5IB3A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and copper
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib3A01
3K80A 2VE6B 4O2FA 4PGBB 4XRCB 1IT9L 4P57B 4M4RA 1P7HL 1VFAA 2VXUL 1ZT7B 3QJFA 1MAML 2QADD 1RZKH 4MQXD 1OAQL 1C5BH 1ZGLA 5KZCD 3H2WA 1ZHNA 1RZFH 3T1FB 2YUVA 3NTCH 5D8JH 4RX4A 2FJHB 4LMQE 2VH5L 1II4E 5C07D 4DQOH 3KYOB 3DV6B 1ZLWH 3FCTB 1A02N 5F3HA 2YUZA 2HJLB 4P9MH 2DOCA 3SPVB 3IXAB 3FT3A 3V6BR 4AT6A 1CS6A 2NW2B 2QKIB 1GGIH 4UV4L 4NO2A 4X6DA 3I3BA 5I8EA 5LCVL 1PQZB 3OB0H 3QHZL 4OUUA 3O6MH 5IEHB 5CS7A 1ONQB 1XF5B 1B88A 1ETZB 2VZOA 3V0VA 4F7PB 1T03H 3OKOA 4DUXA 4EDWH 3GEWB 2A6KA 2ATPB 3SOBL 2IPKB 4FQ1L 5T33L 1M7XA 2SEBB 1RVFH 3HE6C 4P3DB 3E3QA 5IMOB 3BP7B 1NGWA 3U0WH 2IH3B 3D6GA 1UWXK 2W07A 2OTUA 2WBJD 3WO4B 3UJJH 1EFXD 1MRFL 2N7BA 4Y1AD 5MERB 3IVKA 3A67L 2D7QA 2LU4A 1N26A 3ARFD 3RZWA 2DTML 1C5CH 1GOFA 4Z7UA 3KPQB 3W11D 2ORBH 1A7OH 3MRCA 1UM4L 3PWPE 2CQVA 3TT1H 4R26L 3IJHA 1YMMB 1BM3H 3BGMB 1WZKA 4OQTH 1QR1B 4OM1L 3RUGB 2CRZA 4MXWL 4H26B 4U1IB 5JPMB 4UQ3A 3AREB 1V7NH 3E2HC 3MGTA 5SWZD 1N3NB 4WEMB 5FV1L 4LMQI 1AQDB 4AMKL 5DWUH 4J3OC 3K4ZA 3VXRE 4E41A 1DEEB 2R29L 5IB2A 4ODTL 4ZYKB 5L8LB 1VFAB 3HZVB 3PIQB 3B6SA 4YH6A 4LPVA 1HKFA 1MVFA 3UXFA 1QKZL 2R4RH 4E41B 4HUXA 4MJ6A 1LO3L 1FZMB 3DSFL 3JV5A 3LKSB 3P73A 3G5ZA 4Z7VA 4JG0L 2IPTL 3JV6A 3RZCB 4G8IA 5FAAA 3V52L 1Y0LB 5BV7L 3R06B 4TSBH 2V2TB 1RUPH 5EOCJ 1MQ8A 1QR1A 4DN4L 5E5UB 4MA8H 4NBZB 5IWLC 1DQJB 1X5LA 1AKJA 3MUGB 3OKNB 4R90H 4JQXA 3JWDH 1SQ2N 4LLVA 2ED8A 1TQBB 4LSSH 1HXMA 4N0UE 2ARJA 4F37F 5ENWB 5FHAH 1KTLA 2XY2A 3P4NA 3SE9L 1IM9D 1BJ8A 4X6CA 3F5WA 3W0WA 4PGEA 2NYYC 4H8WL 3ARVA 4HUXB 1YEIL 5SWZB 3I6LE 3W2DH 4MVBA 1NGXA 1T83A 2R15A 5DMJB 4F80A 5CP3A 5A16A 2VDPH 3LIZH 1NC2A 3O9WA 3NN8A 2GJJA 4U1HB 1AY1H 2CLRB 1BMGA 2P46B 5GGVY 4XB8A 1G7LA 4TSAH 4PGZA 1RK1B 4TSBL 2OYPA 1U8HB 3FQWB 1RFDL 2DQUL 3QIUA 1J05B 1U9KA 3P0VL 3L3JA 1J8HA 2XWTA 4ZQKB 1LO0L 5JA8B 4OLXH 4U1KB 3Q2CA 2OMNA 1C5BL 1A7RL 1BQHG 5J9PA 5F89A 5ITFB 4DFIA 3AAZA 1A22B 3CSPA 3LMJH 3O9WD 2YA2A 2CLVA 1ZE3C 5FKPB 2DJSA 3QEGH 4PRAA 2I9LA 5ILTL 3WFHB 1ORSA 3ORJA 4LRIC 5H35B 3O9WC 1JYVA 3M8OL 1JZ2A 4Y1AA 1C16A 5E6ZA 3P0YL 3TESA 3N50A 43CAB 3BDYH 3V5DB 4DKEL 5INDB 2ITCB 2W60B 1JGLL 1D6EA 1D7FA 2BNQE 3U7YH 1Q38A 2R2BA 4E0RB 1EVUA 2VKWA 4XP9L 3NZ8B 4U6VL 4DUVA 1JWSA 5GZOC 2JB5L 2A1WH 5HHPB 4I0PB 3DLQR 1RSFA 4PJFF 2X40A 3OKOB 2H32B 3BESR 3MA7B 1JMZA 1IGYA 4IIQB 4JO2H 1OP5H 2IQ9L 2FEEL 2WINA 3UZEA 1GIGH 4HXAH 1PQZA 3RIAF 5I8CB 4MJ4A 3FOMA 3T3ME 3DROB 4K23H 1ZA3B 4I1NB 2ZUVA 4K7FA 3KNBA 3WNOA 5K33A 4OI7A 2I5YH 3ARGC 3LPFA 5CHNB 4JFOA 4P57A 1KIRA 2VLKE 3FL7A 5FYLH 3O2DH 3OAUL 1NDGB 1UM4H 2ZOLA 3C6SB 3I75A 1CLZH 5ICYA 4PJGB 5GRVK 1JV5A 3GZKA 5IM7A 4RMUA 3GMMB 1JHLL 3MJ8A 1CE1H 2VRAA 4O5LL 4ZFZB 5I16A 1BOYA 5HPOA 2I9TB 5I71B 2JLLA 4D2NA 2GK2A 5DJZA 5EO0A 5JHDA 3LKNB 4J8RB 5HYJD 3MACH 2GJZB 3G5XB 1KN4H 4OZHF 4PP1C 1L7TH 3V79C 4X7TA 1A6VH 1K4DA 3IFPA 2VQTA 4GG6A 4FFEX 3Q1SH 2IANB 2AERT 2OTWB 4OZHB 2NY6C 4BK5A 4F33B 3MBEB 1FNGB 2EDJA 3TJHD 1T04A 3AU1A 1TJGL 1Q72L 5CJ8A 4DGIL 3CVHB 3MRMB 3OGCB 3QUXC 4U7MA 3QWOB 3EJJX 4QNPE 2HAZA 4GG8B 4JPWL 2AKRB 2OTPA 2AK4E 2AAVA 3C60B 4GAGL 4LIQE 2Y36H 2Z4QA 4P3CL 3GHEL 1WISA 5FYLE 4G8GE 2GW5A 1RJLA 3UC0L 2WLYA 3DUSB 3HB3D 1J12A 1Q9LA 3ALXA 1D5IH 2DYPB 3OHXA 3U4EA 4HCRH 3AMLA 3VXSE 1PX4A 1MJUL 1OPGH 1QFWL 2B0SL 4U6TA 2BNRE 2EDFA 3JTSB 5JOPE 4I0KA 5F70A 5CKAA 3WNNA 2BHUA 4JR9L 1KN2L 2VDMH 3T65A 4PREB 5FYJH 1T7WA 2BSSA 2OL3B 1RZKL 1GSMA 3HMWL 4L4VD 4QT5B 1I9EA 5CMAB 4OT1L 5EPMA 2P8PB 5GS2H 3QA3A 1AD9A 2Z8RA 4JQXC 4PV8B 4DW2L 1P9MA 1QQDB 2NLJB 1HWHB 4HPYL 3AMKA 2WLZA 4FQJL 4L4TA 4NKQB 1DQTA 1VGEH 3LN5A 1LMKA 4FQLL 3ZDYE 2H9GA 4N0CD 2G75B 2E8ZA 4F9LC 4KI5F 4D0DB 3MRNA 3AXLA 2UYLB 5J3HC 1DN0B 1BIIB 3S5LG 5F6HI 4PLKC 4K7FB 1JHTB 1ZGLM 4I2XE 5KVGH 3WFCL 2OX5A 1CFNB 1XAUA 2YBRB 4WWKB 5CLTA 1NAML 3TV3L 4CADA 5E95B 2O5XL 2FSEB 3RZCC 1CTOA 2DMKA 4O2CA 3KS0J 5F71A 4NIKB 2E5EA 3EHBD 3LZFH 4LL9A 3S88H 1H8NA 3LHPH 3HG1B 5IHLB 3DXAB 4MJID 3GK8L 3LKRA 3U0PA 5CGMA 4JQIH 4N0YH 3UTSD 2JF1A 3AS2A 1D6VH 3PGDA 1A3RH 1JIBA 2BVQA 4JFZL 1S9XA 4WI7A 1WAAF 4WFEE 1FGVH 3EYFB 2D9CA 5IMLA 4JO4H 4HDIA 4Y5YA 4MQ7A 1JP5A 1JV5B 5IM7B 1C5DB 4MQSB 3WO4C 3FFCD 1QLFA 4PJ8A 43C9A 5T1MA 1WF5A 2AJZA 5E8PA 2J6EL 4PJXB 3UJIL 1S9VB 1YEEH 5I1GH 1S9YB 1FNLA 3MLTB 5AD0B 1R3IH 3NA4A 2F5AL 1HE7A 5CSBA 3B9KD 2IAND 3H0TA 4XVTH 4Y8AA 4MCYA 1FZJB 2Y5EA 3MBED 1OSZA 3HA0A 3ETBF 3VG0L 3VCLB 3P0VH 5HYFA 2PYEB 5D9SB 1CFQA 3QNYA 5HHMB 4PV8A 5B38A 3VFSA 1H3UA 3ILPB 5CZXD 5CILL 1QHOA 1U58A 2Y25A 4XC1H 1FBIH 1FE8H 5EBMB 4Z0BL 2VDQH 2BFVL 4P23D 4ZS7H 1CZ8H 1KENH 2XQBL 1UCBL 3VFTB 1NLDL 4YHPA 1QD0A 5FHBH 1QBAA 4MJ2A 3P9MB 5CFHA 1P9MC 1A6TB 1Q8MA 4FTVD 1ZKAA 4YDVB 4K3GA 3E3QE 5IFJA 4PJGF 1OB1B 5I15H 4G9FB 4LLMA 3VGAC 2HWZH 3SN6N 5F7WC 1OP3K 5TF1L 2VDKH 1XIWC 4F33A 3D2UA 1NGXB 3CLEH 3MLUH 5C0JB 4PJ7B 1I7RA 2CRYA 5HHNB 5FECA 3OGCA 5J11B 1CFVH 4PG2C 4PJHA 2EKSB 2NY2D 5F89B 5ITFA 1DQQB 2GI7A 4C4KO 