 4LVOA 1V6CA 1AVTA 3WIUA 2Z2YA 2DP4E 2W2NA 2W2PA 3P5BA 2G4VA 1YU6A 3BX1A 1C9NA 3LPDA 4OMDA 1OYOA 4ZOQI 1Y33E 4OV6B 2TECE 1YJBA 1SUCA 1GCIA 5JXGA 4DZTA 3D9QX 3I37X 4ZARA 3VHQA 1SUEA 3CNQS 1C3LA 5B1EA 1AQNA 1PEKE 4WOBA 4B5LA 1PJ8A 3D43A 1MEEA 1Y3BE 1TM3E 1Y34E 1GTL1 1OYVA 4NE9A 1KE1A 1WMFA 1Y48E 1ST2A 1S2NA 1ZVKA 4KG7A 3DE3X 2E1PA 3L1KA 1R64A 2PYZA 3F7OA 3DVQX 4H6XA 1SELA 2Z58A 1GTJ1 1Y9ZA 2Z57A 1TM4E 3EE6A 1TM5E 4BWGA 1SBNE 2WV7A 2Z56A 3F7MA 3ZXXA 5K7SA 3BPSA 3DE0X 4FONA 3LPAA 1GA1A 2WUWE 5FFNA 5ARCA 1T1EA 4AKTA 4H6VA 5AMXA 2IXTA 3WHIA 1WMDA 2ID8A 1Y3CE 2SECE 2PMWB 1PFGA 4CFYA 1P7WA 3F49S 1V5IA 1XF1A 3HJRA 3GCXA 1UBNA 1C9JA 4Z2AA 1SUPA 3I30X 1SIOA 3SQOA 1ST3A 2XRMA 3T41A 3UNXA 1VSBA 1SPBS 1BE6A 1AU9A 3A3PA 4H6WA 1HT3A 3VSBA 5JMOA 3QFHA 1SN7A 4DJ5X 3QMPA 3TI9A 3LPCA 2ZRQA 3BGOS 3DWEX 1SBHA 5AQEA 1Q5PA 3WQBA 4JP8A 1GT91 3A3NA 1SH7A 2B6NA 1PTKA 1A2QA 2PWBA 3SICE 4M1ZA 1DUIA 1SCAA 1R6VA 3AJ8A 1IAVA 1TK2A 2PQ2A 1YJAA 1SCNE 2GKOA 2XTJA 4NMXB 1S02A 1GA6A 1NDQA 5FBZA 2QTWB 1BJRE 1Y3FE 5CW1A 4CG0A 5B1DA 5I9SA 1SBTA 3DE1X 1SIBE 3I2YX 4OMCA 1TO2E 3GT3A 3DYBA 1AF4A 4YN3A 1MPTA 2SICE 2X8JA 2ZWPA 3DE5X 1P7VA 3DE2X 3CO0S 3VV2A 3I34X 1GNVA
chains in the Genus database with same CATH superfamily
2NSJA 2OESA 2WM2A 1ENPA 5D3QA 4I8IA 1XZCA 3H84A 3I61A 2JFQA 3EEFA 2I87A 1WU8A 3GWGA 1KE2A 2FPWA 1B6GA 4UHJA 3WK9A 4HMPA 4JLVA 3IOEA 3QBEA 1QPBA 3Q7IA 4PPFA 4Z54A 1SM4A 2HJWA 1CULC 4MR8B 4OM7A 4BRWA 4INAA 4FZJA 3K9BA 2ZBUA 4OAPA 2X5NA 4PVDA 1LLDA 1T35A 2LVBA 2WHPA 3HDVA 2ZBDA 4KO4S 5D2CA 5EMMA 2PFSA 3MQFA 2DQSA 4YP1A 3VYWA 1NDUA 3C8MA 3LF1A 4R54A 3KDAA 1AHNA 2W2KB 3HDTA 4BC1A 3IMKA 5EMHA 3OFSA 4LC1A 1Q19A 2HAEA 3LT2A 3UK7A 2GR9A 1G4HA 1GPLA 2GFQA 3O8OA 2CCKA 4WLNA 1GFIA 3QXXA 3IUPA 3KOWA 3QKSB 2XWPA 3AFGA 2Q3LA 1XPUA 3X1XA 1PQUA 3LKDA 5JECA 4N7JA 4I3HA 4DADA 3TLCA 1FTNA 2FSPA 3ISVA 5F2EA 4OQYA 3ROMA 3ZBPA 1O57A 1A2KC 5KUTA 4A4DA 1OB2A 3VR2D 2VPYA 2CHVA 4U7WA 1LNZA 2DHQA 1U5CA 1UKEA 3WXBA 4QASA 2I2XB 5LJIA 5ALLA 1NZDA 3ZD7A 1SXJD 3FYUC 1ZCAA 3PZRA 2QW1A 4ZQFA 4LJRA 1BWPA 3GFVA 1ZWKA 4MI1A 3NWJA 3L7AA 2QE6A 3ASVA 4XSVA 3GFQA 3IPRA 3ZDYB 2WZDA 2DM6A 1J2EA 5DX1A 3ROEA 5CB6A 2X2OA 2I34A 3HHPA 3SZLA 2PXXA 4YBRA 4LF5B 2R2GA 3WA7A 3TFQA 2QBYB 3GDFA 5DHAA 1QO9A 2I71A 1UKBA 4OXRA 5BR8B 1VKNA 3VVLA 4BNYA 4IEIA 2E5LB 3KKKA 3PL1A 5K03A 5DHSA 3SIRA 3EGVA 3HMKA 1WSAA 1E0SA 4Q4AA 4D8WA 2ISQA 1Z2EA 2IF2A 3A1CA 1EFRA 1KYTA 1H2XA 4QBIA 3QVMA 5BPHA 3ASYA 4JXXA 1LBQA 8MHTA 1L3BA 4E0BA 1KZ7B 5IN4A 5ER9A 1KK2A 5CH8A 1EMDA 3IVXA 2WR8A 1UBKS 4GZLA 5IEBA 1CJBA 1EFVA 2P4QA 3VRHA 1PNOA 2NVWA 4ZVTA 1E2QA 2EAUA 2NYUA 2WJPA 1JTVA 2HF8A 3QU2A 4NBVA 2B4RO 2R4QA 3NEAA 1U3VA 3IC5A 1J2RA 5AW5A 2WF8A 3LY7A 1Q0RA 1RWKA 1W88B 1E9CA 3LL4A 3G2JA 3W0LB 3L6OO 4V24A 3W1VA 4BX0A 2PM8A 1RQ2A 1SG0A 1XMPA 3D0KA 1J21A 1QTIA 3H8WA 4R8RA 2C20A 4GOND 4TGLA 2B2NA 5TGDA 2YASA 1GVNB 3TQTA 2QUJA 1O03A 1OBOA 4IMIB 4FSDA 1CKEA 4L5YA 1AOXA 1KVRA 4M88A 4PEVA 5KVQA 1E6LA 1RRFA 3HLTA 1DTWB 3NM4A 4EHAA 2FR1A 4JZYA 4M1WA 1WW3A 4IZ6A 3KJIA 4DNXA 3BWMA 3TI7A 5C80A 4HUJA 5KC9A 2IH2A 4HVAA 1VI5A 1NPDA 2PX5A 3X1YA 4PU0A 3RWOA 3INNA 4LGVA 4G1CA 1RFLA 4TRJA 2WUGA 3DKRA 2W4MA 1KFKB 3IL2A 1XP8A 3K1AA 2QRNA 2XUOA 3Q5DA 1VSQA 4FEYA 3QVJA 4TS1A 3VR2A 4CG1A 3QUQA 3L7BA 3EQ9A 3NPMA 1ADCA 1IK4A 4PCAA 4X8OA 2Q7OE 3UK2A 3ZHOA 1CCWA 1Y7HA 1ZMOA 2XBMA 1P1FA 2E5WA 1SXJA 3UMBA 1CJTC 2HT6A 5K8JB 4WNYA 2PX0A 1JVNA 2QLBA 2JC3A 3MS4A 3K1YA 1D07A 4JOCA 1E7MA 4JYAB 4BO3A 1L6IA 3QJ5A 2QN7A 2IUFA 2PSFA 4XJSA 3Q2IA 3VU3A 2EJCA 2PKRA 3R0VA 3QOXA 4R1UA 3GLHA 4EHLA 4RMJA 4H1VA 2HMUA 1R8QA 3HFJA 2ZITA 3GLIB 1MF7A 2WWTA 4IWYA 4K87A 2FVXA 4MVJI 4X0EA 2BE7A 1NGSA 1U28A 5DHUA 1VI2A 2BM0A 5I7WA 1ICEA 1DAMA 3AIMA 1Y1QA 4MQ6A 2JIMA 3CZQA 4I6EA 2CJWB 4GBGA 2BKLA 1BMFD 1U8AA 2J5RA 2PV0A 3CWZA 4BLQA 4Z1OA 1CZLA 4JSTA 5JRZA 3N0WA 2CXUA 2EXXA 3KB6A 2WKPA 2AJDA 5D00A 4X8MA 2WSMA 1Y8CA 4NAVA 4M4SA 3MN1A 5AWFC 2I7XA 3OMWA 3DVAA 5BWOA 2ACEA 1ILWA 4G5QA 5ALSA 3JSXA 2PKYX 2CL6X 4UASA 3U4GA 1OWMA 4DV3B 3RM3A 3M7IA 3EY4A 1X86B 4L95C 4ZANA 4GSKA 4ZVVA 4LNAA 2BE9A 3IAS1 4TM8A 3AI2A 1RWQA 3C2QA 3F8SA 4L5AA 1ZRMA 1KJNA 2GN2A 4WKPA 3DLCA 2G9QA 1JHDA 2XJ9A 5DX0A 1L5MA 3CM0A 1T26A 4MVXA 1IOLA 3ZVLA 1T1JA 3I04A 5BSVA 2WHPB 4CCWA 4PYOA 3TQFA 1F9AA 1JDSA 4WEOA 1MO5A 1RKVA 3J7TA 4DDUA 1P5RA 1QOPB 2C1EA 3D0QA 5AJYA 3Q0EA 1GCAA 2BGTA 1Z7EA 3E2PA 2AMFA 1RXWA 5A3VA 2PS1A 5JTUA 4CNQA 1S2GA 3PPWA 5DSZA 1YRYE 3DL7A 3TNDA 3VSEA 3OE5A 4R41A 4Z49A 2AJ8A 1A4RA 3C5WP 2B0JA 1F17A 2XLCA 1OC4A 2QRQA 3FFTA 4GSLA 3UAXA 1CYEA 1P4SA 2PV7A 3HZZA 4L2IA 1AGPA 1QFMA 4MS4A 3RKSA 4HAZA 4B80A 5JROA 1C9YA 1OSNA 1VJCA 3QNUA 2JRCA 1M2JA 3E9QA 4YAJA 1OXTA 1KMQA 3HKEA 5KYGA 1JFRA 2I7CA 3KT0A 1E92A 5KMGA 1GUBA 4RD6A 1XROA 3SI7A 2OAEA 3E53A 1SY7A 1SOAA 4ALMA 3EHEA 2V54A 3O03A 4WL0A 3S2UA 4HB0A 1AMUA 2F3QA 5TS2A 1Y3AA 2C9DA 1UMDB 3N8NA 4YI3A 4Z4GA 3M81A 