5IB2A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib2A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib2A01
3VXTA 4CRPA 4JPKL 4N8VG 4HUUB 4XX1E 1J05A 5C7XH 3INUH 3MOQA 3ALPA 3HZVA 3TYGL 4HJGB 1OW0A 1CGVA 4BQCA 1KFAL 3V0WH 1I7RB 2O61B 2CDFB 2PO6B 1H0DB 1T0NB 4DOHE 2GUOB 4EI5B 5A3ID 4ZUTA 1FNGB 1FC1A 1N6UA 4XBEH 2FH8A 2MSPA 3OPZH 3KLAB 4OZHF 2WQ8A 5IBLD 3QXVA 3MRGA 3VXUD 2BVOA 2MNUA 4HHAA 1FE8L 3TBSB 4OQ1A 1QTYT 3QH3A 1PW3A 3IETB 2IADB 4C55A 1FJ1A 1MCOH 4CBPA 1D6VL 2DOCA 2FSEB 4KKBD 4RWYH 2HFGL 1W72A 5HHOA 1ORSB 1WIOA 4OI8A 3ZKND 1DCLA 3BKML 5GJTL 3CUPB 4RZCA 1JGLH 3PDOA 3GBML 3ILPA 4QGTA 2DL9A 4KRLB 3S35L 4NKQB 2LABA 3ORJA 4YC2B 3FKUS 3QCTL 1B90A 5E95B 2XFXA 4RFOL 1UJ3A 2HLAA 1ADQA 1X6NA 3BH9B 5C0RL 5LKNA 5KN5B 4NNYA 4HCRL 1UA6H 4QOKA 3T0EB 1EHLH 2ARJB 3VGDA 3VXOB 4OLYL 2ZCLL 2AK4E 3AM8A 3EFDH 4LVOB 4PJXB 3KPLA 5GGVH 4JFQA 2V6HA 4NO5A 4Z6AT 1UACL 2I07B 1U36A 3NTCH 4NUJA 3QA3B 5AEAA 4UBDC 2J8UA 5HVGB 1FDLL 2BNQE 4L1HA 4D9LL 2R15A 1SJEB 4Y2DD 3N0PB 5E99L 4D94A 2NY6B 2ATPA 5D7KD 2DQUL 2ILLA 3QO0A 4JDVB 5KSVA 4PY7A 1PEZA 2YZ8A 3CSBA 4X8JB 5IP4A 1JK8B 5T3XL 3T09A 1UXWA 5L2JB 3VD3A 5I8CA 5EOCH 4MNQA 4IMLB 1AGFA 1VSCA 3ZE1F 5I1CL 3KPSE 5CHNA 2CLRB 4WJ5B 2FB4L 1J5OH 1FL5B 3VDCA 4R3SA 2G5RA 5F89A 4R2GD 4ZFOA 4OM1L 4F58H 3C5JB 3SY0A 1FYTE 3SDAA 1JGUH 4OFIA 3TESA 4KUZH 1L8JA 3BO8B 1FGNL 2W59A 3MACL 1A3RL 3NCCB 3O2WL 2V9RA 3OF6A 2XRAH 1CK0H 1T7WA 3O2DA 1S9KC 5CEXA 3QDJA 2ZUQB 4J1UA 5F7DB 1NBVL 3GI8L 1INEH 3W9DB 1IGIL 1E28A 2X4TB 1B2WL 4WNQB 4N1EA 3O3EA 1M7DB 4JZNB 4Z7QE 1JWMB 4RX4A 3QEGH 4L8DB 4UTBL 3VFSA 2WWMC 4LSPH 3JWOH 1CR9L 1K5NA 2IH3A 1GGUA 2C5DC 2PO6D 3T8XA 2CKNA 4P5TB 4PGDB 4EI5D 5KW9L 1UKTA 3TC9A 3PQYA 2PTUA 2IFFL 4GJTB 5TE6L 2HJLB 4Q9QL 1KJ2A 1L7TL 4JPIA 3NN8A 2W60B 3V52H 5J56B 2Q1EA 2OL3B 3WFDL 5EA0H 3MRQB 4GG6E 5KSAC 5IWLC 3VG9B 3LD8C 1V7NH 2VQTA 3MLUL 3WFBL 3JV0A 4LSQL 2DI7A 5AZEH 4XNYH 1QKZL 3TNMB 3U79A 3U83A 4C83A 3S3SA 2IG2L 3SCMC 2DL2A 4NO3A 3S4SG 3W81A 1I1CA 1U8KB 2ZJSH 43CAA 4W4OA 4P0DA 3PL6C 3MR9A 3OHXA 4P2RE 1TJHH 5IVXB 4MJ5B 4I0PC 5LBSL 3VGHA 2YD8A 4X4YB 1T83C 2VL5B 5AD0A 1A02N 2CDGA 1A7NH 1G9NL 1TZIB 1QRNB 4X6DB 2XZAL 1YMMB 5E8NB 4N0CA 4PP1C 4QXUH 3ZTJG 3FQNA 35C8H 3OKYA 1H3WM 1CTNA 4JRXB 1JI2A 1AXSB 3TYFB 1QSEE 4KAQH 5E00B 1L9MA 2E7LE 3U6RA 1OTUD 1OF2A 4MQTB 4NWUL 3RWFB 2NY6D 4YZFF 4NM8L 4CVZB 4GG8A 5DZOA 2AK4A 3VFWB 1PG7W 1TNNA 4JN1H 4B7IA 3D2UB 4LQFL 4NCC1 2F58L 2IF7A 1MCRA 1QFOA 4AY0A 3QIBA 4KFZC 3BPLC 4OFPA 2XWTA 1LWRA 2AJZB 1MF2H 4M6OH 5IVZB 5TH2A 1BVKA 3LKOB 2Q76A 5FGCB 2ADFH 3ZLQC 1RUAL 5DEZA 3B9EA 3GM0A 2EDBA 5CIPB 4LCWE 3HMXA 1HYSC 3TA3C 2X1WL 1K85A 1CFTB 2MTPA 1P6FA 4Q74A 2VDMH 3KPPA 4KZEL 4BK4A 4G6MH 4NN6B 5T5FL 3RIFF 5DYOA 2BJML 4LPTA 4OZFA 3EDEA 4MNGB 4PDCE 1ZLSL 3ARZA 3CPLA 5D72L 3LMJL 2G2RA 2CGRL 4X99B 1BZQK 4OV6F 3EOBA 4QYOB 4DVRL 3KPSA 3VD9A 5HHVH 4L4JA 1QA9A 4K94C 2Z31A 1NBQA 1FYTA 3RX7A 1P7QB 4E41A 3MLSL 2HVJA 1HOCB 3QQ4A 1QO3B 4WW1B 2AABL 3MRJB 3HC0A 4N0FA 3VDBA 3LN5B 1MWAL 1JNHA 4JANA 4YBQD 2VL4A 2HJKA 4PP2A 4P5TD 2GCYA 1GZQA 5SWQA 1ZLVK 3O8XA 3HC3H 3RJQB 2R29L 4KI5E 1JGEA 2R4SH 2YN3A 4PJ7B 3HE7C 1G7QB 4QNPF 2Q87A 3CFEB 1BBJA 1F3JB 2EIBA 5JUEH 5EC2A 3VFMA 4K3DH 5E8PA 1NC4B 1RIHH 2BFVL 3ESVF 3W39A 2HN7B 1MHPL 4LSVH 3U46B 4WCYH 5BO1L 5MEQA 4K23L 2ED8A 1MJJA 3DTXB 1DANT 4G9DA 2X2YA 5E56A 2AAVA 3ULUC 1AQDB 3UZVB 4GG6A 1HINH 3L3JA 4XPGH 4U4BA 1E0OB 1CDGA 2DQIL 4G8FA 4CN4A 5JIHA 4ZQKB 1QRND 1YMMD 3ARTA 3B8SA 4AM0A 4S1SH 1YEKH 3FTGA 4FQPA 5D2NC 2AP2A 1DLHA 1FPTH 4G6AD 4JRXD 4QRQA 3V4PH 3TLRA 5C1MB 1SYVA 1T7XA 2OTWA 1UYWH 3CFDA 4C56A 3QUKB 4B7LA 2FHCA 4L8CA 2ITCB 1BF2A 2UUDH 1A6ZB 3V8CA 4P9HC 2NY5H 4XNUL 4MLIA 4PYHA 2PYFB 4I9WD 3DVNB 3E2HA 3D2UD 5EUOF 4F15C 5BRZE 2CXGA 5CEZH 2DBLH 1BVLA 4N5ED 4GRWE 1RIVH 3C6LA 2CIKB 2QSCL 1RZIB 1F42A 5C09B 3GHBL 2JCCB 4KJQD 1Z9SA 2HT3D 4DFHA 4UNUA 3H0TB 4PG2C 4HUNB 4XXDB 3D69B 3I6KB 4U1KA 3ULVD 5D7IB 1C5BL 4JRWA 4ODUB 2GAZA 1NDGB 4XCYA 1WFNA 2XXMB 5E6IC 1LP9B 1ZVSB 4HQQH 4NP4H 1KN4L 3T4AB 2F74A 1F6AA 3ELAT 4NHCH 3T0VA 3VH8G 1NAKL 4ORGA 3RWCB 3EHBC 3QEQD 3RVXD 4X80L 1CI5A 5JDJA 2X7LB 5IBTH 1P7QD 3WNNA 4FRWA 2VQ1B 3TJEH 1NCBL 3PWNA 1RJZA 2AJSL 4IJ3C 4JHWL 3CD4A 4QEGA 3DUSA 4NKDB 5J4MA 4KTEH 5E8EA 3EFFA 2A6KA 2CK0L 3M45A 4YHIA 5D96C 1DQTA 4OLVH 4YHPA 1NCNA 4YHNB 2D7TL 4F9PC 5DJZB 3LKSA 5ADOL 3ZTNH 5F7HA 5HDQH 3CFBA 3RUGE 4JKKA 4NQXA 1P4IL 4P2CG 5F7WC 3SE4A 5HI5C 3MRHB 1O5DT 4XVTH 1NC4D 2IPTH 4HKZB 1ACYL 5EU3B 5IMLA 1AGCB 1ETZA 3BGMA 2XWJA 3MXVL 2J6EL 2VLMD 1K8IB 5KSAB 5IM7A 1H5BB 4I2XB 5HD8C 4UIKL 3ARDC 3EO9H 2WWKO 4OCLC 2AJ3B 1CLOL 1IGJA 1U8JB 1HKFA 4MA7L 1A0QH 1OAZH 3SGKA 2VRAA 1A1MB 3SCMB 3KAAA 5C0DB 1U3HA 1LNUB 3E3QC 3CSGA 4Y8AA 3MV7E 2JJSA 5EIIA 4GAGH 4OGAD 4V1DB 2O5ZL 3PL6B 1MCNA 1BM3H 4Z7WA 2Q3AA 4NM4H 3RGVC 5JPNA 5JZ7C 5B39B 4P48A 1Z5LA 4U1IB 4I0PB 5I18L 4UV7H 2ZSWA 3T0AA 4PRDA 3DGCR 1AD0A 2DQDL 1EIBA 3VJ6A 3FN0H 1NQBA 1EXUB 2KPNA 5MHSD 2MHAB 2E6JA 4PJ8A 3C60A 3HFML 4P3DA 5DK2A 4GXVH 1N0LA 2DQHL 