5IB2A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib2A01
2VLMD 4NM8L 2O5ZH 4B41A 4OZIB 1NUDA 4KQ4H 4EQ3A 3MLTB 2IANA 4X9FA 3QCTH 3MLXL 3TLRA 3NFNA 4LASL 3SJVE 4JM2A 4HZLA 4ZFFA 5F7DB 4C4KO 3BZ4A 3HS0A 4YDIL 2YA0A 3MLZL 1DSFH 3MOQA 1RZIA 5ANMB 4Z8FH 5DEGB 4WFGD 2GY5A 2F8VA 2Q86A 3ILQC 3BQUB 1U3HA 3VXTA 2VZ3A 4I77L 1A7PH 2EEAA 4LCCA 3I6KA 1E4WL 4NC0B 4PIRF 3OKNA 1DEDA 1CDHA 1TVHB 3H0TA 3BKYH 3QIBB 3PHQA 3FT3B 4ZDHB 1UG9A 3AY4A 1BBJA 2Z93B 4LLUB 1A0QH 1AJ7L 5MP6L 4V1DB 3HUJB 4XTRC 3MBEB 4LCIH 2ZWLT 4HH9B 4S0SD 3S88L 1WAAF 4ODVH 5FYJE 4NQDA 2CDEB 2IBBA 2J8UA 2FGWH 5D93C 2HRPH 5BZWA 3GI9H 4AH2B 4LVEA 2E7LA 2QQQA 5KW9L 1NKRA 2E5EA 1XIWD 3N9GL 1BQSA 5J8OA 2Z8WC 1RZIB 1JGEB 2PR4H 1HH9A 1G7PA 2BNQD 3FQRA 1L8JA 4GRMA 2YD3A 2O93L 1MLBA 3MRIB 3OXSA 3LZFL 1CE6A 4Z7NF 4DKDC 2BC4A 4LEOB 5BV7C 2P5EA 1NGWB 2FB4L 1REIA 1RZKL 1LEKB 1JRHH 2OJEB 3MUZ1 3KPQB 4OUOA 4V1DA 2PO6A 5IHBA 3ARED 3VH8G 4UQ2B 4TVPD 1RZGA 3PV6A 2FJGA 4JVWA 5D2NC 4N0CA 1CCZA 1DLFL 4HUWA 1B90A 3V7AG 4QY8B 3IF1B 2EXYC 5FA4B 3CPLA 3R0NA 2HLAA 3FRUA 3FB7B 1YPZE 4FQXC 4P5KB 2UZYB 1TNMA 2D3VA 3MUY1 2HJKA 4MXWH 5MEOA 3FQTA 1A7QL 2APXA 5I1GL 2WP3T 3WEXB 4HMCA 4AG4H 5D7SL 5I1JL 3GMOB 1GC1H 3RUGA 1UADC 1QZ1A 5HI4D 5AZEL 3W0WB 1TJIL 5HHOD 3MRPA 1RULL 3L3IB 3MXVL 3OJMB 4LEXH 4MJ6B 4PV8B 3CFDA 3JWOL 5ESAA 2XACC 3BKJH 5E9DE 3QWRA 1YN6A 4ZO9A 3MREB 3ZSTA 5HHME 4ZNEE 2ZUQB 1S9VB 2R0WH 3I9GH 1Q9KA 5IBLC 1IE5A 2P4AB 4PLJC 1QBML 4TPRL 3FN0H 4OKVB 2FJFB 3V4PL 3W2DL 3F62A 3WN5C 1AE6L 1CFQB 5JOEA 2V2TB 4ALAL 5JIPA 1F6AB 1ZGLM 4D8PB 4LF3B 3HAEH 5CINL 1P84J 5CJQL 3SO3B 3ECBB 5C0CA 2XWTA 1GRWA 1VEMA 5DD0H 2YSSA 4HKBA 1FORL 3PDGA 5TF1L 3LKOB 5CJ5A 4QF1A 1A21A 3QJFB 1CFBA 4HT1H 2OL3A 5FYKU 1KB5H 4KK6C 4HC1A 1V7NL 1NC4D 2NY6B 3C08H 4ZUWA 2P5WE 4I48A 5IK3A 1T66D 2VDQH 1JZ2A 1PYWB 5ANME 3T4AA 2NY7L 1G0YR 2FD6L 4G9FB 2JLLA 2I26N 3QUZD 1CQYA 4JRXB 1FBIL 1KG0B 5DHVB 2PYED 4M02A 5HHMB 4D94A 1ZEAL 1FFNB 3V0WL 4MHHI 3GI8L 5HXMA 2DKSA 1H8NA 1OF2B 3C87A 3QFDB 5K93A 1EFQA 4P57A 2HWZL 5K9QG 2X4UA 5EG6C 5TH2A 4O9HL 4X6EA 5I74B 4CNIB 1RHHB 2ENSA 3VD5A 4Z7QE 3G5YA 4XNXH 1KIRB 5HHOB 1JZ5A 3CFBB 3CXDH 3MRMB 2NYYD 3L5HA 3DHJA 1NBVL 1AKJA 2OS7A 5F6IB 1DDHA 4RGOL 2A6KA 5IWLC 4RRPA 2FWOB 2ZSVA 2D0HA 5I1HL 4LSSL 2Y25A 1KLGA 1QSVA 4N8PA 5IB2B 3WLWD 4YBQC 3K2UH 4ZFGL 5BO1L 5DJ0A 4M3KB 3E3QC 3L5WB 3MRRB 3QUXD 3Q0HA 3BHBA 4X6DB 1HNGA 2YPKB 4NNYA 2LVCA 3DARA 1TCRB 3UMTA 5KN5A 2ICES 1KN2L 5JHDA 1VCAA 2CLZA 4LNVA 4YE4L 1MEXL 1PG7W 1KIQB 4QOKA 3VDAA 3CU7A 5GXBB 2R8SL 2EKSA 2VABB 1IGFL 4PREA 3U7YH 5JNYA 1LO3L 2DIJA 3KPOA 2Y5TA 3UEZA 1EBPA 4M9OA 5KSVB 5C07E 1OD7A 3QXAB 1OTTD 3QXVA 5C0FA 2EE2A 4QTHA 2AEQH 3CVIL 1IC7L 2EDFA 1AP2B 5TE7L 2XN9D 4F9LA 1U42A 4JFOA 3B6SA 1A6VH 4JQVC 2DQGL 1N4XL 1NAML 2MKLC 3EHBD 4QRPA 4WGWB 4P2OC 2KZWA 3QULB 3P9LB 2QBWA 4P4KA 1TCRA 4WW1B 5IFJA 1FFRA 4KRNA 1HWGB 1X5XA 1OPGH 1ZHLB 1ZA6A 5DK2A 1FLTX 3MMEA 1ZLWH 3RY5A 1FC1A 5J3HC 4X4ZA 1U8IA 4GW5A 4XCEB 4P2QB 5ABDE 3U48A 4G7YL 3TCLA 4Y4KB 3RGVA 3DURA 4FXGB 1FDLH 4Y1AE 4H1LG 3MGOA 5DMIL 4ZO6A 4YXHL 1T2QL 1EHNA 4X5WB 4RMVA 1JPGB 4JKMA 1L0XA 4FQHB 4N8VG 3ISWA 1I9IL 2D31B 5HHPA 2AQ3A 2BMKA 5EBWA 4KRPD 2EEBA 1F4AA 3G08A 2IF7A 4YPGB 3B5HA 5E6ID 2MPAL 4BQCA 3K4ZA 2R39A 2GCYB 3MQIA 4MAYB 3VFVA 5C0GB 3FCTA 3QCUL 2J8UE 1GZPA 3M17B 1E6OH 3QNYA 3QR2A 3ARTA 3Q48A 4PJ9A 1DBAL 3CVHB 1XR8A 4WFFD 5C09A 3FFDA 2B1AH 3UTZA 2A9MH 3VFGL 3F7YA 4ODBD 1EMTH 4K9EL 2X89A 3HI1B 1UWEH 4LHQB 1RIVH 3RWHB 1BQHG 3H7BB 4CW1A 4OD1H 1MSPA 2W65B 3GKZA 2NY1C 2DBJA 2Q8AH 4NRXA 3HE7D 2QSVA 3SPVA 5F7FA 4H26A 5TDOB 5IM7B 2F54E 1BWMA 4JFEB 5TDNA 1HHHA 3RWGA 4MD0A 2YC1B 1AO7E 4XVJH 2D9CA 5AAWA 4R3SA 3WO4C 4ELKA 1HINL 1BFVL 2AQ2A 4DKFL 4WEMB 3EZ8A 2OM5A 12E8L 4XPHH 4MCZB 3LEYL 3FT3A 3MNWB 2ZUSA 3SO5A 4F7CB 1FPTL 3IRPX 3IVKA 3QHFH 4PRHA 4K71C 3VXRD 1RUPL 1N6VA 3PABA 4HJGB 3BH8B 3QXDB 4N68A 1FVCA 1MNUL 2DD8L 5C9JA 1F2XK 4MA3B 5D7JB 3ULSA 3HNVH 4QEGA 1JZ7A 3MSPA 4P4KC 4HXAL 4NOFA 3VA6A 5T5FL 4PRIE 5KSUB 1KSRA 1NCTA 4HGKC 1CXKA 2NY0C 2P44B 3WHXA 2EIBA 5B39A 1OVZA 1JNHB 3MJ8A 2FHBA 1EEZB 1S7TB 5EU6B 4LVOB 5DRXA 5CGMA 4HWNA 3GRWL 3AREA 5D1XC 1ZWIB 5C7XH 3PQYE 2AI0L 4GRWF 5EO0B 2OZ4H 1MCDA 4Z7VE 1MI5E 3U46A 1HI6A 3C2SA 2VISA 1I3RB 2YPLD 3MCG1 3MZGB 1D5IH 4F7PA 5D7IA 5I18H 4NQVB 3BEVB 4JZJB 1J87A 3WN5B 5TF0A 4LCYA 3B9DA 3CDFA 3RX5A 1BJMA 4ZXBC 1IGCL 3FB7A 1T6VN 3BZFB 4R0LB 1ZLVH 1EHLH 2AXGA 1CIDA 3FQWA 4XPGH 3S36H 5E2VL 1EEZA 1S7TA 2J3SA 3G6DH 3MFFA 1AI1H 4PV9A 2OK0L 3E8UH 5CIPH 1U8HA 3TPKA 1FGVH 5BRZA 4PGZA 3MROA 4Y19B 3QO1B 5ACMA 4XP4H 3STZA 3EYQC 3P30H 3I3EA 2CDFB 4HS8H 4NJAL 5FOJA 3OB0K 5C0JB 1FZMB 4PJCE 3VFRB 3P2TA 2BJMH 4GAYA 1KYOK 2BVOA 4XPBH 2IGFL 2X10A 4JKKA 2Q6WA 3OR6B 4PJCA 5DD6A 4FQIH 5C0BA 5J06A 2PTTB 4OCSH 4U31A 3RAJL 5KSAC 4J12A 2FX9L 1IGIH 3BEWA 3H3PH 1B6DA 1G7LA 3HN3A 4BH8A 4YX2H 2GJZA 5FM5M 1NFKA 5D7JD 3FAWA 3MV9E 1T1XA 1I3GL 2D7QA 2X1QA 3IU4H 3PHOA 3VJ6B 3BMVA 5SWSE 5IOPB 3SY0A 3F65A 3L95A 43C9B 2GAZA 2YKLH 1P7QD 5EIIB 3VFNB 