3JQRA 1HQDA 4DJAA 3PEVA 1GR0A 1W0JD 2H2AA 2I67A 3IAAA 3E9YA 3CU5A 3GJRA 1GSIA 2G8NA 4B6QA 1U6KA 2X4GA 4H1UA 4POOA 2RHCA 2CHUA 1N9ZA 2TECE 1BHJA 2XB8A 3C5EA 1GL7A 3NI2A 2JIBA 2CDAA 3LKVA 3N7AA 4HAUA 4IMRA 4PBTA 4DAOA 4OH7A 3H1PA 3EMKA 3RIEA 4UNRA 2IUUA 3MGGA 2LGJA 2VDVE 2YNMC 3CSUA 2MTBA 3DHYA 2C9ZA 1WXEA 2IFTA 2W6CX 4MWSA 4YO8A 2WWVD 4IEFB 3PXEA 3ZHBA 3LX4A 1JJVA 4C2BA 4E5MA 5B1EA 4P7KA 2P35A 1AQNA 1BMFA 1PEKE 4MV1A 4IJMA 3PGKA 4PWYA 4PY2A 1EFVB 2ZJYA 3QM1A 5FOSA 3T0IA 1ONPA 2YWFA 3G1UA 4YV0A 1L5QA 5FYQA 2PRSA 4B3GA 4X1OA 2LD4A 2AK3A 4MVJM 2QN2A 1XXLA 1IIBA 1L5VA 2P0EA 2Y9PB 1Z22A 2EJWA 3S2FA 2NU9B 3T5AA 4GR4A 2NZJA 4JMPA 5D5HA 3S40A 2CLDX 1P80A 5TQ0A 5C81A 3SZ3A 2C78A 3JVUA 3L4BA 4HNVA 3IP9A 3EDMA 5C8VA 4RPGA 4JI1B 2DH6A 5L40A 3VJRA 2UZ4A 4BB9A 2VS1A 1YNOA 3QLEA 4WBNB 2XYVA 4FFMA 2HRRA 3HS3A 1UJ6A 1IAQA 3UWDA 3BT7A 1FFWA 1RYMA 3F6EX 3GVIA 4MEBA 1JDNA 2WRZA 1Z28A 4YAOA 4KO8A 3ILSA 2Z58A 3H18A 3HRHA 1SULA 2ZRHA 1D5CA 4NC9A 4FDVA 4PFKA 3PQ7A 3LI2A 5HIKA 1NU6A 3D4BA 5HWSA 5KNDH 4E5NA 2VNSA 1T6ZA 2XZDA 4KO2S 4RL6A 1I3LA 4M22A 5FL7A 5KNDD 2JHGA 3FFAA 1RM3A 3A36A 3KYCA 3LA6A 2D5IA 5B3JA 1QUEA 3H6KA 1XQWA 1TF2A 2Y68A 3VISA 3ZCSA 1RADA 4I9GA 2JGIA 2P69A 3ZTTA 9LDTA 3IAHA 4JJ8A 3EA4A 1XDWA 1ZM2A 3FDFA 4DG5A 1NV8A 2CMHA 4IF4A 2ZRMA 3TEMA 1SXJB 2QJRA 4AIIA 4HLNA 1AUVA 1UMBA 2WZCA 2MMGA 2WYUA 1OYYA 3HB5X 3FDXA 3L7NA 3QPUA 2AG5A 3ZNPA 5CFNA 1MG0A 2XKJE 4EUKA 5DSXA 2I6FA 1W25A 4NVRA 4F8YA 4B48A 4BATA 1LKZA 5FOVA 5FDFA 3QQ5A 3X1KA 2YVAA 4DLPA 2F9FA 1PJ2A 2VZLA 3CTMA 2BGMA 4WD3A 1NXWA 2Q0HA 4XB2A 4I55B 5JY1A 5C1IA 2J4CA 4GBMA 4BC0A 4J1TA 2CDNA 1RQ7A 1QHXA 3DD5A 3IIEA 4ER3A 2H63A 3KCQA 4HRVA 1HYQA 1NW8A 1P72A 4WDRA 1UPAA 3PICA 3PJEA 4V0SA 5AW1A 1B76A 3FWKA 1IRIA 2WHQA 1KU6A 2P1RA 1JJFA 2MIIA 1CBUA 4BVFA 1P7WA 1V16B 4WJKB 1DQNA 4AP6A 3RSGA 6GPBA 1GFSA 1L8AA 3E2MA 1G60A 2EBUA 4B4DA 5BRAA 5JS7A 3DVAB 3FTDA 4QU8A 2RHTA 2XCQA 4Y9RA 4PQEA 5JJLA 5H1YA 4FILA 3ZPXA 3A31A 4P6VF 4BFWA 1NDHA 2C2KA 4FUQA 4I4IA 1WKBA 3CINA 3QLUA 4RBNA 4ZVNA 3TG8A 4YCDA 3WK5A 3QMMA 4DIOA 3NIWA 4RFSB 2I1QA 2WOOA 4JFRA 2L42A 2PS3A 5MFPA 2NTVA 1SIOA 2F59A 2O07A 2ZIAA 4KVAA 3O9MA 5IM5A 4FC7A 4X7PA 1RMYA 1IBLB 1B3BA 5DNUA 1DWPA 5TF4A 4QQFA 3SF8A 5HMLA 2O8EA 3RD5A 5HE8A 2J59A 4OYLA 1WHTA 3T5CA 4GE0A 5B5SA 1I5EA 1OX4A 2HNAA 3KQTA 2HIAA 1B0AA 1DBPA 3B36A 2DUNA 4XR4A 1M66A 3GQVA 3LC7O 4BPBA 3DKKA 3C87A 1HFJA 1NHWA 2Q5FA 3ICVA 2BM8A 3AL3A 3VSBA 3QX8A 4UHFA 1FDUA 2R79A 3KJNA 4GEKA 4LC9A 2QM0A 4ACAA 4G37A 1Z6QA 2C99A 3NHLA 4L2IB 4MS4B 5KTTA 1MX5A 3K31A 3TI9A 3KXLA 3VKFA 1JHOA 2BZ0A 1SWWA 2Q4EA 3DGEC 4D9IA 3HKEB 3BSFA 5H8WA 4M0LA 2CYCA 3WAJA 4W5OA 3WB0A 2PVSA 2Y77A 2QP4A 2O8VA 1WLSA 3GJ5A 3KJGA 1CETA 3X2EA 2HA2A 4YYZA 1J70A 3SOPA 4OD0A 2CNWD 5ICEA 2XMRA 3O5AA 4HNRA 5H4HA 3E9EA 2PSHA 2P2DA 3GLRA 4WMLA 5JANA 2PZJA 4PG5A 1WOYA 2WF6A 3H5OA 2PUTA 5H5JA 1K3UB 5K6TA 2VA9A 2YCBA 4W5WA 4ED9A 1E99A 1Z6ZA 1HDGO 1RKUA 1VDZA 2QU7A 3EMBA 1Q92A 4KXMA 2HK7A 2ZRJA 4AKGA 5ITSA 4YONB 3NKFA 1UFQA 3L7DA 1MO2A 3K09C 4NDAA 1UBJS 3AFNA 3H5IA 2RK4A 4PLFA 1N8SA 3LCMA 3R5SA 1S2DA 5EP4A 1L4FA 2ORWA 1U0SY 4N3BA 4OHWA 4UUQA 5ABPA 1R50A 3RS5A 4ND5A 1DKUA 1FC0A 4LF8B 1RRKA 3LPNA 3TH5A 1N1DA 1B6SA 5FFMA 4YPOA 2C5AA 4W8OA 3IIIA 3TF5A 4MWDA 1U2RA 3CE6A 5HTKA 4U2KA 1SBYA 4F7DA 1G20E 3K1TA 1NM5A 1RJWA 5GOTA 1UIMA 4RTKA 1NXQA 1F9EA 4MS1B 5HMMA 1LXCA 1ZUNB 4W5NA 5JS2A 1NE7A 1XXHA 3DOHA 3R9WA 1PX2A 3L46A 3FCXA 1LV7A 1EFHA 2C5EA 3QVOA 5B7GA 4ARIA 3L1HA 5BOSA 4CLHA 5B1DA 1OXVA 1RYFA 1LBEA 2BGUA 3LW7A 2XJ4A 5BPFA 3VDNB 1P91A 5AVZA 4QSMA 5CA1A 1RJ9A 1CUIA 4LOIA 4MV7A 2Y9MB 2R4TA 2WHXA 4P92A 3FFWA 1I9GA 4D4MA 5I7FA 1Z37A 2DT8A 4V0OA 3DYBA 1YVDA 1H9AA 5KVCA 4BO1A 4U4AA 4F6RB 3FNEA 2HRQA 2X3FA 3FPJA 5DTRA 1NVEA 5FJIA 1P3JA 2I9PA 4DUYB 2ZRAA 1T4CB 1KAOA 4CKCA 3UW1A 1YBHA 1YRBA 4UOEA 5LBUA 5AJXA 3FGNA 2QD4A 2WWWA 3GJQA 4LNUA 4N47A 3TUIC 2YXBA 2V3VA 3KYCB 2P90A 4F85A 1JLHA 2NU8B 1IMJA 1NUHA 2Q4TA 1I3CA 3FZQA 4M1YA 3AX6A 5G1OA 3W7AA 3RU3A 2NP6A 4LZAA 3OZDA 3KJEA 1XYGA 2WWIA 4R5HA 4J2OA 5JS6A 1ZH4A 2NM0A 5FQNA 4J4HA 4KVFA 2J3JA 4DILA 1XVAA 1GPMA 1JAIA 2X3UA 2JL1A 3DH0A 1LY1A 4MI6A 3NIFB 1Z36A 4N0EA 1VPVA 4RD3A 4YRGA 4ROSA 5DTJA 3QE9Y 4HDCA 3HJUA 4QT0A 1WPQA 4AS1A 3V3TA 2JK1A 3FM9A 4CKXA 4DTCA 5ADUS 4W7IA 1BX3A 4B73A 1C9MA 3STHA 1LLCA 1GV1A 4J7CA 3ZE1B 2D1TA 5IYZB 4GI7A 4E13A 3OI7A 4MQUA 2CFRA 4HPJB 1HLGA 3L7JA 4IH4A 1JA1A 2H9IA 2B7LA 3HU5A 1C0PA 1PL8A 3AWIA 5IJ9A 1P5ZB 1UKAA 3CIOA 2NGRA 2Y76A 4G8JA 4RV4A 2P11A 1MORA 5EJ9A 3QEBZ 3IP3A 1YZUA 5AO9A 1L4YA 4L50A 3KQLA 3H19A 1JE0A 2PGDA 4V0MA 2JH8A 3DOIA 1J49A 1WBBA 3UENA 2DWPA 2F8LA 4BBJA 4TROA 3GCWA 3CUVA 4OHMA 4Y6PA 2FXIA 1DQZA 1M34E 1XA3A 3NHAA 5EG5A 5F4ZA 4DWJA 4X1KB 4BMOB 2R8YA 2QTCA 3MSXA 4KRXA 4KDRA 1SRRA 1A5ZA 4YRRA 4B3CA 2ZKLA 4Q5IA 4BBPA 5EZ5A 4C14A 5J5AA 3D8HA 4IDBA 3SF0A 3OLYA 2W2TA 1ELOA 4JR2A 4O1IA 4WVFA 1NE2A 3S3TA 