4YBQC 4EKXA 5FK9A 3WJLC 2PYFA 3IFPB 4RFEA 1CD1B 1CDYA 1NGYB 2FZ3B 4JN1L 5GS0H 1RUAH 5CJQH 3WUWG 4F57L 5IESH 5IUSA 1FNEA 2EDQA 3BMWA 4TVSa 3SDXF 5ETUA 2AJUH 3L3JB 4URTB 5MEPB 1KEGL 2C3HA 1KB5H 4PJIB 2X4OA 5DI8B 3N06B 1HNFA 4HWEL 4FNLL 4NQCB 1CLYL 5EC1A 1KIRB 1J7VR 1T3FA 5IROA 3CVIL 3V6OE 4JLRA 5GGQL 3RAJL 3TP4A 3GUTA 3C6SA 2AEQH 1ZA3A 1QSED 1LQSR 3QUKB 3QUXD 5ANMB 5AYQA 1ZLSH 1GCFA 4XAWL 5I66B 1P4IL 2PO6B 3R4DA 3MMEB 4RFOL 3JWOC 1Q9WB 5D1ZB 4IIQA 4R26H 5TQ0H 2E27H 3NAAL 3BFOA 1UVQB 1N5AB 3HLAA 3SDXB 1ZTXL 2NY4C 4AQ1B 5JNYA 4Q58C 3VG9C 2ILLA 5I8CA 1YPZF 4OJFL 3MOBH 1Q94B 2YD1A 5EH1A 1CGWA 1YN7A 1MCOH 4PP2B 1JNLL 2AJSH 2DLFH 3NFNB 4AH2A 3IDNA 2BVTA 1C12A 1Y6MR 3UPCA 1FYTA 1TVBB 2NCMA 1U6AL 4JY5L 4JM2B 4A6YL 4MA3A 1JPGA 1RMFL 1QLEH 3U4BL 2E6QA 5GJSH 4PGDB 1F45A 1TPXB 1T89A 2WW8A 5C0AB 4U1GB 3O3DA 5IJKC 1J1XH 3H6JA 1VPOH 5BO1L 5IFJB 4OCMC 3K46A 4RFOH 4TTDD 4ELKB 3PNWA 2ED9A 4NCC1 1RUQL 3RWHA 3WDIA 4GT7A 1IKNC 2B4CH 4KVCH 4JO1L 5KSUA 4JFPB 2IWGA 2P44B 4LEOB 5DJAB 5JPMA 2KL6A 3D1MC 5DMGC 1U3HB 4NQEB 3V4UL 5I18L 1CDJA 1SYSB 1UXSB 4ZFFA 4Z7WB 5D93B 1S7VA 4OGAD 3NCYS 3UBXA 1GGCH 1U3HA 4KFZC 2NY6D 3CU7A 2QV2A 5EO1B 3VFPA 1KEGH 3OAZH 4FXKB 1OP9A 4XPAL 1NC2B 4QOKD 3D39B 1G6RA 3NCBB 4WW2A 1S8DB 4P2RA 1Z9SA 3HC0B 1S9VA 2HJFB 4Y19A 3G6DL 5I0DA 3TCLA 5ANMA 3SO5A 3H9HB 4IRSB 4PRPD 1NSNH 3O3EB 1F4YL 4K07A 5ACLA 2R1YA 5DXWA 1U8QB 4JRXB 4NFDA 4XRCA 3QCUH 4FQXD 1KV3A 2AEPH 2NY2C 4WDIA 2DQEH 4UNUA 3DI2B 4GFTB 3PWLA 5I17B 2X05A 5FM5O 4NQED 1OLZA 1UH2A 1F5WA 4BQBA 4X6EB 3SKNB 1S7TB 4H20H 1RZJC 2C3VA 3V8OA 3L3HA 3K1KC 3BKYH 5EOQH 1X7QA 3NH7H 4NM4H 4RRPA 1TTGA 2VERN 3FHQA 3HPJB 4Y4HD 5F1NA 5CILH 3NACL 4JHBA 4N5UA 4NJ9H 3PHQA 1ZLUH 2YBRA 4WWKA 3VU2A 3VJ6B 1ZTXH 1S5IH 5F9AC 2YWZA 1KTDB 4PJCE 5HYQB 3HPLB 2VZ3A 5C86A 4PJ7E 4HIIA 4LGRB 5I19L 1ODAA 4IRSD 4ZFGL 4OZ4B 4GS7C 1UWEL 3WN5A 3D25B 1KGCE 5ELIA 4FQXB 4NBXB 1SJHA 3D0LB 3DRTB 4PY8I 4TUOB 4KZEL 5DK3A 5LXGH 1MLCB 3JV4A 1U8MB 2B8OT 2VIRA 3QNZA 3CDGB 4ZUVB 2D7NA 3FRPA 1F2XK 4CGTA 3IVKB 1XF2B 1T1XA 2KQMA 3RBSA 4BM7A 1Z2KA 5DJAA 3I02A 1MFEL 3QUYA 1XGQB 3GSOB 1I4FB 2AK4A 4RAHA 1QLFB 4YXHL 4RGNC 2ZOKA 2W0KA 1AHWC 4XH2A 4LVNB 2ATKA 3FO9B 4PJXA 3QO1A 4F9LA 4KROB 3VXQB 2IPUK 4MAYD 2R23B 3UEZA 1SBSL 5IMOA 2B1AL 4WUUD 4MLSA 5JHDD 5I74B 2XZQH 3S36L 3GBMH 3MFFB 5AG8A 1MCIA 2QKIA 5AZ2L 4LLYA 4S1RH 1U58B 3W0WE 3EO1B 4Z95L 2MKLC 1RMFH 5LBSH 1CL7I 1P7KB 1P2CB 4LASH 2I07B 4F7CA 3F7PC 4ZOEA 2VLJD 4Q6IA 1AC0A 3B9KB 5DO2C 3ZTNH 3M45A 3R1GH 5MI0C 4XMLH 1L9NA 4JN2B 2BNRA 1I7UB 4GRLB 1RIHL 1UM6H 3VG0H 1T7YA 4K2UH 4J3SA 4HS6A 2X7LB 4HJ0D 5HVHB 5I2IB 2Z9TA 3VMOA 3VW3H 2C7UB 5FYJL 1WWWX 1MI5D 2UZIH 4APQD 1YEEL 5F7DB 4TRPH 1S7WA 2QQNH 3PQYA 2VXVH 4YGVB 1HOCB 5KSAC 3VA6A 4WHTB 4PD4K 4X5WB 4N0UA 3I6KA 4N5ED 3TBSA 3L3IB 5LXGL 3IB4A 4HH9B 2Y7QB 4PJDB 5HTSA 3PGCB 1UQSA 4NT6B 1FO0A 5K9OB 5L6YH 1Z3GL 3VA2C 4UUJB 3EYVA 5AZEH 2VLJB 1PEWA 4JFZH 1F11B 4PJ7A 2YRLA 5IESL 2XZAH 1EAPA 4Z8FL 5D7SL 1F2QA 4BA8A 2Y06H 4Z78B 3IGAB 5B3JF 2NY3C 5D1XA 1A0QH 3LV3B 5CBAA 5GGUB 3UPRA 2W0LA 5C0EB 1NFKA 1DFBH 3S4SB 2V5MA 1RHHB 4KUZL 4W4NA 5B8CB 2GTZB 4L8SA 2PCPA 1S5HA 3N9GH 5INCB 4ZAKD 4L8BA 5FIEA 2VDKL 1MI5B 2BNQD 5JXEC 1CIUA 3VWJD 3IDGA 2Q3ZA 4I5BB 5HY9B 2FWOB 5E4IA 1ZHBB 3O3BA 4UV7L 3TNNB 5A3ID 4R6UA 1T1XB 2HFEB 3OAUH 4MCZA 3RNQA 4F3FB 2R69H 3EGSB 1UGNA 3ARBD 2K7QA 4XNYH 2DYPD 4QHNA 1F58H 4WWKC 3QPQD 2BFVH 3OB8A 2UY7A 2E9BA 3EUUA 1ITBB 3ZYIA 3OPZL 4MS8C 1J88A 3FQWA 2BVPB 1F90H 2W9EH 5B39G 3D9AH 2BVUA 5KN5B 3OHXB 3BH8A 4I5BA 3ZLQC 2CMRH 3TLRA 3ZSSA 3CFEA 3MBXL 2VLLB 2NZIA 5EZJB 1FFOA 2F5AH 4GRLC 4RIRA 1XGTA 4U4BA 1KBGH 2ID5A 5C1MB 5JUEL 2L4OA 5A2IH 1NFDA 4S1QL 2WNGA 5EOCL 3FFDB 2PXYC 2AS5M 4JHAH 4NUGL 4F7EA 5M94B 1FZOA 5C0EA 5IB3B 2G60L 3DROA 3DUUA 4HKJB 3W39B 2AEPL 5E9DA 1G1CA 4X98A 5K9OA 4X9GA 1U8OB 1Y6NR 3KLAB 4PV9A 4P3CH 4UI2A 4JDVB 3LKOA 4GUPA 4I3SH 3W39A 5GRWA 4KTEH 1Y6KR 1BQLH 1MVUA 4DGIH 2IADA 1S9WB 4QRQA 3KXFE 3OF6A 3E6FB 1T0NA 4I77H 5I16B 3U4BH 3V5DA 1MQKL 3CFDA 4OBSA 5E6IB 1QRNB 2AJXH 2LQRA 1DQML 4RMVA 3E2HA 2X44D 5FYKH 4IS6B 5KSAD 3KG5A 5JW4M 1KIQA 1GPOL 3G6AB 1ZANL 5B3NA 1J1OH 4OF7A 3T0EC 3KPPA 5EBLA 1F6FB 2O5YL 1ZT4B 5CEXB 3GMPB 5GGRA 4HLZG 5E2VH 5DURB 3VDAA 1BBJA 3VMPA 2IBBA 3BN9D 2Y23A 3ULUC 3GIVA 4CU6A 5HDBE 1CXLA 5SWZE 1PLGL 5BW7A 1HXYA 2Z31C 4HHAB 1RK1A 5D1QA 3CXDH 5HI4C 1A9EA 4P2QD 3MO1A 4OD2B 3RAJH 2AJVL 3O3AB 3K4DA 5J8OA 3RWHB 3GNMH 5KBNC 3MGOA 4JDTH 3SKOB 3MA9H 3HE7B 2F53A 1WUNT 4DCQB 3QUXA 5ESVB 3P4OB 1AGEB 1K5NB 2AJYH 3RZCD 1EV2E 1I7ZA 3NFPB 5EZLA 1VFBA 4QHLA 4XB7A 1C16B 5FDYA 1X5FA 1LDPH 1LP9A 1MREH 5FM4A 4G7VH 3L7EB 2VZSA 1F3DH 3BKJH 1MPAL 1BGXH 4UOW0 1KLUA 3X11B 3OZ9H 4L9DA 1JL8A 1WZ1H 4ZNEE 2BVOB 1XF2A 1N59B 4OFVA 3STLB 4ZTOL 2ZSVB 3QJHA 4NN7C 4YDIH 2Y7QA 3VFRA 1W8OA 3PV6B 2D31A 4WTZA 5GJTH 3TN0A 1ORQA 4F7TB 3SGJC 4ETYA 5E8DL 3OPZH 3QXWA 3TA3B 5DHVH 2MQ0A 5J7CC 5ID1A 3WUZA 1EJ6A 3QAZB 1U8MA 1VACA 3N1MC 1EMTL 4JFXB 3QQ3B 4QHKI 4PJGA 5TDOB 5FO8A 1RIVL 2O5ZH 5I1CL 2F54A 3NN8B 