1OSPH 3HB3C 4NFCA 5I1AA 4TUJA 3SKJL 3RZCD 5JLZA 3UROR 3KNBA 4L8CB 4UIKH 1FP5A 1YY9C 4FXLA 4LRIC 1UC6A 3DMMA 5EORH 1ACYH 5HHOE 3VG0L 4ODWA 3HE6C 3VRJB 4G9FA 4LGRB 1O5DT 4TULL 4F15C 1UKTA 3KPOB 1MFEL 2OSLB 2XTJB 2AVGA 3WJJA 2DWDB 4YGAB 3JVGA 4PGEA 1X5HA 5IFHH 1Q9WB 5T33H 5E8OB 5I76A 3WKML 2LVEA 4F7MA 1QR4A 1FYHB 3RP1A 2NTFA 2XV6B 4NPYA 3LMJL 1T03H 4Z18A 1D5MB 3QQ9D 5DVNA 3I75B 1PLGH 4LP4A 2R29H 5BW7A 1XZ0A 2XZQH 3HMXA 5DD5H 4ODHH 4JFFB 1MF2L 2WBKA 3RPIA 3MLYL 2NY2B 2IG2L 3UYOD 5DA4A 3HR6A 1HYSC 4KKLD 3UPCA 4YQXH 2C7UB 3LDBB 4F7EB 5FYKE 5T1KA 4N0CD 4I13B 1A14H 1NFIA 3TEUA 3ZT6A 3U4EA 1YN7B 4OLYL 3MV7E 2FZ3A 2FHFA 1IMHC 3BH9B 3QNXB 4CADB 4NP4H 1I9RL 3CH8A 5IW6B 4D9RD 1AKJB 1EUTA 3SCMD 1FNLA 4HEPG 2X2YA 1FCGA 3QDGE 2VDML 1LP9E 3BVNA 1MI5D 4GW4A 4NNPH 2HYMA 3OR7A 5KANI 3D0VA 4KTYA 5GPRA 3HMXL 5DJ6A 4PBWD 5DZLA 1IGJB 2CIKB 5INDB 1WBYA 2CR3A 5ITFB 1JFQL 3UC0H 1S9KC 5KJRH 4DKAA 4YWGL 3MNVA 1MH5B 3NAAH 1BZ9A 3S9DB 1VFOA 2UUDH 4XMLL 2ZPKH 3S37X 5CIPA 1P69B 5AAMA 5T5NF 1FZOA 5D1ZB 3ILPB 3UZEA 2B0SL 3K1DA 4HS3A 3HUJA 5FYKL 3S4SA 3F7RA 2ITDA 1U8LB 2VZVA 5J1AB 5BVPH 4ZQKB 4PY7A 1P7HL 5DSCA 1B0GB 4XTRD 3BQUD 4QWWC 1P9MA 4OM1L 3KDMB 2QR0B 1EXUA 1V3LA 2NQCA 3NCJL 1AGBB 4PR5B 2VE6B 2GFBB 2HVKA 2VDLH 5I8EB 3F6LA 3MV01 2GITA 2ZKHL 4U6XB 5CBEA 2DLTA 1MH5A 3CNKA 1T6WA 4LLMA 5FO7A 1MFCH 3K81A 3EYUL 4KUCD 1CXEA 2P5EB 1WK0A 1WAAE 1RUAL 4XCYA 3WDJA 1W2KT 4R2GB 1NGZB 1DDHB 1TNNA 1U8IB 3S4SB 4ZTOH 1Y6MR 5GSRA 2SEBA 2V9QA 3BE1H 4OT1H 2VDPH 3MA9H 4KC3B 3KXFB 4GH7B 4ZFOB 4IS6A 4ZYKB 4U7MA 3ABZA 2B4CL 1MHCB 4XPTH 2WAHA 1MHPH 3PP4L 5C8JA 4U3XA 3DXAD 1HSBB 4P46D 3FRUB 3QAZB 4N0FB 1S7WA 4PJBB 2A74A 5I1EL 3ES6A 3IFOA 1OW0A 1W72H 5HVHB 5FO8B 4G3YL 2G60H 3WE6A 5EBWB 3H9HB 3GSOB 4ZD3H 5I15L 4C56E 1PVHA 3EDJA 2Q3ZA 1JGDB 2VC2H 4NC2B 1FFOB 2VKWA 1X7QA 3ERYA 4LRIA 2A0LD 4AMKH 4RWYL 3GBMH 4Z78A 2DF3A 5T1KD 3MLSL 3OKMA 1ES0A 2DM2A 4U1GC 3TBWA 1CLZL 4PG2C 1NBQA 3C5SA 2X4QA 2GJ6E 3B9KD 3SDAC 1LQVA 3MRBB 4L4VD 4MWFB 5B3NA 5BVJA 4OZHE 3JXAA 2Z35A 1HILA 1CDBA 5AD0B 4DEPB 2W9DL 3QUZA 5E00A 2DMBA 2FLRT 4DOHE 2DLFL 4WHCA 1KENL 1ZKAA 2X9WA 3N1MC 4HV8A 3VGHA 3BPCA 3GJFH 5I9QB 3T77B 5DFTA 5ITBL 4TSAH 3EYOA 1IBGL 4PRHD 1U8HB 5HGBA 2ITCA 1WITA 5I8OH 3LIZH 4NGHH 4JRXE 4JY6B 4Y2DA 1OGAD 4L4TA 5CZVH 2I5YH 1QKZL 5IB4A 1OSZA 1TZHB 4M62L 1IKNA 4WJ5B 2IH3B 1A6PA 4WUUB 4CAGA 2VDNH 1OB1B 5A2FA 4LSRL 4KKAC 4G8IB 3QPQC 4WWKA 4D9LL 1NUFA 1MCSA 1MCHA 1S7RB 1ETZB 3TBSB 5CEYB 1T66C 3O6FC 3RY6C 3ESVF 4L8BA 3IFLL 5E2WL 1CFVH 3GMOA 3MV7D 4ODUB 1H3XA 1FYTA 3GNMH 4L4VE 3CFCH 2GTZB 3LRGA 4RAUA 4BQ8A 3G5ZA 4BM7A 2VDRH 2DI7A 1MWAH 5D1XD 1CE1H 3DV6B 2VXVH 1MIML 5EU3A 1SY6H 3BDYH 2ED8A 1MJ7L 4M93C 1PZUB 4GG6E 1BZ7B 1U8KA 4PJAF 2PYEB 1I1YA 4PTUB 1PKQA 2XQBH 4P2RA 3EFFB 1A4JA 5HYSA 2XNAA 3LQAL 3NFPB 2PW1B 4LHUA 1UXSA 1VPOL 2EDBA 2IANE 1NSNL 3DYMA 3SDCA 3GHBH 4GBXC 4AEIH 7FABL 1KCUL 3WIHL 4KK6D 1FV1B 5C3TA 5SWSB 2XN9A 1UXWB 3MV9B 4UINL 2RQ8A 3ZYIA 1LEIB 1WFNA 1S8DA 4XHQA 3K7UA 1CXFA 1CGSH 2K7QA 4OV6F 3HUJF 4GQ9L 2XN9E 1H3PH 3LRHA 1OP5K 3WO3B 5HGHB 1NBZA 4GKNA 4AIZA 1Z0NA 4POZD 4K3JL 5C6TH 1QSFE 4Y5XB 3C8KB 4OKVA 1CD1A 1B4JH 2MOVA 3ZT7A 4LLQB 3FTGA 5C0IB 5DLML 1FL5A 2AK1H 4GG6F 4DUXA 3NVQA 1FIGL 1CI5A 3PG2A 5DRXB 1JYVA 1I3VA 4GOSA 4GMTH 1WFOA 1I8IB 2X9XA 1HZHH 3OXRB 5KVDH 2F5AH 5GJSL 2OQJA 3V79C 2VDKH 3FZUD 5A3IC 3S37L 3MV7B 2DQCL 4ENEC 5H35B 1QR1B 3VRLF 1HHJA 4OZHB 5LAXB 3RIAF 5T3XD 1KYOJ 1UZ8A 2VIRB 2XG4A 3HB3D 1KLUA 4HS3B 1TETL 4YIQB 5AZ2H 2IWGA 3ELAT 3GSVA 3V6FA 4Y4KA 3UZVB 3FB8B 5DJAA 2W92A 4OLVL 3DUUA 1EO7A 1U93B 2JJVA 4HF5L 5F93C 1UZ6E 3O11B 5D72L 5CLWA 2CIIA 1MJJA 1TENA 2BNRE 2R2EB 4QXGL 4KVNL 3BYYA 2OMBA 3X13A 3LN4A 4YXKH 3VI4F 2JJSA 4OQTL 4KI5C 2ZZUT 3L6FB 1SVZA 4FFVC 4IMKC 5HYFA 2WMPA 5FYLE 1OQOA 1FL6B 4JPVL 3IETA 2CUMA 1QVOA 3FFCE 4E5XA 1G7IB 3MV9D 1GHFL 3BXNB 2MSPA 3UDWA 3BD3A 4HFWA 4I3RL 3TWCL 5F9JB 5CHNA 4P9HH 4WGVB 4OJFL 4OI8A 4EDWH 5DJAB 3KXFA 3OG6B 3IDGA 5L9DL 4UU9A 2P8MA 4U1JB 1BAFL 1EJOL 4I2XB 2ICWJ 1FSKB 1S9WB 2HFFB 2XT1B 2AV7B 2F58H 4NN6C 5ENWB 1IGMH 3X13B 2V5RA 3UJJH 1D6VH 4N0RA 5IVNA 1SMOA 4NBXB 4Y5YC 5ITFA 2VR5A 2YPKA 4XX1G 1KJVA 1JI1A 5E56A 1T04B 2MNUA 4KK8D 5GGUA 4GSDH 5J3HD 3KYOA 2EC8A 4EVNB 1YEJH 3H6JA 4L8DA 4S1QL 2IH1B 3VWJC 5ADPH 3QI9C 2IAND 4GXVH 4RFEA 2P1YA 1K4DA 1BGXH 4X7SL 4MS8C 1DL7H 1RFDL 2MQCA 4MA8L 3O6FB 3MBEC 4U1GB 5L2KA 3F7PC 3D9AH 3ARDC 3QRGL 2CJUH 1MUJB 1DBMH 1FH5L 4YNYB 3DRTB 2A73B 4ZSOB 4QRPB 3U30B 2WLZA 1I9JL 5GRUL 3T3ME 3FO1B 4QWWD 5GGSB 1G7QB 1VKXA 3D1MC 1U8PA 35C8H 3EJJX 3PGDB 1QPPA 1ZWIA 2ARJB 4JM4H 2ATKA 2VXSL 4XI5D 1CR9L 1MOEA 2VR4A 3V95A 1Y0LB 1BBJB 2Z93A 3QYCA 5IBLD 3RWIA 4HIIA 2FJHB 1FIEA 4MA7H 2A9NL 2XA3A 5DJ2B 4K3GA 4P46A 4Y1AB 2RCSH 1JGVH 4WUUA 2XKNB 3C09C 4L8SC 1IFHH 1A22B 4JFQA 2CLRB 4RX4A 5IMOB 1DBBL 1HH9B 1T80A 2WUBL 4LAQH 3TCXA 4WU7A 3ZTNH 2P5WD 3LKNA 1M7DA 4Y16B 4EZMA 1T5WA 3HZYB 3O3EB 4NCDA 5F9OH 3UO1H 2I9TA 4ZUUB 4F9LC 2E9JA 4CVUA 1LE9B 1LP9A 2Q8BH 4EN3D 3VXUE 5DJZA 4JCLA 4TSBL 4DGIH 