2YDYA 1N6IA 4FZ5A 3OSUA 1O95C 1GTSA 2XGMA 3QLJA 3SF8B 1JH9A 3M6VA 4TTTS 2IS1A 3K6KA 3FJYA 4R68A 1H8HD 3TINA 1RHKA 4ECEA 4LTMA 3UMFA 2WIAA 1GPAA 2V55B 3SNKA 1SAYA 1OX4B 3I83A 4UC0A 3FAKA 1P4RA 5K0NA 1NJ8A 3U4QA 2P2SA 1OH5A 5EOVA 4R9SA 4FFLA 1C1HA 3RIXA 1Z35A 3QYPA 2OSBA 4J7XA 2YMMA 3PUXA 4NPCA 1K5DA 1L7MA 1SFRA 3GYGA 4FHCA 5DV9A 3OBIA 1L5OA 4TN1A 3SHTA 3I5XA 3T3MB 3OQNA 1HZJA 1U7PA 3BGSA 1CY1A 1TCUA 3BC1A 4JX8A 4WW0A 2I65A 3GFOA 3CN9A 5LUBA 3G7SA 2VK1A 3AP1A 3GG9A 3JQFA 4YRAA 4JAVC 1BD3A 3V4FA 3I8SA 3IOCA 3N2ZB 1M2VB 1Z4MA 1GU0A 4Y9TA 2CWWA 4H3KB 1MEOA 2XR1A 3PFKA 5HZHA 2CHQA 1J39A 4JQZA 4CG2A 5C4GB 3R77A 1PD1A 3CLSD 5E4FA 1XZ8A 3DOUA 2QDXA 3U3KA 3DNFA 3H2KA 4I3FA 2BMEA 3H5VA 4TVOA 3L6EA 2FUG6 1M5TA 4MROA 2IUTA 4NZ9A 5EIFA 1QV7A 4D6XA 1W8IA 1GGFA 2PQ0A 4GRIA 1VXRA 1IC6A 3BFXA 1SZCA 5AM4A 1M72A 5GIPE 3ZD6A 1BKDR 1N2XA 5AKKA 1Y9EA 2O6LA 5KHAA 2N1BA 2W2OA 4C6HA 2X4LA 3I5UA 3RS8A 1UAAA 5LVAA 1QHSA 1N6PA 2GNPA 2JLWA 1JFVA 4MXDA 1QHYA 4IGEA 1SOUA 4YASA 5E7QA 4I5FA 1P4JA 4Q6WA 4U5QA 3Q85A 1N5MA 3EEQA 5J4LA 1VHDA 4TLCA 4HLDA 5EJGA 3R76A 1U8TA 3G8CA 4ZI3A 4HN4B 1FFSA 4LGMA 4R0NA 3WX0A 4JXKA 2QMEA 1YAJA 4KQIA 3JALA 1TADA 2WIKA 3PX3A 4OB7A 1KTIA 1XXHB 4MW0A 4Y6LA 3PD0A 4KO3S 2SNIE 3FPBA 4TYQA 2JJ1D 2D0DA 2JCSA 3QF4B 3UG6A 3ZHUA 3VNAA 1C81A 4FSHA 5IF9A 1TCCA 5HXAA 3N2IA 3P2EA 3HZHA 3Q7RA 5EXEA 4F5DA 3AF3A 4MWTA 2G88A 3R7WB 1PJTA 1NA5A 2DH5A 1J8MF 2IZOA 4Q24A 3T6KA 5K3OA 2RD2A 3N0TA 2IP4A 3EIEA 1U2TA 1E5VA 3C1AA 4N82A 1P4AA 1AQLA 1IMOA 3IGFA 1J42A 1H8HA 1O94D 1YQTA 3VI3B 2V8BA 4C6TA 5BMOA 1K8XB 1L9XA 2PL3A 3CUUA 1UQTA 5FI1B 2WQZA 1KDVA 3WKBA 2GZMA 4CKCB 1PR6A 3BEDA 2J3EA 3M1AA 4V2UA 2PZLA 4FNMA 4HXGA 1R0WA 1X70A 4YJFB 3X3HA 3DF9A 4B87A 2N47A 4II2A 5JCXA 2NIPA 1PR2A 1DIHA 1W5EA 2CKDA 2HPAA 3A1FA 3L0CA 3Q8WA 4PBRA 3PNSA 3RSFA 2C2WA 1L5SA 3V3KA 5FIUA 1E64A 2B6HA 4BLTA 2GKSA 1XNHA 3JCZA 2L82A 4FYXA 1KJZA 1PJSA 3DOOA 5G41A 5LP6A 5BT9A 1HE3A 4DIMA 1UZMA 1T8YA 5CG1A 4EVIA 1SMKA 2V9ZA 3RSSA 4DR6B 2BVNA 2JDIA 2FU5C 5FBRB 3IIKA 3F7NA 4RIGA 1X1SA 5K05A 2JVJA 3N2EA 2PUCA 4PAMA 3ER9A 4JVLA 4RJKA 1GR1A 2EOAA 3B9PA 2Q5CA 5H9VA 1SB8A 4ZZ1A 1NUQA 4F3TA 1CERA 3P7MA 4HN2A 5JC8A 4L5JA 3EPJA 2WUFA 1R37A 1A5AB 3VZBA 4BLSA 3BMOB 1C3JA 3BULA 1PI3A 2LCFA 5EPOA 3HI6A 1P2FA 3U3ZA 2R1ZA 4M7OA 4I0WB 5BW5A 4RK5A 4UBJA 4QUDA 1GFWA 3HYTA 2QPAA 3N8GA 3P0EA 5GZ3A 4KMSA 4BMYA 2W6QA 3OCWA 2QP3A 1Y4AE 3NJRA 4NJMA 2H31A 3N76A 4S2EA 1N2JA 2J0UB 4Q00A 4BUZA 5AVSA 5IJ9B 4OQNA 2R65A 4ID3A 2G9VA 2OHIA 4I2NA 5CVUA 1Z29A 3DCIA 3IDAA 2WM8A 3CUKA 5EHIA 2GRAA 3RROA 3F5DA 1C41A 2VFAA 4L73A 1OZ0A 4D9HA 2N46A 1A50B 5BP7A 2W00A 2E6KA 2VPWA 1EAYA 1RHMA 1E9DA 3KQHA 2WP0A 1H2AS 3U9LA 2AMLA 4YJGA 3QEAZ 5H7XA 2JW5A 4LF9B 1ZM4A 4ZQEA 2DTXA 1JYSA 1U1EA 1ZOOA 3CR8A 3F8WA 3I9LA 3IT2A 1RWPA 3LUJA 3VR3A 2UZ1A 5K09A 2ZRNA 4XDGA 4CTNA 4R9NA 5IMBA 4RLFA 2JD1A 1A5TA 1ADJA 3W5HA 1XZKA 4HGQA 3WNZA 4ZOQI 2HSEA 4PRLA 1YQQA 4DMHA 3MMPA 1O94A 5CVJA 1GRVA 4BCCA 5LQUA 1N3BA 2RGRA 3NASA 4EHNA 1H2FA 1T2AA 4GHWA 3I45A 3I6QA 4AX4A 4S1NA 4P34A 1FVFA 4HAXA 3U4QB 2UUAB 3T1YB 4GKKB 1M6YA 4KWIA 4FHGA 3R3WA 2FWAA 3G82C 3SYLA 3IKVA 1XTVA 1C3LA 3UBMA 3G85A 1W1IA 4WOBA 2V98A 1Y1RA 3IJPA 1BOOA 3OZUA 3R3SA 3AESB 3AJRA 3INYA 4QPZA 4A73A 3S8EA 3BK7A 1LJ8A 1TO6A 2C0PA 1U9YA 5T3UA 3DTVA 4NAHA 4JIMA 4W9NA 5H0IA 4D56A 4A0SA 3B38A 1Y3BE 2GDJA 1CS4C 3DZBA 2VATA 2Z1DA 2CVZA 3DHNA 3EW7A 4FFWA 4Z7JA 1QS0B 2PMEA 1GL9B 3CZRA 2NVUB 2WINI 3OIWA 4R4JA 5B1IA 4JHLA 4G41A 2RG7A 3R6WA 2HQRA 2DUMA 1TB4A 5EINA 2AZ4A 1ZCBA 1OJ7A 3NNSA 2O8DA 4UJ3A 2Q2NA 3RYFA 4L6CA 3LC0A 4KPEC 5A3QA 5IKPA 1A8IA 3GD7A 1LX6A 4F3NA 4N7BA 3VTKA 4EL0A 4AUEA 3L1IA 5T4FA 3WL4A 5K0SA 4H2DA 1V6AA 2EZ8A 5TMDA 2ZYTX 1UBTS 4Y18A 4BQFA 2VK4A 2RMKA 5BV0A 3BFVA 1WZ2A 1QYCA 3VH4A 2DBVO 2MR5A 4PQFA 2AJTA 1Z34A 3N2LA 3TW8A 2WIGA 4OLFA 2BCGY 2CUNA 1KJQA 1ZSYA 1KORA 3I92A 2HR1A 3GGDA 3KZKA 4GM0A 2OGZA 1RZRD 3UWMA 5ULLA 3P0IA 2BFNA 2ZU6A 4OQXA 2YXLA 2AKYA 2HNBA 5CIWA 1QVRA 4K6GA 1JG4A 4JKOA 3JVIA 3OICA 4R3UC 3UJPA 3JALB 1RVV1 1KZ9A 4PWZA 5JAHA 2NSHA 4YNBA 5DBFA 4B40A 5LSAA 1X8JA 1A0OA 5AW0A 2YXEA 4NZOA 4B6EA 3NXKA 4ATNA 1K9VF 2HSJA 3UKJA 5CA1F 4FN4A 3LTEA 5AOCA 3DQPA 4CE6A 1KAMA 4IVQA 2ZYGA 3QELA 3HA3A 1E2HA 1DEOA 2OVFA 2PG3A 3ONDA 4N6GA 4QGSA 1NI5A 1PD0A 1Y4SA 2D5LA 1F2UA 3UMVA 5C9ZA 1GUZA 1EQAA 1IHUA 3V8QA 1RAFA 1AY0A 4YMVA 2FOLA 3UM9A 4L78A 2XQGA 4C6TB 1FSGA 4HFNA 3M49A 3ORSA 2G1JA 3OOSA 3CZ9A 2CVHA 4UNIA 1N77A 5K3FB 3D59A 4YMSA 1Z4NA 2VBCA 3SQDA 2AJLI 2WLSA 4PXYA 4RKFA 4AG5A 5KOHA 5CT6A 1V1RA 2R7LA 5AVTA 1A97A 3DP9A 3IQGX 2G1KA 3MT8A 3OPVA 1BRTA 4LY6A 1RYHA 2DYKA 1ZGHA 3F49S 4XGNA 5IUNC 3P2IA 3FTNA 4D3ZA 4XIYA 5BW6B 1TL7C 1PUJA 1YMVA 4K05A 4X7RA 1T5IA 2Z3VA 3O94A 3O3NB 4MWCA 2ZTUA 2ZYRA 3BICA 4EHBA 3ZXSA 3ZV3A 2CC2A 3V48A 1ODJA 4V0RA 4JC5A 4JJ7A 3T4UA 2ZM5A 1EFLA 3D1JA 4EB0A 2VAVA 4HXYA 4FMPA 2PHZA 5B36A 3KQKA 4KN8A 5DK4A 