5IB3A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and copper
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
b'GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib3A01
2MPAL 4HLZH 3EO0A 5CJBA 4LK4A 2Z8RA 2ERJB 5AAMA 1FCCA 3V5DA 1KTDB 2DYPB 2RHEA 1RUQH 2DKSA 1Q0YH 1TETH 1RVFH 5T5NG 2BXYA 2X7LB 2H2SC 3R8QA 1UJ3A 3N50A 2VZSA 3HZYB 5IHUL 2BSRA 5CCKL 2HTLD 2X6MA 3LEXB 2XWBB 3HZVA 3UTPD 1G7MA 5DHVA 5D93B 3NAAL 1ERNA 3REWA 2GIYA 4Y88A 3MNVA 5I66B 3Q6FB 1CBVH 1IMHC 2IBZX 4NCC2 3MOBL 1TVBB 5D71H 3CCHA 3D9AH 2CUMA 3HHRB 1NFDE 5CHNB 5C0BE 3G6JB 1X6LA 3MV7E 1HHGB 1II4E 3UX9B 1KJ2B 4DN4L 3HZMA 4YHOH 3MV9A 3OHXB 4K23H 2Q7NA 5CINH 3U46A 2Z91B 3O2DH 4NZDA 3O6FB 1O7SA 4HWNA 4XX1E 4CN4A 1YEEL 4ZUVB 1HH9B 3QSKB 1XF3A 3T04D 2NY1C 2EE3A 2P5EE 3MACH 4NQVB 4S10A 3MQIA 3S5LG 1D5MA 5ICXA 4D3CL 5JDJA 5JPNA 4LCCC 2W59A 4M8QA 5BO1H 2A73B 5F3HA 4QHUA 3HMXH 4O5LL 4PJHE 1IILE 5JXEA 4WHYH 3S8WA 3PWVB 4JFDB 1F11B 4M6ML 1KXVC 4NHUB 2XG4A 3B8SA 4TSAL 4YGAB 4LQFH 4OZGF 3FAWA 4RQQB 1RIUL 4Z7UA 4PJ9B 5CJXC 4X80L 3EW3B 4PJBB 1NGYB 1S7QA 1M4KA 4QTHA 1JUFA 4PJGA 4KRLB 5IHZB 4B50A 3NCBB 4HZLB 5JOEA 4P46C 5IKCB 1T7VA 4JRYE 2OTWA 1JPGB 4GFTB 3TZVD 3UPAA 4OSUL 3WDHA 3U0PB 4CDHA 3NCYP 1MCFA 4QRQB 2D9QB 2MJWA 4FQHB 1H8NA 4HXBL 5EZIL 1MCJA 5GZOD 1OWRM 1A1NA 12E8H 3V6FB 1CG9B 3PNWA 1BOGB 1A0QL 3CFJB 3IAGC 4JG0L 1BF2A 5B39G 4JFHE 1MY7A 5FECA 2P43B 3K8LA 5F1OB 1LO2H 3TNNA 1K8IA 1Z0NA 2PW2B 3ZO0A 1J86A 4MNQD 4WWKA 2R23A 2A9ML 1J8HE 1JTPA 2C3GA 4XWOC 4OZFH 4RBPK 1UKQA 5T1DH 3U9UA 2R4RH 4Y16B 4BZYA 3PGCB 3BYYA 2D31B 4ZXBB 4DWHA 2JCCE 2VR9A 3ZTJG 4YX2H 2R2EA 5I15L 2P49B 3OXSB 3WNNA 5KSUA 3VXMD 2OYPA 1F6AA 3C5ZA 5E2WH 3AS2A 4M48H 2JJSA 3UTTA 2GSIA 1EJOL 1Y0LA 3HC4L 1FG2B 1S7SA 1JTTA 4RIRA 5BRZB 1JZ4A 5FM5M 1L8JA 1YNLL 5IB1B 1HHJA 4PJ8B 1PJ9A 3VFPB 4L4VB 3MNWB 3RY5A 4L8BB 4OI8A 2Y6SC 3ULUE 2Q3ZA 4N0FA 3RVUD 3B83A 1LDPH 2NXYB 3VE0A 3GMLB 3DX7B 4EN3D 4K8RH 3FQXB 3P3YA 3FFCA 3GSUA 4ZD3H 4F15C 5JR1L 3HMWH 5GXBB 2DTSA 3MA7B 3A6CH 3BW9B 4LLVA 4P2RD 4GBXC 4K3EL 4RMVA 4OZHF 1BZ9B 4TPRL 4WV1A 4ELMB 2P7TA 3DROA 4YHYB 1U3ZA 1HEZA 2A6KA 1GPOL 2IQ9L 1ACYL 3F7PC 3BQUD 4G9DA 1JFMA 2VDOL 3CFKA 5TDPB 4MS8A 1ES0B 1NBVL 1KOAA 2C3VA 2I5YL 1P2CB 1TVHB 4OCWH 5E00A 2IANE 4DKAA 4HLZG 4M43L 5I1HH 1A2YB 3BO8B 1J0JA 4MVBC 4N9GB 3U1SL 4CUCA 2DQDH 3B9AA 5JW5A 4I0PD 2UYLA 4Y2OA 3PWLA 5LQBH 4PJAA 3VFUA 2BNRD 3GSVA 1G9NL 5IESH 3VFGH 2ZUSA 5HVFB 5C0IB 1P7QA 5HI3C 2G9HA 3RZCB 1W0VB 3K2MC 4OLWH 3TBTB 5EBMB 1S9KC 4OD3H 5IWLA 1YPZE 3X14B 4HUWB 1F58L 3RKPA 1F8TL 2DI8A 2P45B 3RBGA 1I3RB 1PY9A 3BP7A 4PBWD 5DDHA 3MRIA 1D6EB 4B53A 4B41A 2XQBL 3NCCB 4HPYH 3S96B 1S7WB 4LLQA 1LDSA 3QEGL 3ZYOA 3S35L 4L4TD 5TPWL 4GG6B 1KCVH 5F88B 1EUUA 5FYLD 3DX8A 1CZ8H 1JGLL 2P47B 3TLRA 5C0AE 4JFFE 4E41E 2AEQL 1Z6JT 4WI6A 1U8QA 4P2QE 3I6LE 3CFEB 4GOSA 4WHYG 2J6EH 1F3DH 1TTFA 3GIVB 4G8GB 3I02A 2R0WH 3SDYH 4AZ8A 3BKMH 5EBGA 1A3LH 2Y7QA 3L7EB 1S7UA 25C8H 3G5ZA 3BH9B 5EO1B 5IG7B 3NIDE 4JHAH 2I26N 4P9ML 4WJ5B 3L6FA 2JLLA 2R69H 3D25B 4NNYB 2PYED 4IBLT 5C0DA 2RAMA 1I8IA 4GT7A 4Z7WF 5KG9A 4HIIB 4OFYD 3SDXE 5EU6B 3QEQE 1Z9SA 2RB8A 1B2WH 1AXSA 4KRMB 4I77L 3TCLA 3P11H 3P4MB 5D7KE 2HT3D 4K3GA 3IF1B 5JLZB 5EIIA 3RVXD 3NPSB 4WTWA 4HD9A 3ZKSD 3FQWA 3ELAT 2JJUA 2W65A 3IFLL 2MMXA 5HI4D 1IAKA 5BZWB 2IH1B 3HI1A 4MHHI 1CFTA 5DJ0B 3QDGA 3VU2A 3UTZB 4MA3A 1ZK9A 3C9NB 2EDDA 5HYSG 3RWHB 5A3IC 4JZJB 3O4LA 1U93A 1OQXA 3IB4A 5C9JA 5SWSA 2YWYA 4CMMA 2AK1L 4OZFG 3HAEH 2AVGA 3LS5H 3A67L 3LIZH 3MXVH 4X6CB 3KLHC 5SWQB 4PLNC 