3FT4B 1U42A 2DYPD 5E5RB 1XH3B 4OGYL 1T2QL 3KYAA 5DD6B 1HEZA 1S9YB 4UBDD 2A6IA 4IRZH 2A1WH 3CVHA 1H3VA 1KIQA 2ZUXA 2R69L 2CRYA 3T2PA 3G08B 2AI0H 2FJFA 5JW4N 1F00I 4Y0GA 1FZOB 5T1DH 1KPRA 3S98A 1S5IH 5ITBH 5I19H 5C09D 3BPLB 1MCPL 5KSBF 1S9VB 4YHMH 5FYLD 4N90E 4TULL 3WCYA 2EYRB 4QTIL 1QP1A 4FXGA 1MRCL 4GW1A 1H3TA 3D3VE 5DA0B 2DTMH 4TUOA 1VHPA 1BQLL 3BWUC 1BBDH 5HHNB 3QRGH 3TA3B 1BZ9B 5BRZA 4PB9H 1EO5A 4NGHL 2A77H 4D0BA 5LCVH 5ICYA 3OAYH 2PXYA 2XY1A 3EGSA 3A6BH 1ZK9A 4R4FL 2BSTA 5F9DC 1HQ4B 1JNLL 3KPRB 1H15B 3WDJA 4X6CF 3V6FB 3P11H 4WO4A 4R8WL 2QLVB 3WD5L 4Y19B 3SEPA 5K59E 3O6FC 3WHXA 4QRRA 2NPLX 1DLFH 2VN7A 3DBXB 1R3LB 2WWMD 5A2LH 2V9TA 3Q5YA 2FX9L 3HI1A 3NFPB 3LKQA 1FZMA 1MHCA 5HVWA 2IMMA 5AWNH 4DJMA 1I7TA 4XMPH 5E03A 1K2DB 2CSPA 4JZJC 1NUNB 1XGQB 4PFEA 4M1DH 1KT2A 3VFUB 3RVVC 1GGIH 3GRWL 3FQTB 3HE7B 3AAZB 4KKNA 3HCVA 1NGPH 5KSAD 1A6TB 1IAKA 3FT2A 5JORA 3VG0L 3ETBF 3UJJH 2BC4A 4YO0B 1Q94B 3DX6A 4X7TA 3VRJB 3K0WA 3LDBC 5D6CB 3SCMD 1H3GA 3BEWB 1CDUA 5IHZB 4N0UB 3RUGA 2BZDA 3V4VL 3TV3L 2OMNA 2D9CA 3HC4L 3H3PL 1I3RA 4H26B 3WN5A 1R3KB 2VDLL 3EZJB 1URLA 1HKLL 2F19H 3PL6D 4KJWD 3FRUB 4P9HH 4I0PD 3VCLA 4DVBA 1UZ8B 1V3JA 1BOGB 1Q72L 4WFED 1QSFE 1R0AL 4AL8L 3MOAH 3QDAA 4PP1D 3O45B 3RWDA 4OUUB 1LD9B 1NCUA 5JLZB 3JTTB 3GSWB 2C3XA 4KRMB 5AG9A 3B9KB 4I1NB 1K6QH 3SKNB 4WEMB 4L3CA 5DVNA 2DM7A 2FIRT 3RPIB 2VAJA 3MJ9A 5FO7B 1DN2A 4TYUA 1AC6A 5L2KB 3MRDB 2PW1A 4Z7VB 4FN0A 2VDKL 4Y5VC 5I30L 1BJ1J 1I9EA 5A1AA 3IRPX 7FABH 4F15B 1DSFL 1BOYA 4Q7DA 5IBUG 4E42B 1RK0A 1H8NA 4HH9A 3O11B 5E94A 3MBEB 2YK1L 3IFPB 1T7ZA 2ICEB 4PJHF 2FEEL 2VERN 4Y4FC 1HYSD 3LSOA 5BMFL 3TA3D 1S7QA 4ELMF 3AVEA 1N6VA 1EBPA 3K3QA 1XGUB 5E24E 2X4PB 4JFEA 1MNUL 1IGFH 2ESVB 4XP4L 4GRMB 2FEEI 3MOBL 2YC1B 5CINH 1DL7H 3GNML 2QKIA 3H9ZA 1KXQE 5BZWB 3V5KB 4PGBB 1A7PL 3KPRD 5E6IB 1MCHA 1YNKL 5FOJA 4M62L 4Z8FL 4PJFF 3IXTA 4GBXA 3D3VA 1ONQB 4KV5F 1EAPB 1XF1A 4QF1B 4JB9H 4ODXB 1NKOA 5IMKA 3MGTB 4NKOA 3ZKSD 2EE9A 3P0VL 4ZAKC 3C08L 5E8DL 3L95B 1CFNA 2GSIB 4OIAA 5IB4A 4IJ3B 4H88H 4D0CA 5I1LA 3HNTL 3BP7A 4XTRC 4G6JL 3U0PA 3NGBC 4L4TB 4DGYL 4U6YB 1UXSB 4JLRB 1X44A 1EX0A 1ZA6B 1DBKL 4FFWC 3IFOA 5D96B 3RVTC 4MXWH 4Y4KA 4J3UA 1OL0A 2V17L 5C0AA 2GIYA 2HWZL 1B4JL 1SJXA 4QRUB 2AJXL 3HE7D 2EDFA 1HIML 4YWGL 5CP3A 2KKQA 3H9SB 1CFQB 1RU9H 4UT6L 4PJIB 3VXTB 1DQML 3N85H 3OQ3B 3WMSA 1MAKA 5F1KC 5EZJA 1HH9B 3IGAA 3ARDB 1YN6A 1RY7B 5GGUA 2D7QA 4LEOB 1IMHC 4XMKL 3IS1X 3CVIH 4JPWL 2OK0H 4AEEA 3ULUD 3TIDA 5CFHA 4ALAL 3VFGL 5KVDH 5LGHH 3R1GH 1Q9KA 1VPOL 1YC7A 3B43A 5TF1L 3OKEA 2E8ZA 1HXMB 5E08L 5GS0L 1OAXH 1N59A 3QH3B 3ZDXE 4H1LA 1W72B 4F7MA 3CMOH 5HHOB 4J4PA 4NWTL 5DD3H 3DI3B 4M7JL 4RZCB 4RMVA 3F12A 3U7YH 1RJLB 3RIAK 3WJLC 4UTAL 3BKJL 2FYYB 5L2KD 4QRPB 2VR5A 5DJYB 2X1QA 1QSFA 2WZPD 5I1HL 4G9FB 5GGRB 2HP4A 2HKFL 2XQYG 2XFXB 4FXKB 1UJ3B 5FA3A 1U91B 4NNYB 2AQ2A 1F02I 5BVJA 4PV8A 5KTEH 2VLKE 3HI6L 1A4JB 3ROLA 1D6EB 1BJ8A 1XF2B 5MI0B 1FO0B 3K7UA 2AXHA 3UDWA 4OQTL 5DJDA 3PHSA 4ODVH 5EBLA 4HZLB 3GSUA 4OF6A 2D03H 2NNAA 1PJ9A 5TF0A 4CDHA 1ZSDA 1FCGA 3GMOB 1LO0L 4P2QA 5FYJD 2X1PA 2F54B 3HB3C 1Y6KR 2NR6C 3BZFA 1Q0YL 3CSYA 2IWGA 3LCYA 3IVKA 2F5AH 3DGGA 3DYPA 1U3JA 4CNIA 3Q0HA 1BFVH 5E6ID 1F3RB 3U1SH 5IFHL 1A3QA 1CDYA 3UYOD 3C6SB 1TZGH 5EOTB 3GSNL 3EHBD 3ABZA 3BEVA 2PR4L 3T3PF 4PJGE 3F7VA 3QG6A 1UXWB 3SGDI 4LCUB 4XNMB 2N4IA 3EYUH 2DI8A 4MA1C 3GSRB 4J23A 1IM9B 4MNQB 5HDBF 4UILL 32C2A 2DLEA 3B4NA 2QQKH 1OM3L 1CQKA 2OJZL 3JBG7 4O9HL 4PJBB 4OLUH 4RNRB 4L4TD 4ZFOB 1G7HA 4GXUM 1PKQE 4HC1L 3RVWC 3SY0B 3GHEL 4XC3H 1BD2B 2FIKB 1RURL 4FQQA 1G6RA 3D25A 5K9KA 1AGEA 3PP4L 4MVBC 3QIUD 1B0GA 4Z77A 5DVOA 1UC6A 4XP5L 1G6VK 4R96B 2HLFC 1R3IH 2BNRB 5K9JL 3LPFA 2YWYA 4OCMC 2NQCA 4JZJB 4LLDB 5CEXB 3QXAA 4H8WH 4NRZB 3MLVL 5HI5D 4L4VA 4A6YL 5HPMB 5C8JA 1GVIA 3PABB 3L3OA 1JPTH 5HD8D 2DQFB 3ARDD 3F5WA 5D4QA 3BRFA 3VFSB 1PZUB 4G59A 2RFXA 3OSKA 3MRPB 3LN4A 3LDBB 4WGVB 1R3HB 1DE4B 2JIXB 4WUUE 1T6WA 2X4RB 3PQYB 1SM3H 4I3SH 4LAQL 4DAGH 5EOCJ 5GJSH 5HYSB 3BGAA 3RA7H 3PNWB 2G5BB 4NO0B 5F3HA 5JZ7D 3RGVD 2P47B 1ZHLB 2XY2A 4JHBA 4YHKH 1CE1H 2FDBP 4M6NH 4YGAB 3TJHA 2ADJB 1F3DJ 4YQXH 3D5OF 5BOZG 2VMFA 1A9BB 4XH2B 4U7MA 2NY4C 3QHZH 4Y5YC 1QFWL 2R0LH 5J3HC 5K9OB 4IM8A 4KRNA 1ZT1B 4QRPD 2JKXA 2C1OA 4URTB 4WI4A 3TZVA 4CN1A 2DIAA 5GRVK 4G9FD 2XNAA 4LHUB 3QXWA 4ZD3L 1RK1A 2P8LA 3MR9B 5LAXA 3KNBB 3SDXE 1XIWC 1P84K 1WBZA 1IEBB 1N5AA 4I4WA 5LQBL 4Y5VB 1C8PA 1YEGL 5DFWH 3G9AB 3R0NA 2CDGB 2AJUH 2PYEE 4WDIB 3M8OH 4XX1G 4POUB 4UDUA 2F54D 4XP9H 4DKDC 2H8PA 1I8KB 3QUMB 1NEZB 3TBTA 4Y4FB 2X4UA 3MROB 4AIZA 1GC1L 5KZCB 1V7MH 2IPKB 3U6RB 4X9FA 2MCG1 2D31A 1OF2B 3DIFB 2IPUK 1AHWC 3KPMB 5SX5H 3GO1H 3X13A 2LAAA 2VLKA 3VWKC 1IGYB 4IS6A 1OPGH 1MI5B 5C7XL 3INUL 1QLRA 4KQ3H 3STLB 2EDLA 5ESVA 1T04A 2LVEA 4XB7A 3V0WL 2GTWA 3MRCB 1I3VA 4ZTOH 1QSVA 4HIIB 4NRYA 4X4ZA 3BZDA 2G75A 5TH2B 1BVKB 1IM9D 2KQNA 4OAWA 3VWJC 2EIZA 2NLJA 4XBEL 1XAUA 3OPZL 2VKWA 3O6FD 4ZO9A 5DJ2A 3BE1H 5ICZA 4H20H 2WINA 1BD2D 2XN9B 2CO7B 1T4KA 3FFCB 1MCOL 4RWYL 4CADB 