3RTBA 2PUFA 4JI2B 3ORFA 4HWKA 1G66A 3BREA 4KYUA 2GF2A 2B4YA 2Q6VA 2FETA 4QDUA 5EE5B 2Y0BA 4LQ4A 1E32A 4DOMA 1ST3A 1JH8A 3U1VA 1CJKC 2VWPA 2O2YA 3EF3A 4IOKA 4RF3A 2QLNA 4OQPA 3GN2A 4Q1EA 5E9WA 2J67A 5FWAA 4BQIA 4OI0A 2QHXA 5CT9A 3G9QA 2Q3JA 3IVGA 4QUJA 1Z8NA 4GOXA 4ZVOA 1HTTA 3UNXA 4HNUA 4PC2A 5DTMA 4PZUA 4BNTA 4L22A 4NJMB 3QKRA 3JSAA 2H00A 1B41A 3DR5A 1OFVA 3I6IA 1O6FA 1N9GA 5M5BA 2A4KA 5JMOA 5B2EA 4DJ5X 3PU6A 4UDXX 1DIBA 4JP1A 5IUKC 4CR7A 4TN5A 3B7PA 4MQFA 4FKMA 3ZKWB 3IB6A 1X1DA 4BWFB 5ICMA 4P5DA 1R8YA 1Q6YA 2A4MA 4R1MA 2FMFA 4RSGA 2FR0A 3ZIAD 2OT3B 4K6MA 3QY0A 4UMVA 4B44A 4F45A 4ZYLA 3IALA 2XMQA 4JBWA 3C8DA 2GNAA 3K5WA 3QV1A 2VAWA 2PXCA 2C5GA 2ZJ7A 3BJRA 5JJCA 4EFLA 2QTVA 1YMQA 2OB2A 4E3WA 2VJMA 1RXEA 5HF8A 1YUNA 5A9TA 1GT91 1FQJA 1E2BA 1M6VB 1RWWA 1C7ZA 1OXMA 1TT7A 1CD5A 2PXAA 2VZ0A 2ZIGA 2UXCB 4RDIA 3RBZA 2GPSA 5DPMA 7AT1A 6AT1A 1RYNA 1PQYA 1MOZA 2BTOA 1EDEA 2QJFA 4GU5A 1CK4A 2RGWA 4JJFA 2AHOA 4UHDA 1IB6A 2PQ2A 2G9NA 5HJ7A 1N6LA 2I9KA 2JAHA 2QIPA 4RHUA 2WF5A 2O7RA 1E9FA 5BNWA 2C4KA 3OX2A 1G5FA 5A0VA 4RVDA 5DULA 4Q93A 1KYIA 2XIJA 2Y1DA 3QLVC 5HIJA 1PWZA 5LDHA 4GQIA 4PX5A 1FU8A 3W1WA 4ZICA 4ITVA 1O77A 4TV9B 2FN7A 2OXIA 5DN6D 1EXVA 2F1JA 3DLAA 1ZLYA 5J4YA 4EBFA 1Q20A 1XRRA 4YRFA 3G2PA 3N86A 4MIYA 1URPA 5CDSA 3ICEA 1U04A 1MC4A 1TLLA 2IQIA 5EAIA 1AA6A 4B2LA 3B3GA 4Q3BA 4EH1A 4QAQA 3EY9A 4ZC8A 2YVKA 2BHSA 2OFWA 5KTNA 1QRDA 3MYRA 2VDUE 3H9BA 1ZN2A 4BJ6A 4U2CA 4DC9A 3M1LA 5AM3A 5BV8A 2RIRA 1R0YA 4AK9A 1GKIA 2D2IA 1V47A 2GZHA 4MYTA 5CYPA 4EY7A 1WXFA 1W0KD 3DBLA 4IHAA 4H3SA 3E5HA 3TW8B 4MP8A 1ECBA 2V3WA 3EK2A 3M6LA 4OP3A 5AM2A 1JKIA 1AKWA 5TS3A 1O5OA 1TQ4A 1BHO1 1EDDA 1OVGA 2YHUA 3ASUA 3V55A 3K9CA 4ZK2A 2GBLA 1AKEA 4XFJA 4CDGA 4UPEA 3AJAA 2QRLA 1GKYA 4IX9A 2JKVA 4J0QA 3D6MA 2I6QA 2QRZA 2FMTA 1WQ1R 3WWEA 4KHPB 2H18A 4MJLA 1GUAA 2PMDA 3ROFA 3QVVA 3AYXB 3ZIAA 4PC1A 3UMCA 4CF3A 5JEDA 5JSHA 3H3JA 1NRWA 3L40A 4V3BA 5H02A 1X80B 3DONA 3DKVA 3CH4B 3LZCA 2FWIA 4KQMA 3I42A 2FPRA 3LGSA 4YUVA 2X8JB 4BTLA 2JCYA 2P4EA 3DB2A 2X8LA 4OGKA 3R3XA 1B8VA 1F2UB 4QNNA 1X1AA 4WOCA 2K6GA 4HDOB 4ISCA 4UXJA 3ZTYA 3QW2A 1XLTC 4HGRA 5ADVA 1C0EA 3KHSA 1IBMB 3BKXA 1JKJB 1YC2A 2OHXA 2VA8A 2IWHA 3ZZMA 1ZOIA 5F7JA 1J9ZA 1WTAA 3R6TA 4IS3A 5IAOA 4R05A 4IY1A 1LW7A 1SUIA 1VRWA 1ZH2A 2Z30A 3V7NA 3NP7A 1CUCA 4ITRC 4OU5A 1SQ0A 4GQAA 2NO7A 3OE1A 4EJ0A 2OQRA 3DNPA 4M0EA 1PWXA 5EJMA 1ZXXA 2O1WA 1HE1C 2JAPA 2RCYA 4Q3EA 4BVGA 4P0QB 5LP6F 1Q83A 3ZD8A 4DBZA 5LR6A 1P31A 3KXPA 4ON9A 4XB1A 4ABYA 3PR2B 2ZSEA 4GI3A 4NG4A 4HQNA 3WQRA 3HMQA 1B6TA 2J9ZB 1XB2A 3AHFA 4N8SA 4CW7A 1SCDA 4PVCA 4DQXA 3IUNA 4F4DA 4IIGA 4F97A 4ZYVA 5K20A 1U0NA 3KXIA 4TV8A 2CXQA 3CLUD 2XCIA 4G07A 3B9BA 1OBVA 4LV5B 5C7YA 3IA7A 1NQTA 3MOGA 3M83A 1NY5A 3DYIA 3KVNA 4A8TA 5DGIA 1Y37A 1ZX1A 1ZIXA 3HSKA 1YTUA 2POCA 4LY3A 3FYHA 3GQBA 1TLTA 1J1IA 3HZRA 4EYEA 4A8JA 3EJWA 4B9AA 2XWBF 4BNKA 2I8CA 1TTTA 2P9FA 1BAPA 1CNMA 5GONB 2A2ZA 5I7RA 3ZHTA 4EUFA 2A6PA 2WM3A 1VLHA 1NBOA 2JZNA 4XIIA 3SM3A 5K0ZA 1AMOA 4G01B 2J9FB 4RVHA 2Q8PA 4QPNA 1W2HA 2Z95A 1K0UA 4ZYTA 3QBTA 1MJGA 4E7PA 4NEGA 2BGWA 3NMUF 2A57A 3QKRB 2PPVA 2FSGA 4RLSA 5G02A 2FWPA 2C4MA 2VDQB 3H99A 3O93A 1U8CB 5FAXA 4MARA 4YCMA 5I51A 4IHJA 5SZIA 1HDIA 4BNNA 2M6LA 4E1AA 4EUHA 1DDGA 1BEEA 3ID6C 4Z9BA 2C8VA 2V7TA 1NYLA 3AKDA 4JLKA 4LXUA 1T9CA 3SHQA 1C4XA 3P32A 4GP9A 4LWOA 3E7XA 3A4VA 4BGIA 1A4XA 1GXSA 1I4DD 4DWWA 5JARA 4MITA 3OE4A 4X6XA 1U2GC 2W8BA 3BJMA 2RH5A 1GUFA 2PKCA 4YO7A 3PXGA 3V32A 2XGGA 5JDCC 2FG5A 3U26A 3IEIA 1DLJA 1G8MA 1QE3A 3F6BX 5HCUA 2O59A 2QTVB 2NU7A 2YVUA 1ZIDA 5CFPA 3K70D 1HNWB 4XWAA 5CNMA 1DQSA 2CXXA 2I1LA 2NZ2A 1C4WA 2AR7A 1CLEA 2NADA 5EIOA 4KNVA 1GNPA 4DJJA 3LT4A 1JHUA 3WBBA 4URXR 4RVGA 3EXEA 1ACLA 2ECOA 3I1IA 2VHUA 3U4AA 4AP5A 5L3QA 4JVSB 4L9WA 3RYHB 3DV0A 3R6DA 4J0JA 5EXDA 3ZWCA 3PQCA 2PT6A 3QOFA 4DJEC 1KI9A 5IX8A 3FYCA 3PJGA 3C7TA 2JZCA 4AY4A 4CMJA 2P6UA 2NT4A 2REQA 3NV9A 2CYBA 4AY3A 3KUXA 5FR2A 1VECA 3TOXA 2DXIA 2IEIA 4BJ3A 1QZXA 4L4RA 1JHPA 4D4HA 5F35A 4NK4A 1D04A 2AHRA 2CDCA 2WSLA 4PCVA 2PMBA 3BSSA 1NSYA 3BQ9A 4GWKA 5E4YA 1KWGA 3GEIA 4LRYA 3T61A 1NQAO 1J0AA 5BSFA 1Y8QA 1XEXA 1VKHA 3ZV5A 1CFZA 4G4JA 5A02A 2KHZA 5IAAA 2REBA 3NTOA 2VF7A 3M6MD 3DTTA 4PN3A 4CEJB 1M0TA 3E3MA 2BI7A 1N5DA 3IILA 1NFQA 4RQTA 3CB2A 5CCXA 4DCOA 5E6SA 2P5UA 5CXXA 3SQLA 3FSRA 3DUFA 2MINB 1KEKA 4AKEA 1FPMA 3FBGA 1CUYA 2B36A 3DBLB 1IPFA 2P6PA 5F9HA 3U7QA 1YO6A 1WUYA 3UHPA 1V5EA 4PTLA 4DAEA 3GLIE 4C20A 1QCDA 2WG1A 1OFUA 1QG0A 3C6YA 4XX1A 4ZHSA 5A3JA 3K15A 5HKKD 3G02A 1Y6GA 2ZXUA 1KDZA 4QQNA 3KOUA 1QSGA 4FM9A 4ZT6A 1N0UA 1UOQA 1BCRA 2VC2B 3FYUA 1KR5A 2VNKA 1KI4A 5CB4A 2ECKA 5TPWB 3D5TA 5CHYA 2FGJA 4YLYA 4Z1MD 1MTOA 4WESA 2MCFA 2HUNA 3ML1A 2JD0A 1QOQB 4GAEA 4IG9A 3VBCA 2OHOA 2Z5LA 5TV2A 3N8IA 3G6WA 4AYXA 4HVLA 3OQOA 4TQ9A 5HFNA 3CZ5A 3WL8A 4MV9A 3ZU2A 1EG7A 1ZNZA 3FNIA 4FYJA 2GCPA 4EI2A 1PO7A 4EKYA 1A4IA 3FMOB 3WIDA 3MCWA 