5FCUH 4LVEA 4HUVB 2Z35A 3DHMA 5FO8B 5J06A 1RK0A 1HHKA 4JN2A 1FBIL 1FE8L 5L9DL 5D5MA 5KSBB 2V7NA 5IW1B 2V5RA 2EEBA 3B2VH 2CRMA 4G43B 2YPVL 4G9DA 2A9NH 1SJEB 1ORQB 4F7TA 3HFML 4P5KA 3D69A 4E42B 4MAYB 4ZD3L 1V3MA 1I3GH 1W8NA 1UH4A 4H25B 5GS2D 1YEIH 4MNGB 4HV8B 4RDQG 4HMCA 1WT5C 3L3HB 3KYKL 4LLQB 2R0KH 3RL1B 1UJ3B 3WJJC 1DQDH 3DURA 2ITDA 3BJLA 1CVRA 3EDEA 4RSVA 3U7AA 5CSGA 4AQOA 2DD8L 1NCNA 2APFA 1IGTA 5MENE 3ROLB 3IAQA 3PP3H 2ADFL 4O2EA 5AG9A 1HIMH 3EZJB 4KPHL 4FXLA 1FQ9C 1XIWD 3VFOA 4KI5E 3Q5TA 5I73B 2OBGA 1UXWA 4HD9A 1XCTA 3LB6C 3MCG1 4YIQB 1QSVA 5D6DA 4UBDD 1F6AB 5IFAL 2HMID 4MD0A 3X13A 4M6ML 5D72H 3HUJE 3RTQB 2QQNL 4UQ3B 1AO7E 5C9JA 1LDSA 4JM2D 1DDHB 4EI5A 4ODWA 4QRPE 4NO0B 3BDYL 1G6RL 1LD9B 1MIMH 2E6PA 4M62L 5A40E 4XXDA 2C3WA 4NO3B 1IT9H 4UB0L 3QNYB 4OUUB 3VG9B 5B38B 2V2XB 4IRJC 3X3FL 1UKSA 1UM6L 3OAYK 5KVEH 3NIFF 3DMMB 2YUXA 3PWNA 2FR4B 1SY6H 5J1TC 3IXAA 5JW4N 3ZTNL 1E4XH 2AEWA 1IQDB 1XCTB 5TE4H 5JW3H 4LBEB 5DJ8B 3VGBA 5M95B 1A6WL 2ESVD 3KGRA 5JW4R 1ND0B 1KJMA 5CD3A 2FB4H 3L3KA 3QDMB 5BXFB 3CX5K 1A3RL 2OTUB 1QRNA 4L9LC 2FIKB 1Q9KA 3GSUB 5ADPH 4DOHB 1VEPA 5E2UH 4JZJB 1UWGL 4HPYH 2BMKB 3O6FB 1MCPH 1FLRL 2YPLB 4GBXC 1L4IA 3I9GH 3P30H 2FBOJ 5CJXC 4WFGE 3ULVD 3HMWH 1FH5H 4PJHF 4N68A 4X99A 2VLJE 4OM0H 3WD5H 1AO7B 1M7DB 3WO3B 3S97C 2O5XH 3VFNB 3SDYL 2FYYA 3T0AA 5DC4B 4UINH 3MLZH 4G9DB 3WLWD 4AT6B 2PTVA 3GMLA 3MUJA 5IB3A 4GW5A 1DR9A 1R24B 3GSWA 5DD0L 3DV6A 1J11A 2QR0A 2UVEA 5I66A 4QHLB 3K2MC 1HQ4B 2VL5A 3BP4B 4LAQH 1T4KB 1HK6A 1AKJD 5DMKB 2DIJA 2P5EA 5IK3A 2FO4B 5H8DA 2CKNA 4JFXA 4DCQA 1A1MA 5E8OB 4L3CA 3CC5B 5EC1B 4BFBD 5BV7C 5L9DH 2NY1C 4KZEH 15C8H 5KVFH 2ICWB 4M1CD 5HHVL 1CDCA 4XPFH 4PJ7F 3GUTB 4HUKB 3TN0B 2D03H 2EDTA 5ICXB 4YX2L 4NUJB 2X4RA 4ESKA 2J88L 2DLTA 2Q6WB 4WRLA 5E2WH 2VQUA 3BGMA 4QRPB 5ID1B 2R29H 3IETA 4NN6C 4LFHD 2B0SH 3MRCB 2WUBH 2X42A 1RY7B 4RGOH 4ZUTB 3VFRB 2J12B 4MCYB 4IJ3C 4YDIL 3U6RB 3T65B 3IDGB 3BEWA 3C9NA 3HI5L 1MIEH 2GY7B 4EDXB 3ULSB 3KPOA 5I74C 4JFFB 5HHNA 5FECB 2FHFA 3OJ2C 1BBDH 5ESVA 1FC1A 1LEGB 2YMXL 2FEDD 1JGDB 4P4KC 5IB4B 2IH3A 3EDKA 5DQ9B 5IG7A 1MJJA 4XXCC 5D5ME 3Q6FA 3P9MA 5GGVH 3RDTD 4OLWL 3QUXB 4JHWH 4AH2B 2IJ0C 5MP6L 4KMTH 1EUUA 2VXTL 1HXYB 2AI0L 5C08D 5A1AA 3LKRB 1HNGA 3JVGA 4KRNA 4WFFE 1JHLH 1QFHA 4NRZA 4J3UA 3REWA 2DIBA 1QRNE 5HJ3A 1CT8B 4RRPG 1ZWIA 3WL9B 3ZL4L 1VERA 1PSKL 3BKML 4N8VG 1IEBA 1TETL 2VXQL 1A7QH 2FL5B 5JW5B 3RU8L 5J6HA 4YLQT 5DQDH 2QHRH 4P9HH 3L5WA 3ZSTA 4QTHB 1YYML 2VAAB 1ZEAL 2VISA 1F4WL 4I48A 4HX1B 4HS3B 1J1OL 2DJ4A 3W11C 5HHOB 2HKHL 4WUKH 5E5MA 2VH5H 4G6KH 2VAAA 4XMKH 2NYYD 1EEYA 4KVCL 2Q86A 3KNBB 5GRUL 4POUB 5DVKA 1XMWA 1S7XB 1OAQH 3B9DA 1IBGH 3NFSL 4O00A 1J1XL 4PS4L 1JGUH 2VXUH 3DO7B 4JM2F 2IBZY 5GIRA 3HI1A 1OTSD 2I07A 4HUUB 3RWGB 4F7CB 4OSUL 2R2HB 3P0GB 3QEQB 4L5FL 2XKNA 4NNPH 3F62A 2E9IA 2WP3T 1NBQA 3DRQA 2XG4A 5CKGA 1NDMB 3GJFB 5F6HJ 5B8CC 2FWOA 3I84A 6FABH 3ZMRA 2LTQC 4L9LA 4LAQL 3TVMD 4QY8B 2Y07H 3EDDA 5EZJA 2DWDB 3M8OH 3SQOH 1QPXA 1R3LA 2X1XR 1EEYB 1DQDL 1LK2A 5EOCH 4FQQB 4R97C 3MYJB 4P0DA 1DBAH 5D1XB 1O7VA 4OCYL 4XBEL 3HAEH 4IJ3B 4NM8H 3L3OA 1FZKB 3O8XD 3WIIH 3ARDD 4LSSL 2P5WA 4PJ9D 1JZ7A 3UTTE 1ORSB 4G8GD 3I02B 4XXCA 4NOBA 2APTA 3MV8E 1XCQA 1AGCA 4WO4C 4HK3J 2DQUH 3LKQB 5AEAA 2EDBA 3RGVA 1QSFE 1M7IB 3GBNH 2IANA 2OTWA 4OZHA 4HGMA 3BSZL 4AL8H 2A2QT 1BX2B 3OG4B 4NPYA 2J8UF 4GAJH 1M7IA 5FCUL 5T3ZH 2GJZA 3G5XA 3EW3B 5DVMA 4AEEA 2M2DA 1QSFA 5IGXL 4GBXD 3ZDXF 4JPVH 4MS8A 3MRQB 4OGYH 5GISL 3RVXC 3WNMA 1G84A 4H8WH 2HA1A 3DVFA 3GIZL 1WAAA 5DLMH 1X5HA 4XGZB 1D5MA 3TJEL 1OTTC 3CJJA 1HH6A 3S36X 4L3CB 3AB0B 4U6XA 5AYUL 5F1SA 2FGWL 2YEZB 1Q0YL 3KDMB 3DETC 1ES0B 5ESQA 3ULVH 4PJ9B 2VYRE 5F7KC 5DD5H 1A7OL 5D72L 3FHAA 2XWJB 4PJAE 3B2UC 4IOFD 4TSCL 1U8PB 3SY0B 3IKKA 3RVVC 4ERSH 3GMLB 5DZOA 3PGFL 1YJDL 2R8SL 4FQCL 2YD7A 1KXVC 2FSEA 3BD5A 1IQWL 3GI9H 1SJXA 4U1SA 1WFOA 4XNUL 1B2WL 1EZVY 1NLBH 2C7UA 1JFQL 4HFUL 3TF7C 4K7PH 1WK0A 1A1NB 3SOBH 4KKNA 4HIHA 2QSTA 3L5JA 5DYOB 4EDWL 1TXKA 4QNPF 4XVUC 5DUMH 3QO0A 3ZT7A 2EDKA 1WICA 2N1KA 3VWKD 3WEXA 3WS6C 5DMKA 2F8OA 2XY1A 4XHJD 3LS4L 5DJYA 3MLYH 1XGUB 5DO2D 2R1XB 1KYOK 5F72S 2BDNH 3OXSA 1ZA6B 1P7KA 4OFYD 5EB9A 5D96B 4FQHA 3WL9A 3UBXB 3NCFB 5ALBL 1QA9A 3RI5F 1HKLH 1A6AA 5BCAA 2V5SA 4DKDC 1SVZA 3FOMB 3S5LA 2ZUXA 2YRZA 1N6QH 4I0PD 4YQXL 1LP9F 3V6FA 3DX7A 3B9KC 3U0WL 5HHXH 2X70B 2X4TB 5LBSL 5C07A 5MEQB 5EA0H 5DJ2B 5E8OA 3CD4A 2EEAA 5C0DB 4W70A 2O61A 4PRPB 3GK8H 1T03L 1NCBH 4KJQC 4ONHA 3NIDE 2VSCA 1ZK9A 3OBAA 1AGBA 2RFXA 3H7BA 4P4KB 1AI1L 3VGFA 1PW3A 3I6LD 5CLWA 1P1ZB 3F7QA 2H45A 3PWJB 1GGIL 1N2RA 4UV4H 5E8NA 4X6BA 2XG5A 1FDLH 4ENEC 1I75A 4HLZH 4NRYA 1RJCA 4U3HA 4JHAL 4NUGH 1NANI 4UDTA 4Y1AB 4UU9B 4EBQL 3UBXG 4XWOD 3HCVB 1NUFA 4EEEA 1LVEA 2R0LL 3MRHB 2ITDB 4YAQA 5L8KB 5IBLC 4CMHB 4GXVL 4V1DD 3TO4D 2YD5A 1A6PA 1JF1A 3DX8A 5J9PB 4Z0XA 4FZ8L 1U8QA 3MUHL 4LNVA 5JZ7D 4EXKA 5HGDA 2HLAB 1KCVL 5IW6A 4BSJA 4ODUB 4ODXA 1GRWA 1M05A 4QRPD 2APXA 3QUZB 1Q9OA 5JORB 4G43A 4NNYA 5HYJB 4LGSB 4DW2H 4QXUH 5A16B 1MAKA 