1OTSC 2Y7QA 3PWLA 3DURA 5HYJA 2R0WH 3BKCH 4PJGA 2BNRD 4ZPVB 4FTVE 1JGLL 4Z7UF 3FAWA 3BI9X 4TNWK 3RVVD 4HKBB 3EOBB 5DQJA 2GFBA 4KK9C 5CBAA 1QA9B 3BW9B 3KXFB 4F7CB 3QFJB 4ZFGH 4E41B 5F9JB 4JGJA 4C59B 4LCCC 1ZLWH 4JO4H 4QO1A 1A2YB 5GRUH 4BUGA 1OAYH 4JANB 4RGNE 3NCBB 2HJKB 2RHEA 4PP2B 4TPRH 1EHLL 4P5MA 2JIXD 4U1MA 1WJ3A 1YJDC 5FKAA 5HYQB 1T5XB 2AV7A 3EFDL 1KIPB 5J1AB 3B9VA 5GGVL 1RVFH 4NPYA 1LE5A 2X70A 4NO0D 1EGJA 1PZ5B 4HWZA 3NTCL 3F7YA 3HRZB 4APQA 3I2CH 1NAMA 4OZFG 3X14B 4AT6B 1I1RA 2RAMA 3SDDC 3P77B 4WGWB 2XZCH 5MEQB 4TNVK 1JUFA 8CGTA 1E4KC 2V9QA 4X6FA 3QHFH 3KR3H 5GGTH 1I8LC 1O7SA 2VH5H 2YSSA 4LHUD 4G9DB 2P5ED 2HA1A 3Q6GH 5D1QA 5EOCL 3RGHA 3GBNH 5BW7A 3QI9C 3CMGA 1NUFA 1LEGA 1DZBA 1ND0A 2HG5A 1J5OL 1NFIB 2R8SH 1TTFA 3NABH 4ZTPH 3UX9B 4F58L 4Z0XA 3RDTC 2JE8A 1RUQH 1OP5H 4I48B 1JGUL 1DUYA 3BPOC 4D2NA 2P4AB 3O4OC 1GGBH 4GSDH 4ZMAT 4MXQA 2B7DT 2XRAL 1DLHB 1CK0L 3D39A 1YPZA 4OZGA 5IOPB 2B1AH 2ADGA 4Y4FD 5D93C 1S7VA 5EBGA 4JFFE 1GCFA 4HK3N 4JQVC 4IEFB 2KUTA 1U3YA 1INEL 3SDXA 4L8CB 3UPAA 3QUXC 2NY1C 5I1DA 4PJEE 1MI5D 1WWCA 1ZHBA 3WUWA 2NMSA 1EHXA 3QEGL 1U8QA 4XVUC 5TDPA 4LSPL 1G1CA 3JWOL 4JCLA 4TUJA 5HPOA 5HYEA 3ARGC 5FO9A 4IOFC 1EEUA 3NVQA 3PGDB 4L3ED 2XA8H 3ZTJH 1P69B 3SJVB 1LILA 2QL1A 5MERB 4ZAKD 1TPXC 4RMWA 2VLLA 4HWBA 4MA1B 3V52L 3FOLA 3BZEA 2XN9D 3OR6A 4AG4H 3FFCD 4M6AA 4TVSa 3OWEA 5FUZH 4XTRD 5EA0L 3CDGA 1EEQA 1QACA 2I27N 4FFWD 4MHHG 1V7NL 2DIBA 5EPMB 3LIZH 5ECJE 3RVTD 5D1XA 3F6LA 5CWSB 1WQVT 4ZODA 5ALBH 4RMSA 5AZEL 4XNYL 2EXYC 3PDDA 1IQWH 3S96A 3IJYA 4ORGB 4IDJH 3PGFH 3U36B 2VXSH 3KXFD 3QFJD 4ZFFB 2ZJSL 3F62A 1XGRA 1AI1L 3PWNB 1FAIH 1TJHL 1HZHH 2E7CA 4L8BA 3UTZB 1X4ZA 3MLTB 3O6MH 2B2XH 4I3RH 4FTVA 1JGVH 1A7NL 2WIIA 3O9WC 4YHPB 4QXUL 4E0RB 2PETA 1C5DB 4HKXB 2V5TA 3LY6A 35C8L 2ZSVA 3A6CH 3ARUA 3HZMA 5F6IC 5FFLA 1JZ8A 3ECBB 3KDMB 4TUKH 3NZ8B 4UUJB 3VXPA 3FAXA 4KAQL 5ID1A 4Y16A 2YUWA 1J0HA 2Y5TA 1WBYA 4LLWA 4NQCB 4U1LB 5K93A 1E27B 1J1OH 2UWEF 4XC1H 2E8YA 1DBJH 5FDWA 4JN1L 5FKPB 1LO3H 2NY4B 4Y5YB 1FVCA 3TF7C 1MF2L 4M6OL 4U0RC 1T3FA 3RNQA 1AXTH 2ADFL 3L3KA 2BMKB 4XCCH 4F7TA 3DVGA 3A67H 3WDIA 1FZKB 5L0QC 4JM2A 5D7JC 3P30H 15C8H 1M05B 2VN4A 5L8KB 3O4LA 4RQQA 3BJLA 4U1GC 1P4BL 5JA8B 5JPNB 1WAAF 4JZOB 1NC2A 1T20B 1XIWB 2VDML 4GT7A 2X4NA 3QNXA 4G6ML 4LLAA 5DI8A 2ED7A 4XP6H 4KQ4H 1EO8H 3P4NB 1JPSH 1LK2B 2IALA 4R4BB 5IQ7H 5LGKA 4P23A 3GMQB 5D2LE 1T1WA 5DC9B 3WNKA 5CLWA 3M17A 3HB3D 1B6UA 5HHVL 4FQ1H 2NR6D 3QDGB 4EXKA 4GAYA 5JQ6H 4JPVH 1ZGLB 3V5HB 5IESH 2EIDA 1HEZB 1WT5C 2A6IB 4B50A 4LL9A 1EEZB 1AHWB 5FAAA 3EJZC 4GKZA 2EEAA 5DHXB 5TE7H 5BS0E 5E7BA 4P3CH 3VWKB 3TBYA 3VXME 5DO2C 2FJFB 1XGPA 3UMTA 2HMIC 1OGAA 4HGWA 3MRLA 4O58H 2ZNWA 3QEUA 3HC3L 3SJVD 5IK3B 4TN9A 5MEOB 1NGXA 2EDNA 2R4SL 1ZKAA 2GJJA 5GHWH 1KLUB 4PJEA 5C2UB 1HHJA 2HTKC 3HAEB 5FOBB 3ULSA 1ZANH 3RVWD 2EEBA 1M6OA 5JUEL 4PJ9C 5LG1A 4K3DL 2GT9B 2QSTA 1RIHL 3RX5A 2VIRB 3NFSH 4MVBD 3BP5A 4HMDA 2PXYB 4LSVL 1WCBB 4RRPA 4WCYL 2P46B 4W81A 2HLFD 4NC1C 1FZJB 1CIDA 2H3NA 1QOKA 3TO4A 4PGEA 4K55A 2L7JA 4L8SA 1NGZB 1RD6A 2XXCB 1GSMA 1CBVH 1HINL 4XPGL 3WLWC 5SWSE 2FBOJ 2C26A 5EU5A 3P9LA 5CJQH 4QRRB 5IJKC 1EJOH 2J6EA 2WBJA 1Z0MA 4LCCB 3IDYC 2X89A 1Y6MR 3I3BA 1TVDA 5I8EA 1HHIB 4S1SL 4P4KC 1MHCB 1YEKL 3V6OC 3BXNB 1FPTL 3GSQA 2BVYA 1J8HB 3V4PL 4JQXA 2W0PA 2MWCA 4R4NC 2Y9RT 4PJCE 1UYWL 4JE4B 5L9DH 1T5WA 4RAUA 3UTSD 4LGRB 4NQCD 1LMKA 4Q9RH 3AROA 2NY5L 3HCVB 3EIFA 4MD4A 2N7AA 1IAOA 3TP4A 3FT2B 1C08B 1J10A 1FN4B 3MA7A 5FUCE 3Q1SH 1UGNA 2DBLL 5CEZL 5T3ZE 2NY4D 3SDDB 5F9OL 2NZIA 4X7TB 5J3HD 1M7IA 4MQ7A 3ZE2E 5C0EB 1ZHNB 3PHQB 1RIVL 1ZLUK 4FFVC 2Q20A 1TCRA 3RQ3A 4NZRH 4XRCA 5E9DE 3WN5B 3VXSE 3G6AA 1XGYH 3F58H 2DQEH 2Q86A 3S88H 5ISZA 1XIWD 3QI9B 3ZMRA 1U0QA 1HH6A 2V2XB 4QCIB 2VSDA 3RDTB 2ICWI 3VXQB 4TSCH 5D5ME 3BPOB 4HQQL 4NP4L 4KDWA 3O4OB 3RWDB 3QQ9C 4NHCL 5T1KB 1YEDA 1SY6A 3T77A 2HRPH 4HJ0C 3QDGD 5D93B 1QFPA 1QNZH 5IBTL 4LIQE 4X7CC 3VMNA 4D8PA 3AY4C 3TJEL 4FQIH 1FG2A 4ODTH 5E2TH 3TN0C 3ARBA 3Q5TA 2XQBH 3IKCB 4QXWA 1YEIH 3FL7A 2NY1B 1LEIB 3VWKD 2PW1B 1NBYB 4KTEL 3IFLH 4D9QD 5F7FA 4HAGA 4FQJH 4OLVL 1KG0A 5HJ3A 3D0VA 2V5SA 3ARGB 5SWZE 4GQ9H 5EUOB 3VWJD 3ZTNL 1A6WH 5HDQL 2CR3A 3FONA 1KPVB 1LO2H 4K3JH 3C8KA 5AUMA 1S7QB 4OGZA 1TPXB 2ZG3A 5IHUH 4BH8A 4XVTL 1EERB 3VXMA 2IPTL 4OZIE 2WP3T 1OTSD 2HT2C 4PRAA 1ORQA 3WFHB 5C0IB 3EO9L 1N0XH 1T2XA 5K59F 5J1SC 3N50A 1MAJA 1CGYA 1L0XA 1A0QL 1OAZL 1KJVA 4MQXD 3RU8H 1G7PB 3IXTB 5FB8A 3CZFA 2W38A 4KK9D 4OV5B 2XKNA 5IR1A 5KAQF 4QY8A 2XYCA 3IDMB 2R1XB 3UP1A 4BQ8A 5IMKB 1PGRB 2APVA 1BREA 4GAGL 4ONFH 1NCCH 1CFNB 1DP0A 1BM3L 4NM4L 4MAYA 4WU5A 2VSCA 4D0CB 3BP7B 1AIFB 3VFNB 4LRIC 4UV7L 4KDVA 1J8HD 2GJ6E 4YFEA 3O9WB 3FN0L 3TT1H 4MNHB 2Z9TA 5C0AB 4L29A 4KMQA 3SE3A 2IBGA 3P2TA 5SWSA 3SE8H 4GXVL 1QR1B 4GMTH 4UQ2A 3UJTH 4U3CA 3S5LB 2APTA 1U41A 2VISB 4IRZL 1U8OA 2A1WL 1T1ZB 1IRAY 3SDDD 3C9NA 1X4YA 2O5YH 5H8DA 3WKMH 2AI0L 2WSKA 1K8DA 2PKDA 1JV5B 2E27H 1PEWA 2ADIB 5T1DL 5FCSH 1S5IL 5ITBL 1U58A 5I19L 1IEAA 4YHML 4U0RB 3EUUA 2DMKA 3TIDB 