4F7WA 1PLKA 3SLKA 2YICA 1MU0A 3ORHA 5EGSA 1A98A 4IRXA 4UEKA 1L1RA 1FSZA 2C2XA 4DIDA 1AS2A 1ZMTA 3HWWA 3A3OA 3WKCA 1GQ2A 1WMEA 3GJ8A 2RHBA 3FOAA 4RVCA 3IOMA 2D2EA 1KQGA 3PFNA 1GYPA 3SGLA 4D0LB 2OG2A 2O8BB 2Z0MA 2N0SA 1TAHA 4BJ1A 4YP5A 1FVXA 4ZCIA 3BWCA 3PUZA 3IBSA 3NDBB 4QFMA 1Z0KA 2R5NA 1MZPA 1SK8A 2CSUA 2GHRA 4BB0A 1K8RA 3OIDA 3FDZA 1PG0A 3DVLA 1RLIA 2EIXA 3RCBA 1UXGA 5IAKA 4PLZA 4Q4HA 1HOTA 4ENWA 2ZUEA 1A9YA 2FPIA 2R7KA 3UEOA 5B30A 4BDTA 3E7PA 4IIEA 4XZ3A 2DP4E 1S5PA 4TV8B 4MW1A 4A15A 2ZI6A 4KGDA 5K1ZA 3QHPA 2KS6A 1WUHS 1T10A 4BZXA 4FS3A 1NONA 1OAKA 4Q3AA 4ZEXA 3WGMA 3WWZA 3M6WA 2YQZA 3AFMA 2R6ZA 5EZSA 1SXGA 1OZFA 5I48A 3K73O 2DWCA 4MUXA 4EA7A 3VTFA 4AYWA 1GIAA 4HAYA 4IPTA 5DIFA 1DKRA 5L4NA 2JS7A 3MMNA 1EP3B 2IC5A 5B2FA 3R9XA 1BGWA 4XSGA 3SU8A 3B51X 1WXDA 4S04A 3R41A 3I37X 5HKKA 2RHGB 4UAVA 5HFJA 1AKTA 4EJMA 4NENA 2QR5A 1OWNA 3MJ4A 3V4PB 4AO7A 2Q7XA 1D4AA 9ABPA 2EATA 4IHJB 2XQVA 1KFCB 1K97A 3B85A 2O57A 2WT9A 4A91A 1JNXX 4X9XA 1MGPA 4J43A 1JR3D 2V5UA 2XYRA 4P32A 1BG6A 2BBSA 1PSZA 4IUBS 3VZDA 5HJ5A 3NFRA 3ZE2B 1LEHA 1TZ2A 4H9GA 1GXSB 3GVHA 1R88A 2VDLB 2W8BB 4NE9A 4BNFA 3PHBE 3NTQA 4FYPA 4KREA 3UUGA 3L92A 3NEYA 4R71A 5DH9A 1CRQA 1JA9A 2A94A 1TKRA 1QWOA 1F48A 2NU7B 2QAJA 1IBRA 3VPFA 5KSPA 3HA7A 2Q21A 4K6KA 2W6IA 3OFKA 3RAPR 3HWSA 3DMHA 2YOFA 4LTNA 1FMFA 4KK4A 1YZGA 1T5SA 4MA0A 2H2HA 4Y8VA 4IH9A 4FHDA 1PBNA 1LPBB 2ZR0A 3P71T 2VP5A 4NPAA 2O3JA 3MLEA 3E1GA 4FN5A 2BZ1A 3EXEB 3C4QA 4H7DA 4MRAA 4AJKA 3QEJA 3OQJA 4WFKA 4DLXA 4WBNA 4RE5A 3H8VA 4JLWA 2E4ZA 2YJ4A 3DNMA 4ZJUA 5J4KA 2AJCA 4JT2A 1EJ0A 2GJKA 3AGPA 4TXLA 5KCMA 1O4WA 4DSNA 2YOGA 2OM6A 2REOA 4CT4B 5EXTA 1QCZA 2A9PA 3ICOA 3NC4A 2MSNA 3BGDA 4R7ZA 1G7CA 2JFZA 4RD0A 2I66A 4OHPA 1ZJ6A 2ESRA 2XNJA 4IIJA 3K92A 3UHAA 1TRKA 1X19A 3CEAA 3T1HB 3U61B 3SZGA 1O3YA 1R4MB 1YBVA 1Y9JA 1PS9A 3M82A 2H29A 3OLVA 1FJHA 1SXJE 1Y8QB 4HWTA 1CHNA 2C4NA 1YHYA 2IYQA 3HB1A 3EULA 9LDBA 4R5MA 3JD2A 1H94A 1JJIA 5ERXA 3QEMB 1BA3A 2PUGA 1C0IA 3DUFB 1NW9B 5FBLB 1OVMA 3MUNA 4YDRA 3M6FA 4GE3A 1KQOA 1M1YA 3G8AA 3GLHE 4A26A 3LQKA 1FUKA 4JOBA 1TYEB 1ZGAA 3U7QB 4JUBA 4D79A 1BN6A 4UDOA 1Y3CE 2RDMA 3KD3A 4CUZA 4CFSA 2ZATA 3I01M 1B1CA 1FBTA 3H0CA 5THKA 4C1NA 4ZOLA 1T5OA 1WABA 3FYUB 3GV0A 4ZAYA 5K4HA 3MJFA 3IT1A 5J2TA 5HSGA 2WU0A 4RTJA 2BR4A 5DHPA 2AE2A 3ISTA 4K26A 4NZMA 5K99A 3NXSA 3ETNA 2HWWA 4H3VA 4QDZA 4WESB 3HADA 3D3WA 1E4VA 2FZKA 1QG6A 2IL1A 3MJRA 4G4IA 3UK0A 1AK2A 1EEXB 2OO5A 3WQHA 4EENA 2X4IA 4B3FX 1P1HA 2C61A 4H4EA 1RMQA 2C9OA 1V8DA 2BISA 2PX3A 1XCPA 1HE8B 3A9RA 4MDYA 4MS3A 4Y67A 2DQZA 3I30X 2W9XA 5DWDA 3K70B 1XSEA 2Y3IA 5CAEB 4YDSA 4D0NA 1PCXA 2PBLA 2YNMA 4Q12A 1XAIA 4HEJA 4YT2A 1CUVA 3S2EA 1TUBA 3LA8A 4RX1A 1JYFA 1QVZA 3SC2A 1OGYA 1R16A 1T5TA 1UPUA 1Y1SA 2EERA 2X5KO 1KRWA 1MV8A 2ZAGA 1YOVA 3QXSA 2OHVA 5BY2A 5CFMA 5KJ6A 4AQYB 2RI0A 1FRQA 2PY6A 1T43A 1J7JA 1P5FA 1Y89A 3MUFA 1V5WA 1Z0SA 4RKYA 4EHFA 1L7RA 3FWZA 4D97A 4CLRA 1LDMA 3MELA 2DZDA 2W83A 2Y6UA 4P3NA 3AL0C 4OEHA 3FDZB 5FYDA 4KYTA 2VTEA 3E35A 4TV8F 4WGFA 4WN9B 4QSHA 1R5OA 3HPQA 1G3RA 5JZSA 1YDWA 1TKAA 3OJ0A 3SSNA 1OXKB 4H59A 3TRFA 1I4OA 5LP6B 4JV5B 2P41A 2PGOA 1EVZA 4XKJA 5LYJA 2FZGA 4GKBA 4IDEA 2X0FA 4DJFC 3NJ4A 4CPDA 1L7XA 3CE9A 1WPXA 3O3CA 3G8BA 5CFQA 1YULA 3E48A 3Q3HA 2QRJA 1MOSA 2PKQO 3NDJA 1IXSB 3TKYA 1E9SA 1HE5A 1DO8A 1OILA 1SVUA 2CXSA 3EMVA 1GV0A 3RV3A 3T7TA 1VBKA 4L08A 3ZU6A 2IGBA 4EEXA 3NW9A 3UV7A 1OH8A 4UE3S 1ECLA 2JGKA 2J4DA 3TBKA 1QJ4A 3RUHA 3ADKA 2G63A 3BA6A 2QVZX 5CJJA 3SICE 4LCJA 4O4JB 3R9XB 2E1RA 2XHZA 1XJ0A 3CHYA 5IH7A 1BVUA 4ZI7B 4F5EA 2OUKA 5DHFA 4IHJF 2CLCX 3C41J 1LF5A 1NIJA 2ZSDA 3F3MA 5KTRA 4NENB 5BXQC 3IPYA 1IH8A 2HLPA 1XLUA 2OZEA 1OHHD 2BZSA 2PGLA 4QYIB 1ADYA 1E4YA 4QT4A 2M98A 1JECA 1RHUA 2Y4NA 2CCJA 2ZJ0A 3CEMA 1TZKA 2VT7A 3WLFA 4EKEA 4YHHB 4GR9A 3HKBA 3KLBA 3DBIA 3H17A 4Z3DA 1AB6A 4XX0A 2FGKA 5AHXA 1KKUA 2A8YA 4MKIA 2EFYA 3KR2A 4MI3A 2R6R1 2PZGA 2BCJQ 3GBPA 2QV7A 5FWDA 5TC4A 3W6ZA 3WDMA 5JZ9A 3U6BA 4MDHA 2R84A 4C06A 3UB2A 3UK6A 4BNIA 4IDPA 4L85A 1H0KA 1XK6A 4U7JA 3OMLA 4NCNA 3SAJA 4RPIA 2OAGA 1WEKA 5ERGB 3N75A 4DT1B 4YALA 4PAWA 1Z16A 1F6WA 4RZ2A 3U4HA 2SICE 1RKQA 1FA9A 4EPTA 3Q1KA 1UM9B 1PYGA 2GUWA 4GMXA 1HNZB 4DCTA 4L9AA 2GPBA 3LKZA 3OE7D 4AZ3A 4QDOA 4EYQA 5JSFA 3G23A 3VMFA 4LZOA 3E3LA 3AB3A 2HH9A 4M55A 4MKZA 5KYUA 1JTEA 1YB1A 3VV2A 1EVKA 1W96A 4BB5A 3ZDDA 1ZR2A 2HIGA 4OQFA 4XTCS 4JKYA 3WOHA 5CM2Z 5SYAA 4QRHA 1INLA 2QQGA 4RENA 3EPKA 4CM8A 2ZT7A 2YXNA 5DDIP 2DBRA 4X24A 3ZW9A 3KKPA 1IOZA 1PUXA 2CNKA 3F47A 4JR1A 4R16A 3T3EA 3WGLA 3Q8LA 1J00A 1FS4A 3DSRA 3KRTA 3W9BA 5EZYA 1HFEL 3VU1A 3W4KA 1XU7A 2WFLA 1Y6JA 4BUJA 1K06A 2WYVA 4EJSA 2OL4A 1YKSA 3AWDA 3B1YA 1PR9A 4WBSA 1S8OA 1QHFA 3GZJA 2DECA 1MEJA 2J5XA 3IRVA 3UGJA 2IXAA 5CJPA 1P3DA 3UV6A 1S3IA 2ADFA 1J5XA 2Q1WA 2QTBA 4FD2A 4QBTA 5A9RA 1PJZA 2L2QA 5I6DA 3RRYA 2BPOA 2H8GA 4NESA 3SC6A 4D80A 3R4CA 4ZP1A 4EX6A 5CB4F 4FMCF 4A0HA 