2ITDB 4IRSC 3CFIC 1AC0A 5E2UL 5FEBA 4PRBB 4Y1AA 1QFWH 3IU3B 5ECJE 4FXGA 3MO1B 1BPVA 1UKSA 3I6GB 4NO0D 1FZJB 3FB5A 2XZAH 1T0NA 1JNNL 3LQZB 4LOUD 3GGWB 2AJZA 4OFIA 5DQDH 2IBGA 4CN1A 4JDZB 1OCWH 4X7DC 1B2WH 3DO7A 1IM3B 2Q86B 2IAMD 3E2HC 2R4RL 1Q9OA 2DQUL 4Z76B 4JY4A 7CGTA 2FYYB 2AJVH 2QADC 1U95A 1UJ3B 3G08B 2OL3L 2H26B 2ITCB 3IXAB 4HXBH 2H32B 2QTEA 4ELMA 4Y2DB 3I02A 1MFBH 3KPTA 3LKRB 4QHKI 4L1DA 4FZEH 4NCC1 2E7LE 4D2NA 4E41D 4WJ5A 1RZ7H 3RVXC 2BHYA 1MHEB 3GMQB 4ZG1A 4LLDB 4LCYB 2Q87A 4YPJA 3OKEB 5JIKA 1XGYL 4BSWA 3V52L 1C1EL 1G6RA 3BWAA 1DBJH 3X3FH 4ZPTA 1AO7D 2EDEA 3VXUD 2EDHA 3F7VB 1FYTD 2ICEA 1QLEL 1MLCA 5L88L 4Z95H 3QZWG 1NMAL 3RWEB 2EC9T 3BN9C 3P0VH 4LEOA 1XZ0B 4JO4H 1JWMB 4NKDA 2I60H 4MYWB 2W0PA 5DJXA 4OLUL 3QEQA 4Y4FD 5C0JA 3G5XA 3PNWA 4KMTH 3U36A 2Z4QB 2IBZY 5C0AB 5DTFA 5B38A 1RUMH 4IMLB 2F15A 3HFMH 5B4MC 1E4XH 3QB7C 4NUGL 5FYLL 4LHUD 1K85A 5F7EL 2BRRL 4AEFA 3C60D 4N0CC 1DVFA 1QEWB 3TIDB 5I9QC 4DVRL 4NKOB 4XXDB 1QTYT 5KSUA 5DHVA 4XVSL 3BVNB 4X6CB 5LGKA 5DGQA 2GJZB 3PIQA 4YEEA 1ZANH 1T1XB 4KDTA 1A7PL 4MX7A 1F11B 4APQD 4FQLH 5MHSE 2A6JB 3TYFB 3WMSA 4HIXL 4N0YH 1S8DB 5DQJA 1X4XA 3RL2B 2ESVA 1T7XA 4WW2F 4M6OL 1CD8A 2CO6B 4JO2H 3N1QC 3TT1H 1MY5A 1SBSH 4HUUA 5KSAB 3AB0B 2PW2A 1FZKB 2CK0L 3PGFH 1OAYH 4Q7DA 3VFUB 5DD6B 3VGGA 3RA7L 2FGWL 2CDGB 2HRPL 1J11A 3GI9L 1JWSB 5KW9H 2EDJA 1T1ZA 1CDUA 2FWOA 1U8QB 4NQEA 4PY7B 5ESVB 2V2TA 1CN4A 1I7TA 2PR4L 4FQ2H 2BSED 2KQMA 4GAGL 4H1LH 4KRLB 4NN6B 3D39D 4IOSD 3T3MF 5GS1A 3N1GC 5DJ0B 2AAVA 5GHWH 2VE6A 4E41E 3VXUB 3L5JA 1LVEA 2ESVB 1MPAL 1KJVB 3SDDD 2JE8A 3PWVB 1AY1H 5I1AB 4MCYB 3C9NB 4C59B 1KT2A 4G6AD 3VD7A 3FO9A 4NKMB 4IRJA 2C5DC 3TJHA 2OSLA 4ENED 4S0TD 1WEJH 4WI4A 4JRXA 2X1XR 4ZPVB 4OZGA 3FFCD 4JCMA 4PJAE 5IESL 2ZSWA 1L6ZA 1U2HA 2YEZB 5D7SH 3QXTA 5I1JH 5GRJL 5IB5A 1JBJA 5SWSA 2UWEB 2UVEA 2B1HL 4TRPH 1HQ4B 3DYOA 3JV5A 1HH6B 3UTSE 1YNLL 4L5FH 1ADQL 4P5TD 4JFDE 3KLHD 1INQB 1R5VA 1ED3B 3B8SA 1LWRA 3DVIA 1GIGL 5HDQH 5F89A 3KXFD 2C1OB 5D1QD 3I9GL 3WD5H 1MAKA 5MEPA 1K8IA 2BNQE 3MLVH 1HN1A 3QDHA 4OFVA 4P46B 5D1ZD 2AK4B 3V4PH 3IDGB 3ALWA 4F7MB 1S9XA 4ZSOE 5E8PA 1HYRC 4XXCC 3HI6L 5MI0C 4LRNL 3FONB 4QGYA 3MOAL 4ISVB 3AM8C 4GW1A 1IC4H 3NCMA 2AEPL 4JE4B 2JB5L 4NNXA 4U2ZA 3OKKB 4X6DF 1CGWA 2OJZL 2DL9A 3TBVB 4L3CA 4HCRA 4KI5E 4PJFA 4K7PL 5TF1H 3H42H 4M6NL 5GS0D 4AT6B 2WANA 3H2WA 2CLZB 2BX5A 1INDL 5SX4I 2X41A 2XFXB 2YA2A 4EDXB 5J1TC 3ULVH 3T65B 4JM2C 3NA9H 3DSNA 3LH2H 3SDXF 3VWJD 5I1CL 3VD9A 4O2CA 5J6HA 4IS6B 4ZYKA 1KN4L 4NQDE 1FBIH 2AQ1A 5ESQA 1S9YA 4P49A 2WWMD 3HI1A 2E9IA 1JJUA 5KS9F 4TUOA 3MV8A 1NBYA 3RY4A 1EEUA 1KV3A 4M7LT 5CUSH 3AS3A 1J86A 3UJTH 4IMKA 1AXSA 4X4ME 4UNTA 2PXYB 4XPAL 1RD6A 3I6KB 2HN7B 1S7VA 1Y18A 5E94A 5JW4R 4P5MA 1RAMA 4TVPH 4PYHA 2OYPA 1ZLWK 3HUJE 1AR2A 2NZIA 2UY6A 3G6JE 1WSST 4WUUD 3CXDL 3QDME 4EI5B 4W4OA 1NBVH 4BZYA 1ITCA 3TVMC 3M07A 3CUPA 3H9SA 4KWUA 1V3JA 4KTEL 3OG4B 4O51A 3OKMB 1DQDL 4UBDC 1NCCL 1E4KC 3LKPB 1RZFH 4KVCH 1P7KB 3TZVD 5I1HH 4FTVE 1U36A 3T0VA 4LFHD 3VGAB 4ZUSA 4YR6B 3WS3A 5ISZE 5A2LH 3FQRB 4ZFGH 2WWKT 5IVZB 5BO1H 4NUJB 4P2QE 4U1KB 1YJDL 5GGVL 1ZXQA 1OAQL 3RPKA 3WSQH 2JELL 5JW5B 3RUGB 4EN3A 4KMLB 3U9UA 1YYMH 1UA6L 1FG2A 5HVWA 4NQDD 1CU4L 2X1OA 2NY3C 3FRPA 2JCCB 5CD3A 1LK2A 5C0DB 1GZPB 1XGTB 5IB4B 5DGRA 4NIKB 1IGFH 3GFUA 4BFGA 4ZAKD 4W68A 3N0PB 3U30C 1YEEL 3KYKL 1I1AD 5IQ9A 3PWNA 4HKJB 3QWOB 4X7EC 2I25N 4TYUA 1BVKB 4HCRH 3R06A 4FFYL 4F57H 3S96B 3ARBB 4Y8AA 4H20L 3KPSA 3DRQA 2XPGA 4HV8B 5EZLB 1QBLH 5HVHC 5C0CE 4WW2B 3BPNC 3QDJA 2VLRE 3TFKA 3WFBL 3ZL4L 4V1DD 1H3UA 5HGBB 2KH2B 3NIFF 3PWJB 1QA9A 2DM3A 4F3FB 1CDYA 3PL6A 4JAMB 2NY2D 1H15A 2FGZA 2FSEA 4P2QD 5IHZA 2AK4E 2NY0B 2VB5A 3WIHA 2VXUH 5CJXA 4PY8I 5SWZA 2AW2A 3S35X 4FTVB 4G7YH 4NO3B 3ZSSA 4LIQL 5TE6H 3RU8L 5KVGL 5TPWH 3GSXA 1FDLL 15C8H 2EH8H 4PB9L 3TC9A 3WV0A 1JGUH 4YFDB 5I74C 4YDJA 3NACH 2AABH 1LDPH 4I4WB 3O6KH 4QXUL 3QEUB 1ULVA 1UH2A 3K4DA 1FAKT 1TJGL 3CMGA 3HPJA 4O4YL 2JJWA 3AREB 4JQIL 1UWXH 4UNVA 2R4SL 3ZYJA 1KEMH 1KOAA 5I30L 3L3IA 4MJ6A 1Q8MA 5DRNA 1J8HB 2Y9RT 4KHXL 3CFJB 5GGVY 1B0RA 2V9TA 3TPUA 2E6JA 4U3CA 5SWQA 4N0UE 1CBVL 2VISB 3C60A 4LSTH 4PRBA 4XP6H 2EZ0C 4OGYL 5CBAA 4RNRB 1B88A 4YHIA 3T4AB 2PCPB 4M48L 1PKQB 4S1SH 1DBAH 4K94L 3GGWA 2P47B 5M94B 1ZLUH 1FSKC 4OCWH 3KR3H 5D7LA 1X4ZA 4LCUB 4N1HB 1RIVL 4HWEH 4PJIA 3UPAA 4HX1A 2Q8AL 2Q7YA 4PJGB 4FFZH 3RWFB 4Q0XL 4XWGL 4D8PA 3VXPA 1RUQL 3O4LB 1QLFB 3I2CH 2NPLX 5IGXL 4A6YL 2WQ8A 1PBYA 3PE9A 1XGUB 4PRNB 3BKML 1L4IA 2VZTA 3LEYH 1QLRA 4HLZH 1QRND 5IIEB 4XP1H 5JPMB 1T2JA 2Y7QA 4L8DB 3WCYA 1ZV5A 4U0QB 5FV1L 3O4OB 4KI1A 1WQVT 2DD8H 2WZPD 3SE9L 2YRLA 5KS9E 1WC7B 4PJAB 3SDXB 3FQNB 4S1DC 4NWUH 4K07A 3O45B 2VOTA 4HD9A 4HXAH 4MJ2A 1QACA 4JPWL 4ZAKA 5IW1A 2A38A 5JXEA 3ULUD 1S9XB 2YD8A 3IJHA 1D9KA 4NKDB 4X7FC 3GBLA 1HXYB 3P40A 3PJSB 1DE4B 2H2PC 3RQ3A 4QRUA 4RBPK 3VFNA 2HG5B 5CZKA 4L3EB 2OZ4L 1AIFB 5IW6A 4GAJL 1CZ8H 5E1AB 4C54A 1D5IL 3IDIA 4NO2B 4LP5A 2VLJB 5GRYA 4PREB 5JNYB 3P0GB 5J12B 4L9LB 3ROOA 5FM4A 3WFEH 4XI5C 3W11D 