1TZHA 4Y19D 1E4XL 3PL6B 2ATPA 4XZUA 1IFHH 2J4WL 4WI9A 5JHDB 1KLGA 3TN0B 4K7FB 5DK0A 3VDBA 4J3SA 4P99A 5C92A 4G43B 1G7PA 2ESVE 2XFXA 3B9VA 2VIRA 2FIKA 5EULV 3W9EB 1J10A 4XCFH 3HLAB 2ZPKH 1JHLL 4NM8H 3RUGB 4ELKA 3CIQA 5I6XC 2Z31C 3T09A 2AXHA 1JWMA 4WY7H 1FSKB 1P6AB 2JB5L 4X7EC 4X5WB 1C7SA 2I27N 4XP4L 1U3HB 4HKJA 3WKMH 5SX5K 1YYMH 4AEHL 1G0XA 3FB7B 1YEHL 4U1JA 2YPLB 3OJMB 2BZDA 4WUKH 43CAB 5ABDE 3HZKA 3I6GB 3RNKB 5ID1A 1IEHA 4U6YB 3Q6GH 2YPVL 4L8DB 1Y6NR 3KDMB 4RGOL 4A6YA 4BA8A 3B9KD 1J88A 2HTKC 1UM6L 3JWOH 5EORL 5GRYA 2YC1A 5CEYA 1N6QL 2PXYC 4K8RC 3VMOA 3PIQA 3KR3H 2R1WB 5GSRB 5DO2C 5DYOA 1OVZA 1SJEA 1FL3A 2ORBH 4ZO6A 4EUPB 3ARRA 4OTXH 2J8HA 4MJID 1VCAA 4LHUA 3IRPX 6FABL 2R8SH 5DRXB 2VZTA 1FFRA 3STBA 5HJ3A 5CGYC 1N0LA 1OAXL 4UTBH 2PTTA 4NUGH 3G5YB 5I9QB 4RWHA 3QCVH 1A4KA 1BQHB 3DXAB 1AO7A 1NAMA 1VEPA 4AQOA 1VKXA 1J0KA 4KKLD 4RMQA 1E28B 3MREB 4IMLB 2EKSB 4XAWL 3H42L 4L8SB 4QTIL 1LEGA 4BH8B 1EEZA 3I85A 2WZPD 3WUWG 1WCQA 1M05B 1V3MA 4LFHG 1L7TH 3BFOA 4XP6H 4ZO8A 2JIXB 3BIAX 4HUUB 4HFUL 1D6VH 2GW5A 4K7PX 3D39D 3OL2A 1BLNB 1HKLL 1B4JH 2HH0L 2VDRL 5CJ5A 2P48B 3BP4B 2D4FA 4P23D 2F53B 5D72H 4L9LB 4LVEA 5E8EB 4FXGB 4XBPA 5FHAH 1AGCB 1X5XA 4V1DD 3QA3B 4PLOB 3ULSA 1IT9H 4N8VB 4B0MM 1IEBB 1MJJB 3TPUE 2EDRA 3KLAB 5L2KE 4HLJA 3QUZB 4EQ3A 1VGEL 1OAYL 2F5AH 4NOBA 4NBZB 4KJWC 4JRXA 2ADFH 4R8WL 3ZKND 2AGJH 1FZKB 3UJTL 4QHKI 1T66D 2HT2C 1CL7H 5DFVC 1JZ8A 1ND0B 1HHIB 4ZFOB 4AMKL 4DKEH 1YY8A 4XPAH 4GMSL 4AIZB 4FMKA 3EHBD 3PP4L 1XIWD 4MQSB 1P4LB 4OV6F 3QDJA 2VAAA 1PSKH 4JM4H 1DL7L 4M00A 4HF5H 3RWEA 3MLVL 2YN3A 2VLKE 3OAYK 2YUWA 4WI2A 4DQOH 1INDH 4LCWE 1MJ7L 4OQ1A 4KPHH 3KXFD 3LMJL 4XWGL 1DUZA 3Q1SH 1QLFB 3EYFB 3P4OA 5ISZA 1GAFL 3RY6C 1R5IB 2VDKH 2QSVA 5T5FL 3HA0A 2QQLL 5CEXB 3RJQB 4NQCD 2Z0BA 4HUVB 2X5PA 5JDSB 3RPKA 4Y2DB 1IAIH 1ZXQA 1CS6A 5HGBB 1CI5A 3BZDA 1UXSA 4OLXH 4WWID 2OS7A 3DYMA 5T33L 2J7LA 1ZKAA 3CK0L 5IJKC 5KOVC 3BDXA 5IB3A 3DGGA 5I30H 1AC6A 7CGTA 1W8NA 4EI5D 1QRNE 3EYSL 3K8MA 5KSBA 3RI5F 2XICA 3X13A 3VD4A 5DMGD 4MAUH 1B9ZA 1CD1B 2BDNL 4PGJA 5C0RH 3SBWC 2X70B 3O3EA 5AEAA 2BSSB 1MH5A 3HAEG 5KSAA 1U8IA 3QQ4B 4KZEL 4YXLL 1WIPA 2GJ6D 4LGRB 3HI5H 4JKKA 1X5JA 5EOCH 4H5SB 1P84J 3KPPA 5HPOA 2C1PB 3V0WL 3MJ6A 2JKXA 2YRPA 3IJHB 3FT2A 1OD9A 3ULUH 1HHKA 3GM0A 1ZHNB 5EN2A 3QIBC 2OR9H 4YHML 4GAJH 4NN6C 2NY5L 5IR1B 4ZPVB 1OP3K 1DQQB 5LXGL 1U91A 1TCMA 4LAQL 1CE1H 1T89A 4C4KO 5ITFA 5D6DC 4LOUD 4NWUL 3WJJA 5GGRA 1A6PA 4Q6IC 1A7PL 4L29A 3K2UL 1MCSA 3GMOB 5TQ0L 2Z4QA 1SY6H 3IRZA 4PDCE 1LMKA 3N9GH 1NQBA 2XRAH 4BQ8A 1I1YA 3BGMA 3WXWL 3HPLA 4MWFA 5D8JH 1T4KA 3ZSTA 1AD0B 2NX5B 1U8HA 4U1HA 4Z0XB 3MBEC 4X6BA 3WIIH 3BPLC 4BJLA 4YUEL 3LDBC 1YECH 3P9LA 3U36B 3ARDC 1KB9K 4IRSA 1AHWA 3QUKA 2FHCA 4I3SL 1CLZL 1FLRL 2XZCH 4BYHA 1UCTA 5ETUA 3VWJC 1NCCH 4EDWH 4WTXA 2WWKO 5F3BA 1MCCA 1S5HB 5TE4H 1TJHH 1RJLB 3JWOC 4ONGL 3TJEH 3N0PB 3ZTNL 1AGEB 4POZC 1TJGH 4BQBA 3PWPE 3C08H 5J56B 3F7RA 4F9PA 2DQHH 4UU9A 4NGHH 3MLTB 2AQ3A 4UOW1 1UWEL 4JN1H 3T0ED 4OF3A 3S3JA 1DBBH 4MA7H 5JIPA 1RIVH 2A83A 2VDMH 2NLJB 4OIIH 3KPSB 3L3IB 2D7MA 2GUOB 1R3KA 3CLFL 3FQNB 4IHOB 5FKAB 5JUEH 5EU3A 1AR2A 1Y18A 5CMAB 2F74B 4H0HB 3O0RL 4ODSL 1ORSB 4XX1G 2X4TA 3H9SB 4YE4L 4CNIA 3TV3H 5I1IH 3N1GC 1K8DA 1XGTA 3X3GH 1E4XI 3R1GL 1FAIH 3V8OA 2IFGA 3O2VH 4YHZL 1QVOB 1U95A 2ENYA 5F96H 4PJ5E 1C5CL 5MENB 2DYPA 5ERWA 3HCVA 5KS9E 1P5UA 4JQVC 2EZ0D 4RFOH 1BD2E 4LMQE 3OJDB 5GS1C 3QWRA 3HZYA 1QOKA 1XF4B 4FFZL 3LEXA 4FMFA 3MV8D 5EUOB 5FOJA 3VXRD 4XTRC 3MLSL 4M7LL 1OSPL 1JRHI 3MBXL 3QIWD 1X5AA 