4F4HA 4S1VA 4EQZA 1VBMA 5EVCA 1KNQA 1EK5A 1DOAA 2ZREA 3R24A 5BSHA 1YUBA 1V6SA 1USVA 2ZRLA 1Y9AA 3X1JA 3D6HA 4PIPA 4B76A 3L7KA 3KKMA 4UTRA 1BQ4A 1CIJA 3B6EA 1BCSA 1V9CA 5FI3A 1PL6A 4Q48A 1X1CA 3QHQA 4IDDA 4LJ5A 3HUEA 3MTEA 5IAEA 4BMXA 1PUIA 3LVFO 5DISB 4N7RA 2W6JA 3B20A 4QBGB 3VSDA 1MABA 1CR6A 3VO1A 1R12A 3TXYA 3ERCA 4IJVA 2Q3DA 4C4YA 2QMHA 5SYNA 5FUQA 3DEKA 5LN1A 1YS7A 4OAOA 4B3HA 1EGQA 1ZVQA 5LD2C 4XD7A 4EWLA 2O5EA 2ZQ5A 4ZGWA 4JLOA 4PZDA 2JAQA 3NBZC 3PNMA 3RPEA 5L6LB 2YIVX 4I1RA 4WE3A 3ZJ5A 5JAQA 3OJWA 1RNLA 3D54D 2GF0A 5CIQA 4KQ9A 1YOVB 3DZJA 1NI3A 4MWGA 3WA6A 1OOEA 4JSRA 5BN5B 2R96A 2ODNA 1YIDA 2BFPA 2R00A 4KE9A 1OASA 3LT5A 4KLRA 3MJSA 4ZVKA 2TMYA 3OE7A 3P4YA 3EZYA 3QFCA 2I55A 4L4SA 2YV1A 3O6VA 1RI4A 3BEOA 3FUVA 5D6OA 1F3OA 4Q16A 4Y6GB 3G89A 2Y27A 4O59O 4HDNA 2JGNA 3X1WA 1HF3A 3VVMA 3JQQA 5BSWA 1DEHA 3EIHA 2ZIZA 4M49A 1KOLA 5KEIA 1P2VA 4LBYA 1ZCFA 5FUVA 5LYJB 2UUBB 1NUAA 1KZYC 1DJQA 1ND6A 2FQWA 3H16A 2X5XA 3PFBA 3GL9A 3ZJYA 2OLEA 1MIOB 3DMTC 3AFHA 3NBAA 4Q18A 5AM1A 2JIZA 1FTSA 4ARAA 2O7VA 1P2GA 1XP5A 3DMDA 3FGZA 3IAM1 3HRIA 4KPGA 1YRAA 2ZTHA 3OAAD 5CNIA 1PHPA 4KIGA 5LQJA 2WYWA 1YS2X 5A4MS 4H0CA 3QOWA 2WZBA 3LWBA 5HK8A 3RRNA 1CQIA 1DAHA 1DBSA 1JSLA 2IIBA 3R0XA 4LJLA 5ALWA 5EUBA 1QHHA 4Y2YA 1JEEA 3UQZA 3LUBA 3NWEA 3MGAA 5CXQA 2GM3A 2VCEA 3EGOA 4JBNA 5T64A 1XKTA 1N5IA 1R6BX 2P8JA 3KDPA 3ZJ4A 2OCLA 2Y67A 4DRXB 1V5FA 2X0DA 1OA1A 2VUIB 3LCCA 3WBJA 3MAGA 3NIBA 2J31A 3OM8A 1H4SA 1PZEA 3S1LA 1E6UA 1DTEA 3PPYA 3PC6A 4ZO9A 3F3KA 2NYRA 4E5KA 5I7UA 1VJDA 1IULA 1GSAA 3DUWA 3A25A 3CEHA 3FGPA 4O3FA 5IEJA 3FVVA 1KZ1A 4S3MA 4BVJA 1UK9A 5G3ZA 8OHMA 3HCFA 1V8ZA 1E9EA 3HKBB 1J90A 4Q1VA 3GEEA 3WKAA 5LQKA 4XX0B 1XXHE 3O1LA 3JQPA 3PJDA 4KLZA 4RJJA 2RB4A 5K0BA 2QGNA 3ZH2A 3LFTA 2GUGA 2C94A 5FOTA 1XEWY 2R8ZA 2Y1FA 2I3GA 5FTKA 4CRWB 1I32A 2ERYA 4ICIA 3R74A 3GXBA 4WBNF 1OWPA 3JVEA 3RC2A 5ALUA 3B1VA 4OPMA 4W9MC 2XUIA 4D98A 1Z63A 3D64A 3RV4A 5CFZA 4G0XA 2JEZA 2BUCA 2BMDA 3C14C 3WTCA 1G16A 3AVPA 3ND7A 2I76A 3EC1A 4IF6A 4NI5A 5TR9A 4YRQA 3BOSA 3L0YA 4BTVA 1QU2A 2JLSA 3UZUA 3UY4A 3ZBTA 4DJTA 3IOYA 5K8LA 3ZV7A 4QNMA 4WKBA 2DWUA 5AK5A 3FVRA 3GPBA 5FP0A 3CX4A 3TLXA 3UWSA 3CSDA 4RFLA 5E6UA 4IIJF 1FDOA 1V7ZA 4BLRA 4Z53A 1Q0PA 4LEIA 3G0GA 1N3LA 1H4TA 4OUDA 4KI0A 1YGPA 1MAHA 3RI3A 4EI7A 5HRAA 3H05A 3KEMA 2AF3C 4EDFA 2DSNA 3CB4A 3E5RA 4UM7A 3MJHA 4ZDKA 1SBCA 2H1IA 2QMQA 1CF4A 1O95A 4CM8B 3HBMA 3IBTA 3GDWA 3PFGA 4M1EA 4S12A 3Q8XB 4LOJA 3UFBA 1F7VA 1T9BA 4FX2A 1NZJA 3E9DA 2D74A 1N7IA 1T8RA 3ZWVA 1O6BA 2TSYB 4MRSA 5EZYB 4G26A 3OAAA 1RCUA 5AI8A 3GGJA 1ZU5A 3AEKB 3ICPA 4LI0A 4ZT7A 3VDXA 2GSDA 2WFLB 5C37A 4PZLA 3QTLA 3VH3A 4EJSB 1AH2A 3HP7A 5DK6A 2GJSA 1XFDA 3GHHA 5JDIC 1YCGA 3KQSA 2VDMB 3RSLA 2R86A 2JEOA 2IQ5A 4C2UA 2JGFA 1AUQA 2PSJA 4G0PA 3HA5A 3MWDB 3KR9A 2JF0A 4KQ1A 2ETVA 3B5EA 1ZCZA 3IDZA 3QRWA 4FOTA 3G1TA 4IOLA 5TNXA 4G2NA 3EVDA 3STWA 3CRVA 1QYDA 2R48A 2JLCA 3DQZA 3TUJC 4B4VA 5K8TA 4IDNA 1WY7A 1ULBA 3TLGA 1J0CA 4AZ0A 1PR5A 1XQ6A 2BKEA 4Y0AA 4EW3A 1RCTE 3QF7A 2IHYA 3ZWXA 3QI2A 3LX6A 5DM2A 5JSQA 2WTUA 4F8EA 4QQRA 2AC4A 4P5EA 1BCSB 4V0ME 3TEJA 2F43A 3N7TA 2QZ4A 2YHAA 1FDIA 1WO8A 1XD2A 6REQB 4KO1S 4U00A 1ZW6A 4UHBA 2XOKD 1UC9A 2P9QA 1EK1A 4C0AC 2RGGA 4Q21A 5FR1A 1GM5A 4R3WA 4KR2A 4BMPB 1MX9A 3EJ6A 3W5UA 2JAXA 3KFVA 3M9LA 2KM1A 1I0ZA 2D4AA 3V97A 4EW2A 3E22A 3GMTA 3ESBA 4Q9DA 1FXWF 3Q9LA 2GHTA 1C2YA 3MD9A 4WNIA 4AJ2A 3GUUA 2VF8A 5KVSA 2J4FA 3NUZA 3UUEA 4RKQA 3LJKA 3CNQS 3L6DA 4RGVA 2R751 1ZZGA 3CNOA 3IEMA 3IYLW 1GGNA 2IP2A 4WXRA 1AGRA 2RFLA 3ANNA 2MSEB 2HGSA 4KC0A 1LZKA 1UODA 1PSWA 4DA6A 5DT2A 2C5SA 2ZIFA 1OLUB 5LYJF 3LLMA 1RI3A 1PJ8A 3BBPA 4U6SA 1MJFA 5I9IA 3FRJA 3VC7A 4TVSA 1NWCA 4HDNB 2ZUSA 3JWEA 4M86A 1IYZA 4K9RA 4Y2QA 3FPCA 4RCZA 5DBEX 5C31A 3UT0A 3WLOA 1YFJA 3W5DA 4TLLB 1NJ6A 3L7IA 2AC7A 5KDLA 5IT0A 3PXUA 3ZQJA 1KMHA 1V7CA 1WKCA 2A88A 1RTKA 3VR0A 5JW6A 1S0UA 1W36C 4ZVQA 4KEAA 1K2WA 3WYCA 1S2NA 2QGFA 4YMHA 1Z88A 4B35A 4EPRA 4QQKA 6CHYA 1ECFA 3NBYC 4OFBA 4CDRA 4ZN6A 2H1VA 4REQB 3IKJA 1CQWA 1AKYA 1CQIB 3SX2A 1U8ZA 4CDNA 5A5DA 1QHHB 1TA0A 1MCZA 2Z04A 3LP8A 4MWZA 3TTWA 3HBFA 4YAIA 1IUKA 1FUIA 4CT5A 4FEGA 1VLQA 2V6IA 3OCZA 4M8LA 3DP7A 1P0MA 4I1YA 3EBLA 1Z13A 2PZAA 4CIDA 2XXBA 3TVDA 1MX3A 5I9MA 2I6XA 3AO0B 2NV6A 4KUGA 1NVFA 1XTQA 4I4TA 1IG0A 1NF2A 2Q1UA 4UTOA 1NXOA 2EBWA 3D3JA 1HYGA 1JI3A 2CLLB 2ENWA 3HEAA 3OPMA 1RQPA 2WA1A 4TTJA 3FXAA 4JJKA 3KV3O 2QMUA 4C4XA 3SXPA 3AEQA 4P83A 5B3LA 3ORYA 4Z0TA 4OQLA 1HFWA 4WASA 1N6HA 2WTEA 2P6MA 4OK6A 4DG8A 5BQXA 1SKYB 2ZB3A 1WDWB 3HI4A 4YP7A 2GO1A 1JVSA 2XOKA 2H1HA 5H81A 3REGA 3AEUB 2H9YA 1KMMA 1Z83A 3LYLA 5F52A 5ILGA 3ZWWA 3D8SA 3OOWA 4KLAA 3COPA 1E5DA 3KAKA 4R98A 2E4YA 4W7SA 4EP1A 3I4CA 4NPHA 1NQXA 4NZZA 2AEFA 1C9DB 1CQJA 3MJVA 4O5OA 4CL8A 4FQ8A 2JEYA 4YRJA 3DGFC 2J6HA 3JYNA 3LCJA 1JDJA 4H17A 1C1DB 1DQYA 1L5WA 4G1BA 5DGXA 4L02A 1O8BA 1XVVA 1L5HA 1F4PA 3NRJA 1G0NA 3DMNA 