2IANB 3MJ6A 1KELH 5SWZD 5EU6D 1H5BA 1FQ9C 3QUMH 4MXVF 1CGXA 2UYLA 4XPGL 3BZ4B 3S36L 1VGKB 1UJTA 3TYGL 1AI1L 1ORSB 5EUOB 2L0DA 4QXTB 1ZHKA 3CLEL 3E8UL 4FA8A 5DHVH 4N8VB 4WI7A 5DF0A 1KGCD 1T04A 5JMOC 5IBTL 2F19H 3KJ6H 4HMDA 4AZ8A 4NJAH 4XP9H 3MMEB 4OFYD 1C16A 4PRDB 5DWUH 1ZA3A 1M05A 3NABL 4H1LB 3FHAA 4NCC2 3E6HB 2IGFH 2B2XL 5E24E 1W72B 5LCVL 4KKAD 3W81A 4PJDA 5GS3A 2BNUA 4LLYB 1BHGA 1M4KA 4XGZB 3MRLB 4FQIL 4UU9B 5EULV 5H37H 3VWKD 3QUYB 2V2WB 3ARVA 4FQXB 3VXSB 1XAUA 5CMAB 3QUXB 1A6AA 3SDAB 4QHMA 1JF6A 3VXNB 1JPFB 2X4OB 1AO7A 1R5IB 4OFPA 4HWBL 3HRPA 4JHAH 5I1LA 1IM3A 2GTWA 1F00I 1IGJA 1YPZB 2CIKA 4S1RL 4JB9L 1KTLB 4N8VA 4DOHB 4NN7C 4A2MA 1JF5A 1MVFA 3RZCB 2OTPA 1F4XL 1FJ1B 5FA3B 1CLCA 1P5VA 4ELKB 1BEYL 2X9YA 3QIWA 4NHCH 3C8HA 1RJZB 5AG8A 4N5ED 3TJEH 4OZFH 5JW4N 1MCBA 3ZT5A 1XCQB 1OAZL 4UIKL 4O2FB 4LVNC 4OCLC 1OTSC 2ESVE 4GRLC 1BVLA 2F8OA 4I5BB 2Q1EA 3P9WB 5MERB 4YBHA 1HNFA 1ZLSL 3NFNB 5IFHL 2E8YA 2AJXH 5DZOA 3OKOA 5HBBA 2D7TL 1IRAY 1P84K 3RX8A 1LO0L 4OTXL 5BOPA 1HQ4A 5IMOA 3OHXA 1PLGL 1MCLA 2XZQL 4WHTA 3WFCL 5L7XH 3ARGD 1U8PB 1INEH 1WZKA 3EOBA 3LEVL 1MELA 3RDTC 4YQXL 4KDTC 5GGTL 5JPNB 1X5IA 4POZC 3V0VB 4OLYH 3V2AR 1YEDA 1I9RH 3IFNL 4LOUC 3FOMB 4OCRH 1XGQA 1JK8B 4NO5A 5IW3A 1BZQK 4K2UH 4IMLA 4PJ7A 3P11H 2NR6D 2VDMH 2MQ0A 2ZUQC 3DHMA 3H7BA 1Q72L 1PSKL 2HJKB 2WY3A 3TV3H 3HNSH 1MWAB 4PJ5D 3T0ED 2JKXA 4J3WA 4K23L 2QHRH 5CEYA 1JNHA 3TBYA 5ACLA 4U1KA 5IMMB 3LKNB 3L1OL 3RTQA 3TP4A 4M3JA 3KXFE 2BVTA 2VLKD 3OKNB 4U1HA 3ZDYF 4ACPA 3V4UL 5CFHA 4ZTPL 5JPNA 5EOCL 4FABL 4RIRB 5JA9A 2EDOA 2HH0H 4XMLH 5K9OB 2ZPKL 1LEKA 4QGTA 3OB8A 5L8KB 2ED7A 3BFOA 5CJOH 2A6IB 3C60B 1BM3L 2OBGA 4MZ3A 4OZFG 5FYKH 2EDQA 3BWUC 2M8XA 3RWJB 5J11B 1EEYB 3QAZC 4X0KA 2L7UA 4E41B 2NLJB 2H8PA 3VFTB 5GRXG 3DUHA 5EFIB 3VI4E 2CLRA 5LGJB 4TN9A 3KPSB 3LKQB 4NQEB 4APQB 1T22B 4JREB 1CE6B 1XCTA 3TNMB 1JIBA 3MACH 4KHTH 3QUZC 1XMWA 5E8NB 3PWPA 4Q9RH 2ZKHH 3LHPH 1IM9B 2CKNA 2EDWA 4OI9A 5IEKB 4OLWL 1BD2A 3GZKA 3A67H 5FKPA 4L4TE 3VFPB 1J10A 2DMCA 1YMME 3LSOA 5DS8B 5LWYL 1KNOA 4JFXA 4RMQA 1QHOA 3QFJD 3SJVB 1JNLH 2IMNA 2F53D 3DVFA 5H2BB 1G7JA 2OI9B 4M7KH 2X4PA 3UTPE 3BAEL 5DRWA 2B4CH 3EGSA 3L5IA 4YHPA 1FN4B 2G9HA 2UZIH 5DDHB 3E6FA 4QRQB 3TA3A 3PP4H 4LHUB 3RGVC 1UQSA 3MGAA 3IYLW 1FO0H 4D3CL 3P4OA 5JHLL 3PWUB 5FIEA 4H88H 2VRAA 2MJWA 1KCSL 1UJ3C 2OLDA 5BRZB 1UFUA 1WICA 2CR6A 5DEFA 1GXEA 5JOPE 4WFHE 1HH6A 2DYPB 3ULVF 3I02B 2CRYA 1J5OL 1OAKL 2VAAB 4Z7UE 1QFHA 2VSCA 4ONOA 5T1KB 3SQBA 2R0ZH 4G59A 2BDNH 4YHZH 3GMQA 3V5KB 4AMKL 4M00A 4U7SA 1J12A 2LU4A 5IQ9B 1N0XH 4Q97A 2OR7A 2DWDA 1DBKH 2ICEB 3M8OL 1C8PA 4JHWL 2R9HD 1P4IH 2DLFH 2XQYK 1SEQL 3O6MH 1AP2A 3WIIH 4MNGB 4OAWA 5EUKB 1IBGH 3D39B 3NOIA 3T2PA 3SY0B 3I3DA 1NCWH 4YK4C 5I8OL 4O02H 1N26A 1T20B 1RHHA 4OV5B 3LIZL 4NGHL 5JHDB 3JUYA 1WIUA 2V17L 1NQBA 5CIPB 1B3JA 2JK5A 3U4BH 4M62H 5IEHB 1EZVY 2VDNL 5GS0C 5JXED 1OGAA 3L3OA 2DLEA 5J1AA 1PG7L 3SDXA 3H9SD 5SX4H 3ARPA 3AXLB 1XEDA 5ICXB 4NQCD 3U0PB 4S1DD 2VTFA 4NFBA 2UWEA 1H9VA 2ADGB 1MRFL 3RPIB 1MFDH 2GIYA 5EU4B 4QRRA 1RVFH 4P4KB 4WW1A 2QKIB 1JL8A 1M71B 5FB8B 1PD6A 3OWEA 1OW0C 2C4FU 4GMSH 4QCIB 4QRRE 1R5WA 3G9AB 4BFBD 4WI5A 1MIMH 2ZUWA 1SY6L 3BDYL 3OZ9L 1MJ7H 5IEHA 1PQZA 3W9EB 1RIHH 1AGFA 2N1KA 4NQXA 1UH3A 4XRCA 5EH1A 4O5LH 3MGTB 4P9ML 4XHJC 3AGVA 3RRQA 4PJ9B 2BXYA 1VERA 2IQ9L 5E4IA 3THML 5IJKC 2Q20A 4TNVK 4NM4L 4JPIB 5A2JH 4NRYB 2Y5EA 3DVNB 3O4LA 1QP1A 4P2RD 3QWRD 3U0WL 4IOFC 3SPVB 4WFED 1X5FA 1A1NA 5FO8A 4UDUA 1K4CB 1MJUL 2DM4A 3K8KA 1FL6A 1JPST 3O0RH 5C1MB 3G04B 3SCMB 1RU9L 2Z0BA 4YDKH 2P48B 1WBZA 1G1CA 1RPQA 3DO3A 3GSRA 3ARWA 2FL5A 1BBDH 5B3JE 3FN3A 4KROD 1AGCA 3ARSA 2WWMC 1KUMA 3RWDB 3FHQA 4JN2B 1AQDA 2G75B 3EDDA 5E5MA 3TBWB 4E0RB 2Z9TA 4PJDF 5EA0L 4W4OC 5DYOA 3UYRH 4TUOB 1NJ9B 2AK1L 4Z7QF 4MHHG 3U83A 4OCNC 2HP4A 4X8JA 5IB5B 1FL3B 1FNSL 1AO7B 5A43C 4RRPG 1RIUL 3MRFA 3SKUD 4DTGH 4U1MA 5LG1A 5GGSY 1CDJA 5EBGA 3OXSB 3RTQB 2DDQL 4Y4HA 3HCVA 1MQKH 3VGFA 5DJ8A 2E7MA 2F5AL 1TVHA 1CDCA 3MNWA 4KQ3H 4XCFH 3RIFF 3C6LC 3I3BA 2BSSB 4OF0A 4PLJD 4ZXBB 3RX7A 3MUGB 3C60C 4NQDB 2VLLB 3V9FA 2VKXA 1A3QA 3BEVA 5ID0A 5HYJB 1J0JA 3G5VB 3SGKA 3VXRA 4JZNA 3IJYA 2Z31D 3A6BH 1FFQA 5D7IF 1UM6L 3DX8B 3IRZA 5A2IH 5F97E 3IFOB 3MRFB 3ZE2E 2P5ED 4APQC 5EZIH 4QXGH 4JFYA 3I84A 3WUWB 4HBCL 4Y4HB 2P49B 2IPTL 1G7QA 1DUZA 4Y89A 4YXKL 3ARFD 3MRHB 4OQTH 4Q2ZA 5KVMC 4MMZC 4QKXB 1BQHB 4ZUUA 3ZZ1A 3PHQB 3BKCL 4H25B 5IJKA 3MZTA 3SDCC 1ND0B 1MAMH 2OJEA 5I19H 3KPMB 1HI6B 3B9KA 2OR9L 1PX4A 2H2SD 3PV6B 1EVUA 4KDVA 5BQ7B 1BOGB 4GRWH 4QHKJ 3TWCH 3QXDA 2VLKE 4NN5B 1BZ7A 1U8KB 5E9DD 1GGCL 1BVKA 4GJTB 3QHZL 4H26B 5AD0A 5GIRA 3EO9H 1WZ1L 2F58L 2LTQB 1DUYB 1JUFA 1Z3GH 3GSNL 3QDJB 1QO3B 4J3SA 4QTIL 5JZ7D 1BD2E 3W9DA 3SDDC 4M43H 3T0EC 1NAKL 1NGWA 4XMPH 3QHTC 5JOFB 3DROB 4ELMB 2JCCA 4PV8A 3JTSB 5C09E 5I2IB 3EO1A 2FH6A 4G6AC 3H9SE 3IAQA 4GRLA 4HSQA 2H9GA 2OXGA 4L4TB 1L0QA 1XGPA 3G5XB 3U36B 1DL7L 1BQUA 3IU3A 3RVVC 3QG6B 5J9PB 4FTVA 2DJUA 4P2OD 3VU2A 2WW8A 2PTTA 1V7ML 2VZOA 3O8XD 1NGQH 5DT1L 