3O2DA 3ARRA 4IRJA 5F1KC 4NWTL 3QHTC 4JJ5A 2F15A 5BV7B 3D18B 4MX7A 1DEEA 1ZVHA 4PBXA 4KDTA 1FL5A 3ARBC 3OKEA 4FQIH 4LU5H 5FO7A 4HQQH 4XC3H 4JY6B 4QHMB 4OLEA 1I3UA 2EDEA 3F7YB 3KPSA 1P69B 4Z0XB 4DGYH 7FABL 5HVGB 4KXZI 1D9KD 1GXEA 2F8XC 5I76B 5C92A 2NTFB 2RIKA 5D7KD 1FVDA 1UJTA 3U1SH 5JOFA 3HHRB 4HW6A 3RTQA 4LDLB 3O4OB 5JDJA 1T66C 4X9HA 2CIKB 5C71A 3QI9D 3MV7D 4KY1L 3RVWD 3VI3E 4YXKL 3EOYG 1WBZB 2B2XH 4BFGA 1SEQH 4Z7NE 4PDCE 3EDFA 5FO9A 2A38A 3MRPB 1A64A 1KC5L 5INDA 3NCCB 1YUHA 4NYLA 2GSGB 4Y4HA 1B0WA 3SKJH 2YXMA 4WW2B 3HC4L 5CUSL 2XPGA 4N0RA 4RISL 4K3JL 4AEIH 1MCFA 1DZBA 1MLBA 1U8IA 1VFOA 2RGSA 2DI9A 4MJ6B 3MGTB 1MCSA 4WEBH 1TVBA 3T0XA 4YE4L 3IJYA 4TULL 4JDZB 4KKAD 5TDPB 2R0ZH 4KHTH 3G5VB 5F7HA 2DBJA 3BZ4A 3HZKB 2Z0BA 3IJHB 3LOWA 4FHBD 5EFIA 3VFGH 1D9KB 1MUJB 4UQ2B 4WFFD 3BT2L 1ZLWK 5JO5A 4U1LB 1FVEB 1FNAA 3FT3B 1PSKH 3FFCB 2H2PD 5EUOE 4Y4HC 1EERB 4XCNA 1UA6H 3AROA 4GKNA 5F8QC 1F13A 1TZIA 1UJ3C 3E6HB 4QRTB 3AY4A 3PL6D 3KPNB 3C08H 4XZUA 2KQNA 4PGDA 4FABL 1IGFH 1GHFL 3BE1H 4YIQA 2ZP0T 4OCSL 3H9SE 1OARH 3GI9L 5FYKD 3DPBA 2NY6B 2R69L 5I73C 3BPOC 2X4SA 4GKZA 4OLWH 1W2KT 3O11B 3QI9A 4ERSL 3VD9A 5KSAB 2M26A 3QZWA 2HRLA 5IHZA 3QEUB 2J8UB 1JYWA 5F1IA 1HHHB 5E2UL 2VL4A 3IAPA 4MA1C 3UZQA 1RZGB 3RWJB 1Q94A 5GS3A 2XWJA 3V7AE 1UJ3A 3GMOB 5D1QB 2NW2A 1UVQA 4PJHB 4DAGL 3NZHL 2E7BA 5LWYL 1NKOA 3C2AL 1JNLH 2AJSL 2DLFL 4F7EB 4U1JB 3K4AA 2DN7A 5DHVB 2BK8A 5HD8C 3DETD 5DDHA 2ZCLL 4HJ0C 3G9VA 1KFAL 1D5MB 4HUWB 5MHSD 2FGZA 2XFXA 2VUOA 3VFWA 1H5BC 3VD3A 2P24A 5EIQA 1BOGA 3SGJA 2XICA 3CZFB 4YDKH 5DK0A 1JRHI 1Z0MA 2D03L 1U3JA 1WTGT 3VXRD 4LVOB 3ILQD 4RGNB 3BAEH 4YK4B 1AGDA 2WBKA 2WIIB 1T3FB 4QWWC 3R0NA 4L4VE 4KRPB 2HTKC 5C0RL 3KLSA 2PW1B 1LO2L 3GBLA 1X5AA 1AY1L 1ZHKA 4G6MH 4KPHH 3M17B 1JTOA 3CFCL 3BRDA 2FRGP 4LSVH 2YD4A 3OKDB 4PTTA 4GMTL 4WO4D 5FFLA 5KVMC 3RVVD 1NCDH 2H41A 3BWAA 4J12A 1FZKA 3QB7C 2FX8L 1S9YA 1AP2A 4K3DL 4ZUSA 1K5NA 2QADB 5CP7B 3S98A 3WFZA 5E9DE 1JZ4A 1D9KC 3IDYB 1A1OA 5HYJE 3GMNB 1A4JA 1TENA 2RAMA 2CSPA 1EO5A 1LEIA 1J8HE 4JFDB 4KAQL 5EORL 3MFGB 1JUFB 2Z4QB 4PYHA 2CK0L 4WNQB 3B2VL 2FBJH 1VEMA 5BZWA 2K7PA 3HN3A 3SKOA 5AWNH 4K9EL 2VN4A 2P8LA 4N1EA 1LWRA 4EQ2A 3EO0A 4KHXL 3BWAB 1IC1A 2OR9H 3X12B 3HRPA 2XNAB 3MNWA 3VXPA 2V5YA 2B1AH 4I3RL 4R4BA 3D2UD 3QUMB 4Z0BH 3EO9H 3VH8A 5JHLL 3TPUA 1E4XL 2NZ9D 4E9LA 4UTAL 1KIQB 4IMKC 4YHIB 2WMPA 2IAMC 1OSZB 1ZSDB 2D3VA 4MDJA 1KNOB 3HE6B 3GMPA 5GGRB 1VHPA 1JZ3A 5IVXF 1NC4A 3MNZB 3OB0K 1WAAE 4WCYH 3KYMA 1G6VK 4QTIH 5IBUG 1IEBB 1T6VN 3ZL4H 4LEXL 1AE6L 4GQPH 1CK0H 2P24B 4GQ9H 4HEME 4HBQA 4WEBL 2BNRB 3I85A 4FMKA 4D9RE 2LU3A 3UTQA 4P23C 3RPIA 1BEYH 4JKWA 5I0ZA 1U42A 1U8PA 4XBPB 1RUKL 3QXVA 4UT9L 2ADJB 1UC6A 4K9EC 3C8KB 4Z7WE 5IFHH 1MFNA 3VXUB 2IEPA 2WUCH 1KXQE 2BY3A 1PEZA 3AUVA 5TE6L 4NJ9L 4OIIL 3DGGB 1I9IH 1KLFA 3I6KB 4HS8H 1JPFB 1R5VB 4LAJH 1A1OB 3O11A 1S7QA 4K7PX 4HS3A 2AJ3A 1LO4L 43CAA 4DKFH 5K59E 5L2KD 4RGOL 5FYJU 1J1PL 5DEGB 4DGVH 4WI3A 4HQQL 4KQ4L 4XC3L 3FMGL 2E7LA 1MCLA 4O51B 3RWCB 2G75A 4FQIL 2NW3B 2ENYA 4GG6F 1IGJB 1I1YA 1WGOA 5FYKL 3ZKMD 3MBEA 4QXGH 5HJ3B 5I1CH 5TQ2H 3BPNB 3TEUA 4XWGL 3IRPX 2DLEA 3D0VB 1R3JA 4PRIA 3SDDD 3MRJA 1H5BA 4P48A 1YNLH 1MCDA 4N0UB 2NY1D 1G1YA 2R0WL 4R7NB 4C56E 5DK0B 2ZCKL 5DD3H 1CL7L 3MODL 5C07E 1ZHBA 2VDNH 3TNNA 3HR5B 4M1CC 1KIPA 5EU4A 4I3SL 1D3CA 2ADIA 3RGVD 2XFXB 3K7UA 3BPNC 1OT2A 4OB5L 5HI3C 1T80A 3P3YA 3FB7B 2Y5TB 4KMLB 3UTSA 5IKCB 3EFDH 3OKMA 4BJLA 5BS0E 3MLZL 1W72H 4JGUA 3LSOB 3QDGB 1MCNA 4ZS6D 5ISZD 4OB5H 2DKMA 4N9OB 1FNHA 4OV6F 4GRMA 4GLRI 3BRFA 5IVOA 5T1LB 3BPCA 1NDMA 3ZHKA 4HG4K 5GQBA 5SX4I 4NQUA 1OF2A 3IDUA 1KCUL 3OJVC 1I3RA 3IU3A 3OKLA 1TJGH 2R0WH 1AQKH 3HE6D 1A9BB 2ZG1A 4QKXB 4TNWK 4XVJH 1AO7A 5EU6A 12E8L 2HH0L 1F58L 2F5BH 1X5ZA 4UMGA 3JV6B 4QOKA 1A14L 4WHTA 4X5WA 3W9EA 2WK2A 3UJTH 2VABA 2X4SB 3CZFA 1NCCH 4K8RH 4M6NL 4QTHA 3ARFC 4G42B 4YJZL 1MRCL 3VH8G 1IEAB 1HSAB 4PUBH 4HS6B 2QTEA 4LLWB 1BQHA 3BP4A 3IXTA 3T0DA 5MEOB 3KPNA 5F3BA 1AGFB 3N9GL 4YC2B 1UZ6E 4EN3C 1FL6A 2P7TA 4BH8B 5E08L 4RFNC 4TVPH 3RIFK 4XCNB 4NO3A 3LPWA 3LS5H 2JCCA 1KT2A 4S10A 1SYSA 4HK0A 5D1ZD 4QHKJ 1MCCA 5B39A 3IFOA 4S1SL 3QWRA 3UYRL 3PWNB 3QDME 2XNAA 2JK5A 4WI6A 3KYNA 1KPRB 2NY5C 4K7PL 3G04A 3X3GL 1OAKL 4ORGA 1CGVA 4MD0B 3T8XB 1HHHA 3K81A 3LDBB 4OZ4A 3B9EA 3CVIH 3S3JA 2IQ9H 1X5XA 4RAUA 1PYWB 1G7LB 1IL1B 1WFNA 3ARFA 4D3CL 1H3PH 3FAXA 1DUYB 4I3RH 2EIEA 4WGVB 5EU3A 2G5BB 4APQC 1OAUL 1JE6A 5L6YL 1MCWM 5FXCH 5FB8B 2GTWB 1MEXL 2DDQH 5I1AA 3C60C 3PHQB 4YBHA 4ELMF 4U6VH 1NMAH 4ODVH 1YN6A 3H9HA 2HT3C 1OTSC 3EOBA 3OAZK 5FB8A 5AWNL 2EXWC 4Z7VF 1RAMA 5M7QA 2C4XA 5E1HB 1XF4B 3FO1B 3PL6B 3ZKSD 1L0QA 3IDNB 1FLTX 3AAZB 4GKNB 2K9UA 1JVKA 2YN3A 1NBVL 3V0VB 4F7PA 1YEJH 3OL2A 2DKSA 1HHGB 3HAEG 4PTTB 3KPRD 4NZDA 1HQRB 5L7XL 2HTKD 5K93A 2IAMD 1XH3B 2OXGA 3QDJB 4PJFA 5D96C 2IALA 2D7MA 4U1NB 1OWRM 1QSEA 3CK0L 3VXRB 3WHXB 4EVNB 2XTJC 3GIZH 4CNIB 1JHKL 2PF6A 3MOQA 5SWSB 1LGVA 5F1OB 4ODWB 2VDOH 2LTQB 2DF3A 3H9YA 4WY7H 4TUOA 5H2BB 2L0DA 5FF6A 2O5ZL 3G5ZB 1DN2A 2DBLH 