1FCGA 4PJFE 5I66A 4WFHD 4MGXA 5IFHL 1IC4H 4XPFL 4NT6A 1S7TB 3U4BL 5CHNA 3G6JA 1HHGA 2DM7A 3KJ6L 1JGDB 3GB7A 4KQ4H 1JJUA 4MJ2A 3QUXC 2OZ4H 4TUKL 3OHXA 4O00A 4O2CA 4XBEL 5J6HB 1WEJL 4V3DB 3O6FA 1JV5B 3L3KB 1X5IA 4PJCB 1RFDL 1AI1H 3DPBA 1LILA 3SJVE 4ZUVA 3RWIB 15C8H 1WBZB 2J8UA 4ZUWB 5IJVB 5DA0B 3SCMB 3G9VA 5C6PB 4HK3N 4ZOCA 1YEKL 4NQVA 3PHQB 3MFGB 3O3DB 5DR5L 4KI5E 1U3YA 1CCZA 3DTXA 3HE6D 4M1GL 2A73A 4OQTH 2VAJA 3E2HB 4A6YL 5EO9A 1VFOA 4I5BB 1YNKH 1NKOA 5MHSE 1G7QA 1X4XA 4XMLH 3TJHD 3PWVA 4JFDA 1F11A 3TO2B 3F7YB 4OGXH 5E6ZA 5FYKD 3TH2T 1A6VL 4NNXA 2OMBA 2HMID 2MSPA 4PJ9A 2FEEL 2MWCA 3DETD 1CICC 3TA3D 2H2SD 4PJBA 3SKOB 3RWGB 2XACC 4DVRL 1CQYA 5F7FA 4UIMB 2FD6L 3PGFH 3UP1A 2ADJB 4IEFB 4X7DC 2DIBA 5IHZA 2HKFL 3F62A 1QFOA 2R4SL 5J9PA 3ARSA 3LQAC 2OR7A 2W92A 2X2YA 1NAML 2Y1VA 1N4XL 5E6IC 2FECL 1S8DB 1JVKA 4QRQA 4QRPB 4OAWB 5I8CB 3T4AB 5ANMB 1FDLH 3WXVL 3IFNL 5CD5D 3V6FA 3S34L 1EZVX 1OAUL 3LD8C 1BOGA 5F70A 4MD4A 5DQ9B 1GHFH 3CFJA 5DA4A 3O6LH 4XP1L 1JPTL 1INEH 2PW2A 4BSVB 2CDEA 2FX9L 2DRUA 3VRJB 3VFNB 1S9YB 5IP4A 1KYOK 1AQKH 3AXLB 3ABZA 3MV9E 4KXZH 4Y16A 4R3SA 3ULUC 4LLDA 4P4KC 2ZNWA 4FQCL 4WCYH 4ZXBA 2DQEL 3IKKA 1BZ7A 3KYKH 5F6HI 5LKNA 3LKOB 2XPGA 1GRWA 3FTGB 5KJRL 5ECJE 3CZFB 1HSBA 3OKMB 4MQXC 1FG2A 1VFAA 1CF8H 3WNKA 3KYOA 1DBKH 1DBJL 4ZO9A 4PJ8A 3WNOA 2OTUB 4KVCH 4L4VA 3MNWA 4L8BA 4DCQB 2O61B 5DJCB 3CC5B 5DRWA 5SWZA 4ONFH 2CGRH 3GMLA 3DX7A 3MRDB 3U6RB 3MJ9H 5C2BH 3TT3H 3FQXA 4PRPD 1VA9A 3GIZL 4W6YB 1OCWL 2A77L 4HUNB 5EUKB 5C07D 1KN4L 1V7NL 2DTML 3QISA 4Z7UE 4APQD 3MA7A 3WHE1 3BW9A 4NOFA 2XZQL 1ZGLP 1BZ9A 4IIQC 4ELMA 5IHUH 5CCKH 4PJGE 4HS8L 1VFUA 3D69B 1L7IL 3NAAH 5D5MF 1Z5LB 3RA7L 2H3NB 4NM4L 5A16B 1P4BL 5TDPA 3Q5TA 5F7UA 5CZXD 3T0WA 1P2CA 1TVHA 4S1QL 2NPLX 1RK1B 1A9BA 2BY0A 4DN4H 5FYJL 1A2YA 5EU4A 3TZVB 3F5WB 4UTAH 4N9GA 5JORB 1XR8B 2W9LA 4U1LB 1I9JL 3EUUA 3T0VA 4LSRL 1WZKA 3W0WD 2HJLB 1YEEH 3KPNB 3QXAB 1F4YL 1SHMA 1HH6B 4AEFA 3OR6A 1PQZB 2F8VA 1UQSB 2GK2A 5DS8A 1NDGB 4I9WE 5C0IA 4D3CH 3GJFB 4Y5XC 4F7MB 1W0VA 3TBTA 4ODUB 2EDWA 5EBMA 1CGXA 2CDGB 3WLBB 2Q7YB 3QNXB 1FORL 4O2FB 3X14A 4HUWA 4MNQB 5MEQB 3IDUA 4GLRI 4GS7B 4O5LH 1I3RA 3BD4A 2NXZC 2W91A 4MMZC 4P5TC 1DN0B 1J0IA 3WO4C 5GRWA 1D6EA 1E6OL 5MEPA 5D4QA 2BMKB 3WS3B 5D1ZA 4M6MH 1AXIB 5ALCL 4TSAH 3UTTE 2K3TA 4ERSL 4NKOB 1ZHLB 3O3AB 3O8XA 3S96A 1S7WA 4MQ7A 1RIUH 4QEGA 4U4BA 3VXMB 3UZEA 4OLZL 4X80H 5F88A 2DLTA 3EO9H 4ONHB 4WEBL 4QYOB 4Q9QL 3DV4B 3GSOB 4HKXA 5SV3A 2P42B 2OJZL 2JB6B 1FFPA 3GFUA 1CT8B 3VFWA 4K07A 4RAUB 4XVSH 3JTCA 3CFEA 5K59F 3FFCE 3NZ8B 4OSUH 3SGKC 3DSNA 3GIVA 1KELH 4GRMA 4EN3B 2D7OA 4OT1L 4OCYL 4HXBH 3L7EA 4UOW0 5A2LH 5HVWA 1Q0XL 2IALB 4GRWB 5EO1A 4ZS6C 5IG7A 4WJ5A 5LGHH 5E2TL 4BZ2L 1EFXD 1A0QH 3P4NB 4ZAKA 1E4KC 4JG0H 4P2RB 2XG5A 1FNFA 3H2WA 3CXHJ 1P4IL 2F8OA 4JCLA 4LBEB 4ZQKA 5EU6A 3RVVC 5C7XL 4P4RB 4LVNB 3BQUB 5CGTA 5KANI 4IOSD 3IF1A 3QDHA 2F15A 3P0GB 3RWFB 4M5YL 5B38B 3PDOB 3SDAD 1HOCB 3AM8A 4PJAE 5IB2B 5I15H 2WWMD 5HHOA 5BZWA 1S7XA 3LPWA 5L88L 3EOBB 4Z6AT 1R5WB 3K8KA 4I0PB 1EJOH 4JQXA 3HC4H 2BNRB 5HGGS 3C9NA 4RNRB 4JZJA 1M7IB 1F3DJ 1YNLH 5B8CB 1E27B 3R0MA 1GCFA 3RVWC 3GJEB 4X6CA 5EG6C 3CLEL 2VB5A 3PL6A 3DX9B 1OW0C 2ICCA 5DJ2B 2ZKHL 4RMUA 2HFFB 5JR1H 4YDJB 1G0DA 1ZA3B 3TN0A 4K7FA 5KN5B 2HA1A 2NY6D 4G43A 4K3EH 4TPRH 3W9EA 1CXHA 4L4TB 3HLAA 4L3CB 4LRIA 1GPOH 2IQ9H 3WFDL 1RZ7L 1ACYH 4DZ8B 3VGAC 1CGSL 2VDOH 1MFEL 2GJZB 3NPZB 1NBVH 3RU8L 1ZT7B 3RP1A 2ZOKB 3CSGA 4M43H 2YPLA 5F1KC 1G0YR 5D7JD 43CAA 1NEZB 3RNKA 5GSVB 2I9TB 4NN7C 4OGYL 3KDMA 