1G7LB 1DBML 1AD9A 3D2UD 1TTUA 3UTTD 1IM9A 1C08B 3ECBA 4ZODA 3TIEA 1ZSDB 1DFBH 4FXKA 4LU5L 4WW2C 4RGNB 4N90E 2X7LA 3EO1B 5I16A 4JM4L 3U82B 2VXSH 4TNWF 4Y4HD 3GJFB 1I85C 2E6QA 3QXUA 4CDHA 3DXAE 3MLUH 3TH4T 1FZKA 3OAUL 1T0MA 3IDIB 2DB8A 3OKEA 3D18A 4HKJA 1QFWI 2VIRA 3QCTL 4LKCB 5IB1B 3MLXH 5E7BA 3DMMD 1UB6B 3LS5L 3QEGH 1G6RL 2V7NA 5JUEL 4EI5C 5ACZB 1AGEB 2D9QB 3I6LE 4LF3A 1EUUA 3EHBC 1D5MA 2A83B 1DR9A 1CLYL 3ZTNL 5DJ6B 5DQJB 1T7ZA 2RFXB 5DK0A 4ODXA 5F9OL 5DJXB 3D6GA 4UILL 1HKFA 4DVBB 1G7MA 1TCMA 2Q8BL 1EAJA 1AJ7H 2ZJSL 3KJ4C 2OTWB 1PYWA 3H8NA 1ZLUK 3S88H 3NCCB 1A7OL 4DCQB 3ARQA 5EN2B 3L7FB 1QFWL 5HYSG 2EE6A 5MENA 4N5EA 3E6HA 1PQZB 3GSVB 2NLJA 3VFTA 4DAGH 1N59B 1S5IH 1KCLA 3DUUB 3N9GH 3RJQB 4ZNEA 5HHMA 5SWSD 4HH8A 3LRSB 2GK2A 4MD4A 4PJXE 4MJID 3R0MA 1MJJB 2R2EA 3KPPA 3UZQA 1T5XB 1UM5L 4KRPC 1UWXK 3B2UC 5TQ0H 2R9HC 2OL3H 4Z9KB 1RK0B 4MCYA 1ZGLA 1HQRB 5T1LA 3SGDI 2FB4H 4Z5RB 1UACL 1UCTA 3UTTB 1FNAA 1INQA 1CS6A 1JRHL 1R5VB 3CLFL 3DVGA 4WU5B 4F15B 1P9MC 4IRJB 1DEEA 3QCVH 3W11C 4V3DB 4OZHA 5D9SA 5LAXA 5FHAL 3O81A 1QFOA 1RZ7L 1DLFH 4X6FA 2M1KA 5D7LB 3NZHH 2ZCKL 1XGYH 5HYEA 5EUOF 3DBXA 4NQCA 1BF8A 1DBJL 2FR4A 1DQQA 1GH7A 1S9WA 3NPZB 4G7VH 4Y19E 4YEFA 4KKNA 3QJHA 2J6EL 3O41B 3FO0L 4JJ5B 1YMMA 1KC5L 4AK1A 3ORJA 3ES6B 4XNMB 1TJIH 4B7IA 1NEUA 5EO9A 1BJ8A 5DO2C 3QULA 4DW2H 4PJ5E 3T0EE 3BKJL 4QOKE 4WI9A 2J8HA 3CFEA 2EIZB 4MAYA 3VWJA 1K4DB 4XVUC 2R0WL 3V0VA 4KU1A 2BHUA 3RDTD 3HFML 1E4XL 4NUGH 5FYLH 1S7UA 1QBMH 3MRLA 3DGGA 2D4DA 2CPCA 4XWOD 1D5BA 5DSCB 1NANI 1AE6H 1M7IB 3FONA 1G1YA 1FAIL 4XVSH 4C55A 5C08B 4MDIA 5DEGA 3ALPA 1ZANL 3F12B 5CINH 5CJQH 2YS4A 3B9KC 3SDAD 5I73C 5MEQB 5DD0L 4LCCC 4OUUB 5KVEH 3MRCB 3T77A 5D2NB 4N0YL 3V0AC 5C0AD 1IAII 1FE8H 5IVXB 4G5ZH 5KSAD 4P5MB 5FF6A 3T3PF 4JO2L 1LE5A 4PRDA 3TT1L 5F6IC 1SBSL 1X7QB 3ARGB 3EYSL 1WCBB 4M7LH 2FL5B 3RZWA 3UAJC 1KIUA 2CK0H 3TZVA 4X7TB 2VDQL 4EUPB 5H37G 3QFJA 4PJ5B 3T0EB 4PJEF 3M1BB 1RZ8A 5JHDE 3FB5B 4PJCF 3O3AA 4TOYH 4MNQE 3TO4B 2HTLD 3RZCC 4FQ2L 5MEOB 4GAGH 1NC2B 3GI8H 3HZMA 1AGDA 5HHMD 2HJLB 1CFSA 4YFLF 4L3CB 3EUUA 2P8LA 1UH4A 3H0TB 1MPAH 3KPRA 4AT6A 2J6EA 3O6FD 1NGZA 1M05B 2QL1A 4X7TA 1PX3A 2J12B 4R4ND 4RMTA 4Q9QL 5INCA 2FO4A 3SE8H 2ATPA 4PJEB 4RGOH 5D2NE 2RHEA 3KPSD 2X4QB 2XKNA 1DANT 1PEZA 3RNKB 4MWFA 3MYJB 4S2SB 1IC5H 4GBXB 5BJTA 4LMQI 1FLRH 2YPLE 1U92B 4C57C 2GTWB 3DRQB 2XPGB 2E9WA 3A6CH 1IGTA 4TRPL 2DM7A 4I9WD 2JCCE 2GJ6D 4JY5L 3MR9B 4WVRA 3AVEA 3TIEB 2EDXA 4RAUB 4Y1AD 5D1QB 4CN6A 1NDGB 3QDMA 2CGRH 3OPZH 1MEXH 4YXLH 1CLOL 4DUWA 3WD5L 1JK8A 4NO5B 3WUZA 3P77A 4XCNB 3MLVL 3IF1A 1KULA 1AR1D 1NLDL 4BH7B 5EC1B 3TF7A 3V6ZB 5D6CB 3UDWC 4F37K 1YDPB 4PJHE 1YECH 3ULUC 5E95B 5IVZA 1IC7H 4LRNH 1I8LC 4F9PC 4HUKB 1UXSB 3MOAH 4HLZG 2AEPH 3PXHA 3WNNA 1N4XH 3FB6B 5E8NA 1RURH 1Q1JH 1C5CH 2XN9B 4KY1L 5FDWA 1RQ5A 4K7PH 4LBEA 3VRIA 2CSPA 2FSEB 5IHZB 4O58L 1YEKH 4RGNE 1YEDB 2HFEA 2JCCF 1KJ2B 1FC2D 4XT1C 2BVOB 1TLKA 3LH2L 4C56A 3KS0H 1S7SB 1HHJB 1HHKA 2XWJA 1I1YB 2K9UA 3V6ZA 2CDGA 5LGJA 4U0RC 1KN4H 5FGSA 4CVZB 1I1CA 3WUWA 4DEPC 1F90L 1A4KB 4D9QD 2LAGB 4JQVA 1QYGH 3MFFB 3UJTL 4U1HB 2NTSP 1A1MB 1Q0XL 3QEQD 1KCRL 1A02N 3HE7B 4JGJA 3PGCB 4TVPL 1HHGA 3OJDB 2QKIA 4P46C 3C9NA 3D87B 1KPVB 5MENE 2GJ6B 4LHUG 2B5IC 3K8LA 1E6OL 3CH1A 3CFBA 4L1HA 1IAOB 3X14A 3BPLC 3VWKC 3BI9X 2BVUA 2EKSB 5I1DB 4JFDA 4NKMA 2FEEI 4CL7A 1DQDH 2A9ML 2EXWD 1AGFB 2RBLA 4NQXB 3VFGH 1KTRL 2VLJE 3CDGA 5T1DL 4K9EH 4KKCD 1IGYB 3LKQA 2IPUG 1XR9B 3DBXB 4NQCB 2ZCLH 2XWBA 1T7WA 1X9QA 4PJXB 3QUYD 3ZHKA 3ZO0A 1R0AL 2DQFA 2Y07H 3ARFA 1N2RB 3B43A 1YJDH 3QEHB 5GGVH 1OAQH 3WSQL 1DQJA 4RMWA 2YR3A 3DUSA 4CUCA 3EO0B 3OXRA 1A3LH 1BFVH 1DQTA 2YUXA 3QIUD 1QLRB 4NC1C 1CU4H 3MRNA 3G6AB 2F54D 3FT2A 2VO5A 1OTSD 3G04A 4RNRA 3SCMA 5HHQB 4HIEA 3LN5B 5F89B 4CADA 5BW7C 2VMFA 2NX5B 2XTJC 3HC3L 4JRYE 4LDLB 5TJWK 1FN4A 1T4KA 4WO4A 5E2JA 2R0KL 5E5MB 4XPFH 1AD9B 2P43B 2AV1B 3MRKA 4XP5H 3U0TB 5HPOA 4AQ1B 1S7XA 4WWID 2W59A 3ZKNC 4OF6A 2YPVL 2FHCA 5D8JH 1TMCA 5BS0B 5KZCB 1DE4A 3PJSA 3OKKA 2ADIA 3LY6A 5KAQG 5GGSA 3MRCA 3IS1X 2Z92B 3P9LA 4RQQA 1QSEB 2IALA 5DURB 4PP2A 3B2UD 4FTVD 4QOKB 3QIBA 3NCYP 3JZ7A 4Y19D 4ZOAA 3EYFA 1MCCA 4LIQH 1IKFH 2Y5TB 3RU8H 1KXTB 5KVGH 3L3DA 4A6YB 5L2KB 3KLSA 2WP3O 5KSVA 5J6GB 4M1GH 3O11A 4AM0A 3M1BA 1P5UA 4IDJL 4XNZC 1OQXA 4OF5A 4JZNB 4U7KA 4LKXA 1T7YA 2AABL 4PJ9D 3MV8B 4QXUH 5JDJA 3GSWB 4JFQB 4PGBB 3BT2L 2X89D 4O4YH 4YC2C 2GYSA 4JQIH 2R4SH 3V5HB 1FGVL 5I30H 3BPNB 2DQDH 1HDMB 5D6DC 2BVPB 5HGDA 4Z0XB 4HUXB 3GMMA 3HG1B 2C3HA 3QIWB 4PTTA 2X4TA 3SGJA 5D1ZA 5E1AA 4LSQH 2GHWB 3OF6D 4Z78B 1NEZA 4A6YA 4PJEA 3NN8A 1S3KL 5BXFB 4CMMA 3BD4A 4HWEL 2FX9H 2J88L 3SDAA 4GUPB 3CZJA 5E8PB 4UUJB 4Q0XH 3QXWA 3DRTA 1RUQH 5L0QC 1CG9B 2EDLA 1SM3L 4UDUB 1TQCB 4HS6A 1HHIB 5IGXH 4Y2DC 4I0PA 4UIMB 4Z7VB 3BKMH 1TPXC 5JOFA 2C1PB 1IM9D 1OSPL 1RMFL 2IQAA 3S3JA 4YFEA 4GKSA 2ID5A 3FCTB 1OP3K 3QDMB 2C3VA 1PW3A 2MQ3A 4XNUL 3MGTA 5HJ3B 4PJGE 4D0DB 3FFDB 4LGSB 4I8DA 4AYFA 4XMKH 3H7LA 1C5DA 3SE9H 5GS1C 4BH7A 2YPLA 3C5JB 4NWUL 1CL7H 