4Z7VB 5T5NG 1DANT 4ZO6A 1B4JH 3T77B 4M7LL 5T5FH 3LRGA 4KUCD 3D39A 5GS1C 2VE6A 2EECA 4O2FB 5FYJD 1KCUH 4DEPB 3LQAC 2DQIH 1MRDL 1WZMA 5JORA 4G7YH 4YK4C 5GJTL 5EORH 2A77H 5IVXE 4NO5B 5J4MA 4IMLA 1NCUA 3TVMC 1CGSH 1TIUA 2BVEA 4NNXA 2QR0B 5DHVA 1WEJL 5GGTH 4I2XA 2ZSWA 3QG7H 5DTFB 2YKLL 3QFJD 4WJ5A 3F5WB 3OZ9L 5JQ6L 4C56B 4DJMA 3SO3C 4L8CA 4WV1B 1JF6A 1OAZH 5D7LA 3O2VH 1MJUH 2FHBA 1MREL 1OAXL 1NCDL 3SGKA 3BGFB 2R9HC 4J1UA 3PWLB 5I17A 4LVHC 3P2TA 5F9OL 1BFVL 1TJHL 3QHFH 3C5JA 1CGTA 2CK2A 4M7JL 3QIBA 4RWYH 1IZKA 1J0JA 1FG9C 1NGPH 4JGMA 5C0RH 5TFSH 4GAFB 4FFWC 2RHEA 4HUNB 2HN7A 5C09D 2J4WH 1S8DA 5D7IE 1WCBB 3V52H 2EIBA 3KHOA 1E28B 1T1WA 3THMH 4PTUA 1LO5B 3F12B 3TCLB 3QDMA 4QRRD 4G9FA 1EXUB 1PZUB 3P4OA 3F7VA 4YDLC 1J8KA 5I8KL 1CD0A 1UCTA 3LS5L 3F6LA 5GRUH 1S3KH 3U30C 1KEMH 1AQDA 4WENB 3O6KH 5DHYA 5KTEL 3RVXD 3VI3F 1BAFL 3HI6H 2DQIL 1BFOA 5CCKH 5IJKA 1ZEAH 1YNKH 4X7SH 4X6DB 8CGTA 4PJAF 2OMBA 1G0XA 2VWEE 2MMXA 3CFKA 5KOVC 5D93C 3ARZA 4FQHB 4RGMB 5FKAA 4E41E 1FIEA 4D8PA 2H2SD 4X6FA 4LOUD 5C9JB 1NC2D 3NPSC 2I5YL 3ZT5A 1I9IL 4Z7VE 5L2KE 1N64H 5C0GB 4C55A 3BP7A 1IGCH 3KYAA 4OCNC 1AQKL 4LLMB 3X14B 4YWGH 3MRRB 4TOYL 5BZDA 4ZAKA 3L1OH 1QBML 4U6YA 5GHWL 1F4YH 4JFQA 2OZ4A 3G6JE 4DKAA 1NBVH 1V3LA 3CAFA 1C7SA 3UPAA 4FABH 4JR9H 3MV9A 4OZFA 2A6KB 1IAOB 1BJ1J 1DQQA 3DGCR 4TUJA 4Q74A 3SDXA 2KZWA 3HG1A 1OF2B 1FYTE 4UOJA 5F88A 2PXYD 4PB0L 4PRHE 4DN3H 3O8XA 3KDMA 3TVMB 2NPLX 3KYNB 1GZQB 1P84J 3UC0H 1CR9L 2A6IA 5DJYB 2Y36L 3GM8A 1OLLA 3REVB 5CZVL 4ZAKC 4WI5A 1FZOB 1IGIL 2BXZA 1CL7H 1DUZA 5DC0A 2Y5TA 3D85B 5GZNC 3W9DB 3LD8C 5K9KA 3O2WH 2BVPA 1YMHB 4C4KT 1L0XA 2F9BT 3EFFB 1WTLA 3HZYA 3MRIB 1G9MC 2HT2D 3MREA 1CFNA 1E4KA 2XTLA 3W9EB 3N1FC 4O9HL 4AEIL 4DZBB 1GVIA 2FL5A 1PD6A 2NY2B 2GIYA 4H5SB 1KC5H 1YMME 1IKFL 1S9XB 1QO3A 2JJTC 4N8CL 5MI0B 1SEQL 3RL2A 3T4AB 1UYWH 3C60D 3ET9F 1G7PB 2Q76B 2YS4A 5KSVB 1EIBA 1MJ8L 2R56L 4DKFL 3RDTA 4IOIA 3KLHC 4V2CB 2BVOA 2F58H 1MY5A 4GW4A 2XKUA 2PW2B 1A14H 5IOPA 5C0FA 3FQUA 3DWTA 3SDDB 5I1IL 4L4VB 3QUZC 3TPKA 4OQ1A 3TIDB 1EEZA 4WIQA 2R1WB 2FX8H 4KJPC 5AAMA 1RJLB 4CJ0A 1A6ZB 1C08B 2VLLA 4MD5A 3SDYH 1KOAA 1ZHLB 1GOHA 5TGBA 1HSBB 4WO4A 2X4QA 3QQNA 3MRNB 3RGVC 2CGRH 1FH5L 2QQKH 3DECA 4M6OL 1BD2E 2B4CC 1A4KA 3I9GL 2QQLH 3AM8C 4WU7A 3HUJA 3FT2B 1FLRH 2UWEE 5F96H 3VCLA 3D3VB 5DJDB 1AJ7H 4L4TB 3ME0A 1CBVH 3MV8D 4U33A 3DYPA 1UADC 4R0LC 2XOTA 3UTPD 2NNAA 5IOPB 3TIEB 3U7YL 1KIUA 4A2MA 3MNVB 4KVNH 4WWKD 2CKBL 3PJSB 1JGLH 2VO5A 3BQUD 3I3EA 1AGFA 5D1XC 3GJFH 4YQXH 4R7DA 1H3VA 5CWSA 2X4PB 1V5JA 3WEXB 5FDWA 2LABA 2UZXB 3AS1A 4EBQH 1KFAH 1J18A 3DTXA 3WN5C 4AK1A 1K4CB 1KACB 1MFBL 5EU5B 3B5TA 3EYFA 5BRZD 4Z7OF 2CDFB 2D4FA 1PG7X 1N0XH 2YD3A 3QPXL 4NGHL 3C5SA 3UYOD 1C5DA 2V9QA 1BWMA 2X4UB 1U91B 5C8JA 4Y2DA 4JAMA 1DE4A 2VXSH 3DXAD 3LAFA 4Y8DC 5TF1H 2P8MA 9CGTA 1RUMH 4M3KB 1WBYA 3TBYA 4JKMA 4Z95H 1N6VA 5DJ0B 1T7VA 2H32H 1FFPA 3PABA 3VXOA 4MA7H 4M5ZL 3QG6A 2OM5A 4YHNA 3IDMA 3C5ZC 4S0UC 1RZJH 4KAQH 3S37L 1JGEB 1P4BL 1TCRA 1LNUB 1CXIA 1NGZB 5D7LE 5D2LF 4XWOC 1UCBH 1QOKA 3GM0A 3NMEA 4A6YB 1JFMA 1U93A 1MAJA 3BH9B 5EOTA 2MJWA 4MNHA 5DD6A 4KH2A 3VMNA 4FP8L 1EX0A 4L4JA 5DJ6B 1DBBH 1Q9LB 3V7MA 1NAKH 3PDOA 1DE4B 1RUML 2XTJE 5C0BE 1UB5A 5T3XL 3P9LB 3VXQA 5CWSB 3QULA 2I9LB 2FH6A 4R90L 1KB5B 2QLVB 1HH9A 5ISZA 1RD6A 4P9ML 4JY4B 2OI9C 4LPYA 5I1HL 2NXZD 4GS7B 5LJYH 1PX3A 5JLZB 3CDGA 2Q76A 1AR1D 3QFDB 4M7KL 2NZ9C 4CU8A 3AS0A 4EOWL 1AXSB 2CO6B 4WU7B 2VKXA 2PW1A 3BRGC 2HKFL 1OGAB 5C6PB 1AD0B 5IF0B 2NY0C 2P5WB 3GMMA 4CVWA 1S5IL 4KK5C 3X12A 4OV5A 3OJMB 1FYTD 1NFIB 1SJHB 1C08A 3F12A 1GYAA 1E28A 1T1WB 1TVHB 4ACPA 4PRID 3SDDA 3W9DA 4KQ3L 2P5EE 2R2EA 3O45B 3SDCB 4ZSOB 1G0DA 1BM3L 2F54D 4MQTB 3QXDA 3UPRB 2VMFA 1HILB 3WE6B 4R4NC 1EEQA 2IFGA 1UEYA 1T7XA 5I15L 4WHYH 4EI5D 5I1EH 2EDOA 3BQUC 1ERNA 1AKJB 3V6ZA 4JVWA 4X6EA 4HT1L 5E7FA 4BFEA 4BUHA 1H15B 1VGEL 1KENL 1RZGA 3RWJA 4PP8C 4OI9A 2W65B 1EHXA 4PRBA 2JIXD 1IAIH 3SKMA 2GK0B 1D5BB 2MPAL 4LOUC 3MRLA 1KCVH 1YQ2A 5J13C 3A6CH 4LHUD 5JR1L 3CMGA 1S9KC 1PVHA 2WBJC 3INUL 2HT4C 4HKBA 4PG9A 5ACZA 3REVA 3GMRB 2B5IC 5DGQA 3RHWF 2EH7L 1I8KB 3T0WA 1DBAL 1H8SA 2EIZA 3U7WL 3FN3A 1K6QL 1BOGB 3VRLE 3RUGA 1X7QB 3EOTH 3TA3C 1T0MA 4JPKH 1NAMA 2AP2A 4Z6AT 4R4BB 4NC0B 4KK9D 3P4MB 3RP1A 3SKNA 4LEOA 4N8PA 1EJOL 5DK2A 4OCXL 3VWKC 3NBNA 5A2FA 1FG2B 3IU4L 1E27B 5JR1H 4Y0GA 3IDJB 2HP4A 3IJYB 1IAOA 4L5FH 2VN7A 1WJ3A 2QSVA 4M61A 4X4YA 5L0QB 1HQRA 3VRJA 4PJ9C 3JV0A 3TYFA 3EHBC 1WCBA 1TITA 3NZHH 2XTJB 5C0BB 5HYSG 4NRXB 1DUYA 5EU3B 4ZUSB 1INEH 4XAKD 2GJ6E 4QHUA 2NXZC 4ZYKA 1L7IH 2ADGA 2YZ1A 5GGSY 5D6CA 3MOBL 3IFLL 4EJ1C 4JRYA 2C3XA 1DQLH 4GRWF 1BBDL 2Q20A 1YEGL 1DSFH 2GAZB 1TNMA 2EE6A 1EUTA 2OXHA 3KXFA 3IF1B 4OCSH 1FYHB 4M9OA 5IW1A 1CDIA 1DBJH 2GAZA 3DNKA 3NA9L 2OQJA 3DX9B 2EXYC 4G3YH 4HWBH 4U1HA 2X9YA 3O9WB 1BZ7B 1ZHNB 4TUKL 3VXSA 4ELKA 3TN0C 1R5WA 3O6KL 3BN9C 5J13B 5KTEH 3O4LE 3QO0B 2NX5B 4KGJA 5CZKA 1BREA 2EZ0C 5F3BB 5CINH 4HUVA 7CGTA 4NQTA 5C3LD 1UG9A 2ZG2A 2R8SH 3VRLF 5C0CD 1D5BA 3STBA 2WWMD 1M6OB 3KJ4C 