1NFDF 3OKLA 4NNPL 1A6WL 4K2UH 3QYCA 1U0QA 3DUUB 1W8OA 2DM4A 2R9HC 3IU3B 2Z92A 4OFDA 4FFEX 4MNHB 2LU7A 1G9NH 3U7WH 3VXQB 4U1KA 5GSRA 1I75A 1EBPA 4QHNA 1JYVA 5A3ID 2PYEB 3IDNB 4BSWB 4ENED 4QO1A 4EUPA 2R1YA 3UBXG 2E6PA 2V9QA 1M6OA 2RCSL 3WD5L 1KUMA 3Q48A 1F58H 1EVTC 1F8TH 1EO7A 3P77B 4MAYB 3U9PL 5D2LB 1N2RB 1RZJL 2DI9A 1KULA 5AG8A 1WTLA 1AY1H 1A1OA 4HKZA 3KLHD 1GZQA 4LPTA 4AH2B 1U8JB 3WUZA 1D3CA 5TF1L 4XHJC 1DTUA 1S7VB 1BQHA 4ZG1A 3DXAA 2XQBH 1A5FL 3QDGE 3LN5B 5CP3A 1ZSDA 3BPCA 4U0RB 1E28A 3S35H 4IMLA 4X9HA 1T1ZB 5TPWH 2EKSA 3HNSL 3LKSB 3BD3A 4DEPB 3O4LE 2V7HA 3BUYB 1JGLH 3MYZA 5SWSE 2Q8BL 2VXUL 5CWSB 4BH8A 2AS5M 4DJMA 4LEOB 3I2CL 5GZNC 3LRSB 2AEQH 3QDMD 3HN3A 4RA0C 3BKCL 1BBDL 4K9EL 3M1BA 1X5YA 5DJYB 5KOMC 2JIXA 4HUUA 1X5ZA 5DD5L 3MRHB 4NZJA 1EX0A 4TTDC 1Z3GL 3BIBX 4MSWA 1BLNA 4M03A 1MAML 4JN2B 4LSQL 4Y19B 3EFDH 1RJCA 3EOTL 3ZYIA 4GXUM 3BP4A 4L9LA 3N1PC 4QHMB 5M95B 5E8EA 1WAAA 4FXGA 5GS2H 5BW7C 4I3GA 2LV4A 3QA3A 4N8VA 3TO4C 5HPMB 3UO1L 1IEBA 4Y5YC 4MCZB 3LV3A 3QUZA 1S9WB 1T5XB 2YPKB 1PGRB 2GT9A 1OT1A 4NRZB 1FZKA 2VH5L 3NOIA 2FATL 5E95B 4FQXC 1ND0A 4K94L 1HHIA 1X5LA 3WHE0 4ZFOA 1J0ZA 3IFLH 3NA4A 3OWEA 2DICA 2NTFB 2VDLH 3B9KB 1RZIA 2AKRB 4PP1C 2JCCF 4D9QD 2KZ1B 5GIRB 2V2XB 4E0RB 4NFDA 3EYFA 5DJZB 2BVPB 1ETZB 1HNGA 2E9JA 3A67H 1AGFB 2FL5B 5CEXA 4MJIB 2WP3O 5DHVH 1TPXC 4BQCA 4NSKB 2AJSL 4KK9C 4Y2DA 5HGBA 3LKNB 4JFPB 3ULUF 1AO7E 2J4WH 2BP3A 2Q76B 4FZ8L 4XGZB 5HHXL 3U30C 1QLRB 3I3EA 4N0CC 3IDIA 1I8LC 5FGBC 2B5IB 1S7RB 3OKNB 2X70A 2AQ2A 2BSSA 4J3OC 4OIAA 1OGTA 1W2KT 3BMVA 4P49A 2CLRA 2R29L 1WFOA 2JB5H 1KCKA 4KJWD 4XP4H 5A1AA 4H5SA 4KKBC 2X44D 2LU4A 2E8YA 3NABL 4KTYA 2HT2D 4AEHH 2DL9A 2W9EL 1YEHH 5DFVD 4AT6A 2XN9D 4JVPA 4OCNC 1X44A 5E24E 2EH8L 3D39B 2CKNA 5C09D 1KJ3L 4KUZL 1UM6H 5CKGA 1ZHNA 3HNTL 1Q9KB 4P23B 4OCSL 1N6QH 2FEDC 3GMQB 1T83A 5CZVL 3O6KL 5EU7E 1HYRC 5IR1A 4ZPVA 1DQQA 4Y4KD 4V1DB 4F7PB 2AJXL 3RDTC 4JRXE 5DJDA 2XWJB 4YHNB 4FQQB 3J7HA 1B88A 1JK8B 4G6JL 4ISVB 4OKDA 3GMOA 5IIEB 4G59A 4HWBA 6FABH 1I1FB 1FFOB 1EUTA 1YPZF 3B9EA 1U8KB 2H2PD 3QDJE 1MCBA 3VXPB 35C8H 4MNGB 2BVOB 1C12A 1YMMD 2E6QA 3U36A 2F54D 3FONA 4Q74A 4DKDC 1XIWB 4I18C 3UTSD 3LN4B 4XVTL 4HIHB 5K33A 3T4YB 4JJHA 43C9B 5LG1A 2OCFD 4KXZI 3WS6C 3PWUB 4M93C 2OJEB 3I6KB 5EOCJ 5I19L 1ITCA 4XAWH 5EC2B 5ISZE 4G9FD 2N7BA 5L0QC 3KXFB 3Q5OA 1KPVB 3MRCB 1RJLA 2V5TA 5HHMD 1G9NC 3BPOB 1UB5B 4Y4FD 5H35B 4HFUH 1LVEA 2IMNA 4NQCB 3GUTB 3AU1B 3MLTA 1HKLH 2HH0H 2VDRH 2WAHA 4ETQB 3TESA 1RUPH 2RBLA 1IC1A 5FYJE 2C4XA 2ZWLT 2C9AA 5KSBE 2NLJA 2IEPA 3KPSA 4LVOB 3L3IA 5ESVB 1W72B 3FQNA 4IHOA 3QIBD 2G75A 5FKAA 1NMCC 4EI5B 4NQXA 5CMAA 3L1OL 5DK2B 4D0BB 3O9WD 1ORSA 1LE5B 2ILLA 3PXHA 4OZIA 3NIDF 1VGEH 2XQYG 3QUMB 3MV01 2DLGA 1Z9OA 3V79C 2GJ6B 5EZJB 1QVOA 4HKBA 1ZLUH 2ZSVA 4HT1L 5FEBA 4PREB 2B0SL 3CH1B 5JW4M 3SDXF 1A7RL 4HXAL 1EH9A 3MCLL 3DYPA 2ZUQB 3RHWF 3W2DL 1R5VA 4QT5B 5C70A 1BFOA 3PP4H 1XF4A 4YBHA 3CDGB 4HCRA 1DL7H 3MLVH 3HRZB 4D8PB 3CH8A 2IH3B 4I3RL 3GK8L 1SMAA 4PGBB 2HT4C 3I3BA 2ZUWA 4KI5C 5ITBL 3LMJH 4XWGH 4OGAD 3VWJD 3QPXL 1JGDA 1RUAL 5J11B 5ESQA 2X1WL 2YD4A 2QQLH 1JV5A 3L3KA 3NGBB 1KLUB 2VSCA 5HXMA 1NMAL 3MYJB 4FOMA 1JE6A 1ZMYA 1XT5A 2AJZB 3ZSSA 1WBZA 4ZUWA 5T33H 5IJVA 2KZWA 1YUHB 2MOVA 1B0WA 4CVZB 1CWVA 4YLQT 3PHQA 4QNPE 3O3DA 3FQRB 3QG7L 1D7FA 3EYSH 3Q3GA 3RNQA 3SDCA 4ALAL 2P8PB 3TBVB 2BDNH 4YPGB 3ES6B 5IBLD 3E2HA 5A40E 4I5BA 2FB4L 1NEUA 3EYQC 4KZEH 4M3KB 1AR1C 5D9SB 4YXLH 5H94A 3AY4A 2NYYC 4H88L 4E42B 3MV7D 4JJ5B 2DM3A 2F58L 1YN6A 3F7YA 2GFBB 5CLTA 1ZLVH 