4KTDH 5CP7A 4C4KT 5T33L 1AHWC 3IXTB 3RL1A 4K3EL 3GUTA 4PJ7E 4JPWH 4KPHH 4HW6A 4Z0BL 3LMJH 3HRZB 3KG5A 2R29L 4LPXA 3WHXB 2HKHL 5DD5L 4ODHL 2YWYA 3C2AL 4JR9H 3NCEB 2IG2H 3KPNA 5KVFL 1BJ1J 3QIWC 4G8GD 1BQHA 2R69L 3QDGD 3G5ZB 2VLJD 1GOGA 5CD3B 5HGAA 4NP4L 1EFXD 3QZWB 4RGNC 1MHEA 1GC1C 3ZHLA 4JEGB 1MVUB 3HG1D 3DX8A 3WFEL 2D7OA 3DOSA 1KJMA 3QO0A 2GSIA 1KGCE 4X98B 1YMMD 2FJFA 4ZOEA 1KTDB 2JF1A 1OM3L 2GUOB 5FYJL 1M6OA 3K2MC 5DC0A 1XIWB 3HMXH 4YHYB 1JUFB 4XNYL 5EU6A 3TYGH 4Z76A 4YHML 4XBPB 3CLEH 3MRPB 3WL9B 1JFQH 3UC0L 4EI5D 3MV9A 4WWKC 5IBTH 4MD5A 2APFA 1QSZA 3KJ6L 3L95B 1WCBA 6CGTA 4XP9L 1F5WA 4X83A 1MCOL 3NABH 3VE0B 1G9NC 1XGRB 2B2XH 2DMKA 5FO9B 4ZFZB 3WNPA 3BPLB 1QBAA 5BVPL 3O3AB 43CAB 4WTZA 4JQXC 5DRWB 2DQIH 3DX9A 2CKBL 4KKBC 1AR1C 2NMSA 3Q5YA 4QYOB 1I1FA 2BSTA 3QEHA 1OT1A 2QQLH 4P23C 3PDDA 4Y4HC 4BSVA 2HTKD 3L5WA 3MRRA 4MQXD 4RISL 1A6ZB 3RL2A 3L3GA 4M8QB 2FO1A 3ARDD 1F4XH 3KLAA 3EYUH 4AENB 3LKRA 3PF2A 4U05A 1OP3H 1BEYH 1OP5H 4HHAB 2GAZB 3VD3A 2LE9A 1T3FB 2EDRA 3SJVA 1MRCL 3GB7A 1P4LA 3QUKB 5DXWA 3QQ3B 3TN0B 3BGMB 2ERJC 2EYRB 5CEZD 3BE1L 4OT1L 3QDGB 3MA9L 32C2B 4X4XA 2IMMA 3WFDL 5ADOH 1H0DA 5D96B 1ZLSH 3JVGC 3RDTA 5FDYA 2VJXA 3LDBC 4MB3A 5AYUL 3UTOA 3NH7L 2X4NA 5IHLB 4LCWB 2D7TH 4RFNC 4OTXH 4X6CA 5D71L 2EH7L 2B20A 5I1EH 1PDKA 1N7MH 3SGEH 3BW9B 4X8XA 5EBMA 4X7CC 4NSKB 1A6ZA 3LEVH 5IBUG 5BS0A 1Z6JT 5I15H 3D39A 4U6HA 1GOHA 5F8RC 3AMLA 3IDYC 5DR5L 3UBXB 4HKXB 5DA0B 2AP2A 1XF5B 3IFNH 2IPKB 3RVWC 5KSAA 2GKIA 2VZUA 4PJFE 3MLSH 3U7AA 1JTTA 4OCRL 3MPCA 4RX4D 2YUZA 4LNRB 3P11L 4Y88A 1I4FB 3L3DB 5M95B 4IRJD 4NZRH 1PSKH 5ESVA 5F72S 3NIFE 4P48A 2FEDC 4EN3C 4JRXD 2OP4L 2DQHL 1KENH 4IRSD 3V8OA 4BFIA 4HZAA 5EBMB 4HKBB 1C08A 4XWOC 3EOAB 4HJJL 4KXZI 1T20A 5EOCH 1VA9A 1R24B 2XYCA 4FABH 3S4SG 2R1XA 4J1UA 1KJ2A 2OTWA 5JW4Q 1L7TH 2HLFD 4F7TA 4P3CL 5CZVL 5B8CC 3SKMA 4QRTB 1QVOB 2P5EE 3HMWL 5E70A 5IBUB 2YXMA 5CWSB 4Z7WE 2QADD 4LSRH 1FFPB 3CVHA 5I6XC 1T4KB 4WO4B 3FKUS 1U3YA 4D9LH 1UVQA 4Z7UB 3GMRA 1MUJA 3T2NH 5GRWA 3U1SH 5FUOL 2BVQB 5B21A 1HSBA 1NUNB 4AJ0A 3QFDA 4GUPA 3RGHA 4CJ0A 2EECA 3P0YL 1EHXA 2RGSA 3IFLH 1CFVL 4W81A 1EVTC 5F1NB 4XNMA 4Q9RL 1MLBB 3LHPL 3MA7B 4HS6B 1KB5A 3CFCL 3DXAA 2VH5L 2BOCA 5HHPB 2QSCH 3ROLB 2JJTA 3A67L 4ZUTB 2VDRL 4WRLA 5IG7A 5GRZA 4EVNA 1IT9L 5FOBA 3VD4A 25C8H 4DQOH 3AY4C 4ODTL 3SE3A 4TNVF 4GKZB 3BN3B 2I27N 2ZP0T 5D4QA 5I66A 1S7UB 3DGGB 1IILE 2XQBL 2XWBB 2X70B 3WXVL 1JPSH 2UZIL 2IAMC 3FQXB 4K7PX 4HQQL 1UEYA 5F7DA 1YNKH 3VFWA 4M5YH 4MGXA 5JHLH 4F58H 2AJSL 1VPOH 4PJBA 5K33A 4ONGH 1KCUH 3WIHH 3V5HA 1E4XI 3F6IA 4N9GA 2HKFH 1WWWX 2PUQT 4DZBB 2Y4SA 4JJHA 2IAMB 4POUB 1J5OH 2D03H 5IP4A 3CFDB 1H3PL 5ESAB 4OIBA 4MDJB 2R0ZL 1BJ1H 4AEHH 2VLRD 5IQ7L 1Y0LA 2W0KA 3KVQA 1VFAB 4K3JH 4OLZL 5E2TL 3MV11 4WO4C 4J4PD 4WFGE 4ERSL 1TZGH 2WNGA 1NCNA 4ONFL 3UTZB 1QQDB 3Q1SH 4U0RB 1OB1A 2NY3D 2DWEA 3UXFA 2I07A 1EERB 5DLMH 2AJZB 3K46A 4PGCA 2OI9C 5AEAA 4PUBL 2NXYB 4E42B 3VXRE 5F96H 3ARRA 3BN9D 5JW4M 1CG9A 2VXQH 3T3PE 3NMEA 5FK9B 5JW5A 4UQ3B 4JG1L 4LPCA 1X44A 4GMTL 2HJLA 4J8RA 1O0VA 2FECI 1U3ZA 4LL9A 4GLRI 4M93B 1NPUA 5GJSH 4O02L 3B8YA 3VMPA 2FH8A 5LVEA 1GGBH 1TQBB 3QQ4B 2LU3A 4NRZB 3S37H 3VRIB 2DQCH 4M03A 3IVKB 1KB9J 4FNLL 3QNZA 2V17H 3MRJB 4JO3H 5IMLA 3SE4A 3VXSD 3H9YA 5E6IB 4JREC 4D0DA 3H9SB 3IKKA 3GHEL 3U4AA 2D7NA 4CDGC 1TETH 4JFED 5AZ2L 1NCBH 4LPUA 2VQ1A 3MFGB 3C5JA 4BA8A 4OLVH 3GDBA 4UB0L 4MZ2A 4TQEL 1WUNT 4YLQT 1MCIA 1YY8B 4MXVE 5GS0H 5B39B 3OGCB 3OKDB 4J6RL 5IKCB 1RJLB 4JZOB 3QEUA 2P8LB 4JY4B 4L29B 4YPGA 1F3JB 5H94B 3MR9A 2XY2A 2AJUH 2X44D 1ONQB 1LP9B 2X4UB 4P9HC 4OFKA 1G9MC 2DKUA 4YK4B 3OJDA 4RFNB 1U91A 1F6LL 1NEZB 2DQTH 2IH3A 3MO1A 2JIXA 4KZDH 5D7KE 3WJJC 3TN0A 3LKSA 4PJ5A 3T0EA 3LQZA 4P9MH 5FYLD 3VXRB 2PTVA 4EDWL 4K7FA 5EO1B 4OSUL 4X98A 4HPYH 1BAFH 1BFTA 4MJ5A 4Q9BA 2LV4A 5HYQB 2PETA 3U2SA 5DMYA 2VITB 1MLCB 3GKWL 3HI5H 5EU5A 5CSZB 1D6VL 3LQAC 1K9TA 3FB6A 1WWCA 2XWTB 2CRIA 3PWJA 3PUCA 3CFJA 4N8CL 4J3XA 3KYMA 3VMOA 1YEJL 1RU9H 4PRNA 5D5MB 1D6EB 2YK1L 5ADPL 2A6IA 4HJGA 2ATPB 4IM8A 2X09A 1C5DB 2X1PA 2QSTA 3EGSB 3SQOH 1FNHA 4PB0L 4X6CF 4LLQA 5E8EB 2B39A 3QRGH 1WBXB 4U1NA 2IFFH 2WBJA 4LCWE 3SDYH 1JYWA 2BHZA 1DP0A 2BNRB 3HE6B 5GJTH 4IJ3B 2BK8A 4JM2D 4KGLA 5SV4A 3QFJE 2AS5M 1F4WH 2VLME 1HWHB 1RZJL 4OAWB 3JV6A 3L3GB 1H15B 1YN6B 1WWAX 3KYAA 2OMNA 3QEQB 1B0RB 3E0GA 3OB0H 5HPMB 4ZOBA 4LLWA 3ZKND 3P3YA 3D85D 1HSAB 2A9NH 1ZA6B 5D1ZC 5F8QC 4NQED 5B39G 2Z31B 1QRNA 3K0WA 4X99A 1JGVL 5ETUA 4X6BB 1ZT4A 3JV0A 4G8FA 1JHTA 3A6BL 3E6FB 4QRQA 1UM6H 3TA3B 4I2XA 2XG5A 4JDVA 4PJDE 1AXTH 3KDMA 3TESA 1EXUB 2WUBH 3SO3C 5F6HI 3TVMD 4JFFA 3GO1H 4KFZC 4A2LA 4WUKL 4CU7A 1HK6A 3IDXL 5K9JL 1A7RL 2CDFA 3TA3C 2F53B 5EU4A 4NNYB 1NCDL 4I1NB 5F88B 4JFZL 1YUHA 2NY5C 5HI3D 1MAML 2XTJD 5I19L 2NW2B 4EJ1C 4TSBH 4DGIL 1MIEH 2P8PB 1NLBH 5E2UH 4PRIA 3U6RA 1ZA3B 3JTTB 4H1LA 3D18B 2FX8H 5GSRB 1G9MH 2NY4D 2W0FA 3RVWD 1I7TB 4R8WL 3FQNA 5F1IB 3Q3GA 2FATL 1WWBX 4BH8B 5DQDL 3X17A 2AEIT 1WZ1H 2DYPD 3U0TA 3GSNH 3LN4B 1FNGA 4KJWC 4YZFE 4ZAKC 