4EQ3A 3GJFH 4HSQA 1T1XB 2KQMA 3MYJA 3QI9D 2DTML 3NA9H 1V3LA 4QXTA 1GGYA 5L0QB 3QRGL 5D7JB 1WVZA 3QUYC 5DJCB 4PB9L 3RDTD 4U1GB 3QDHA 1N59B 3WIHH 2A77L 5IF0B 2MQCA 5LCVL 1WC7B 2YRPA 4ONGH 2VO5A 4LVHB 1G9NC 5T1KD 3A6BL 3TCLA 3I6LD 2PCPB 4O4YH 4CJ1A 5DK0B 2VWEC 5E9DA 3S8WA 1AJ7H 3CC5B 1FHGA 3LRGA 3L9RA 5D1QC 4NSKA 5DHVB 3RY4A 1QBBA 3P11L 1RV6X 3QUXD 1S78C 2E7HA 2EDQA 4OBRA 4CDGC 4NZUH 5HGDA 1FL6B 5J6GA 3HG1D 1CICC 5CGYC 1DLFL 4XVUD 3KYOA 3IF1B 5D7LB 1I1AC 3ARGD 2YN5A 4IOFD 5GPRA 5AWNL 4XMPL 5CD3A 1WFTA 3ZE0E 3OGCA 4DCQA 5KBNC 4M1DL 4U6XB 4AQOA 1RFDH 2APWA 5GS1A 3VFOB 3LKRA 1ZSDB 1GGIL 3WIFA 1HCVA 1A1NB 1MY5A 1T66C 2YBRA 3MRNB 1S8DA 3FQUA 4H1LG 5DJ0B 1LEKB 1NGPL 5KSBB 1QLFB 4LARH 5TDOA 2J7LA 4DTGH 4PJ9B 5TGBA 1SEBB 2DB8A 4LLYA 4ERSH 3UJJL 3JVGA 1C16B 2DQTL 2OXHA 2DF3A 2EXYD 4WHDA 4QHUA 3MJ8A 3X11A 1GIGH 5D7KE 3EYVB 4OBSA 1CGTA 3NIFF 2ARWA 2H26A 4JKLA 1P4LB 2CUHA 5JR1H 4BSVB 1QBAA 1NEUA 1CDHA 2BHYA 2VAAA 2F19L 1I85A 3MUHL 4YXHH 4YR6A 1I3GH 4P9HL 3K8KA 5HY9A 3S3JA 1RJCA 4DUXA 3VXRB 4H5SA 3QO1A 1EFQA 5MEPA 1G7HB 5EU4B 4KKLC 4X6CB 5D70H 3F7QA 3VA6A 4NRXA 4JDZA 3HPJB 3IDYB 3O9WD 3QWOB 3MOAL 4FQQB 4R7NA 4FMFA 4P4KB 2YEZA 1SJVA 4QRSB 1JHLH 4X5XA 3TH3T 4AH2B 1OY3B 1K6QL 3OGOE 1F4WH 2HFEA 2HFFB 5IBUB 2X9YA 1CL7H 2EDOA 4QHNB 3RWJA 4L4VB 4XPFH 4YNYB 3HLAB 5EZIH 4JY4A 4R7DA 4M1GH 4EN3C 1I4FA 1PYWB 1WEJH 7FABL 4HX1A 1EV2E 4KU1A 5JW4M 3R06A 5IVNA 1D5XA 1GPOH 3OXRB 5C08E 5CUSH 3ME0A 3WEXA 1MH5A 3BZ4B 1I7ZA 1BIHA 2DQGH 4HJJH 5D7JD 1GH7A 1KYOJ 1VESA 4JFHE 5JW3H 3BDXA 2QSQA 5F3HB 4MCZA 3VGEA 3VA2C 3OKLA 1IGFL 1L0YA 2GHWB 4NDMB 5HBBA 3IJHB 4YDVA 1U95A 3K4DA 4QHMB 4OKDA 4NQSB 5CINL 5EULV 3X12B 1DL7L 1JN6B 2OQJA 3TPUB 4CL7A 5JMRA 4ZUSA 5ICXB 1JYWA 5GRYA 4ODBD 1FNEA 3RWIA 4JB9L 2VB5A 3TZVB 4IBLT 1JCKA 1OGTB 2A73B 3T3MF 5IROC 3VXUA 3SGJA 4L5FH 5A16B 2E3VA 4JFPB 4H88L 5D7LD 3N1MC 1DTUA 1N5AB 4EVNA 1W0WB 5DO2D 4XWOC 3ZT6A 2HMID 4S0SD 3GSOA 3T0EE 4ZOCA 4MXWL 1KTLB 4X98B 1QUNA 4TSAH 4NFBA 1C12A 1EHAA 4PJXE 3TCXA 4L3AA 2DJSA 3PP3K 4CMHC 1M4KA 3MCG1 3QUZC 4LBEB 2HTKD 5JHDD 3AS1A 1MVUA 2X4UB 5F88B 3K1DA 1U8MA 4HK0B 1RU9L 4PJ9D 4PJHB 3BQUC 3N85L 4YFLI 4NKIH 4WWKC 3FB6B 3L3HA 1W0VB 2BOCA 4IS6B 4Q6IC 1MQKH 4JFXA 4JRYB 1AGBB 2P8PA 4NN7C 3OJMB 4X4XB 3CVIL 2OK0L 3IB4A 3GMLA 4NRYB 1X7QA 5IG7B 4UT9H 5A2JH 5KVDL 5IJVA 3VXRD 4N68A 3R1GL 5DMYA 5LGHL 3WLWD 3AS3A 1QFHA 3T1FA 4OIBA 4WEBL 4PJFB 5DJ2B 3DHMA 4YDIH 2CJUH 2CUMA 1OAXL 3S6CA 2MFNA 2ZUSA 4Y2DA 2I25N 3WL9B 3QRFM 3I75A 4P4KD 3CMOL 4LPWA 3C8DA 5HYJB 5B22A 2C4XA 5DD3L 1AQKH 4IMKC 2F8OA 5BZDB 3FB5A 3HUJF 1IL1B 3H42H 4R4ND 3BP4A 4KK6C 3U7YL 4NCDA 4U1NA 4G6KH 1D9KC 3S37X 4KMTH 4TVPH 2GFBB 3DX7A 2NXYC 4BSJA 2ZUYA 3MRMA 1ADQH 5T1LB 1T21B 3JWNC 1UM4H 2DKUA 4WEUD 3RWEA 4JVPA 3C5ZC 1NUGA 2J3SA 1L7IH 5KTEL 3MYZA 4U1MB 4ZG1A 1A6VH 4FA8A 4MYWB 4ZOBA 4FFVD 3RTQC 1YMHA 4JQXC 5C0CE 4MJ4A 4ODVL 5DMKA 2D03L 4U33A 2HJFB 3SGEH 3DX8A 2W1NA 5E1AA 2X70B 2FO4A 4HWZB 8FABB 3F7YB 4BFEA 4PJDF 5F3BB 1CLZH 3CCHA 1I75A 1KCKA 2YXMA 2MJWA 5C07D 3QUYB 1X5KA 2F5AL 4LMQE 3VFTA 4MMXC 2EDDA 1BFVL 2IPUG 3AFLA 3RWGB 3U1SL 1I7RA 3QQ9D 2O61A 2CDFA 2AVGA 3TGXA 2PO6A 1H0DA 1T0NA 1TZGL 2YWZA 4HFWA 4EI5A 3NCMA 5B38B 4HJ0D 1ZLWK 3UBXB 4OKVA 1IGCH 3KLAA 3EYUL 3TN0D 4AEFA 5D1QB 5HGGS 2HH0H 3TBSA 3IETA 2IADA 2QQKL 1HNGA 2FSEA 4OLUL 1ND0B 2HG5B 5SX4I 1OCWH 4P3WA 2P45B 5CEYA 5IVXE 1ORSA 1CICB 4XC3L 5DC0A 2IEPA 4YIQB 1H9VA 3O2DH 1I1AB 4X6DE 1QRNE 1RZ8A 3DV6B 5T3XD 2JJTA 3IXAB 1UH4A 1YMME 1R3IL 4KJYB 4OZGB 2E7LC 4KDTC 1SBSH 2ADGB 2N56A 3TWCH 4M00A 1S7VB 1KCSH 4H8WL 5CILH 4P5KB 4JKMA 3ARBC 1EUUA 3BH9A 2BX5A 5KN5A 2HT2D 4PD4K 5EG6C 1JPTL 3I02B 5IMMA 3WFCH 3WUWB 2ARJA 4JRYD 3VXOA 5IB2B 5F7LB 1KENH 4I9WE 5TDPB 4PJXA 3AXLB 4PD4J 2I07A 1KJ2H 1SM3L 3F7RA 4I3SL 4FABH 4DAGL 3QA3A 4YX2H 5ACZB 2FX8H 5GJSL 3MV8E 3RA7L 3CH1B 4PBWD 2X4SB 3HE6C 1SJEA 2ICCA 4YHKL 4TOYH 1CE1L 1OAKH 4M6NL 3E6HB 4HXAH 2H2SD 3FFDB 3MNWA 4JDVA 2BERA 2FZ3B 4UNTA 2I9TB 4YQXL 1MWAB 3ULVE 4X8JA 5E70A 2VDPH 2X1XR 2YD4A 4MNGE 3QHZL 2R0LL 3C09C 2WQRA 3S96B 4X7SH 2Q6WB 4IMLA 2SEBB 1A7OH 1RZKH 2CLRA 2GJZB 2UZIH 4U2ZA 1FL5A 2IFGA 5T1LD 3NBNA 3C5JA 1P6AB 1JRHH 3K74B 1P5UA 1WIPA 2A2QT 2AJUL 2X9WA 1JF6A 4Z7NF 5EORH 3M8OL 2ZSVB 3W9DA 2IQ9H 2X4TA 1YC8A 4XP9L 5A2KH 4LSTH 4TVPD 1DR9A 4WNQA 4PJ7E 3VGAC 3VXPB 3QUYD 4JZNA 1V7ML 3EAKA 4L8DA 4X6EB 3QCUH 3GO1L 2FD6H 3QIWC 1OPGL 5C9KA 1U8LB 4P5TA 4PGDA 4LPYA 3FT3A 1NFDF 2VLME 4KQ3L 4X6BB 1EHNA 1U8HB 2HJLA 1NCDH 4ZTOL 2JB5H 1FNFA 4XVJH 3HMXH 1QEWB 1X5JA 1S78D 1RI8A 4F7TB 2OL3A 4Y7MA 1YEEH 1G0DA 3MRQA 1CT8B 1TITA 3BE1L 4EI6B 5I1IH 3MNZB 1CICD 1IBGH 3PWUB 5CGYD 2APXA 2H1PH 4H20L 2FRGP 1NC2B 4OZFH 4ZDHB 1I1AD 1DBBH 2M1KA 3TNMA 4RDQG 3U9PH 2WY3A 2R0WL 5K33A 2AEQH 5ANMA 3BKCL 3BWAB 1D3CA 2D4FA 4IHOB 1DQJB 2IALB 1U8KA 2LTQC 1P9MC 4P23B 4QRTA 3P0YH 2YD1A 9CGTA 3M17B 1T66D 4YK4C 4CMHB 1VCAA 3H7BB 3QQNA 4H25B 4NZTH 4MJ5A 4XGZB 1OP3K 3WNLA 4ZFGL 3RRQA 5C0BD 2E9BA 4X4YA 1MCQA 1EDQA 2VL5A 4JO4L 4GUPB 4JG1H 4X6DA 1TZIA 1QRNA 5GRUL 1YMMA 