3TO2A 1E4WL 4ZUTB 3UCRA 3JUYA 3V0WH 5IMOB 5HY9B 3L3JA 3PHOB 4HJGA 4ZYKA 3SKOA 3RWGA 1UJ3C 3QG6B 3BE1L 3T0EB 4FZEL 1GC1C 4UIMA 1RULL 5EWIH 4F37K 4YHMH 5JPMA 3B43A 3GSXA 4RMWA 4N1CA 4NN5C 1DEEA 1KCSH 2O93L 2CIIB 3D87B 4X7TB 1NCBL 1P9MC 5LXGH 4LAQH 2AJYL 2W0PA 1XGQA 3GRWL 4NWUH 1JPFA 1J0HA 4HPOL 1A7PH 3L3HB 2NW3B 3K2UH 3OB0K 3VXUA 4QRPA 4OAWA 2APBA 3K4AA 1IKNA 2PYFB 5I8CA 3T4AA 1ZHKB 3WXWH 1NGQL 4YWGL 3WBDA 3BESR 2EDLA 1CLYL 5I73C 2JK5A 1JI2A 1KJVB 1UACL 1EPFA 1QFUL 5DQ9A 3MLWL 1S3KL 4KJPC 2BOBA 2EDKA 2FJGB 4YUEH 3RL2A 5A2FA 2JJWA 4X6FB 4I3SH 1CLZH 3MV8B 3VXRB 1FLRH 5FDWB 4BSVA 1WFNA 2QSQA 3VRJA 3G6JE 3QIWB 5D7IB 4LLMA 3BZFB 4OCRL 3VFNA 1SYSB 5DT1L 2WMPA 2ICEB 3DIFA 5JXEC 3ZTNH 1HK6A 2DJUA 2HRLA 3HR6A 2BVUA 1R24B 5AUMA 2J8UE 4YDIH 5ALBL 5CEZL 3CZFA 1XGYL 3OKMA 2C1OB 4R2GC 5D1QD 1N5YL 1FC2D 1O5DT 4Y5VB 2VZOA 4U6VL 4XH2B 1OPGL 1KIUA 4ZFOL 2OTUA 2CKBB 3CFBB 4QWWD 4LSUL 4DCQA 1WBXA 3HE6B 2O61A 4LPCA 1CU4L 5DJCA 3O0RH 4ODSH 3WHXB 2V17L 4YE4H 4JFDE 1IZKA 4YO0B 4BFEA 3R1GH 4RFNC 3P73B 3SEPA 3MJGX 5EUKA 1C5CH 1JNNL 1U8OB 4UBDC 5JXAH 4PJBE 4PJEB 4XC1L 3SN6N 2NY2D 1UG9A 4H26A 3D69A 4JPVL 3MLSH 4M7LH 1EO8L 3TA3B 1OSPH 5GGQH 3MBXH 1Z5LA 2H3NA 4HG4J 5E4IA 5AZEH 1U8NA 3N06B 5IFHH 2Q3AA 4XPFH 4WWKC 2NW2B 3U4BH 4FRWA 4Z7VB 5I1EL 1RK1A 5DEGB 5J6GB 4N5EA 4TUKH 4JY4B 1WEJH 2AXJA 5J12B 4KVNL 3W11C 1RFDH 2HJLA 3G08A 3QXAA 4YFDB 3FQUB 3C5ZC 4PLJC 2JJSC 1PG7X 1UQSA 5FGSA 4C57C 1QHPA 4MQXD 1NDGA 1YEKH 4JZNB 5F9JA 5DR5H 3PV7A 3GJFA 4X4MA 2AJ3B 4Z77B 4ODUA 1JHKL 4JDTL 3WLBA 3CPLB 2Q7YA 4NPYB 3QNXA 4OUUB 3ZKXB 4M1GH 3WFBL 4X9GA 4A6YH 4O4YL 4EJ1C 3F6LA 1DN0A 2P8MB 3F8UB 4OM0L 2VLMD 1NL0L 1UZ6E 2BMKA 1LP9B 2IPKA 3M07A 5J8OA 4LPWA 1A6VH 4LU5L 4NKOA 1ZHLA 3S5LB 3O3AA 4LPUA 5ACZB 5TQ2L 4DUXA 3VXMA 2OK0L 3L5IA 3S37X 3GI8L 4YXHL 4HWBL 1AC0A 3J8F7 1RZFL 1VACB 4WV1C 4NHCL 4DVRH 4L4VE 4DKFL 4ONHA 3SO3B 5BJTB 4QYOA 1MEXL 2CQVA 2A6IB 3H3KA 2HKFH 3WN5B 2AXGA 5SWZE 2R4SH 2FRGP 1MCWM 3DSFL 4MS8C 4RAUA 4IRJD 1U58A 1NAMH 3V0VB 1N4XH 3ARZA 3VD3A 2NMSA 2X40A 2NY0C 4LDOB 4PRPB 4KI1A 3OKOB 3CSBA 3PJSB 3VFMA 1IZJA 3WXVH 4EEEA 5C07B 4QRTB 1OAUH 2IGFH 4APQB 4ELME 3TIDB 3QEUB 1F3RB 2L0DA 4P2RA 1HI6B 3MRFB 1JPTH 4XP1H 4MYWB 2MHAB 4TVPD 2AJVL 2FX9H 3OZ9L 3INUL 5FO7B 1EFQA 4UIKL 3FQTA 4P4RA 2Y36H 5IWLC 3BQUA 4KU1A 5C0AD 3RWFA 2X9YA 2NXZD 4U1IA 4RGMC 1A6AA 4P5TD 4U1GB 3U79A 4FQCH 4ORZC 1NUFA 4P2QD 5ADOL 5B39B 2NY5C 3LKQA 4JY5L 4HWZA 4NO3A 1CE6A 2FBJH 3EOBA 5KJRH 4MDJB 2VZUA 1ZGLB 1DZBA 4I0PA 3UJIL 2O5ZH 1TTUA 3W0WB 3BIKA 2WWKT 5DEFB 4JFXB 4OUOA 1DUYB 1DBJH 1A1MB 4G8EB 5B8CA 1E27A 1QR4A 2WUBL 4TUOB 4FQJH 5BXFA 3C2SA 4PRHA 4OJFL 3LB6D 3GJEA 1UWGL 1Q8MA 1FVDA 3SE8L 1XGRB 4H20L 3V52L 4XAKE 5BVPL 3GIZH 5HYJA 1MVFA 1OCWH 2A77H 1EBAA 4MD0B 2W0FA 4YDJA 1KN4H 1V7NH 2DTMH 1KB5B 3ARBA 4XCYB 1ZA3A 5KN5A 3DUSA 2XZQH 5DJAB 3QIUD 2WSKA 3K46A 2XIDA 1FNSL 3M17B 2VUOA 1I9EA 5F1IB 4PRNB 1BEYL 5EBWA 4ZTOL 4LSTL 3MMEB 1V3KA 4HS8H 3O45B 2DMCA 1KENL 4L3CA 3MUJA 3RWJB 4BM7A 4KGJA 4O51B 3RA7H 3O81A 3WFEH 5KS9F 3Q0HA 4NM4H 4DZ8A 5DURD 1MSPA 3QFJD 1H3UA 1P4BH 1J87A 1LO0L 4QXGL 2G2RB 5DEZA 5CP7B 2GJZA 1XCTB 1ZT7A 2ZOKA 5J3HD 4S1QH 1FNEB 1CDCA 2HVJB 5JNYB 4M6NL 3HS0B 3DRQA 5FYJH 1QNZL 4PJFF 1NEZA 2I9TA 1FH5L 1I9JH 2ZP0T 1DQDL 2A6JA 3DUUA 1F4YH 3IU3A 4MNHA 2B7DT 3U48A 4LPXA 3VXQA 4KUCD 3PF2A 4WFGD 4PG9A 4WU5B 2R0LL 1DQTA 1EFXB 5M94B 4HW6A 1C8PA 5EU6E 4S0UC 1X7QB 5CAYB 4BSWA 5CBAB 1H15B 4NQUA 3EOAA 5I75B 2VZ1A 4OFYA 1FORH 4LKCB 2APFA 1AH1A 1ZE3C 5DD6B 3RVWD 3P77A 4MAYA 4EDXB 3BVNB 