5GGVL 1DVFB 4NQVA 4QOKB 1YA5A 3IFLH 3BGAA 5MEND 5FYKE 3O6LL 4KK5D 1TCMA 4P3DA 3CPLA 5KVDH 3PWUB 2DLHA 5FK9B 4KUCF 5DMYA 3A6BL 3V6ZB 4ZMAT 4FZEL 2HFGL 2V7HA 4FTVB 2FGWH 1ZT1B 3TF7A 1V3JA 4MVBD 4KK6D 4GRMB 4LLVB 4G8IB 4JB9H 1T5WB 1E6JL 3TFKA 3ULUE 5EO9B 4HPOH 1M4KA 1YZZA 3MUZ1 2NX5E 4HF5L 5EA0L 3NPZB 3SE4A 1X3DA 1WSST 4B5EA 1RK0B 2I24N 5HHXL 5IB2B 2RFXB 4PY8J 1J86A 1FCGA 1WC7A 4M8QB 4BQCA 2C1PB 2FECI 4XGZA 2OR7A 5E1AB 1EHLL 1NLDH 4XZUB 3VFVB 1E6OH 1AGEA 3AREA 1KCRL 1IL1A 2FX9H 5ID0A 1OSPH 1CE1L 3SDXE 1KLGB 4K94H 3U7WH 3FFCA 4KC3B 4HLJA 1MHPL 4NQEE 3J8F7 5C08E 4U1NA 2WP3O 3BN3B 3MO1B 5EZOL 5D9SA 5IB5B 4RDQF 3FO2B 5C7XL 3ULUH 3MLYL 3WCYA 3H9SA 2OI9B 3O2DL 4PRBB 4BKLA 1BX2A 3GSXA 3FN0H 3WIIL 1N4XH 4LVNC 2JELL 2YHGA 1GZPA 1UKTA 3O6FC 4NQEA 1NAKL 4TNVF 5JTWA 5C0CA 1MFBH 2MPAH 4OCLC 3MLSH 2AXJA 4XP4L 4L8DB 4FP8H 1P1ZA 3VFUA 2EH8L 4PRNA 4X7FC 2A74A 5E24E 5D7JD 3WNKA 4Y5VB 3MYZA 1SEBB 3AREC 3O4LD 2BY0A 1MF2L 2XXCB 2SEBA 3VRJB 2PYEE 4LCIL 3QULB 3VD5A 4ZSOA 4F7MB 5HHQA 5I1EL 1B4RA 4GAYA 1WBXB 3E8UL 5CJOL 4G6FB 4JQIL 5E56A 2J2ZA 3QDJE 4X8JB 3LEVH 4TPRH 5D71H 4Q2ZA 1CU4L 2AABH 3MJ9L 5F7NC 4W81A 2QQKL 1R5VA 1YQVL 3WJJA 3OKKB 5DQJA 3NGBC 4F2MA 2C9AA 4FFZH 2NY1B 1BQSA 2BNQA 4TPRL 1U8NA 2VITA 3B5HA 3PGCA 5D4QA 5KVEL 1EEUA 2ERJC 3BWUC 3H7LA 1U91A 4S1SH 5C8JB 1ZGLB 1AR2A 1ES0A 5ESQB 1KPVA 4DVRL 1MIML 1F3JB 4G42A 4HH8A 1MFEH 4N5EA 1QHPA 3KYOA 3BIBX 5F7DA 2Z93A 3IXTB 5IR1B 1FFOB 1MHCB 1YDPA 4E5XA 5ACZB 1T5XA 3HNTL 5EU6B 4OF0A 4YUEL 1NPUA 2ZJSL 5IR1A 1OSPL 3A0OA 3MJ9A 1IAMA 4POZC 2PETA 1RV6X 3SBWC 2ZZUT 5T1LD 1X6NA 2VLRA 3WFDL 1G7IB 5EWIH 2VDPL 3PV6A 5T3XD 5IMKB 4PRIB 5IV2A 5I1JH 1I85A 2KKQA 2FNBA 4Y16C 3UAJC 3U9UA 1VADA 1IILE 3S3PA 3PV7A 4APQA 5BS0A 3QUMH 1WITA 3EOAB 1JGVH 4ZDHA 3TO2A 3TJHA 1AXTL 3WYRA 4F15B 1E6JH 2DM4A 3BPOB 4KJWD 1ED3A 4LQFL 4CDHA 3UTSB 4UDUB 1JFQH 5DJDA 4NM4L 3O6ML 4JFFD 1FV1B 2PTTB 4OZGF 1OL0A 4X8XA 4XPHH 5CBAB 5T5NF 1MJ8H 4FZEH 4CW1A 4NQDD 1MSPA 3VFMA 4MA7L 4WTXA 4RMQA 3BKJL 3UTTA 1MH5B 4YFLF 5KVDL 1KJ2H 1I1AB 4AIXA 3EJYC 2UWEB 4XNXL 4JG1H 4R7NA 3T0EE 1AP2B 5GS0C 3EZ8A 3V6FB 2HVJA 3MLXL 4JFEB 5JXEA 2EXYD 4ZXBA 3DO3A 4PJ5A 5FOBA 4YX2H 2BZDA 3U83A 4NQSA 5AYUH 4HBCL 1ED3B 2X9XA 5D2LB 1AO7D 4MJIB 3CVHA 3M17A 3MRMA 2HKHH 4WUKL 1QBLH 3B3IB 3RWGA 3NABH 4OLZL 1XCQB 2AVGA 1SBBA 2YD6A 2Q6WA 1IGCL 2COQA 1E4XI 2QHRL 4P9HL 1MWAB 5CIPH 3BJ91 3U46A 1BF8A 5ICYB 5AUMB 1PY9A 1BVKA 3MJ6A 4WVRA 5IQ7H 5IT2H 1P7QA 2I9TA 5CGYC 4HG4J 5TGBB 3NIDF 2FO4A 1B90A 3BH9A 4X80L 3ARGD 2LAGB 4Y5YB 3BHBA 1OWWA 4YHIA 4L4TE 5DJ6A 4YHYC 4ODHH 1NUNB 2HT3D 2NXYD 2L7UA 3BW9B 3KPRE 4XX1E 1GGTA 4PJAB 2H6PB 2E7CA 2DQDH 4Q2ZB 2JB5H 1U8OA 3TBYB 4IOSD 1P2CA 2ICES 4XP9H 3K2UL 5I75C 1HYRC 4YHKL 3K74B 3UTQB 5HYIA 3HS0A 3I6GA 1CF8H 1B3JA 1OGTA 2FX7L 3BHBB 1TMCA 4X8JA 4PJFE 4X4ZA 2G60H 3R0MA 4U49A 1BIIA 4ZUWB 1E4WH 3BMVA 4N0CA 1HWGB 4LEXH 2XXMB 1YNTA 5E9DD 4X6FB 3IU4H 4ZPTB 4XX1G 5EIIB 4U2YA 2XIDA 1G6RH 5D2LE 1DQMH 2DWEB 4OCRL 4ZUVA 3RWEB 2YA0A 5FUZH 1ZV5A 4HKZB 4BKLB 5J1SC 4P2RE 4U1LA 4XPFL 4Z18A 1D5XB 1ADQH 3FO0L 5HHVH 4BQ8A 5I6XC 2BSTB 1RFDH 4Y4FB 3ALWA 4GKSB 4FOMA 1YECH 5IP4A 4TSAL 1FIGH 1IGIH 1FC2D 1CLYH 4QRUB 4UZGA 3MRKA 1ZHLA 2FX7H 2XACC 4XNYL 5H37G 3HPLA 5E4EB 4Z5RA 4XVSL 5KW9H 3X13B 4M8QA 4K71B 3C6LA 5INCA 3CVHL 1RUAL 4P2RD 2ZUYA 5DD0H 5SV4A 4KKCD 2ZUTA 3MOAH 3B8YA 1JPST 3TH2T 3PP4L 2FBJL 3BYYA 3CK0H 3KPMA 4S1QH 2DWDA 5SX4H 4YDJA 3TA3D 4O58H 1EEZB 2EDHA 5EUOA 2UZYB 3GSQA 5IROC 1XGRA 3Q3GA 3D5OF 3D48R 4J1UB 1IEHA 3WD5L 3KXFD 3HFMH 3RVUD 3MRPA 5FCSH 2YPVH 2HWZL 1DFBL 5C0CB 4MA8L 2BHYA 2HFFB 4PJEB 4K3DH 4J6RH 1YY9C 4MNQE 1MFCL 5GIRB 5T5FL 1CFSA 4NWUL 1I9RH 1U95B 1B9ZA 4P5KB 1Y0LA 4WW2C 4XAKE 4IBLT 1MEXH 5JNYB 3BUYB 1FFRA 4IMLB 4XVSH 1CDHA 4M8VA 1FZMA 1PAMA 4X7CC 5DMIH 3C09C 3ZKND 2ICCA 5T1KA 1VKXA 4ODTH 4ZFZA 1YPZB 5KSBA 3CGTA 1FIGL 2EIZB 3L5WB 2FIKA 4XCFH 5E8DH 2Z31D 1DL7L 1I8LC 1EGJH 1N3NA 4XP6L 4Q0XH 1FSKC 4RX4D 4X0KB 4QGYA 1CFTA 4ISVA 5CAYB 3ZO0A 4O4YH 5IBTH 4M62H 1DUZB 3OR6B 4WFED 4XPBL 1PKOA 4MXQC 3QIBB 1G0YR 5I1GL 3TA3A 1R6VA 3UZVB 4B0MM 1INDH 5LQBH 5KJRH 1UFUA 3MTRA 4S2SA 3P11L 3R1GL 5BJTB 1AH1A 3MA7A 2DDQL 4GW5B 1XEDA 4K8RL 1KJVA 4LSPL 4AJ0A 3O3DB 5IHUL 1PG7W 4I18C 4F8TA 4D3CH 1XIWB 2RCSH 1YEFH 3TT3L 5EBWA 1A6UL 3O8XC 1U3HC 2Q8BH 3QH3B 4NC1E 4P5TA 1T1YB 5JIIA 1I7ZB 3NFPA 4IRZH 4S1RL 5EZLB 4ETQB 4ONHB 2H26B 2APWA 4GXUM 1NMCB 1I8MB 3GKZA 3QQ9C 4Z7NF 2DAVA 1I3GL 1JWUB 3H42H 1RZIB 2AK4B 3JWOL 1GHFH 1T2JA 4LCWD 4LDEB 3VFUB 2G5BA 3MV7E 3DURB 3P4LA 4W6XB 3P30L 5J0BA 3P4MA 3BISA 4YBLB 3NOIA 3N85L 1RJYA 2AQ1A 5IMMB 5BVPH 4YC2C 1MRCH 4P2OA 5E6ID 1XF5A 1CYGA 3DX7B 1IVLA 3MMEA 1NCAH 2DBLL 4LP5A 2A73B 4QF1A 1I1FA 5IQ7L 5FO7B 1DVFC 3KPQA 1VCAA 3V6OC 2J8HA 2J8OA 4J3VA 1YEHL 1BZ9A 1W72B 4DVRH 3BZFB 2A83A 2UWEF 3TC9A 6CGTA 5T3XE 1AR1C 1MI5E 2NY4B 3QUYD 3VFOB 4IRJB 1WWAX 2JJUA 1BQLL 3WKML 2C1OA 3OQ3B 2NY7L 3GSNL 3EKCA 4OZFH 4Q9QL 4KTEL 5DUPH 4P2OD 3T0BA 2XZCL 1MHHA 1NGWB 2OCFD 2Z8WC 5TQ2L 1NGYA 2FZ3A 4X6CF 2X4NA 1P4LB 2BOBB 