5E8NA 1E4JA 2ZNXA 3VFVA 1OAYL 3V8OA 3PF2A 4Q6IB 4TPRL 2VXTH 5D1ZC 1FIGH 1OGAB 1ZS8B 4HGWB 2LU4A 3EJJX 4JRXA 3CXHK 4BZ2H 1AXSA 4NN7B 4L9LC 3TYFA 5KG9A 3MBXH 1RVFL 4PTTB 5E00A 5CJ8A 2XKUA 4ZO6A 4LSSH 3BGFC 4S0TD 2JCCE 4UOJA 2Z8SA 3C5SA 3RWFA 1TLKA 5FYLE 1HHJB 1NMBH 3I2CL 5FM4A 3CXHJ 3N9GH 4CVZA 1OOAA 2A38A 4KKLD 3VFWA 5D7IE 1VEPA 3D2UA 4LP5A 1MCLA 1NLBH 2W0KA 5E6ZA 2RCSH 4NYLB 1LP9E 2XZCL 5IVZA 4N5EA 3LKOA 3MRKB 3QHFL 3DECA 3KR3L 2H3NB 5CIPA 1PFCA 3SKOB 5GGTL 4F33B 2VH5L 2NW2A 4M8QB 1D9KB 1CFTA 2WAHA 3Q6GL 4RMTA 4P9MH 3GBNL 2NXYB 4EN3D 4Z7UB 2R8SL 3P9LB 1BF8A 2DN7A 3NABL 4ZTPL 1N6QH 1RUQL 1S7RB 2BVEA 4G7VH 4ZNCD 5HGAA 5I8EB 5GS2H 3ARPA 4N1CA 5FM8A 1WFOA 3C5ZB 3GIVB 1IC7H 1GGBL 2EDWA 3FMGH 4GSDL 4X99A 2EKSB 1S5HB 5A2FA 1ZT4B 4QYOA 4HUXB 1A22B 2W9LA 2B1AL 3QEQA 3RTQB 1DQDH 1IFHH 2Z35A 1P7QA 1HOCA 3DO7B 3OZ9H 1QO3A 3DO3A 5DRZB 4WW1A 1OSZB 5GS0C 3T0BA 4TTGA 3UXFA 3LN5A 1S7WB 4PRIB 5D71H 1DN0B 3P4OB 2NY7H 4I2XE 5CZVH 2LFGA 2DWEB 4BFIB 3THMH 3U4EB 4S11A 2P48B 5DSCB 4MQ7B 2OM5A 1G7QA 2XA8L 2IBZY 3CFEA 1F3JA 3OJ2C 1JTPA 4PIRF 4Y88A 3G6AB 4UIMB 1ES0B 2V2WA 3U82B 2Q86B 4AG4L 4Q6YA 4V1DE 5D2LF 2V7HB 3VGFA 1KEMH 5FUZL 1NC4A 1YYMH 1J7VR 2HN7A 3K2UH 4XWOD 3U46A 3LIZL 4MLSA 5ALBL 3DTXA 5BQ7A 4Q2ZB 3U0TB 1IQWL 3S7GA 1AQDA 1A21A 1LO5A 3C87A 3KPTA 4IDJL 4KVNH 3PGFL 3QUZD 2VXSL 2WP3O 3JXAA 2BNQD 2FECL 3LPWA 1G84A 2GITB 4U1HA 4YHZH 3ARBB 3BQUD 1FAIL 2V5RA 4WWKD 1UWGH 1HZHL 4O5LH 3O6ML 2B2XL 4I3RL 4ODSH 3G5ZB 3HR5B 4JFDB 4ELKA 1JGVL 1A6AA 1QPXA 3W11C 4DGIH 1PG7X 5JMOC 4LCWB 3QUKA 4WFFD 3A6CL 1JHTB 2FH6A 2ITCA 4RFEB 3WV0A 4RSVA 5DD0H 1A6ZA 4TUKL 1J9CT 2DYPA 2VDQH 1M1SA 4OGXL 5DTFB 4QHKJ 4HUVB 1CDIA 1YYLH 3VD5A 3PIQB 1J1OL 4XC1L 1ORQB 4K3EH 1DBJL 2CIKA 2EYSB 1RZIA 1X5ZA 1MHEB 1LO3L 3DI2B 4KK6D 5F8RC 4JQIH 1KB5H 5C09A 2JCCA 5BJTB 4TQEH 4HEME 2GY7B 1D9KD 3C09B 3KPRE 1AXTL 2BCKB 3JSSA 5FB8B 3H0TA 1CZ8H 1QHOA 2BNUB 4UV4H 4XXDA 2DAVA 4XCCL 2NXYD 2XKNB 3A67L 4NQDB 4DWHA 3V4UH 3D69A 5J6HA 1KTDB 3I6KA 3P30L 15C8L 4DKFH 4MA3B 4ODUA 4Y19E 1NDGA 4PJCF 4WU5B 1ZVSA 3C5ZD 4WI9A 5TJWK 3U30C 4XP6L 3QXUA 4KQ4L 4Z95H 1EO8L 4HEPG 1P1ZB 4XI5C 2ZKHH 3RTQD 5IQ7L 2X7LA 4HIHB 2VQ1A 5F93C 1JWSB 1FP5A 2ITDA 4BA8A 3D85B 4X5WA 4FQ1L 3VGAB 4PRID 3CVHH 4UQ2B 4JPVL 5JQ6L 5IESL 2EDEA 4R2GC 1KGCD 4WTXA 1BZ7B 1VEOA 5C71A 4G8EB 5TE7L 3B3IB 1U92B 3QIWB 4YHNA 1D5MB 4HGKC 5CZXC 4P3CL 4IRSC 5EDXA 3LB6C 3UPCA 4OF3A 3OKNB 1H3PH 4O58L 2JJWA 2YA0A 1B0WA 4N0UE 5D5MF 3L7EB 4P2RD 2AJVH 2UWEB 5GHWL 3VU2A 4OFVA 3MRHA 1CGSH 3MV9B 1OLZA 4FQXC 3ULUE 3ARQA 4HKZA 3MYJB 5EU3A 4HLZG 1AGCA 4QXTB 5FF6B 1TMCB 3DUUB 1K8IA 1ZANL 3E0GA 1UB6A 4HW6A 5KSAA 5IWLA 1JMZA 4I2XA 4IDLA 1TJIH 4GRWH 43C9B 4I5BB 3FB8B 2AJ3A 4V2BA 4YFLF 1U8JA 3NFSL 1FFOB 3P4MB 5HGHA 2HKHH 4F8TA 1MIEH 3MMEB 3G9VA 2L0DA 1QSED 3SCMA 1CS6A 5C0DA 3KPOA 4BH7A 1JP5A 2LTQB 3ARRA 3L9RB 3EYFB 3PL6A 2VZVA 3TVMC 4YK4B 1CBVL 1BQHG 1GC1C 4N0RA 1GAFH 3OJVC 3TT3H 5B39A 3PJSB 5D8JH 5AYUH 4U1IA 4I0PA 5L2KE 5CJQL 1J1XH 4JFDD 1JFQH 3MLZH 5J6GB 1EJOL 3UTTB 1T83A 2FLBT 1EXUA 1OD9A 5I1JH 2MHAA 1TTUA 5I17B 4OF5A 4XNZC 4LCWD 5DLMH 4OZIF 5D1ZB 5I6XC 2BVTA 2H6PB 4BFGA 3C2SA 3QHTC 4L9LB 4FOMA 2R2BA 4DK3A 4Z5RB 2W9EH 5EN2B 5TPWH 5DD6A 1S9YA 4MB4A 4U7KA 5L9DL 3UO1H 3BGFB 4NC2B 3HE6D 2RR3A 3CNKA 1S8DB 3EYQC 4X9BA 2XT1B 4Q9RL 5KVGH 1DEDA 5FYJE 3NACH 3G08A 2VDNH 4QHLA 4XVSH 1J12A 2ESVE 3NAAH 5TGBB 5HHXH 1FZOA 4J7RA 4MX7B 3Q1SL 4M5ZH 1S9VA 1KXVC 2R2CA 2EYRA 1HSBA 5JXAH 4NQDD 4Z7OF 4PR5B 2H26B 4FZEH 1O0VA 1JZ2A 4NZRL 5HHNA 4NQTA 5C86A 3TA3A 1BZ9A 1XGYL 1GGCH 3F58L 4YR6B 1IT9H 2DQEL 3WIIH 4OI7A 1X5GA 3S88L 3GEWB 4M6MH 5JTWA 3G5XA 3BKYH 5T1MB 1FFNA 4GKOA 1CDCA 4NRXB 4TSCL 4KUCD 1T0MB 3RI5K 1HQ4A 3UTPE 4IOIA 4F7PA 2AQ3A 4KROC 2YZ1A 3KPRA 5C92A 1A3LH 1GZPB 2YEZB 1H15A 4YUEH 3OMZA 5F6HJ 3Q6FA 3V6FA 4X5XB 3FRPG 1HDMB 2HRPL 3D85D 4J3TA 4IIQC 5I16B 1QNZL 2P5WB 1CGWA 3MJ9H 5DMGC 2W9DH 5DRWB 4FQIL 3BP6B 3MPCA 2NY3C 1FGVH 4ODTL 3WKNA 5CGTA 2XQBL 3DBXA 3H9SE 1R3LA 1YEIL 5BV7H 3QIWD 1J8KA 3NFPA 4PJIE 3IFLL 4WW2F 4KC3B 2BDNH 5IW1A 1HHKB 1X5FA 1K2DA 1LDSA 2BY3A 2R0ZL 5F1NB 1XGQA 2Z8RA 3MC0A 4NHUB 3VFUA 5IEKB 3GFUA 1HK6A 3P9MA 4GQ9L 4CGTA 1FLRH 1MUJA 3MV9D 1A6WL 3FQTA 3HE7A 4OF8A 5IB5B 3AAZA 1I7ZB 4OLZH 1IGMH 1E4XH 1LO2L 2YA2A 3CU1A 4K3JL 4ETYA 1A6TA 4YHLH 1P7KB 5IHUL 3DVFA 2COQA 5HI3C 1C1EH 1BJ1H 5ID0B 3OKLB 2XACC 4YO0A 1Q94A 1Z6JT 1E6JH 5D6CA 1ZEAH 4YDVB 1U95B 5IHZA 1N0XL 2A74B 5HHOE 4N0UA 3BOVA 1I3UA 4FQHB 3GK8H 4JN2B 4HH8A 4EUPB 4P57B 3RU8L 5J57B 1R3KA 3GSVA 5EO1B 1X4XA 3W5MA 1S7TB 1FNEB 1XZ0B 3FRUA 3GM8A 3RWIB 1FAKT 4FFEX 3RHWK 1J0YA 3U2SA 1IAMA 5BRZD 4QRPE 3V7AE 1UT9A 4ONFL 3UTTD 5FM5M 1NCCL 1TTGA 5KANI 4M03A 4M9OA 4BZ1H 3H3KA 3DUHA 3FN3A 1DQQB 4OUUA 4G42B 5D2NA 5JLZA 3JWOC 2Z8WC 5D1ZD 3GSWA 4JY6B 4QOKE 3TT1L 1E6OH 1FL3B 3N1FC 2B0SH 4XCNB 3GSNB 3SKNA 4M5YH 2YUVA 4HWEH 1DBMH 4MJ6B 3RPIA 3UPRA 3D87B 1GOFA 1Z3GH 5CP3H 5FO7A 3SE8L 2F53B 5L2KA 4Z7VA 2F54E 4GMTL 4HBQA 1U8IA 3UJTL 4LF3B 5FHAH 2YOCA 5IIEB 4LGSB 2ZCKH 3SBWC 2O5YL 3H3BC 