1N2RA 3JVGA 4HIJB 5DJ6B 2PTUA 4KI5F 1MFAH 1E6OH 4AH2A 1J11A 5HHOE 5JIHA 3MRBB 4PLKD 3SDAB 5ALCH 1H8OA 1IARB 1S7VA 5L2JA 2QHRL 2Q8AL 3LN5A 2VXTL 4JHZA 4ERSH 2D2OA 1JGVL 1T6VN 2X4SB 3QB7C 1ZEAL 1EV2E 3IDYB 1CGTA 1T1ZA 1XCQB 3LKSA 1SEQL 3S4SB 4R4FL 4X9IA 3BUYA 2UV3A 2PO6A 4FQPA 4IMKA 1DBML 3VD9A 4LEOA 4GAGL 2JE8A 3AAZA 3LRSA 4X6CE 2OJZH 2VN4A 3H9YA 3LKRA 3BZ4B 4NDMB 4XNUL 2E7CA 5DJYA 2L7JA 4QXTA 1VHPA 4MMXC 5F7HA 3MRHA 3KPTA 5GJTL 1PX3A 4Y19A 4OT1H 3MRRA 4OCYH 3MRKB 1ORQB 1Q0XH 4KWUA 4NZRL 4F7TA 4WFED 4QHMA 1YEIL 4BZ2H 4LHUG 5IQ7L 1QEWB 5F72S 2NY6B 2Y4SA 3BWUC 1G9ML 4KKAC 2X42A 2ZCLL 3MOAL 1OB1B 4MXQD 1P4IH 3U83A 3THML 3PXJA 4MCZA 2OR8A 3ARFD 2YPKA 2YR3A 3TYGH 5C7XH 2J88L 1DANT 4QY8B 4QCIA 2Z8VC 2YPLE 3HRPA 4YR6A 1NCWL 3QAZC 4W68A 1U2CA 4M5YH 5DHXB 5DK3A 1MCWW 3P0YL 1CD0A 3ECBB 1OTSD 4Q7DA 3T2PA 3OGCB 1BREA 5D7JB 1VPOL 1FZMB 3B2UD 4NO5A 3HB3D 3HE7A 2X4QB 4Q2ZB 2AKRA 5CJOL 1UA6L 4G5ZL 5EU5B 4GRLA 2VISA 1NCUA 2OI9B 5GIRA 3NFNB 3WFHB 1LD9B 4DK6A 5DJZA 1EGJA 5GZND 2BVPA 1AGFA 2FL5A 3TBSB 3DMMD 5LCVL 5L2KD 2B8OT 4PYHA 2VLLB 3CLEH 3IDJA 3PWNA 1CFNB 2HFGH 1IM3B 3RTQD 3LKNA 4HFWB 3DXAE 2ZKHH 5IEKB 1BIIB 4WI3A 5ILTL 4GO6B 3VXOB 1LQSR 1T5WB 3QRGL 3DVGB 2VN7A 1AIFB 4XGZA 4Z78A 1DEDA 3HC0B 1QLRA 4OZFB 3RL1B 3L7FB 3LPGA 4KK8C 1S9VB 2EH7L 3OKNA 2GCYB 4Z7UF 2WINB 3WFDH 1RZ7H 2B1AL 2QSCL 5EU7C 4ODXB 2HWZL 2VLKD 5AYUL 2NNAB 4LCWD 3H9ZA 3QDMB 1V7ML 4PJGF 3RU8H 3VI4E 1E6JL 1T2JA 5HVHB 2EEAA 1IAMA 4EQ2A 3MRQA 3UTOA 3WE6A 2H9GB 1KCRL 4PJXB 3IDMB 5E5MB 3UEZA 4B5EA 4OGYH 4UILL 5DJ8B 1WAAE 1A6WH 1DQLL 3CX2A 1CDUA 1Q9KA 1RZGA 3QCTL 4P23A 5CLWA 1L6ZA 3A0OA 1N8ZB 3CFDB 4PP1D 4LAJH 1T1XB 5MERA 3PG2A 5CEZE 4V1DA 5GRVK 1QRND 2XWJA 4J3UA 2AERT 4H1LA 2UVFA 3IXTB 1JK8A 2RCSH 3WD5H 4FFYH 1HYSC 4X0KA 3U9PH 3BX7C 1RZJH 5F7NC 2QADC 3BEVB 1KCLA 4U6HB 4PBVC 1FFOA 5IW1B 5I0DA 3U4EB 4XPGL 1U8KA 4KK9D 5TF1H 3VXPA 1MCOH 2BVOA 3V4PH 4UT7L 5E8OB 5TE6L 1A5FH 1K9TA 1XIWA 1QG3A 3LN4A 4CN1A 43C9A 4L3ED 3HNSH 2IPTL 3PWUA 1FGVL 2OJEA 3I6KA 3TC9A 2NR6D 4N0CD 1CTOA 4NZUL 2VXUH 2Q8BH 3T2OA 4CW1A 1F97A 1YZZA 1M7DB 5IHBA 1ZV5A 5KSAC 3MRCA 4ZUUA 4AIXA 3BKCH 1BBDH 4K9EH 1D5BB 3ULVF 1UB5A 5DD5H 4XNYL 4KKBD 3SKJL 3T0AA 4NQCA 2ITCA 1Z3GH 3GUTA 1H5BB 3MR9B 3AU1A 4Q9RL 4LSQH 3CX5K 3NZHL 3EOTH 5TDNB 4JPIA 4ETQA 2C3HA 1H0DB 4PV8B 4U1NB 1IGJB 3NMEA 5ESVA 1KEML 2XY1A 3C60A 1W72A 3WUWB 2FEDD 5C0GA 2ZUVA 2Q86B 4U6TA 4EI5A 3T8XA 5DK2A 1UEYA 5EIQA 4D0BA 4ZPTB 3WYRA 3TVMD 1LE5A 3RDTD 3ESVF 1KNOA 1NJ9B 1T89C 1GGCL 2X09A 3QUMA 3WJJC 4Y1AA 3B6SB 1GVIA 1QSED 2GJ6A 2VH5H 5EZJA 2LABA 5LBSL 1CR9L 4PREA 3CH1A 1NAKL 3MROA 3N85L 4BKLA 4KHXH 1U3JA 4K94H 3K81A 4KHTL 4RMTA 3ROOB 4QT5A 1KFAL 3MRGB 2XN9B 3PWPD 3VCLB 3QDAA 5IV2B 3CFIC 1QFWL 3CDGA 2ITDB 5CZKA 4TUJB 1MWAA 4IRSC 4FN0A 3HRZA 4D8PA 1AHWC 2IH3A 1BM3L 5C09B 5TJWK 4PGBA 3UAJD 3SKNB 4PJAF 5FCUL 3RGVD 1RU9L 4HMCA 5JOFB 3NACL 1NGZB 1LNUB 4HULB 4Y4KB 4JM2D 4JAMA 3MGOB 1C5BL 3ZE1E 3WJLA 2XTJD 5FO8B 4LLUB 1G7IB 2CK0L 4DAGH 5IMMB 1LO3L 1KLUA 2D0GA 2D0HA 4UDUB 1R3IL 2AJZA 4F9PC 4PY8I 1YUHA 4ZTPH 1IGFL 2D0FA 4PJ5D 1KG0A 1B6UA 1YMMB 1EAPA 5C8JA 5HHXH 1S78C 3MCKB 5IFJA 1BD2D 1MRFH 2F54B 1IQWL 1T0NB 4S2SB 3UTSB 3H9HB 4AJ0A 3TBVA 3KYNB 4S1DC 5EZLB 3G04B 4YPGA 3ES6A 3R8BB 2BHYA 3AS0A 5E0QA 2FH8A 1JGEB 3QZWG 4W6WB 4G9FB 5D9SA 4NO2B 2R29H 2CXKA 4E42A 1C08A 4JJ5A 2GFBA 5HHMB 4QGTA 5F6IB 2ERJC 4ZUTA 2W9EH 4Y4FB 4I2XB 4RA3A 4AQ1B 2DLFL 5IMOA 1ZLWK 3EDJA 5HY9A 3O41A 2EXYC 3A6OA 5DQDL 3V2AR 2EH8H 1WITA 1EA9C 3KPSE 4JDVB 3GKWL 1KJ3H 4KUZH 2WBWB 