4ZNEA 1U92B 2AK4D 3UO1L 1XGPB 5IIEA 5D71L 4GW1A 3LN9A 4KQ4H 4H25A 4NC1C 1ETZA 4ZNCD 2XQYK 3RRQA 1NMAL 4JFHD 4ODVL 2XRAH 2YOCA 2GSIA 1UACH 5JUEH 4HIXH 2ARJQ 2J8UE 3QJHB 1I85C 4Q9BA 1S7UB 3L9RB 4GBXB 2JJVA 4RQQB 1N5AA 3W0WD 4HK0B 3LSOA 3WIHA 2QHLA 5IWLA 4KKLD 2X10A 4M5YH 4HC1H 4S2SB 3TZVD 2V9TA 7FABH 4GSDL 2IPUG 1HHKB 4U1MA 1I8KA 4JVUA 3WKNA 2AXHA 2XQYG 4L3EE 2FH8A 1T2QL 1RHFA 2O61B 4P46A 5ESAB 5C0DA 4MAYC 4WGWB 1UWEH 4UT9H 3T0EB 1DN0A 5E2TL 1K8IB 2A0LD 1P6FA 3ARDA 1S78C 4PBWD 1C1EL 3SEPA 4O9HH 2GQHA 1P7QB 1NJ9A 1LE5A 1T83C 4BZ1H 4OF5A 1A7PH 4ZPVB 4YUEH 4CVXB 3G6DH 4PUBL 1MWAA 3U46B 2VAJA 1R3JB 3P40A 1VACB 1CLZL 4HHAA 1QA9B 4M6NH 3EYSL 2IGFL 1KCRH 3ROOB 5DA4A 2BNUA 1TTFA 4EI5B 4OGZA 2E8YA 4Y2DD 1R5IB 5DJXB 2J6EA 3GKWH 1F42A 1RIVH 3EBAA 4U7KA 2CUMA 4Y88A 4YZFE 1U95A 3PG2A 2KZ1B 4JRYB 2AJXL 1I3VA 2FEEI 2EDYA 4Q97A 3ABZA 1H3TA 2VDRL 5JLZA 4XNZC 4Y4KB 4BQ9A 2BSRB 5GSRA 2XA3A 3IDIB 4KDVA 4MYWB 5FYJE 4HDIB 1FDLL 4HXAL 1LK3H 1R3KA 5DFVC 3QCVH 1F3DJ 2AXGA 3EYQC 1LP9B 4P4KA 2FJGB 3G08A 4Y19D 4GG6E 4Y5XA 2VZVA 5F9JA 4AENA 2ZUQB 2CUHA 2V17H 3C6LB 3Q5OA 4UOW1 3E3QC 3AY4C 4CN6A 3I6GB 1NGZA 3N1PC 2ERJB 1ZLVH 4JFYB 4R2GC 1A6AB 5DD6B 2R39A 5CJOH 3HMXH 3VXNA 3ARGB 4D9QD 2OSLB 2YPKB 4OD2A 3GMQA 1TCRB 5B4MD 2F19L 5JIKA 3DO7A 1MF2H 4CADB 4TNWF 3MBXH 1EHAA 5DUPL 4AIZB 2F53E 3BVNA 5CBEB 3L1OL 4ZTPH 3EAKA 4NOFA 5GSVB 1KCSL 1CN4A 3V5KA 4GRLD 2FDBP 3GNML 5ILTH 1HOCA 4FQXC 2VQ1A 5I18H 3N85H 4JCLA 4NSKB 3RBGA 4OAWB 5CCKL 4RA0C 5C2UB 2DWEA 3J7HA 2JELH 1RUQH 1QZ1A 4LRNL 3D39E 2D9QB 1VKXB 3FT4A 3DBXB 2EDXA 3SDAA 3OG6B 2RB8A 5HHMD 2PO6C 3S9DB 1B0RA 1JF5A 2VLME 2QBWA 4OZGA 1ULVA 1KNOA 4X7SL 3D87B 4CDGC 2CK0H 2J4WL 1L7IL 1A21A 3GSNA 3HI6L 3T09A 1VENA 1YEFL 2HT2C 1U8NB 2VITB 1IZJA 1KCKA 3QDGE 5K9QG 1DANU 1MJ7H 1X5GA 2P8PA 1VA9A 3LPGA 4U2ZA 2BY1A 4YPGA 5FUOL 2H32A 1A5FL 2O93L 4JFYA 4F57H 2X4QB 2YN5A 3TBTB 2H8PB 2Q7YB 1PKQA 2E6JA 3T2PA 4IRZL 1U36A 3O2VL 2ZCLH 5HGBA 1JZ5A 3MX0A 5IVZB 3VI4F 4PLJC 4E0RA 1A6UH 4LF3A 4P4RB 2X41A 3O45A 3FFDA 4B50A 4ZAKB 3U4EB 4P23B 3VGAB 3QG7L 5E94B 4CU7A 3QWOA 1JUFA 3C2SA 3I2CL 3A6BH 5JOPD 1J5OL 4XH2B 4OGXL 5SX5K 1QEWB 1JGDA 1SEBA 4MVBC 5HD8D 5TDNA 5ABDE 1I4FA 3BAEL 1JJUA 4HC1A 4UUJA 4OLUH 3DSFH 5KANG 5DMIL 4AM0A 1AD9B 3SGEI 3U6RA 1TJIH 4ZFGH 4KTDH 4TVPE 2VIRB 4GRWE 3BZEB 1AIFB 1MCQA 1NCTA 2BSSB 4G8GA 2XA8L 3FT2A 4JQVC 3CDCA 5F7LB 2JE8A 2ICEA 3RGHA 4MGXA 5DRNB 3G6AA 3ARDC 3MSPA 1LK2B 4M3JA 1P53A 5E00B 3GHBH 3S4SA 2CD0A 1J10A 2JKXA 4MD5B 4N90E 2VLRE 4PTUB 4M9PA 3MRGB 1T0NB 2AJ3B 4PJIE 3RHWK 4JVPA 4FFVD 4YFLI 2WY3A 4P5MB 3PP4H 1RZ8A 2Y6SD 3NIFE 3B9KA 2D2OA 3WSQH 5DS8A 1U93B 1XFPA 4X5XA 5I1LB 2MNUA 1KTLB 1BHGA 1J5OH 3FQTB 3MV9B 4LCCC 4XBGA 4JO4L 3TBVA 4LKXB 1K4DB 5CUSH 1IFHH 1CD8A 1T0PB 3BW9A 4NQDA 4N9GA 2A0LC 3PE9A 4FQ1H 4M03A 2BHZA 1FO0B 1GC1H 3BKCH 1WBYB 3MOAL 4ZUUB 2Y06L 5CEYA 4HX1A 3MJ8B 1L8JA 4Z7OE 2XZAL 2X9WA 3OX8A 4OKVB 4XCYA 5DRXA 1TPXC 2AQ2A 4XVTL 4QWWD 4M93B 4GAYB 1NBZA 3GKWL 1H3XA 4KK8C 3L3DA 2IGFH 2AW2A 4PJIF 3MNZA 4KJYB 1CT8A 2R0ZL 4QRSB 1ZMYA 4MNQA 4KV5F 3QEHA 4DQOL 2NY4D 1I1FB 5EUKA 3QUYB 4QXWA 4KWUA 3BIKB 2B4CL 1H0DA 3KPSE 3KJ6L 5T1DH 2IFFH 3KPLB 4QT5A 4NO0A 2H1PH 1KTKE 2F5BL 12E8H 2HH0H 1FVEA 3RKDC 4CVXA 4N0YL 1S78D 2CDGB 1NQBA 4P2YA 4JFPA 5CGYD 5IB5A 4OFKA 4Q9CA 1KPUB 1T20A 2CKBA 3QXAB 4ONGH 1A4KB 2OZ4H 3EO1A 1G7JA 1SVCP 3ECBA 1NCCL 1A4JB 4KMQA 4HT1H 1F8TH 3QZWG 3T0EA 1MCKA 4L1HA 4Z76A 3L5HA 3S8WA 4CW1B 3EYOB 3Q6FB 5J11C 4ODBD 3S6CA 5GGUA 4MXVF 5D2NE 5H94A 1YJDC 4ZFOB 2WV3A 4OF8A 5CEZD 3PP3K 5ANME 2A74B 4X80H 2WBJA 5HI4D 5EC2B 3WXWL 3FQUB 1R3KB 1CE6A 1OPGL 1QFWH 4JE4B 4FQPA 5FGCB 2BNUB 3P77A 2VXSL 4Z9KB 1KJVB 4PGCB 3VXME 3JBG7 4OZIF 4NKIL 1AI1H 4NZTH 5ENWA 2EC9T 2VWEC 5IJVB 4C59B 4Q9QH 2CDEA 4Y5XC 1BD2B 4KJQD 3L5IA 1CLOH 1B6DA 2ZPKL 3S96A 3PWUA 1NEZG 4S0SD 5ID0B 1K8IA 4JDZA 5TDPA 1EO8H 2VDRH 4NUJA 1IRAY 4XPAH 3ZE1E 3OR7B 5GXBB 3U2SB 1LE9B 4X6CE 3QWQB 2CKBH 3K3QA 5FF6B 4EOWH 4PLOB 3KPRA 1F3JA 4NHUE 1YUHB 1KPVB 3VWKA 1CBVL 3NABL 2Z35B 4NQCA 3V4UH 4LCYA 4Q9RH 1YNLL 2BRQA 1BD2A 2FR4A 1IGML 1U41A 4JRXE 1W0YT 3CDFA 5IB1B 4WW1A 5EZIL 3WLWC 4YXLL 2PYFB 4PLJD 4TVPD 2ZSVA 4P59L 1IGYB 4BZYA 2DQJL 3ILQC 4GRWB 4RQQA 4TNVK 4PJBE 1CCZA 4CRPA 4FFVC 1NMCC 4JPIB 3WDJA 4MMZC 1OTTD 3T0VA 4HFUH 3MV01 5I9QB 5KANI 2FD6L 3QEUA 4L3EB 1LO4H 4PGCA 5KSBF 4NRYB 5HHOE 4XHQA 1RQ5A 5ALCL 5IHUH 3QRGL 1P4LA 2BOBA 1KGCD 3EYSH 3N1QC 5EU6D 4YHOH 1JGVL 3ECBB 1TVHA 2PR4L 4HUMB 1KULA 1L6XA 4X4YB 4WFHD 4PB9H 3EYQD 2A73A 3QDGD 3V4PL 1RUKH 4L29B 1IQDA 4HV8A 1Z9OA 3QPXH 4NGHH 2X09A 1EHNA 1BZ9B 1QRND 4JJHA 1U3ZA 4ZOCA 3SCMA 4MAYA 1ACZA 5DUML 4DZ8B 2AK1L 2IALB 4LP4A 3GIVB 4Q0XL 4P9HC 2ZJSH 3W81A 1JZ8A 3NCJH 3D3VE 4NFBA 3QBTB 1EH9A 4Y4FA 5F8RC 1BECA 1DDHA 5EIIA 1V8HA 5D5MB 2NW3A 4XHJC 4U6HA 4NN7B 2R1XA 4MNQB 3LEVL 1OAYL 1MCHA 2VDLH 4G6JH 4MD4A 5L8JB 4KTYA 1GGCL 1ZT4A 3QDAA 2CR6A 1I9RL 4R4FH 1CICC 4ZPTA 3BKCL 4P49A 1RIUH 3EYOA 1IE5A 1I9JL 2YSSA 1A3LL 4MB4A 4KDWA 5E6IA 5ETUB 1MHEB 3HE7D 1HXMB 1YYLH 4XP1L 1OP5K 4XBGB 