4E42A 3MLXH 2K7PA 3UROR 3WKML 3O11A 3SPVB 5DUMH 3IFPA 3HA0A 3ROOB 2H32B 2E27L 2ICEA 4P2OC 4JFXB 2IBBA 5CGMA 5INCB 1MOEA 4X7EC 4WI8A 4NQVA 2E9JA 1X7QB 4UDTB 1R5VB 2CR6A 4PG2A 1XGUA 4PRPB 5H2BB 3NA9L 4MNQE 2X4PA 4A6YB 4GRMA 2H2PC 4PJBE 5F9WC 4H1LH 2YC1A 4LLUB 3WIHL 3OKMB 5BZWA 3V5KA 4PGBA 5E6IA 4C58B 4G8GB 4ONGL 2QSVA 1BD2E 3U30B 3U4BH 4HT1H 4UNVA 1OAQH 1ONQA 5SV3A 4UI2A 1YUHB 4O4YL 5MENB 4QF1A 3ZHDA 4ODXA 3NH7H 1VFAB 1AJ7L 3O41A 2BNRE 2Y4SA 4O51A 5I8OH 4XPTH 5ETUA 1YQ2A 1HHHB 3L95A 3CDCA 2GSIA 4FQCH 4H0GA 1T22B 3V0VB 5GS0D 1F6FB 3DX7B 4NZUL 4WVRA 4GO6B 4L4TA 4U6YA 4JLRA 1ZA6A 4R2GB 4PBVC 1DDHB 2GK2A 1ZOXA 2MKLC 3PG2A 3RWEB 4IRSB 4F9PA 3QIUA 4X7FC 2XV6B 5EB9A 4ZS6C 3MV7D 4GS7C 1QD0A 3P3YA 1RZFH 4HFUH 1MRFH 3PQYE 1RFDL 2P7TB 3H9SA 1CFQA 3DX8B 5EO0B 4JGMA 4LASH 2P24B 3QCVH 4JGUA 4FQXB 4LCIH 2OZ4H 1I8IB 1SQ2N 3R4DA 3CCHB 4LLVA 1HH9A 1R24B 3LPGA 3NCJH 4LARL 4DTGL 3ARDA 3VFTB 4LEOA 4ERSL 2H41A 5JDSA 1I1FA 2Y06H 5FYKE 2DDQH 1GIGL 5BOPA 3M1BA 1VA9A 5IFAH 4HFWB 4EBQH 1U2CA 4KTDH 3GJEB 3E3QA 4FFZH 2DLGA 4JHAH 4OKVB 3EYOA 5JR1L 1HXMA 4YXHL 2F8VA 3G6JF 1I3GL 5DS8A 3TO2B 3TVMB 3RGVA 2N7BA 2AEWA 1II4E 3PV6B 1KJ3H 5CEYB 1G6RH 3QDMB 2X05A 5D70L 2ENYA 3ZT5A 4N90D 3W11D 5CP7A 5JNYB 3B5GA 1RJLA 1RZ8B 4XNZB 1JHLL 4YE4H 2FYYA 5I6XB 3N1GC 2F53D 4QRPA 3NA4A 1A5FH 1T7YA 5DJYA 1F4WL 5FV2A 3R8QA 1CL7L 1CXEA 2E6QA 4G9FA 5GGRA 3WHE1 4OGAC 4YGVA 4YPGB 4FXKA 4XPFL 4NZDA 5EZIL 1U91A 4M1GL 3WFEH 1HSAB 4BKLB 4NBXB 1WTLA 3T4YB 5IMMB 4LQ1A 1WEJL 1UEMA 1A4JA 1D6EA 1MI5E 1QYGH 1R5WA 1XF3B 1FO0A 1I9JH 5K9QI 1XF2A 4XBPB 5F1OB 1EAJA 2NW3A 5F1IA 4F2MB 4HZLA 1DQLH 1GPOL 3FB7B 3FO9B 1MPAH 3LQAC 5GSRB 3GMOA 4UOW0 5CUSL 2Q8AH 1F8TH 5DXWA 2F54A 4PRPD 4HDIB 1ZVHA 2R4RH 1CN4A 4G7YH 5EIVA 4U31A 4M3KB 2DQGL 4HJJL 3KLSA 1NUDA 3S37H 1KJMB 2PN5A 1MFCH 5JW3L 2W92A 2UVEA 4N8PA 3CIQA 4G8GD 4MXVE 2BXZA 5KVFH 3HZKA 2XN9E 3QZWB 3FFCE 5F44A 2LE9A 3MNWB 1KCRH 2BK8A 3C6SA 4J12A 5EOTA 3G5YB 5EUKB 1KPUB 4XI5D 5MEND 4EZMA 3HR6A 4KROB 5GSVB 4LCUA 4X0KB 4XNMA 2MPAH 2UZXB 3GSRA 3KYKH 1IM9A 2AV1B 3I85A 2GW5A 3G5VB 3BJ91 4IIQB 1CDBA 4PJBA 4RNRA 2C9AA 4EJ1C 5DMIH 3O6FA 1FDLH 3GB7B 2F15A 3QFJE 2NY5C 4L5FL 4KTYA 4E41E 1BD2A 2FIKA 5I1AB 1J0JA 1SJHB 2B1HH 4OM0H 5CZXD 3EO1B 4IRSD 1F3DH 5C0JB 3LB6D 3S34H 3LS5H 1RPQA 4R96A 3WLBB 3E6FB 2BNRA 4ZYKB 4JZJA 2Z92B 4LLDA 5A2IH 1I8MB 4NRZA 4TSAL 1IC4H 2OMBA 1UENA 4ZUVB 5DR5H 1QG3A 4YBHA 4FQXD 1CVRA 3RY6C 5HPMA 1EK3A 3PABA 2DLIA 1I7UA 4JEGB 4R97C 1X6LA 2EE6A 1NH6A 2DQFA 3SKJH 2HT4D 4Q9CA 4NKIL 1KLGB 3JTSB 4GMSH 1MIMH 3MRPA 3ZDYF 3W0WB 2FO1A 1U8NB 1MQKL 5DRXB 2VITA 1R3HA 1DE4A 2JIXA 3FT3B 4PJAF 4DKEH 2X4RA 5BXFB 3C8HA 5HYSA 3AC0A 3PNWA 4W6WB 1NDMA 3OV6A 2G5BA 4NO0A 4UT9L 3TVMD 1ZHLA 3D0LB 1WGOA 1WIUA 5IVOA 2UVFA 1F4XH 1P2CA 2ADJA 3DROB 3QDMD 4YDIL 2CJUL 4QKXB 1TVBB 1T03H 4HS3B 4N8CH 1BFOB 3P40A 1A9BA 4XH2A 4LLQB 5K9OA 5ANMB 1AQKL 1BVZA 1ZT1A 1TQCC 3H42L 3KS0J 4PREB 4G6KL 4LHUA 4QRTB 1BIIB 4KMTL 4TVPL 4KJWC 2X44D 3KNBA 3EYQD 4C56E 1IEBA 3BUTA 1ADQL 4Y5VA 3LEYH 1UFUA 3FO0H 4XZUB 1EPFA 1UM4L 4RAVB 5DD5H 2FHFA 4H0IA 3VFVB 1BQSA 1L7IL 4WDIA 2R2HA 1FBIH 1JYXA 1RUKH 1A6VL 4NNXB 4LKCA 4P2OB 4MDIB 1EGJH 1I8KA 3QUMA 1NEZA 5KG9B 2PF6A 4Y4FA 2MQ0A 2YD7A 2CKBH 2WANA 3MROA 2IPKA 5B8CC 1VKXA 1CQYA 3CLFH 3SJVE 1NAMH 1KXTB 3NPZB 3C5SB 1FVEB 1IAIM 3B5TA 3DIFA 3KPMA 1PKQB 1CLZL 5IMOB 3OKOB 1IGYA 3UBXI 5HVHC 3FOMB 1MI5A 3X3GH 5F9WB 2EYTB 2VXQH 5DD1H 5ABDE 2QQNH 3STLA 4KROD 4M7KH 3MRCA 3ZE1E 3H6JA 4HIIA 1YNTB 3HNSH 2YRZA 4WI3A 3EZ8A 4L3EA 4HG4K 1C5CH 2VOTA 2C3GA 3VGBA 1IGCL 5B3JE 4F9LC 2VZTA 5DMGD 1F4AA 7CGTA 4ZAKA 2NW2B 2NY3D 3WE6B 2CKBB 2HH0L 2XN9A 3IS0X 4ORZC 4YHOH 3HUJB 3FFCA 3NIDF 3SO3C 1RULH 1Y0LB 4CADA 4HG4J 1KACB 4XPAH 1OCWL 1EMTH 1CE6B 2NTFB 4PJ7F 6FABH 4ZPVA 5HGAB 2Q8BH 1EFXB 3O2DL 4JKPH 4GS7B 4HKBA 4AIOA 1B9ZA 3ISWA 3BN9C 3QEQB 3BW9A 1SBSL 3X17A 3TWCL 3KXFA 1KCSL 5CILL 3QFJA 4F7CA 2Z35B 5F9JA 4WV1C 1JPST 5HI3D 1KUMA 1A2YA 3R0MA 2W07A 4NQCE 5T5NG 3WFCL 3W0WD 1UZ6F 4WHYG 5DVKA 3MO1B 4HS6A 3VFRA 5HYQA 4HKJA 1T5XA 1KENL 2AGJH 3MUJA 5J1AA 1KIPA 4PJDB 1J0ZA 2NY0C 3QISA 1AP2B 1PZ5A 1KJ2L 4WI2A 5DJXB 4FABL 4HWBH 4OJFH 1NLDL 1FLTX 3HRZA 4YX2L 4RCAA 1NJ9B 1UB5B 2FX8L 3JUZA 4ISVB 1JHKH 3ARWA 4M61B 2V2WB 1B4RA 1OSPH 3X14A 4AT6A 4TOYL 1OAKL 4OZHA 1RZ7H 4HXBH 4Z7WE 3P77A 4FG6C 4U1SA 4HXAL 4MJIB 3G6JA 3OG6B 5I0DA 3MNVA 2VDPL 3LQAH 3Q2CA 5BQ7B 4LLMB 3ARED 2BY2A 4V3EB 1MCWW 1XFPA 3WJLA 3I3EA 1LO5B 4X7SL 1A4KB 2V5YA 3RZCC 1A7OL 1RZKL 3T0WA 2UZIL 2YD5A 1NFIA 3LV3A 5FECB 3QDGE 5E2VH 2BRRH 3V9FA 3MRIB 4U1HB 4I48A 4LP4A 1JRHL 1OQXA 2C3VB 4JY5H 1BAFH 2C3WA 1WUNT 2GYSA 2XWBA 5E2UH 4OCYH 4ELKB 4P2OD 3TIEB 4R6UA 2FHBA 2YPKB 5IOPA 4O2FB 1A6AB 4DGVH 5CCKH 4YZFE 1BX2B 1JRHI 5EORL 3D48R 5GGTA 2IQ9L 1LP9F 4I18C 1RAMA 2J88H 3LKPA 4LSTL 4Z78B 2DYPB 2H2PD 4EDWH 1RIUL 1YEFH 5EC1B 4JJ5A 4N0YH 5J06A 3QCUL 1AR2A 2FD6L 2PTTB 3HI5H 12E8H 1PDKA 3OR7B 3PGDA 3PE9A 4NOBA 1NCDL 1YY8B 3QG7H 3SJVA 5MERA 2JB5L 4ZUUB 1AD9B 4PG9B 4XVJL 3HMXL 3IDIB 2YPVH 3S4SA 4W70A 