4M43L 3KLAB 3UTPD 5T1LB 4XNQB 1HHGB 5FB8A 4HHAA 3IDUA 4WV1A 4JFEE 5JPMA 3X12A 1MFBL 4X80L 1A3RL 3LEXB 2Y36H 1IC1A 4MA1B 5FHBH 1E6JL 4F7CA 2VLJA 3L3JA 3HA0A 1I8KA 3VXQA 1U8LA 4BYHA 2HLFC 3MLTA 1Q9WA 1AQDB 3V52H 1J1PL 1W0WB 1X6NA 1GOFA 4FN0A 3QDJD 5LQBH 2AXFB 2XTJE 1FRGL 1GGUA 5ESQB 4PJXA 1NEZG 4YHOL 5ERWA 3Q5OA 3ULSB 5DT1H 5B8CA 1OP9A 3MYZA 3WXWH 4QRRD 5J56B 5C8JB 2PF6A 4Z95L 2WUCH 3ARDA 4R26H 1DCLA 1YNTB 3BIBX 2O5XL 1H8SA 2LU7A 4G8EB 3MLWH 1KCGC 3UTSA 4D9QE 2PYFB 2ATKB 4MJ4A 4ZUVB 4KMTL 5TGBB 5CLTA 3O8XB 4EDXA 3ET9F 4UDTB 3MLUL 1JGLH 2CO7B 3CJJA 5FCUH 5L2KE 2HA1A 1E4JA 3OAUH 1DQMH 3BSZL 3QIWD 4NT6B 2E7BA 5FGCB 2P45B 2BRRH 5HVFB 2V2WA 4YHKH 4FOMA 3EYQD 5D2LE 1G6RH 1S9YB 4NBZB 4NDMB 4NZDA 4XAKD 1KJMB 2VL5B 4JZJC 1LK3L 4RGND 5EUOA 4JLRA 4HUVB 4X9GA 5LXGH 1XIWA 4DWHA 4KZEL 4FQLL 4K94C 4OFDA 3SBWA 5HGDB 3O2WL 2XZCL 2BNQA 1JTOA 2WINB 4LIQE 3TBTB 2AXJA 1I7ZA 4UILH 1TTGA 3VH8A 5C2BL 4DZ8B 4ZO7A 1NMBL 4OGXL 5HSFA 1OAYL 1U91B 3PABB 2FO4B 1SJEA 2NY5H 4PP8C 4NJ9L 3GMRB 4OB5H 1S5IL 3QWOA 2BCKB 5T3XL 5BVJB 1EFXB 4TUKL 1VB9A 3NPSC 1AGBA 2Z91B 3CU1A 5FV2A 4Y5XC 3PWPE 1DN0B 5J13C 3BP4B 1ZTXH 2XOTA 4LMQE 1R6VA 1CFSB 5D5MF 2HJFA 1NC4B 4XBGB 3OKLB 2K3TA 5DUMH 4HPOH 4UNUA 4MJIA 1QNZL 5K59F 3T2OA 1A6WL 1FVEA 1UACH 3HR5B 2NXZC 4ODSL 4G9FD 4IJ3C 2V5SA 5GRVL 4MQ7A 1U3HC 4HGMA 4LSUH 4P23D 3B9VA 3GSUB 4J3UA 4V1DE 4EUPA 2K1MA 3JWNC 1R3KB 5TFSL 2ZCKH 3VRJA 4PJ7B 4QXWA 5AYQA 2ICCA 5IESH 3ME0A 5EB9A 1TXKA 4JFPA 5I76B 4L4VB 2J6EH 4WWKD 5GRJH 5GISH 2AK4D 5JQHC 1KC5H 1DTUA 4I18B 5EC2B 4KUCF 1YNLH 2IADA 2CKBA 4L5FL 3WHE1 1NDMA 1NDGA 1U41A 2W9LA 4TTGA 1GSMA 1B0WA 4M1CD 1UB5B 2J8OA 5I16B 4K8RD 3HKFA 4PRHB 5E9DA 2PYEE 4OF3A 3ZDYE 1MI5A 3BH8A 3AAZB 1S5HA 5L6YH 1VEPA 1VACB 3MRBA 4BKLB 1RUKL 1BVZA 2OI9A 3BWAB 1K8DB 4NN7B 4Y5VA 1LO4H 1FAIH 1KPRA 3B3IB 5E08H 3HI6H 5HTSA 3W39A 5DEZA 2VQTA 2AJ3B 1G9NH 1IC4L 4PJEE 4TSCL 3SE3C 2JB5H 4G6KH 2BXZA 3N1PC 3W9DB 4D0BB 1YEGH 5IF0B 1A1MA 1F13A 4F3FA 3D69A 5FKAA 2RFXA 2VLRA 4XB7A 4M8QA 4ESKA 2VQUA 5DRNB 1FE8L 4M6NH 2V7HA 3MRJA 5HGHA 3MNVB 3OX8A 1INDH 1UM4L 2DBLL 2H9GB 5E9DB 1YUHB 3EYSH 3QZWA 3S8WA 4OV5A 4M7LL 4XAWH 4PRPB 3ULVL 2ZOLB 1KF9B 3NA9L 4LVHB 4EOWH 1EEYA 1TIUA 1G9EA 4N90D 5K9QI 3A6OA 3O3BB 4LKCA 5IB1A 4OZ4B 4KUZH 1WAAA 4F8TA 5IB3B 5GS2D 1WFUA 1PGRB 1AGEA 3OGCA 3OKDA 4PJGA 5CUSL 2Q7YB 1CVRA 1NL0H 4KK5D 3AM8A 2M26A 2A1WH 5EDXA 3EOYG 4R4BB 5JXEC 1WIPA 3H3KA 4U1SB 2HVKB 3KWWA 4LBEB 3DV4B 3DSFH 2L7JA 4OD3L 3V6OA 3IDNA 3RY6A 1J05A 3BO8B 3DV6A 4H0HB 3BISA 4ZUTA 2JIXB 1Y6NR 5EU7C 4IRJC 4DN3L 4JG0H 4Q9QH 3RNQA 4MA1C 1UZ8B 3SE8L 1NCCH 5C07B 3JWDC 4KK9D 3O4LE 3GJEA 3O9WB 1ZT7A 3FOLB 4UTAL 1UCBL 1FLRL 4ZAKB 3TH2T 1F3DH 4FS0A 5IHUH 2BSRB 4UOJA 1S7WB 4XHJD 2A73A 1CDIA 4ZSOA 3VJ6A 4PGDA 3VFSA 4B5EA 4JY5H 1YYML 1VKXB 3BUYA 1SVCP 3QA3A 4MNQD 3DVGB 5JXAH 4WHYG 2Z92A 1KT2B 3V5KA 1CTNA 2E9BA 4UAOB 4HK3J 4PS4L 4YXLL 4MDJA 3IAPA 1AGCB 3UBXI 5EU7E 4PJAA 1YEEH 3KYKH 4DFIA 4O2CB 1C12A 1PFCA 4HCRL 3WHE0 1YECL 4FFYH 3T2QA 4F57L 5IJVA 3QIBC 4AY0A 4JGUA 4J4PC 3HS0B 1QBLL 3ARGC 3LOWA 2AXHA 4U6YA 2J7LA 1CIUA 1DQJB 3ULUH 1F45A 4HKZB 1Q1JL 2D7PA 2C7UA 3QISA 4GKOA 1ERNA 4U1MB 5K59E 4L3EA 4M7ZB 3QA3B 2XRAH 4O58H 1LO2L 1M1SA 2V5MA 4YHNA 4EI6A 3SKMB 3I6LD 2FZ3B 3KPLB 1WBZB 3MRDA 3R1GL 3T4YA 5KS9A 2VXUL 3IS0X 5F7HA 4UV7H 1J8HD 2MHAB 4DKEL 1SEBB 2AGJL 2NR6C 2PXYC 5TPWL 1UVQB 4Z7UA 4XGZA 5KG9B 15C8L 2VLLA 2CQVA 2EH8L 4PB9H 4E9LA 5J6HB 2COQA 1ADQA 2DKMA 2R56L 5C0BD 1F90H 4GG6A 1TJGH 1QYGL 4XC3H 4PJFF 2ESVD 4WHTB 3EOAA 3LPWA 5MEQA 1KIPA 3BZDA 9CGTA 1RJLA 2APVA 4W6WB 1KCRH 1NC4A 4XBGA 5DJ8B 1U95B 3D85A 1BREA 4KHXH 4U1LB 3D3VA 1J0HA 3ULUE 3RGVD 1ZHLA 2ENYA 3HR5A 3CZFA 5CSBA 2I9TB 4LSTL 4EKXA 4XP6L 2EYSB 3S36X 4ELME 5F7KC 3ARFC 5I71C 4NFDA 4XVTH 4M48H 1N5AB 4Z77B 4UI2A 2X70A 3GBNL 4O51B 3S3PA 4F8QA 3SDCD 3KR3L 4AM0B 5T1DH 1G6RB 3LS4H 2ZCLL 1VFBA 1R0AH 4UV4L 4XWGH 2GFBA 5FGBA 5IROA 5A1AA 3O2DL 4HUVA 1F02I 1KFAH 1KTLA 3QIUB 3MOBH 2HN7A 4A6YH 1HDMA 3N85L 4EN3B 4YGVA 5ICZA 4OGZA 3MRQA 3MX0A 3GSRB 4LLUA 1YPZF 1U8NA 2CUIA 5INCB 4QHLA 3HC4L 3QEQE 1YC7A 4JPKL 3HC3H 3LKPA 1RZ8B 2YD4A 1TPXB 5B8CB 2Z8VC 3C5ZD 3BMWA 5HI5C 3FZUC 4PJHF 5A3ID 5E7FA 3INUL 4U1NB 2KL6A 4XP5L 1A9EA 3NIGE 5KTEH 3QG7L 4R96A 1JHKL 1MJ8L 4DGVH 3WE6B 1XCTB 4R90L 1QG3A 1MCPH 5JQ6H 3CX5K 1J9CT 3DYPA 5D8JL 1ZAGA 1J8HE 1A5FH 3CC5A 4NKIL 1YEHH 4CJ1A 3DTXB 2A6JA 3TYFA 2JJTC 1R3IH 5EOQL 3HNTH 4XAKE 2MCG1 1ND0A 1IQDB 1QFPA 1CICB 4GAJH 1EDQA 5BRZD 1CZ8L 1FZMA 1EH9A 3NCFB 5ALBH 5H35A 1QR1A 4HUWB 3S35L 4URTB 3C5SB 5H2BA 3MXWH 3GMLA 4KI5D 2R23B 2UY7A 1KELL 2V5TA 2GW5A 5DDHA 5E99H 3FB8A 3QUML 3WIFB 1QFUL 2EC9U 1KJ2L 2FX7H 4EUPH 1LMKA 2H3NB 1QSEE 3L7EA 3BOVA 5DHXB 3WL9A 4G43B 4M1DH 3REWB 1U8JA 1XF2B 4IHOB 2DQDL 4XH2B 1JP5A 2OR8A 5JA8B 3PWVA 2F53A 3K74B 3MBEA 3VE0A 4HH9A 5IIEA 1C5BL 5JLZB 4IOFD 3AAZA 4R97C 1IAKA 1T0NB 1P7QA 2Q7NA 5JOPD 1S3KH 2OTUB 3N50A 5FYKD 1H5BC 3WDIA 5ICYB 1FL5B 3F8UB 3EFDH 5B22A 2VITA 3FT4B 3MJ7B 3RWFA 2VNCA 1G84A 4X5XB 4KROC 5FM8A 3T1FA 