5TPZA 1CYDA 2Z5GA 4U7TB 4DLKA 2Q6OA 2QD2A 2E6UX 2PO5A 3RVDA 3BM5A 5C51B 1SOMA 4M36A 1T15A 1KIFA 2GFHA 1XZBA 2HREA 2OENG 3QKWA 1BS1A 1Z4QA 4ERNA 5AVVA 2H3EA 3GN1A 1QQBA 4LFAB 1EEHA 1JFSA 4W7HA 1U2SA 3GR6A 4RK1A 1OI4A 5FT9A 2FQXA 2O52A 2GAIA 4TTIA 5EIBD 4E2WA 4WUTA 3PQ2A 2RARA 5EZYF 4BNLA 1WNTA 1NQUA 3OHPA 3CKKA 3IBGA 3ON5A 3H1TA 5BQ5A 4E2FA 4AUNA 2A9VA 1OW3B 1TUGA 3JD0A 4YRNA 1VHWA 3AXSA 1W1WA 3SJUA 2OFFA 4YRLA 2O0MA 4UE2A 4UZFA 4B09A 1YASA 1U0FA 3AERA 3NJ8A 4KFSA 4A6XA 2AOTA 1EI9A 3V4SA 4MCAA 2V4UA 4DBVO 1JLLA 3A1NA 5DNYB 1N5RA 5L51A 2W11A 2A78A 2R4UA 3P9NA 4DQLA 2AF4C 3EWSA 1KEVA 4TMWA 4PNHA 4BNJA 5B4UA 1U7UA 1LGYA 3I5MA 3QPDA 2WU3A 4ENVA 2AA3A 3DG9A 1VA4A 1YE3A 2PYIA 4UHEA 3Q6NA 4BNUA 2JGRA 3CX3A 4AZ0B 3EUWA 2ZIXA 3V2GA 1SN7A 4LMAA 2NP7A 1NW6A 4MWOA 5CT5A 1PE0A 4JA2A 5AVWA 1RYBA 4DLZA 2I7TA 3S4YA 2E18A 1KEZA 1OXSC 3UN1A 4M1KA 2ZAMA 1QGDA 3AV3A 2G70A 5DYIA 3W04A 2BCEA 2QY9A 4C0KA 5JAIA 4B79A 4I66A 3UBTA 3JYHA 3SXUA 1QK5A 3ZGLA 1AO3A 4E6PA 3NYWA 4N41A 5JIBA 5AVYA 3C6ZA 5BSRA 3DHVA 4H7HA 1ZK4A 4NMHA 1TGVA 2BF7A 1PAUA 2VYQA 3A06A 3BDIA 3CRMA 3UG7A 4MPJA 4BX2A 5E1MA 3J80A 1XJ5A 4IH1A 2B1GA 3COWA 2N3ZA 1ZK1A 5IT4A 4CUKA 3CZ4A 4FYYA 3NHBA 4I7EA 1QP8A 4E46A 2UAGA 1ZFNA 4MYUA 1JTFA 3GH3A 1IAVA 3GPIA 3E8SA 3QGMA 1D8TA 2KE5A 4LRTB 2AFIA 4UUOA 2WOJA 4KFTA 4DLAA 3U4IA 2WIJA 3DWFA 3CKMA 1RM4A 3KOZA 4XWYA 1ZMBA 5DKFA 2FMXA 2HSZA 2H92A 2XVXA 2XADA 1S02A 2BFCB 4WKOA 4ZO4A 5E1DA 5IAJA 4DIEA 2OFPA 2W0MA 4RVUA 4DIKA 2H57A 4ARVA 3UTDA 3K0EA 2YW2A 4Q7LA 2RGBA 5C8YB 3G0CA 3BJEA 3ROPA 3S2YA 4AKIA 1ZUHA 1JHAA 3BF8A 3HB4X 4N12A 5J2TF 1PQWA 4CMKA 3K8YA 4BVHA 2QT0A 1QV9A 1U1IA 3GLSA 2Z4SA 1XWFA 1MB4A 2FWNA 3K8QA 2IDJA 3DHEA 4N3CA 3QX3A 1HFKA 3A1DA 1ZI9A 4UMDA 2J07A 5IJZA 4Y1FA 2IBMA 1MPTA 1GT6A 3H9JA 2B20A 2BH2A 3GA5A 1Q7RA 4XDYA 4DMKA 4ESOA 3ZGZA 1ISHA 3I1FA 1VHJA 1HXHA 3A7DA 2EV9A 5AXAA 2ISSD 2IYAA 5GJVC 4NZYA 2JVKA 4CIBA 3OZCA 4QGFA 2VHXA 3L7MA 2IV2X 3QMVA 4YRTA 4QDKA 1PJ3A 4EG4A 3M4XA 4XUDA 3OCJA 2OZLA 3AEQB 5EQJB 1DRUA 1JXMA 1LI5A 4YJDA 1FNBA 3OLCX 4P80A 4AJJA 3DBOB 4I9HA 1JSZA 2XCOA 4ZU1X 3TZEA 3L84A 5KTYA 3A4TA 3I72A 3WG9A 1PEYA 2YY5A 2CLOB 3AOEC 4XQGA 1R4NA 1UK7A 4IVPA 2PX4A 1DXOA 5TEWA 4CN8A 4E4YA 1UQRA 1ISPA 3V4RA 5I4KA 1FLNA 2ADOA 1BYUA 1OPRA 3GUYA 1CQJB 2IY7A 2C97A 3T0GA 3P9RA 3KTAA 2BBOA 3UH1A 5F23A 3G2OA 2NVBA 5E9AA 4Z4FA 3ESXA 3BD9A 4AF8A 1NATA 2BGRA 3KSDO 4HSGA 4BCBA 1W581 4EGAA 5JALA 3RFVA 3LUGA 2OBYA 3WTBA 4UU1A 2ZG6A 3DE6X 4GYJA 3OIGA 4HDSA 3SS8A 5CEJA 2EF1A 3LT0A 3THYA 2PS0A 1CF2O 2EX0A 3VR5D 5B7QA 1RC0A 3KTDA 3QE3A 3VNUA 3TCNA 1XBTA 4LTDA 2HN9A 3RVQA 3K71B 1R0RE 2R62A 3N39C 1D6SA 2ZW9A 2CE7A 2BEKA 2LUOA 2YKGA 4NBWA 1YFKA 5J4HA 4B43A 3MGBA 3NT2A 2XCSB 1RM0A 1R0ZA 2C2BA 1A5SB 2PYDA 3DZIA 3W5VA 5C18A 4JP3A 4GECA 3P2YA 4TVBA 5FD8A 1KMCA 4D8TA 4NMWA 2QNRA 4XWWA 3JRWA 2IW1A 3C48A 1YZYA 1M1XB 2Y0EA 4Y2VA 4EEKA 1N2OA 2VCYA 1CTQA 4M0MA 3GP5A 3GGOA 1UIRA 2R1TB 5FPHA 4F6CA 1TZMA 1VRCA 1X9GA 2HMSA 3CLTD 4K9QA 2AOTB 3EXHB 4BO9A 2QM8A 2WSBA 4URUR 2JLVA 3AUAA 4AM8A 1S3SA 1X0XA 2VSYA 2OORC 3MC1A 3QX7A 4P93A 5CT4A 1R1DA 4IIHA 3T06B 3O1HB 1USGA 3DEFA 4OVKA 4TUYA 1WDLA 3G7UA 3HN2A 1SUDA 3RVRA 1BWRA 4DG9A 3S81A 3SDSA 1M8KA 3IH5A 1I2BA 4K40A 4KXWA 1NOIA 2HA0A 5I9TA 3W4IA 4UARA 5D84A 3C5CA 4CMIA 1F6BA 4Z9XA 2P4SA 3TPCA 1LVHA 1HDZA 2DKFA 4MWBA 1XI2A 2RKOA 4MV8A 4GI1A 4QKQA 1VJ5A 3TQRA 1SPXA 1ULZA 1Y82A 2Q6LA 2X2PA 4JL6A 3MQ4A 3RT7A 4ZDJA 2JASA 3C6KA 3L6UA 2AI1A 3LK7A 3SXUB 3BWXA 3YASA 421PA 4AX8A 4PICA 4JLSA 4UBLA 4XR9A 2W2XA 2ZDHA 1H0HA 1VSVA 2HCFA 4Q3NA 3ADPA 3L79A 4YV2A 3SFTA 1CPYA 4DXHA 1FLVA 2C4WA 4BN4A 1OR8A 4D99A 1UF9A 3QUCA 4RVOA 1ID1A 4CLRB 2DKOA 1NJSA 1Q6ZA 4ZYUA 3F9IA 2OECA 2YHSA 3NAGA 3NV7A 4LE0A 2XVMA 1YSCA 3SVZA 5FNVB 3T5MA 3TLYA 3U4CA 1UPTA 4ZIRA 4B2YA 1WP4A 1LSOA 1U2DC 3BL6A 1Z73A 3COZA 4MZXA 4PONA 3W8DA 2RHDA 5KMGB 1LC0A 2A1IA 3TIIA 3VR5A 1PT9A 2YBDA 5AP9A 3HXOA 2OZPA 1D1QA 3AUFA 3E23A 3JZMA 1QYXA 1UADA 2OCAA 4PZPA 4RXTA 5G40A 3RFUA 3WO0A 1S3FA 4P4SA 5E0OA 1K7XB 5E3IA 3RSQA 1VXOA 2V7BA 3UFXA 1OFGA 1NP6A 4LUCA 1RXCA 2H1CA 4E5UA 2AR0A 3U3RA 4CLOB 2D0PB 4GLLA 4G9BA 4NNJA 1K2VN 1P0PA 1Z5PA 3MWKA 1T36B 1Y4ZA 2X13A 1TLFA 1F2TA 3M3HA 3OSZA 3WL3A 2ZSUA 2Q49A 1NKVA 1SCUB 4ARBA 3OFJA 5CLQA 2QUAA 2OFXA 4IFIA 2PH7A 3TM4A 3RBXA 1K7FB 2B69A 4OA5A 2P91A 4UOZA 5ETJA 1JG1A 2DFVA 1XJCA 2DPYA 8AT1A 5EMLA 4C4PA 3LUPA 3TSYA 3DWGA 5ALEA 5UKDA 1NLYA 1HEUA 2PJUA 2QRGA 5LMUB 4EKIA 5FAKA 2A58A 4I4TF 5KYYB 3KLNA 3P0FA 2HLDA 3HL4A 3S28A 2NTJA 2QX4A 2IHZA 4AKSA 1IHOA 3DCYA 3SFVA 3WGQA 3RS0A 4M1SA 4MV0A 3PXCX 5K3CA 1P2UA 2VPQA 3DBVO 4HQ6A 3DT9A 4M6WA 3PQDA 4RTSA 3SQWA 4WCFC 4R2XA 1S3GA 5AW3A 1OIWA 5CYFA 4LJKA 1N75A 4C5BA 4Q7MB 4E7OA 1RBMA 3CV3A 3S5UA 2IYZA 1TT5B 4O25A 3K0FB 2LW7A 1BHSA 1MB0A 1R4NB 4POAA 4F8JA 1I7QB 3IAUA 2WB2A 1OY1A 4FNOA 3HVIA 4Q3OA 4QNRA 5DRTA 1EIZA 4BWVA 4C9BA 3KLPX 2QX9A 4LSWA 3T38A 