4AMKL 1YEEL 3B2VH 2CQVA 2DIJA 5J6HB 3BFOA 5I1IL 1IBGL 2H1PL 1DFBH 1J11A 2LV4A 5EPMA 5CWSA 3EOAA 4QRRE 3IKKA 1EFXD 4WUUD 1DBBL 4MVBA 4W4NA 4JAMB 1XGTB 3U9PL 5DJAB 4ZS6D 2AEQL 5JW4R 2OJEB 2IAMC 3U36A 2BVPB 4FNLH 1WK0A 4ZFFA 1J8HE 2VZ3A 1ZHKB 3ARVA 3L3DA 3P0YL 2ICWB 1VFMA 3QFDB 5J12C 2ITDB 4X5WB 4NZTL 3ZYJA 4P46C 3UTZA 3MLTA 5KS9F 4PUBH 4R97B 2B4CH 2PW2B 5DUBB 3BH8A 2B39A 4JG1L 3K8MA 2R1WA 4QNPE 4E0RA 1C5DA 3QIUC 4HKXA 2VXTL 1FIGL 1S7XB 3ECBA 3KDMA 4K9EH 5E4IA 5EBWA 4BZ2L 4MZ2A 3NZ8A 4UUJA 3MBXL 1CG9B 4LHQB 4G3YH 1MCCA 4LSSL 1NFDB 3UTSA 4U1LA 4NQCA 4GLRI 1T2JA 2OTUB 1NMBL 3N9GL 4M1CC 4BM7A 1DVFC 4MJID 1E27A 1UB6B 3LD8B 1NLBL 2PYED 5FKPA 3QQ3B 3WHE0 1F13A 2RCSL 4LVEA 5HGHB 5HSFA 4Y5YA 4MA8H 1AR1C 1B3JA 4JFFB 3HPLB 2BMKA 3LKNB 4JDTH 3KPOB 4WFHD 1TQCB 1PG7H 3I6LE 4BH7B 5IQ9B 1FZKA 3LZFH 3L5XH 1M05A 4MSWB 2C4FU 1ZVYA 3DRTB 4P9ML 2YS4A 4JZOA 1T20A 1XIWA 4F37F 1UWXK 5FCUH 3OAUH 1OP9A 4YH6A 1N6QL 3P4NA 2VR9A 1LK2A 4BUHA 4G7VL 4R4BA 3FCTA 2VC2H 1IC7L 3FMGL 3GMQA 3TBVB 3GUTB 2EKJA 1G7IA 2V7NB 2P42B 1IEHA 1K4DB 5EUOE 3QDGA 1DQDL 1IFHL 2R2BB 5GGSY 1ZGLA 3V5HA 5B8CB 3OZ9L 4MHHI 3RP1A 1EEZA 3RIFK 1AHWA 4EOWH 3WJJC 1AE6H 3OKDB 3VWKA 5HVHB 3MLRH 5D71L 4QHLB 3CFCH 4JFEE 1Z0NA 3Q3GB 2NY7L 5CZVL 5LVEA 1MLCB 1JWUB 2AERT 3THML 2YPLB 5IK3A 5MEOA 1KLUA 5B39G 3VWJA 1HSBB 3MRFB 4ZFZA 3BIKA 1UM5H 3HAEA 4F7EB 1YDPA 5EFIA 5FOBA 4YEFA 1P7HL 3FHAA 5AAWA 5DUPH 5IB3B 3IU3B 1Z9OA 2GT9A 3EDKA 4MJ2A 4WI7A 1KEML 4UAOC 1YYML 1ZE3C 3SO3B 2E7BA 1KIUA 2VIRA 3G5XB 3K2UL 1WCBA 4CVUA 1FFNB 2OR8A 3KJ4C 4WWID 5CEZD 4U0QB 1FZJA 1AKJB 4MD5B 1WF5A 2KL6A 1SY6H 4IOIB 4JO2H 5JO5B 3RI5F 4F7PB 4E9LA 4X9IA 5C0AE 1NGZA 3Q6FB 4KVNL 3DHJA 5IV2B 2EC9U 4HIEB 2HYMA 3IAPA 1UG9A 4LCCA 4MWFB 3OL2A 5GGRY 4PGZA 1ZLUH 4YHZL 4OSUH 1UWGL 1S7UB 4O5LL 2Y72A 5FUOH 1HHIA 1MJ7H 2M26A 3VW3H 5IW1B 3BXNA 4ODSL 3EOTH 1FSKC 1RUPH 3NOIA 1J8HA 4GOSA 4DGIL 3DARA 4XPBH 3BDBA 2NY0B 4WW2C 3SQOH 3WUZA 3MJ7B 3P9MB 1MUJB 1FQ9C 5DD0L 1EZVX 1AO7B 3RL1B 5CBEB 3DYOA 2VDQL 4M8VA 1AY1H 3OAZH 1QZ1A 4XAKD 1C08A 1FN4A 1OWRM 4BELD 5ACLA 3SDDA 2D0GA 1YYLL 2VDOH 1OT2A 1ACZA 5EU7E 4K3EL 4D0DB 5C0EA 2WBKA 4JFFD 1ZHNA 1E4KA 3PHQA 5GRJH 4B41A 5CJXC 2DKSA 3GMMB 4JQIL 1I8LA 1KB5L 2OSLB 1UM6H 4TQEL 1IM3B 1HILB 5C0GB 3GSVB 1G7LB 1FORL 4H8WC 1CZ8L 4UV4L 1CD1B 5DVLA 3U2SB 3QI9A 3RZCB 3V4UL 3SDCC 4DKFL 2A0LC 4GAFB 2V2XA 4QCIA 5BS0B 4PRHB 1OHQA 3ALWA 3RDTA 3VXQA 2DKMA 4HLZH 3GKWH 4UU9A 1S3KH 3QXDB 1NMAH 4LSUH 5D7LE 3O2VH 5D2NB 4Z95L 5T1KA 3RL2B 3O81A 2ZKHL 3VMPA 3CFJA 4XMLH 2CUIA 3DRQB 3KWWA 4JQVA 3UPRB 1IJ9A 1FC2D 2ATKB 3IKCA 2OI9C 1WICA 2H9GB 3QUXA 4I18B 4ZOEA 4P2QE 1LEIA 1NBYA 3CVHL 1VEMA 1U8IB 3BT2H 3HG1A 3QT2A 5B4MC 4M3JA 2YPLD 2VQUA 2QTEA 3F7PC 3ARGA 2LU3A 4GRLC 5GQBA 3L1OH 5EUOA 1H3PL 4X5LA 1H3XA 5ESQA 4NC1E 1KPVA 4PY8J 4NQVB 5M95B 1CD9B 2AJVL 4DUWA 1M7XA 1CGSL 4OF0A 4WRLA 3H9YA 5DDHB 4UMGA 1H3UA 5T3ZH 1HXYA 4R9HA 3VXRE 3WFHA 5C0IA 1TJIL 1KC5H 1AKJD 4X6CE 4G5ZH 3BISA 3KPQB 2HKHL 1MIEL 1G7PA 4PJIF 4YJZL 3PWJB 1QFUH 3J7HA 4U7SA 3V6OE 5CMAB 4PJCB 4OV5A 2IAMB 3BN9D 3IDMA 4OLEA 2R1XA 4MCYA 3O41B 5I2IB 3VDAA 4O51B 4KJPC 5ETUB 1A1OA 1L6ZA 5J12B 4JO3H 2X4OB 5JIIA 1GAFL 3TT3L 5D8JL 5AYUL 4L4VE 1AIFA 4P46B 3VFNA 3L5IA 3ZZ1A 4LEXH 4TRPH 4BJLA 1J1XL 1XCQB 1JFQL 3MLZL 5ENWB 5TQ2H 3ZL4L 4MGXA 5DT1H 5DWUH 5DEGB 1KBGH 3O9WA 1UJTA 4MNHA 4M62H 4MB5A 5I1JL 2NY0D 4ZSOB 4LIQH 4LDLB 3DSFH 3QIUB 5DLML 2QJDA 3ZDZF 2OXGA 5HHPB 1PQZB 2C7UB 1EH9A 3I84A 3GMPB 1AO7D 1QR1A 1T89C 3O3AA 2K7QA 1JF1B 2GTZB 2VKXA 2W9EL 5TPWL 3NMEA 3BPCB 3S5LA 4WFGD 3UO1L 1HHGB 2VISA 3VRLF 1T1ZA 1GOGA 2G60H 2ICES 5KVGL 4XAWH 4LLVB 3NACL 4FG6D 4NBYB 1DVFB 5D5MB 2VDNL 1JV5A 4XVSL 3NAAL 2ADIA 5HHXL 4K2UH 3UC0H 5JDSB 4J8RB 4M5ZL 4AENB 1I1FB 1QVOB 1JNNH 2F5BH 2JTDA 5DEFA 3QWRD 3TF7A 1WZKA 1XF4B 5INDB 3M1BB 5H35B 1G9MH 1EBAA 5JXAL 1T1XA 1WCQA 4NNPH 2IANB 3RZCD 4XHJC 4YC2C 2ID5A 4FZEL 3EYOB 1CTOA 1R3JB 5D7JA 5BS0D 4UT6H 1GOHA 1GGCL 4OD3H 4PRHD 5DJCA 1QPPA 1IT9L 1QHPA 3WIIL 5DS8B 1YA5A 5IF0A 1KB9K 2VABB 3RGVB 3L5WB 1WC7A 4M6ML 4P99A 4JM4H 4OCRH 3BKYL 3T0EC 4PLKC 2IJ0C 1IZJA 1JI1A 2PCPA 2ZZUT 5DK0A 4XMKH 1JYNA 5CP7B 3LHPH 3IFNH 3CC5A 1A3LL 4YBLC 2W65B 4YUEL 2J8UF 4G80A 1KSRA 4G6FD 5DHVA 5T3XE 3B8YA 3MJ9L 4J3OC 1FL6A 2W9DL 3TM6A 4YGVB 1WT5A 1FGVL 5DURB 1L6XA 4XXCC 4QLRA 5BV7L 3IF1A 5D7LA 4PJHE 2ARJQ 1IQDB 2QQQA 2BDNL 3HS0B 4XP1H 2Z91B 2A6JB 2A83B 1MEXH 1MLBB 4XBGB 1R5WB 3VGGA 1N64H 5ILTH 1FH5H 4AEHH 2NW3B 5F1IB 4JRYE 2NYYC 4U6XA 4GKSB 3O6LH 3NZHH 3VFOA 1RZGB 1FLRL 4GW5B 3LS4H 1A1NA 5DJ0A 3MRNA 2QHRH 4OLZL 1IGML 1E4XL 4S1DC 5JHDA 1LEKA 5KSBA 1QLFA 4JREC 2I9LB 1S9WB 5EU6B 4YHLL 2X5PA 4PJ9A 1SEBA 1C1EL 1Q9WB 4UAOB 1C16A 2FEDC 5E8OB 3HZKB 1JZ3A 4M4PA 1RZJC 1E6JL 3CLEH 3KJ4B 1ZEAL 3QSKB 4AK1A 2RBLA 1OB1B 3EYVA 1E4XI 3V7AG 3V5DA 2IAMD 5HYJE 1ULVA 1N26A 2VXUH 3GK8L 5JOPE 2ZUQC 1P4LA 1BJMA 4BSVA 1Y18B 4KK8C 3W82A 3VXRA 2YUXA 4P46D 3O6FB 4K7PX 4LCYB 5EU4A 4X6CA 1AGDA 5IJKA 3HPJA 3QJHA 3QWOA 4BZ1L 1ODAA 3MJ6A 3O3BA 3DOSA 1YN7B 4YAQB 4P4KA 1LE9B 