2BC4B 4S1RH 3ZE1E 4JB9H 5AWNH 2FIRT 1JMZA 1I7UA 3R8QA 3TPUE 4G80A 4P0DA 5D7KD 5DVMA 3AS1A 2AERT 2PO6B 3HAEG 3L3HA 1BLNB 2XY1A 4NHCL 4HMEA 2AKRA 3TJEL 2DLGA 4HWZB 1LP9F 1XGRA 3EBAA 3O3DA 4GS7B 3FT2B 4XNUH 4JRYA 3UTSD 3B9EA 3RI5K 4RA3A 4JKLA 4JM2F 4IIQB 5BMFL 4Q6IB 2NNAB 4Q74A 2X4PB 2E7LC 1I8KB 1TDQA 4XMKL 4PJIE 1GPOH 2X42A 1IGYA 4UTBL 3LD8C 2L4OA 1CL7L 3QI9A 2AJXL 5D2LF 4KV5E 2FEEL 3QXAA 3AREC 4Z0BH 1N2RA 3IJSA 3TN0C 5IUSA 4KMQA 3GMNB 4Y7MA 2HKHH 2C4FT 3C2AH 4JR9L 5L7XL 4MNGA 1X3DA 3WNLA 4R2GD 5INDA 1INEL 3VG9C 5KVFH 4WDIB 2JB6A 3PGCA 5GGTH 4CN4A 3B83A 4LLWB 5DRZB 1NBZB 5LGHL 4U2YA 3NTCH 2VLKB 2HT3C 1R3HA 2V2XA 2OZ4A 5I1KL 2EIZA 2WLYA 5T1LD 3FO9B 1B6UA 1T83A 4JKPL 4AEEA 4ZUVA 5TGBA 3VXOA 3QDGA 2YD5A 5C0RH 4X6FB 3D5OF 4HEME 4MQSB 4OD2B 4K2UL 4LPTA 3RUGE 2WWKO 1VGEH 3KYNB 3BIKB 2ICWI 1Q72H 2VDOL 3TV3L 3HNSL 3KPRE 1OM3H 5FYJH 3SOBH 5C6PB 4MAYC 4K23H 2XI9A 3IDJA 4KK9C 5ENWA 3FL7A 4YHMH 4U6VL 5F88A 2GSGA 4WTWA 4LVNB 3PWLB 3O3EA 3C6LD 4NBYB 4Z5RA 2HH0L 4QHNA 4U33A 1SYVB 5IG7B 5SX5H 2DIBA 4HFUL 3VI3F 1G7HB 3EJYC 2YRPA 4PTTB 5C9KA 1YQVL 4LQFH 5DFVC 3L3OB 4GXUN 5CGYC 4OD2A 3CSYA 1U8QA 2ZUTA 3X3GH 5C70A 2R1WA 2RJMA 4AH2A 3QFJB 2X4RB 2DQIL 4LSPH 2CKBH 4KJPC 3UAJD 4CW1B 2BY0A 5C86A 4JDZA 3BRDA 4WTZG 3O41A 3BP7B 1ZHKB 1Z9MA 4HIHB 3IFPA 2QQLL 3ZKSD 5TH2B 4G6MH 3QIBD 3TBVA 3IDNB 2W60B 2EDYA 2XA8H 5EO9B 1U9KA 4OLWH 2CXGA 4I0PB 2A77L 4IBLT 5KSBF 2OXHA 3I85A 1C16B 4YFLI 3FMGL 5E4EC 2MMXA 2Y1VA 3O8XA 2FBJL 4XRCB 1JZ3A 3EKCA 2YA1A 5DJDB 1MREL 5DJCB 4EQ2A 2DQEH 2D0FA 2EYTB 1NCUA 2GJJA 3KGRA 4H5SA 3GJEB 3O9WA 3HC0A 3WFDH 5ADOL 3BAEH 4E0RA 3E1F1 2Q3AA 4OQ1A 1U3HD 5AYUH 1KCKA 2PXYD 5AUMB 4X6DE 4Y4FC 3VGEA 3RL1B 1FO0L 4D3CH 5JZ7C 5D71H 2EH7H 1L9MA 3ARDB 2D7MA 4X8JB 3CDYA 2HMID 3OQ3B 1N7ML 2UVFA 4H88L 3D3VD 1KCSH 2QQNH 4Z7WB 1K4CA 5DD1L 3EZJB 3GM0A 4Y16A 2R2BA 4BZ2H 1EK3A 2Y6SD 2BNQB 3DETD 4YDLB 1JWMA 3O2DA 2H1PH 3TBTA 1OAKH 3VWJB 4H25A 3LEXA 5L8JB 4WCYL 3QQ4A 4MSWA 4NQCE 2CRMA 5IVXF 2BZDA 3O6LH 3RVVD 3QH3B 1GAFL 2YMXL 3EYVA 2GK0B 3UJIH 1QQDA 5JW3L 1UENA 2QEJA 4H5SB 1N0XL 1ZVSA 3VFMB 3QRFM 1CDGA 1FZJA 4N0UA 2B8OT 4L4TD 3EOTH 5CILH 4NZRL 5TE4H 1DBKL 4P23B 4WWKB 2EDNA 5EFIA 4ISVA 1GYAA 4PG9A 1YDPA 4JHWH 1QSFD 4KJQD 1P4IL 2OP4H 4FQCL 1CFQA 1A2YA 1SEQH 3O6ML 5K9KB 5EBLB 3WIIL 2YC1A 3C8DA 1V05A 2H6PA 4NOBA 4AL8L 5CEZE 1F3JA 1XFPA 4MCZA 5D6DA 5I2IA 2XFXA 3BDXA 1L7IL 1PY9A 3LVEA 4GRLB 1OTUD 4K3DL 4UT7H 3TZVB 1P2CB 2FCBA 4XCCH 1N8ZA 3U4BL 3V4VL 3HMWH 3C6LA 1MVUA 4WENB 5BQ7A 2PCPA 4I48B 3O3UN 1HE7A 4OCXL 3RVTC 3IAGC 3GJFK 1U8MB 4GXUM 4WY7L 1ITBB 1UGNA 2VL5A 5D93B 3O2VL 5BJTB 1KLFA 2YUVA 1Q0YL 2J4WH 3ZTJG 3FQTB 5FUOH 5IMMA 2FLBT 4HX1B 4G8GA 3RHWK 1F4YL 3OBAA 2ZG3A 5J89A 2VYRE 5E94B 4K8RC 4GFTB 3CC5B 2DIAA 1ONQA 2GCYA 4GG8B 1NDMB 1KTKE 3CFKB 3JTCA 4KK5C 1I1AB 4X6EB 25C8L 4DQOL 1K5NB 4ODTH 2AJYH 5D7IB 4MNQA 1WV7T 2ZOKB 1KPVA 4Y5XA 4NO3A 2NY4C 4O5LL 3OAYK 5EUOE 4IIQA 4NKQB 5F9AC 3WKNA 4G9DA 3WXVH 1JPSL 4C58B 1JI2A 4PRPD 3T0WA 1SJVA 4HQQH 1BMGA 1X5JA 1I8LA 1DN0A 4I4WA 4M5YL 3WYRA 1DUYA 4ZS7L 5J0BA 4F58L 5D1QC 3U0WH 1T0PB 5C0ND 5D1XA 1XF3A 2YUWA 3CAFA 5IF0A 3DROA 2HKFL 1MJUH 5ALCH 4QRSB 5KBNC 4X9BA 3HE7A 4AENA 3F7QA 1PZ5A 4WFFE 3O0RL 5GRVK 4PLNC 5TQ2H 4S0UC 2D03L 2OL3B 3GSNB 4P4RA 1BQLL 2V6HA 1S5HB 5GGRA 5J11C 2Y7QB 4WI8A 4XXCA 3OR6A 1G7JB 1TZGL 1CGUA 2BFVH 2R2HB 4AIOA 4ONFH 1KLUB 1N6QL 1TZIB 3Q1SL 1NAMA 4X4MA 1A4JB 4RGMC 5HYSB 1OGAB 3ARBA 3WDHA 1EZVX 3DWTA 1CGTA 5JDSA 1G0DA 3MODH 4PUBH 4FG6C 1CYGA 5F96L 3MJ7A 1FNSH 1ACZA 4RMRA 5EU5B 3BW9A 1RIUH 4DTGL 3U0PA 1XF3B 3STBA 4JG1H 6FABL 1II4E 4NSKA 3IJHB 4M6MH 2VLRB 1I7UB 1MQKL 5DHYB 2ADFH 4FQQA 1TMCB 5EO0A 3DV4A 4JRYD 2DN7A 3ZLQC 2QSQA 1WT5A 5L2JB 1GGBL 2C26A 2Z4QA 1DZBA 4JO3L 4CMHB 2YWZA 2UUDK 3WUWG 4WEUD 1ZE3C 2P8PA 1NFDE 1HKLL 2NXYD 5DUPL 4BZ1H 1F58H 4FRWA 1UB6A 1SEBA 1P4BL 3CIQA 2CRZA 5I6XB 4O2EB 4UB0H 2X4NB 1SQ2N 2F5BH 1HXMB 3REVB 4OGAC 3OSKA 5CD5C 5GS0L 3MGOB 1S7XB 4FP8H 4J6RH 5EZIL 1XF4A 3FRPG 4HBCH 2XKUA 4XNZB 2PTUA 3MLRL 5FYJD 3V5DA 1AXSB 3DUSB 3JWDH 4UBDD 4M4PA 3LKOA 3F5WA 3HZKA 3O4LD 3VGBA 3MCKA 2PNDA 3BKCH 1KCVL 2AJUL 5KANG 5HPMA 3ROLA 2ORBH 5I71B 1NFIB 4K8RH 2ZOLA 3GMMB 4FFEX 1R5WB 2OR9H 5HHQA 4K55A 4XX1E 5EN2A 2DQTL 4RDQF 4KZDL 3CDGB 4BK4A 4M5ZH 1IEBB 1Q94B 2ADJB 3TNNB 1T89C 1I4FA 2E27L 2Y06L 1EEQA 1GGCH 1IL1A 5CP3H 4Z7NE 1W0VB 1EHAA 4LKXB 4X5XA 4BQBA 2DLIA 3GSQB 2HFGH 3CCHB 1IEHA 2I9LB 5DK3A 1LO5A 4QTIH 3AB0C 1B9ZA 5JO5A 1R5IA 3P4NB 4IOIB 4MAYD 4NHUA 1DQLH 2NXZD 4R7NA 5EIIA 2E3VA 1TFHA 2R1XB 4J1UB 3U9PL 1EX0A 1IVLA 3T4YB 5KS9B 2VABA 3VWKB 3U6RB 1W72A 5D7JC 2B5IB 3BGAA 1XGTA 1CFTA 5CHNB 4JDTH 1Q94A 4OQTA 5T3ZL 3GIZH 4KAQH 4HG4K 3SQOL 3P4MA 4R0LC 4PB0H 3FO2A 1V7MH 2AV1A 2Q76B 1NGQL 5CJBA 3SDYL 4UOW0 4QHUA 3VFWB 1AQKH 5EZOH 3MLPA 3QJHB 3CCHA 4RBPH 2X6MA 3SGDH 3OKOB 1FGNH 1LHZA 4QNPF 1F4WL 1SJHA 4RMSA 1RZJH 1NANH 3VRLE 5HI5D 2YXFA 1WF5A 3K3QA 3C09B 1AIFA 1BX2A 2Z8RA 3C6SA 5FOBB 5EU6E 1MRDH 4CVXB 5CEXB 4MXQA 2BY1A 4WV1C 1AD0A 3RGVB 5F7LB 3C5ZB 3HPLA