4WK6A 1ONNA 3KTAB 5K3DA 3UAWA 3CC8A 3UMJA 5K8CA 5J1TB 2A5FA 5EQDA 4DDTA 5JWRA 4YWHA 1XN4A 2C3MA 4ZZIA 2BFBA 2UVQA 5C1PA 3ROQA 1EESA 4YLEA 1V96A 1CDZA 1YDFA 3V8VA 4D8VA 3OA2A 2HA3A 1N92A 2O48X 3OM1A 2D59A 4OJNA 5DOVA 1VL2A 5EFZA 1Z26A 2V4MA 3VR4H 4F06A 4ZJZA 3THYB 1OI3A 5GJBA 3VR4D 2QZZA 3WYFA 5AK6A 5HJEA 1V2HE 4M3NA 2ERCA 4UUAA 3UGQA 4DA7A 1WY5A 5IT9A 1S7GA 2VK8A 4GL4A 4U2DA 2GPYA 3OPYI 1H9CA 1HEYA 2GMWA 3DC2A 4ZODA 4BYGA 4EVSA 2OOSA 3MT7A 5JDCA 2E3JA 1AVTA 2GRUA 1ESZA 1NXPA 1QLHA 1X7HA 2H4JA 1IE3A 3IUMA 5DNVA 1NJGA 3GJ6A 2BLLA 3UJHA 2OK8A 2CV1A 3GDGA 4XRGA 4FFBB 1VL8A 2JI6A 4BMNA 4TTVA 3D81A 1US8A 3TM5A 3RRXA 4H15A 4O33A 1HKHA 2BDTA 3M4JA 2RJ3A 1ZMRA 3WSWA 2VI5A 5C5EA 2C58A 3IERA 1OYOA 4MICA 1DIRA 2PD3A 1CVLA 1UPCA 3BHNA 3GJ0A 3L5OA 3RF7A 4YRBA 3OTOB 3BIWA 1G1AA 2IZ7A 4ETIA 4EGJA 1UBOS 4DW8A 3A0UA 4IWNA 2GBGA 2VEOA 2WUDA 4BKUA 1PEDA 2XMSA 1R7RA 4DV5B 4QIHA 3H75A 1ZD5A 4ZARA 4HLCA 4LXGA 2YMPA 4NCIA 3EFBA 3VZCA 2HQSA 2O5RA 3RUAA 5E1OA 3UATA 3ZHSA 2K5UA 3MG9A 3FA2A 3GGCA 3RRJA 2YC2C 3WLKX 4M8IA 4J6FA 1NC1A 1S8NA 1C9EA 1TYBE 2I3DA 3M2TA 3R5XA 1IVNA 4PQGA 4UUPA 5CCDA 2FLWA 3P2OA 5G0UA 2CJYA 4I50B 4C0WA 4L74A 1O96A 1Q16A 1FP4A 2W48A 4F2GA 1F06A 1N7GA 3PS9A 3TPFA 4JYMA 3GEGA 2VUTA 1I4EB 1DO2A 4JQCA 2ZB8A 3H87A 4HNTA 3RC9A 1JG2A 5I7VA 5KYKA 2G4CA 5E6RA 3LLCA 1RJDA 2CEKA 3WFJA 1IZYA 1UCFA 1OBFO 1KEWA 1Q91A 1JQBA 1RAIA 2E1PA 2ILVA 3HVJA 3W3AH 4ZOLB 3W3AD 2IDZA 1II0A 3S55A 5ALYA 1IZ7A 4YT5A 4NBRA 1JRLA 2EDCA 2QK4A 1WSWA 1KJJA 1JU3A 4ZIRB 3IVRA 3PVCA 1MC8A 1EWYA 1TF5A 1N7HA 4TXNA 1G7TA 1AZLA 3VR4A 1E9AA 2VP3A 4KSBA 4EVQA 1T2NA 5JXWA 2LV8A 3PNBA 5K0LA 4WZAA 5DXFA 4UBKA 3T7IA 3U16A 4ZZ3A 2JLUA 4UQPA 4KX3A 5REQB 3ZXXA 1RWBA 1ZMXA 1MQ8B 1MQAA 1C7RA 2O50A 5K7SA 1GUDA 3UFXB 5JCZA 1VIAA 4PLHA 3FI9A 4LGCA 3PXXA 4Q9LA 3SKVA 2QD5A 4ZCRA 2WF7A 3TL6A 3LBIA 5BYJA 5C8DA 3OZ7A 1F2TB 4EA9A 3CLHA 3K0BA 1D2NA 3ORRA 1T1EA 4N5IX 1GL6A 5IW8A 3ZI7A 1YA6A 1WETA 1WXWA 4M89A 1BKYA 3W78A 1GG2A 4BV9A 1M67A 2XZOA 3JWGA 1JW9B 3K72B 3RAFC 2G0TA 3B5IA 3V8PA 4MEAA 1JXOA 4S0XA 1ZRHA 2B83A 4EHIA 2IU6A 3NDPA 1OFIA 1BQ3A 1X8LA 2XMCA 1G4AE 4G0OA 4L8VA 4I6GA 1KS9A 1OKKA 4GYKA 4RZSA 3OJLA 3RTDA 1R15A 5JMPA 4BKPA 2DBYA 1N2IA 2IKQA 1MJHA 1QNFA 5IVDA 3EOBI 3RLIA 1GYRA 3C1TA 4BZWA 2AS0A 2G0AA 1ZRSA 5D7NA 3ZDRA 1DX6A 1C8VB 1AQUA 2HZBA 2WP8J 3CQ9A 1SJ9A 4KWHA 4XQ9A 3WS7A 3FCEA 3WRVA 1T1SA 1X7YA 4C4TA 1AE1A 2P77A 3CONA 1ORWA 3MEQA 3SYKA 3VXKA 3ZWNA 2J32A 4JI0B 2I2WA 3BA1A 5JNRA 3B8EA 3L6CA 3EG9B 2ZIEA 4GOLD 3BAFA 1A5BB 4PS1A 1SUPA 2NX2A 3CBGA 3QNMA 1LJUA 4LJ8A 5CVDA 1RVDA 1ZGGA 3AM5A 2ZS7A 5IK2A 3JYLA 5DBGA 5E2BA 1FDVA 3M6UA 3WB1A 1WSBA 1E2EA 1QANA 1L8QA 2RGUA 4ENTA 2VXBA 5KSOA 5T41A 3U7HB 1W7AA 3P8ZA 3OP4A 3ZZUA 1ZEMA 2C31A 5COBA 4DL9A 3WFZA 2O2DA 3EAQA 3PNVA 5F5NA 1WKVA 1NW7A 3O2QB 4N4AA 4RETA 1ZH0A 5E0KB 4FOLA 4JASB 4XJVA 2H1WA 3QITA 2CCGA 4MCJA 3MIZA 3BL8A 3EPRA 4P38A 2OZVA 1C2TA 1QB8A 5AKIA 3FUXA 3FZEA 3RS2A 1V7QA 4WCVA 4YRMA 1DIGA 4F3RA 1Q74A 3OU2A 3NNDA 2PZEA 4OBBA 5L3SA 2Q50A 2QMOA 4H60A 3UOGA 3AB8A 3OQHA 3ZDFA 3EVAA 1IXYA 4BFCA 5AXBA 4JSYA 1PR1A 1P2BA 2ZRQA 3KQVA 2JIQA 2QA5A 3PE3A 4PIVA 4KSCA 2OAQ1 2B4KA 1NBHA 4P7JA 1U8FO 1UJBA 1ZA2A 2C0QA 2CNNA 1UFKA 1P3Y1 4DGQA 2AZMA 1D7AA 1WUKS 2FLKA 3MWGA 4JLAA 1I3KA 1SZPA 1US8B 1QCYA 2VF4X 4HPXB 1UBEA 2F3TA 2MSDB 4AQ7A 4UFOA 3RAGA 4X8LA 4RUKA 1V11A 3ANLA 2R8BA 4DBLE 1SH7A 4XJTA 5DBOA 2AMVA 1ABFA 2OKGA 1RC8A 3CURA 2B6NA 1R6DA 3HACA 3KT3A 1DNPA 3PENA 4HDQB 1SVOA 4CHTA 1K7EB 4WBXC 3LDUA 4GPD1 4FYHA 4C0SA 3TAUA 1XL1A 3AJ8A 1AS3A 2I1WA 2QYOA 4EHDA 5ESRA 5A5GA 5IH3A 3PUYA 3LG2A 1Z2DA 3IELA 5KDOA 1IDOA 2CDBA 5ELLA 2FW8A 4O3MA 2AYXA 1QV6A 1KIAA 4OCZA 2J45A 4R8LA 5IZ4A 1P9RA 3HXKA 2PAFA 3VKGA 4BBZA 4JBGA 4QEKA 4FFNA 1NVDA 3KPYA 2D62A 2X3YA 2ZFUA 1O96B 1GL3A 2BFDA 2QL6A 3IMGA 3PWTA 3TIFA 3HYLA 1Q57A 4JMLA 1OF1A 4NSNA 1XPJA 1P1KA 4GF5A 1NHGA 4ENSA 1GCOA 3F6RA 4F9GA 2Q1XA 1HORA 1M2GA 4FXOA 2YJGA 2F17A 5JC1A 3HXPA 4UVDA 1UT8A 3ES9A 4MUFA 2PT5A 3DO6A 3IMCA 3M5CA 3O0DA 2B5OA 3IVMA 4J75A 3K8OE 5KHOC 3U5TA 4OMCA 1T4MA 1ENZA 3BB3A 3D0OA 4KIUA 5FBWB 4G5XA 4CKEA 1S1MA 3VJLA 3N0VA 2P3OA 3R3HA 2IBTA 1I2DA 1Q22A 4BB6A 1GKUB 2GXQA 3OOHA 4I3GA 5FHRA 1JQDA 3PF9A 3EA0A 3WRXC 5HYVA 1SXIA 2FWBA 4Y0VA 1JMVA 1VBFA 1Z0AA 2OBLA 4LC0A 2AV6A 4BP1A 3GZ4A 2B8JA 2PVPA 1FIUA 4P3YA 1JJ7A 3CRW1 5FI0B 1G7RA 3FOBA 1DDOA 3CO0S 4S2UA 3UJDA 4KKXB 4XGQA 5BQFA 1VLZA 2J3DA 2VDNB 3T5TA 1JHZA 1U3CA 4PYNA 9GPBA 2HOQA 2NVOA 3FNFA 4N8DA 1THGA 5EWLA 5TRTA 5LOVB 1YZLA 2IA5A 5DYTA 4YJ3B 3V4LA 3AJ9A 2IY9A 3DMYA 4E12A 4N49A 4B7ZA 2XSZD 3E5MA 1FYWA 2IPXA 3WYEA 1EXDA 1LS6A 4OA8A 1R0LA 3MOSA 3AIKA 4P5PA 1HPLA 1PDOA 1Y1KE 3U09A 4O2BA 2I4LA 3H2SA 5D5PA 1UZNA 1I2ZA 1O97C 3QEOA 2HSGA 1C7EA 2FFJA 3GEMA 2Q4RA 1QX3A 2RCNA 1NLFA 4N5DA 3TOCA 2JFVA 3ZW8A 5L7YA 3WB9A 1R5BA 3Q0IA 4FKBA 4NHOA 5FUYA 4EZBA 4X61A 3SCZA 5IJ0B 3JQBC 3ZOKA 4OHUA 4RPKA</