3TBVB 2EH8H 1FYTB 3HNSL 3CH8A 4R8WH 5B39B 3FKUS 2ADJA 2DTSA 4ZXBD 3KAAA 4CVZB 3CPLB 2A6JA 4HWZB 4E42A 2V7NB 1J0YA 1CI5A 2FJFA 1FAKT 4PV9B 5IGXH 1C7TA 1N4XL 4Y19E 5DFVD 1JMXA 4NQCE 1XGRB 2F58L 4JY5H 1JK8A 4YFDB 3G6JF 4K71C 2P4AB 3MRGA 3JWDL 1AFVL 3F65A 4KK9C 2P45B 5IKCA 5E6IC 1D5ZA 3QQ3A 1CGUA 3A6OA 4DN4H 3P11H 4QO1A 2X89A 4P2RB 5HVFB 4Z7QE 5KJRL 3VXSB 3U9PL 5DRNA 1XGTB 3GMRA 4LVHB 1JNHA 2FLBT 1JGUL 2FCBA 4JFFE 3WLBB 2CDEB 4JLRB 4MHHG 2EYSA 4OKDA 2C3GA 5B4MC 4XNZB 4LK4A 4YDKL 4BSWB 3UYPA 4HGKC 1EA9C 3P77B 5A2LH 5TH2B 4LQ1A 4ZO8A 5CP3H 4RNRA 3DSNA 2NY5H 2XI9A 3QDJA 4PJFB 3GJEA 3AS3A 3LQZA 4I13B 1H15A 3CFJB 5FHAL 2JJSA 3RWEA 2AXFA 3GGWB 3SQBA 1YC8A 4V2BA 1N59A 4RWYL 2WQ8A 3BO8B 3JUYA 1G9NH 3RA7L 4L8BB 1FGVL 2HFGH 1NC4D 2KPNA 4LLAA 1RZ8B 5BZWB 5IHBA 4PB0H 5F7EL 5I1KL 3DMMC 1YN6B 4WEUD 4ZODA 3D2UB 3HKFA 1W0WA 3LEXB 3MPCA 4NFCA 1XR8B 3JZ7A 4EI6B 4LFHG 1OAZL 2BC4B 4J6RL 4PJGE 4Z5RB 3DI3B 2PTTA 1IBGL 4YHPB 4G6AC 1A6VL 2IADB 4ONOA 5BVJB 1T89C 5B21A 3CDYA 3DRQB 3CSBA 5SV3A 3PWPB 3MXWH 3OWEA 4ZOAA 4AMKH 2W92A 1F4WH 3C08L 1UZ6F 3FZUC 3MLVH 4LNRB 3FB5A 3ARYA 4JFHE 1JYNA 3FB8A 3H0TB 3IKCA 3T2QA 3KPPB 3W5NA 1TETH 2VXQH 5HPMA 1VADB 1GGBH 1QSEE 2DRUA 2VLRD 3I50L 4OZIE 2NMSA 2EC8A 3DBXA 5T3ZL 2GYSA 4YPJA 2N56A 3BXNA 2CLZB 2CIIA 4PJCA 1X5IA 5J1AA 3CSGA 3G6JA 4G3YL 3CMOL 1YNKL 3BXNB 4UILH 2Z31B 3ARUA 4TN9A 4R0LB 4YE4H 1S9WA 3MXWL 4QRQB 4KKCC 3M1BA 3QPQC 3FRPG 3JVGC 3QISA 2EO9A 1QR4A 4PR5A 5C0ND 4O58L 1OGTB 5IW3A 5CEYB 4OCYH 4XBEH 2XWBB 4JZOB 4PY7B 3THML 1G9ML 4U1JA 4FFYH 4JG1L 3RTQC 2DM2A 3T3MF 2YMXH 3TBWA 5D1QC 4PFEA 5DJ0A 4POZD 5BVJA 4TUJB 2YPLD 1EJOH 2GFBB 2IG2L 3IDMB 2H6PA 3HC4H 3OKKA 3PDDA 1S7SB 3WFEH 5IHZB 3QIUC 5F9JB 3C8DA 2YEZA 4JPKL 1OB1A 1NFDB 1UWXH 1V7ML 3MCLH 4EIZC 2WSKA 4NHCH 3MLWL 4EDXA 2ADIB 3ERYA 2YKLH 3CCHB 4MS8D 4V3EB 5ACMA 1X5KA 5D5MF 4M43H 3O0RH 1EPFA 4D0DA 5I75B 2DQTL 2FIRT 3GRWH 4XMKL 3D9AL 1AHWB 4P2QB 5DC9B 3N0PB 3QYCA 2DQGL 1BVKB 2HFEA 2MFNA 3OF6D 5DT1H 2N4IA 1EVTC 1CGXA 2BSRA 5GSRB 3TIEA 1HYSD 1VSCA 4G59A 1CICD 2GT9B 3V8CA 4BSWA 1I1AD 5HY9A 4D9QE 1R5IA 3D0LA 3DRTA 3IETB 1L0YA 3OJDA 2X1WL 1GGBL 2H3NB 1ITCA 5ERWB 3MROA 1EBPA 5JXED 1J0HA 1A1MB 5E0QA 1RHHA 1WWCA 3WLBA 1BF2A 1EXUA 3SE9H 1WQVT 5CZXC 5C9KA 3EDJA 4M02A 3PDOB 4WFHE 3MYJA 1YMHA 3HTLX 4L9LB 4M5YL 1KXTB 2OLDA 3GRWL 4DK3A 3QXUA 1ZVSB 3DGGA 5HI3D 5CJ5A 3CFIC 3KPTA 2C3VB 1P7QD 1BP3B 4MAUL 3RWDA 4XI5C 5BMFL 4YHZL 5GGTA 3UX9B 3EJZC 5EN2A 3RL2B 3UBXI 4PG2A 5F7UA 2GITB 4JANB 1LO3H 1B0RB 1T04B 4RGMC 4LCWA 3RDTB 1N0LA 1A6WH 3QT2A 4W4OC 3VFNA 2YD9A 5C0CE 1U0QA 2GSIB 2I26N 3R06A 2V2TA 4ZPVA 3DJ9A 2EO1A 2ZWLT 5E99H 4J4PC 1NANH 3ZKMC 1H9VA 4P5TD 4FFYL 1G9MH 1UZ8A 4HZLA 4PIRF 4J4PD 4TTDC 2Z91B 5D7JB 1ZS8B 2ESVA 3VW3L 4N0FB 3TT1L 4KKBD 5MHSE 1BZ7A 1Y18A 1N6UA 4PB9L 3VGDA 3V9FA 5H2BA 2OJEB 1G7QB 4XNXH 2PXYB 1OQXA 3ZT6A 5ALBH 2CH8A 1DBBL 2OSLA 4DTGH 1FAIL 1YPZE 3SE3C 3CMOH 5CMAA 3CSYB 2BDNL 4HGWB 4LKCB 2BP3A 3JTTB 3QRGH 1FFQA 1XF3B 2IBZX 4JQVA 1AFVH 4NKOB 3UJTL 2BOCB 3LIZL 3S37H 1QSZA 2BCKB 4M1DL 4LCUA 2DD8H 3H8NA 3ULVE 5FV2A 1QLRB 1U8HA 4WI4A 2GY5A 3W2DL 3BP5B 2BXYA 4RFNB 4Y4KD 3RTQD 1O7SA 3PF2A 2W91A 4QRRE 1IMHC 1YY8B 2FHCA 3BPLC 3VJ6A 3PQYD 5DD5L 4EI6A 4P59H 1MHHB 4PJ8C 3TT3H 2R2BB 1SBSH 1P4BH 3GSOA 2GJ6B 2PKDA 5LCVH 4I18B 2CXGA 5KSBE 5I8OH 4KK6C 4ETQA 4NKMB 2E7HA 4MNGA 4DTGL 1MNUL 2F53D 4M48H 5J6GB 2CIKA 1CK0L 4PJBF 1OHQA 4HMEA 3H9SB 5FKPA 2FB4L 3LKNA 5FKAB 4DUWA 1MAMH 1GZPB 4QLRA 4WCYL 4XXDB 1LD9A 5D7IB 3QQ4A 1YMMD 1MLCA 3JV4B 3OXSB 3ESUF 1TTUA 3KPRB 2X4RB 3CLFL 3LQMA 2EZ0D 3RZCA 2IAMB 35C8L 3QDJD 4OZIA 1JNHB 4XCFL 2NY5L 2BRRL 4W4OA 5JHLH 1DLFL 3T3PF 3B2UD 4IOFC 4JPVL 3VXTB 3C6LD 2PO6A 5HDLA 1R5WB 5I19H 2CLRA 2VC2H 5DMGD 2H26A 4OD1H 4FRWA 3U2SA 5E2JA 1HQ4A 4J7RA 1EAJA 1YEDA 4OGAC 1MHPH 4ODXB 4YZFF 3IYLW 5A3IC 5EU7E 5DGRA 3BSZH 5IFAH 3L95B 1R24A 3GSWB 4NJAH 2G9HA 1B6UA 4J2XA 4G9FD 3HZMB 4WW2F 1UXSA 1ZXQA 3VXRA 3C5JB 3SKMB 1ZAGA 1HIML 1EHLH 2QSQA 3PWJA 4M43L 5K9QI 1JZ6A 3BYTA 5EN2B 4RGNE 1KELH 2R2CA 5SX5H 4WW1B 2D7TH 3SGKC 4QHMA 4LVOC 4CAGA 5DJCB 4PD4J 3MLSL 3QRFM 4GKZB 5C0AA 3X17A 1KSRA 3V6OA 5HDQH 5L0QC 4MX7B 3O6FA 2JJWA 3QCUL 4U6XB 2WBJB 5ICZB 2IFFL 3FN0L 1C8PA 1NH6A 2Y07L 3FFCE 5EUOB 4IRSA 2DMCA 3CFCH 5JA9A 3UDWC 5CD5C 1MELA 2F54B 3B5GA 6FABL 5EUOF 25C8L 1GGUA 1OW0A 1GJIA 5F7YC 4HJGA 2JCCE 2CPCA 1S7VB 5C09A 4Z7WA 5J57B 1IKFH 3O3AA 1KPUA 1QSEB 1T20B 2CKBB 3QXAA 4JG0H 1H0DB 1AXSA 4NKOA 4V1DE 3OTTA 4LPTA 3O0RL 4CMHC 1OT1A 3VD7A 5EFIB 1AD0A 3CSYA 5MENA 4G6KL 3ARED 5F6IB 2ZPKH 3V0WH 2W0FB 3FCTA 4OF6A 2N7AA 1N2RB 5E8NB 1SM3H 4HWBL 3L6FA 5EC2A 3ARSA 1Y18B 3QEHB 5DEGA 3SCMD 1T1YA 3WFEL 3PNWB 2HVKB 3CCHA 1KYOJ 5F93C 1A7QL 1KJ2A 5DRWB 5LWYH 1CF8L 4H1LA 5I1AB 3U36B 4PRPA 2Q8AL 1WZ1L 1DSFL 1DVFD 3BKMH 3AFLA 2XN9B 2NXZB 5FOJA 4K9EH 4N5EC 3RJDA 3QH3A 1A8JH 1B0GB 1NBYB 4L3EA 3O6LH 2W65A 4JM2A 2BOCA 3S5LB 1KBGL 5C0AD 1OGAD 4C58B 2P49B 2P5WD 4HEPG 4PJ9A 3GHBL 1MIEL 4WJ5B 4F37K 4JHWL 2ZCHL 4KUZH 4NHUB 5DK2B 3LRSB 5C0JA 2ZKHL 1D5XA 3QR2A