3HNTH 3SJVD 1OARL 2XV6B 2A0LD 4OCSH 4GG8B 1IAIM 4M4PA 4MA1B 3DURB 5D93C 4BFIB 3O6KH 4OZIE 2R39A 1IAOB 3QIBB 3G5XB 5HHNB 4X7TA 5D7SH 4CVXA 2AJXH 2R0ZL 3O9WB 4YEFA 1I8MB 5E99H 4G6JH 1FNAA 3L3HA 2NW3A 2X9XA 2B2XL 1NFIA 1NC4D 2PYFA 3H7BB 1ZHKA 3O6FC 1AGDA 2MFNA 5MHSD 3U7YL 3ZDYE 3BN9D 1AE6L 3QHZH 2HJKB 3D48R 2Q87A 2FJGA 1X6NA 4X9BA 4Y4HD 2FNBA 2YS4A 5FDYA 4C83B 4X6FA 4R26L 3BPLB 3MV8A 3VXRA 3LDBB 5FDWA 4OLUH 1T1YA 5IOPA 4P3CL 3QIWA 5D7IA 4UT6L 5I19H 5IW6B 5GS0H 2R1XB 1PG7L 3EIFA 2IQAB 4FS0A 4PGCB 1TQCC 1AR1D 3VWJB 1WWAX 5IVNA 5DUMH 2NYYD 1N64L 1R24A 1FO0B 1YEDB 4BSJA 5FCSH 4XPHL 2DQJL 4EVNB 2DMKA 4CL7A 2YEZB 3T2QA 4JDZB 3GO1L 1UWXH 4PJ9C 3VG0L 2C1OA 2K7QA 3DWTA 1NBYB 3FRPA 3QPQC 1MRDL 3QO0B 4QOKA 4JO4L 4XH2A 2MQ0A 1FGNL 3HG1D 1QP1A 4I48B 3L1OH 4DK3A 3HE6A 3S37L 5GGUA 5T3ZE 4LLWA 3WHXA 1VEOA 5D6CB 3IAPA 1EIBA 4PRID 1DP0A 3BP5B 2VXQL 5HVGB 4HT1H 4MCYB 3TJHA 3KPRD 4G80A 1B90A 2B0SH 1U41A 1U8OA 1NFDB 2OTPA 2R56L 3MV7B 1DBAL 4UT9L 1A7RH 4PJEA 5L9DH 1EGJL 3MCLH 3W2DH 5MP6L 2YN5A 1OY3B 4HWEL 4WHDA 3TA3A 2YOCA 4I3RH 2D7QA 3GK8H 1RY7B 4LEXL 3MLZL 4P5MA 5CJQL 2NW2A 3RIFK 5ITBH 5C3LD 2N56A 3ZKMC 4I0KA 4Z7VA 3VXUE 4QRPE 3QPXH 4BUHA 3VFOB 2FHFA 1RUAH 3MNZB 5J6GA 4Y16C 1AKJD 3IJSA 5HSFA 5D7LA 4ZXBC 3MLPA 4BUGA 1CDIA 2EKJA 4PJHB 1NMAH 3PGDB 4WW1A 3NIGE 1BQLL 5JHLL 1FL5B 2WBJD 2GJJA 3IFPB 1QSFA 1U6AL 4JZNA 3UTPE 4RWYL 2UY7A 2BK8A 3QG7H 1BBJB 4L9DA 3FOLA 4HUMB 1YJDL 1ZT1B 3CPLA 4NPYA 4K94C 4OUUA 4ALAH 4PJ8C 5EA0H 3HI6H 1BOYA 3VH8G 1TNNA 2FB4H 1WUNT 4LCIL 2P8MA 3F65A 3L3GB 4FP8L 3F12B 4MJ6B 1LP9A 3OX8B 4H88H 2I9LA 3MZGB 3QCUL 2F58H 1RSFA 1E4WH 1JMZA 4HS3B 4NKDB 2Q6WA 1A7NL 3T77A 2E7LA 1ZVHA 2KDGA 1RHFA 2CRIA 4WIQA 1VACA 4FZEH 3V4VL 1F00I 4YHYC 1F6LL 5D1QB 1RULH 3LQAL 4PRDB 5BJTA 3TWCL 3P30H 3G5VB 1JZ5A 1N7MH 3WN5A 3ZE2E 4QLRA 4UAOB 1NCBH 5I1DB 4NC1E 2AJYH 3M8OH 3GRWH 5CP3H 4IJ3B 4OCMC 3V0VA 4HPOH 2IADA 4H8WL 5JMRA 1GOFA 2CLZB 3OKOA 4U0QB 3PJSA 1NGQH 4YWGH 3WLWC 1MHHB 3I9GL 4PTUB 4QRTA 5B21A 2XKSA 4APQA 5HYQA 1BFVL 1UACH 2P8LA 3QEUA 5BVJB 1S3KH 4PLJD 2HLFC 1A22B 1HI6A 3MRFA 3P2TA 3L5XL 4WTZA 2NY2B 3UTTD 3RVTC 5HI5D 4HIXH 4KDVA 2ADGB 4UQ3B 1QSZA 2Y5EA 5FO7A 1I7TA 4R0LB 1H8SA 4OCRH 3DVFA 1F02I 1FNHA 2ED8A 4E5XA 3D85D 5I76B 1W72L 1X9QA 5EZOL 3OPZL 3LCYA 5B39A 5D1ZC 3VGBA 3HNVL 1NCTA 3KPOB 3MLRL 5E8DL 1F45A 3QI9D 5ALBH 1PAMA 3E0GA 3S97C 4MDJA 1ZGLA 2NY7L 3ILPB 4OBSA 3O8XC 3QUML 3W0WA 1JF1B 4HJ0C 1XGPB 2GSGB 4H0GA 5D1XB 4G6AD 4X4ME 3PWJB 2RFXB 5DEFA 1N5YH 3QULB 1ZA6B 4G7VL 1CXLA 4JFXA 1KTLB 1CFSB 4IOIB 4NWTL 1DUYA 4U6VH 1T7WA 1OPGH 4DOHB 1C5DB 4TUOA 4LSUH 2HJFB 4YH6A 1VENA 1XF5B 3KPQA 2FWOB 2V17H 2CXGA 3D2UD 4DGVH 3ALXA 1XGRA 1MWAL 3SOBL 3MLYL 1DDHA 3FO9A 3RKDC 1MNUH 2X4PA 3ILQC 4MD0A 4YDVA 4QXUL 2BOCA 3ARPA 2V5RA 1JNNH 1KB5A 3VXME 1WLHA 1R3HB 1TITA 4XCYA 4IDJL 3C8KB 1JYWA 1P69B 3WIFB 5HD8D 2J3SA 3EKCA 4XC1H 3M17A 5F1IA 1DE4A 4PRNA 4RGND 4IDLA 1V3JA 4JPVH 3UMTA 1A14L 3JTSB 1EO8H 5GGVL 1J7VR 3MA9L 4IIQB 5JOPE 4QRRA 3ORJA 3O11A 2X1PA 1P7QD 2NZ9D 1G7HA 3T3ME 2G2RA 3BXNB 4PBXA 1UVQB 3MJ7B 1XCTA 3GKZA 3GMMB 1MJ8L 3EYOA 3OKEB 5I1EH 5L8JB 1FNEA 2HVJA 4ZOAA 5JNYA 4IRJB 3HS0A 4F37F 1MIEH 2VDNL 1A6TB 1Q9OB 2X4RB 5IUSA 2OX5A 2IF7A 3PABA 1EEUA 3AM8C 4KVNH 2O5YL 4P2RE 1SBBA 1YEFL 3S88L 3EO1B 3GJFK 4DGYH 3CVHL 5TGBB 4J6RH 4JQXC 3NCFB 4L8CB 1EFXA 4XP5L 4R7NB 2ZJSL 4RMRA 1X7QA 5FM8A 5GQBA 5KVMC 1FN4B 4KFZC 4JZJC 3ZHDA 5CBAA 1SYVB 5ESAB 1JHKH 1ZTXH 4JDTH 1CXEA 4X6DF 4LKCA 3GBLA 2EIZB 5DD6A 2GAZB 2OXHA 4O4YH 4EDXA 3WEXB 3BVNA 1G1YA 5IVZB 