3V6OA 2UYLB 4QRSA 1CWVA 1MRDH 1WZ1H 1FSKB 2Z93B 3VXSD 3MRRB 1E6OL 4U3HA 4W6XB 3RKPA 4AH2A 2CLVB 2B0SL 2HFFA 4M5YL 4HWEL 4QHNA 4WW2B 1DBML 5I75C 5IKCA 1Z3GL 4YNYA 3HLAA 3V95A 3BUYB 1FNHA 4M1CD 1PYWA 1DVFD 1I7UB 5FHAL 2ZCKL 3F6IA 3FQRB 1NCWH 3MLXL 5I74C 4EDXB 2YKLH 1AR1D 3OXRA 5DUML 5HHMB 3TFKC 3RWHA 2ZOKB 2VITB 3BZ4A 2IAND 1JNJA 3IDNA 1K4CA 1B0RB 2VWEE 3AMLA 3FN9A 1NDMB 3ZYOA 2DQCH 2BOBA 4ETQB 1Z9LA 5DZLA 1SEQH 2LAGB 2VLRB 4NDMA 1P2CB 3IJHA 4U1JA 3SDCB 3PP3H 5C07A 4QHMA 3X12A 4NQSA 1FNSH 1JN6A 1OD7A 3TPUA 4HCRA 5SWZD 5ICXA 3U4BL 4HT1L 4GH7B 5TQ0H 1OAQL 1PSKH 4JG0H 1TENA 4HV8A 4MZ3A 3NH7L 3MA9H 4QTHB 1CGUA 3D39E 1YPZE 4OZGE 1G7MB 1OGTA 2A73A 5I8OL 3AY4A 2P5EB 4XPTL 5DURD 4CU8A 3TN0A 4FQCL 5A16A 3FJTA 4JFPA 2OI9B 4CMMB 1QFWI 3V6ZA 1W0WA 4DZ8B 1D5BB 4WHCA 3PWPB 1HN1A 1MCSA 2VLJB 4MS8C 1MCIA 4J3SA 5HYSG 1KTLA 4N8VB 4X98A 1P84J 5F96H 2R2HB 4GRLB 3RNKA 4OFDA 1MFAH 4MQSB 4QT5B 1J87A 2WUBH 4LKCB 1SYSB 1RZFL 4FP8H 4LBEA 4HFUL 1MRFL 2WLZA 5EU6D 2X1OA 4NCC2 4UT7H 5F88A 3G6DH 4HK0A 1VKXB 4AYFA 4LASL 4PJHA 3QCVL 4LCIL 2OZ4L 3QJFB 3GGWB 5JPMA 3FB6A 2Q7YB 1W0VA 2GJ6D 5EH1A 4BQ6A 5CJOH 1EO7A 3T3PE 3UYPA 3NCJL 4ELMA 1F4HA 3SKMB 4ZUWB 4JRYA 4YFDB 1AGBA 1XR9A 2M2DA 2X9XA 4LPVA 4X4XA 5HDBE 2Y06L 5J0BA 2XZQH 2DDQL 1ED3A 5IFAL 5IG7A 1QBMH 4EBQL 4KTDL 5FGBC 4FFZL 4L3EB 4JHAL 5ITFA 4PJFA 4ZAKB 3WNOA 4K71C 3WL9A 5TDNB 4BSWB 4YXKH 3NGBB 4LRIA 1KJ3L 1G6RL 2WV3A 5EBMB 3V79C 3DJ9A 1EA9C 1NEZG 3WSQH 5BZDA 5C08B 1IL1A 4HPYH 5CZKA 4Z7QF 4MQXC 2D0HA 3QXTA 4F3FB 1CF8H 4YE4L 2WUCH 4EXPX 3FQWB 4G8IB 1IE5A 1A5FL 1C7SA 4V2CB 2OR9H 3OB0K 1TQBC 1MFBH 5T1LA 1RJYB 1T21A 4XPHH 3ERYA 3WFEL 3QULB 3DMMC 5HHMD 1UA6L 1XR8A 4R0LC 2DM3A 4HS6B 1QYGL 3WXWH 2FGWH 2GEEA 1I9JL 3VFRB 4GG6F 4HKJB 1FFPB 2AEPH 1DQLL 2DM2A 1U8PB 2HJFA 1MPAL 2Q8AL 4RA0C 1F8TL 8FABA 1W0YT 1GHFH 4KH2A 1YEJH 2R4RL 1PY9A 4G7YL 4K07A 5DVMA 1KCLA 5F3BA 2VLRD 1UWEH 3G04B 2ZUTA 3SDCD 2A0LD 4E5XB 2YD6A 1NGYA 1UCTA 3S37L 3QUYA 1MFCL 2NTSP 4OFYA 1S7SA 3KGRA 3O4LE 1JIBA 3OKKA 3RWGA 5KVFL 1PBYA 4LU5H 4OZHB 4Y89A 4U1SB 1KCRL 3G6JB 1TETH 5B38A 3MNVB 1L0QA 1HWHB 4PS4H 3UBXA 3D9AH 4YBLB 4N9GB 2MPAL 3KYKL 1FG9C 3D18B 1MCJA 2X10A 1VADB 5E0QA 2BHUA 2D9QB 5DMIL 3LV3B 3PWPD 1CICA 3LQZB 5B4MD 2VLJD 1NFKA 4KUZL 2B1HL 4LFHG 1RZJH 3UCRA 2ZG1A 4GW4A 4OM0L 4YIQA 3TEUA 4OD1H 3I6GB 1I1AA 3DV6A 2XWBB 3IXAA 3S34L 3LS5L 4GRLD 1Q9OA 4KJYA 2Y07H 1J88A 1YNLH 3DETC 2DMBA 2JF1A 5I66A 1OGAE 3WNPA 4P5KA 1IC4L 4K3HA 5DR5L 3W2DH 4WFFE 3LKPB 1V3KA 3I02A 3T65B 4JREB 3IT8D 1MJUH 5I1KH 3SKJL 5C0BA 3A0OA 4JJ5B 4M48H 5B3JF 5IB2A 2FWOB 5GRVL 3ARSA 4GMSL 5M7QA 1MIML 3QNZA 3AXLA 3NFNA 2A9MH 4DKEL 1D5ZB 5ACZA 1X3DA 3KLHC 1X5HA 2OL3H 4KJPD 1G9EA 2EDHA 1MQ8A 3CH1A 1KCVH 2X4SA 4R26H 1LK3H 3S4SB 1SVCP 2CPCA 4HD9A 1TCMA 1T80A 3EYSH 3K8LA 1F4XL 1L9NA 2AXFB 3E6HA 1N8ZA 3U48A 4Z7UE 3FFDA 2I9TA 2FZ3A 1MWAA 1T03L 5C08D 4P49A 2GSGB 4N8CL 4V3DB 3EOAB 3KHQA 1UQSB 3ARFC 4XHQA 3IDGB 1MFDH 5C0CB 3PGCA 3EO0B 2GKIA 3MJGX 2Q6WA 2SEBA 5FA4A 4PJ5B 1F45A 4JFHD 2GJZA 4NKMB 1PD6A 5I75B 3L3DB 4MDJB 2Y5EA 4OD2B 4KI5F 3FZUC 4KUCF 4D3CH 2R1YB 4EN3A 1H5BC 3LEYL 4RBPK 4NO2A 2R2EB 3FO0L 2F9BT 4PRIE 4GQPH 3MREB 3BH8B 5M94B 2KZWA 2XKSA 5DD5L 1KGCE 2FX7H 1T1YB 1JF5A 2R1WB 4FMKA 5I74B 3I9GH 4WENB 5DHYB 1FBIL 5I8KH 1RUKL 4Z7WF 4Y1AB 1WWWX 4Y4HC 1EGJL 1A7BA 4XHJD 5EBWB 1DUZB 2R39A 2CKBL 3BPNC 3KPNA 1AI1H 4DW2H 3CLFL 3P73B 3GZKA 1NAML 4PJAB 4X6EA 5CLTA 3MXWH 1JPGB 2VDRH 3UTSB 3OX8B 1BLNB 2ZUUA 2WMPA 3BESR 1L4IA 3T0ED 5ISZE 3X3GL 4LK4A 4PLKD 1U8LA 3H8NA 5I71C 2VXQL 3S36X 5DD1L 1ZGLM 4X6BA 2QQNL 1U8HA 1OP3H 3CFKB 4U6TA 4M7KL 1KIRB 4CJ0A 4WHYH 4EKXA 5CIPH 3IDUA 3HNSL 1KELH 3RBSA 1QEWA 1IKNA 2AK1H 1C5CL 4YDLC 2I5YH 3DVIA 1CT8A 3KYNB 1KNOB 4EI6A 1CFSB 3MNZA 3PWUA 5IROA 3QNYB 5LGJB 4YHOL 3ULVH 3QAZC 2AXGA 4ZDHA 1RULL 3DPBA 3B6SB 4AJ0A 4XPAL 1EMTL 1VFBB 3LAFA 4OIIH 4PTUA 3BWAA 6FABL 5CSZB 5GS3A 3JWDH 1IAIH 2YRLA 4IHOA 4JFDE 1DQJA 3FCTB 2Q8BL 2NYYD 1CGXA 4JKPL 2B8OT 1G7IB 3QEHB 5C3TA 3MV8B 2ZOLB 3H7BA 3N1PC 3QUZA 4Y5XA 4H25A 4GRWF 4S1DD 4XGZA 2BNQA 1P4BH 4NN5C 1UVQB 3BQUA 4GUPA 4LPUA 4WWKA 2FEDD 2DICA 4YLQT 5C6TH 1U93A 2FJHB 4HIJB 4Q6IA 4RIRA 1IZKA 4AZ8A 1ZS8A 2YA1A 2AGJL 4DQOH 4CUCA 4PTTA 2BSSB 3E8UH 4I13B 5ERWB 1VACB 2QQLH 4KK8D 1ZT7A 1MCBA 4KHXH 5HGBB 3TNNB 3VWJB 2V2TB 4HWBL 4OJFL 2XTJE 4QWWC 2X4QA 2VZOA 4ZFZB 3BIKB 3PV7A 1YDPB 5EFIB 4NQDE 2OP4H 1JHKL 1OSPL 5HYIA 4K71B 4LPXA 1HQRB 1RZ7L 4HXBL 4NYLA 4ZXBC 5C0CD 2J12B 5H37G 1AFVH 3MRKA 4IMKA 1N2RA 4OB5H 1QQDB 4PJ5D 5CSBA 3LQAL 3SKOA 3DNKA 4F33A 4O2EB 1Z9MA 4M8QA 1D9KA 2C1PB 1YEHH 2IQAB 1NMCC 4Z7UA 4FQ2H 4RGOH 3UAJC 4X8XA 1TQBB 4PLNC 5E2VL 2BRRL 3RUGF 1S7RA 4JY5L 2XTLA 1BAFL 1TNMA 4LRNH 3C5ZA 3GIVA 3T08A 3DMMB 2EKSA 3TFKD 1S5HA 5E2UL 1F90H 1A7RH 1ZT4A 4OCYL 4R0LB 4Y1AD 4HUXA 3HAEG 2MKWA 3RTQA 2J8HA 4MB3A 4M4RA 5E6YA 4DGVL 5CCKL 3MUGA 1JE6A 3DO7A 1NCAH 5DRZA 2UWEE 1OSZA 4YDJB 2J88L 5EIQA 4JFOB 5AZ2H 1S7WA 2NZ9C 3MV9E 4PRIA 4EDWL 1YEFL 2VJXA 5LXGH 1DN0A 4N0YL 4M02A 2P43B 3P4OA 4RFNC 1I9RH 1Q1JH