1UH3A 4QNPF 5H37H 4HIJA 5DJ6A 4OM0H 2HRPL 5C0AB 4KK5D 1NL0H 2V9TA 4S0TD 2NXZB 5I16B 3MRBA 3PL6C 4P5TB 3SDAA 3WO4B 5GGSA 4RZCB 4HJJL 4P2QB 2FLRT 4LU5H 1PBYA 2X4SA 5TQ2H 3TN0C 4ZDHA 5IBTH 3DARA 2OK0H 2BFVL 3GI8H 4YXHH 4LF3A 1XCQA 4HWBH 4MLSA 3BGFC 5C0EB 1RZFH 3S4SA 3QUYA 4NHCH 3VGGA 4Z95L 3QQ9C 4DKFH 1MEXH 4PRHE 4RX4A 4LRIC 3CU1A 3VXSA 3O2DA 2DBJA 1FSKC 32C2B 3BZ4A 3GZKA 5HYJE 2QV2A 1U3HC 5JO5B 5FF6B 4L1DA 5DSCB 1WIUA 3SDXB 5HGHA 1N3NB 5F97E 2PKDA 2BC4B 5F93C 1BZQK 1ORQA 4OV5B 1JNHB 5IMLB 4PJ7B 4XVJL 1QEWA 2A9NL 4KJQD 3QIUB 3KWWB 1EAJA 4M8VA 3QDGD 3FZUD 1QACA 2JJTA 1IGCL 5E9DA 1IEAB 2AJVH 1WWCA 2N1KA 5GRXG 2VL4A 5DD3L 4YFEA 3CAFA 3ARQA 3O4LD 4GKNB 5DURB 1H3GA 3QFJB 5SWSD 2RQ8A 1WIOA 5DD1L 4M6OL 3T3PE 3ZHLA 2VLJA 4O9HL 3VD5A 2NZIA 3ECBA 3G6JF 3O6MH 1JI1A 5ADOH 3EYUL 4WO4D 5D7JA 4JY5H 4Z8FL 4G6FD 5I9QC 5DZOA 2E5EA 2X4QA 1UKSA 3UJIH 4LSVL 3L5HA 4OKVB 3DV6A 4JQIL 5EU5A 1MOEA 2PUQT 1QKZL 2Z93B 1A3RL 2J8UF 2OI9A 4LCUA 3NFNA 3WFHA 4AL8H 1LD9A 3H0TA 2YUVA 1UYWL 2WUBH 4EBQL 2YD6A 2PTVA 3V5HB 1KEGH 4GMTL 4F57H 3TBSA 1UWGH 3MJ8B 3SE8H 4H20H 5C0FA 4N0UA 1IC7L 1T20B 5BVPH 5CBEB 4D94A 1V5JA 1IM3A 3VD7A 1RJZB 4HFWA 5IEKA 3PQYD 3VXOA 1T5WA 3RY4A 2VLRD 5E03A 1AIFA 2UUDK 3BI9X 4L9LC 5BCAA 1R6VA 4ZTOH 4UB0L 3RL1A 3L7FA 5L8LB 1AD9B 4HWUA 1JTOA 2GCYA 1OTTC 4G6KL 4G7YL 2H32B 5KBNC 4X5XA 3ROLB 4AY0A 4ODXA 4PJBF 3QUZC 4QXGH 5HHPA 2NNAA 3QHFH 4KAQH 5J1SC 4S1RH 5CIPA 1T04B 1K4DA 2IPUK 5FOBB 4M6NH 4Y19E 4LHUD 4R9HA 1KBGL 5DJXB 1XEDA 1QNZH 4URTB 2LU3A 4PJXA 4UQ2B 1FFNA 5E5MA 1T80A 1FH5H 5FO9A 1KTRL 2UZIL 4U7MA 1DQDH 3REVA 1KIPA 3EZJB 2D3VA 4X4XB 3OKDB 5H2BB 3RWCA 1G7JB 5E8PA 4CU7A 1AO7D 1MLCB 4OD1L 1MCQA 2BNQA 4XNZB 1N8ZA 3CFDA 5EC1B 2R0LH 5IF0B 4ZFZB 1N5AA 1T1XA 3JV4B 1T1WB 4A2MA 1PYWB 4XXCA 3IXTA 3ARFB 4JR9L 2BVQB 3JXAA 4PJDA 2EDTA 1FHGA 2YBRB 2R2BA 1P9MA 4NO0A 3MLUL 4U6HA 4YK4B 5IW1A 1IGML 4LHQB 3U4EA 3BJ91 1R3LB 1YYLH 4Y2DC 4MXWL 3SPVB 2EO9A 2BNUB 2Q8AH 1JGVH 3B8YA 1DLFL 1HQRB 3UBXB 5GHWL 4H25B 2EC9U 4F2MB 1UZ6F 1SEQH 4R4FH 4NQTA 1DQJB 1DBMH 4N8PA 4U2ZA 4GAGH 3KNBA 2WIMA 5H37G 1D5BA 4XNUH 3HC3H 5INCB 2DOCA 1OF2B 1R0AL 1BX2B 2G5BA 3DMMB 5L2KB 1N26A 2VNCA 1H5BA 3OGOE 5GJTH 3RTQB 4NRYB 5TDNA 3PHSA 4FTVA 3KYMB 4PV8A 4R90H 3EGSB 4NZRH 5I18H 4JY6B 1CLOL 4LKXB 2Q86A 1T83C 5FM4A 1I1RA 3VFTB 1JF6A 4ZPTA 2ZCLH 3MOAH 1PKOA 3GMPA 5FA4A 2P24B 3THMH 1C7TA 4ELMF 4LNVA 2J88H 4PIRF 3VFVB 3B6SA 4JO2L 3OAZH 2VLKB 3C8DA 1HYSD 5IVXA 4LCWB 1NCWH 1WWBX 2QSTA 1BVKB 4IRZL 4BH7B 2ZG1A 1IKFL 3ROOA 4M9OA 4JPWH 2XN9A 3TIEA 1KV3A 3U0TA 1HHHA 1VPOH 1FVCB 4TUJA 1HDMA 5FUZL 5CJOH 4OZ4A 4G5ZH 4V1DE 2DDQL 2EDOA 4JFOB 3IGAB 1KB5L 1MFBL 5JOFA 1CGWA 1NGZA 1KPRB 3DHMA 4FG6D 4Y4KA 2CMRL 5F44A 1QRNB 1HE7A 5DMKB 5FO8A 5HYFA 1G7IA 5KSAD 1X5HA 5IMMA 5LCVH 1BQUA 2QEJA 4UDUA 3GI9L 4N68A 4F8QA 5FHBL 1WFTA 3ARGD 4HGWA 2X10A 3JTTB 3D0VB 3QRGH 1ZHBB 3TBYB 4PB9L 3MCKA 1VEMA 1HINL 4WNQA 2F54A 1T0NA 4S2SA 1V3LA 4LNRB 3RIAK 4FXKA 1MLBB 3BOVA 3KYNA 5EZLA 4L3EB 2EH7H 3G04A 2DLHA 4MXVE 1UEMA 4XRCB 3IFOB 1I3UA 2QSCH 4WW2B 1JGEA 2HWZH 5AYUH 4NO2A 1P53A 4XI5C 2GI7A 1HCVA 4GW4B 4NQCE 3AROA 1V7MH 5J57B 3QNYB 5E08H 1E6JH 5C0CD 4JFQA 4Y4FA 1QYGH 3QHTC 5DTFB 1HILA 1ZVSB 4KKCC 1J5OH 5BS0B 1KCRH 4C54A 3PE9A 5J1AB 2OBGA 2VDQL 4M02A 1TXKA 3K7UA 3SDDD 1Q0YL 1TETL 1DQLH 1VFBB 3GSRB 5IB4B 3QCTH 4IRSD 4BFIA 3DURA 4YGVB 1PLGL 5E2UH 1QLEH 3DI2B 3G5XA 4W4OA 5HHNA 3KPLA 4Y1AE 3O9WA 2FBOJ 4JPKL 2GJ6E 1I8MA 3TVMB 1WC7B 3BAEL 5D71L 3RDTB 2QKIA 4ZS7H 3UYRL 1QSEB 3HUJB 3RAJL 5E2VL 4JANB 4QRUA 4XPGH 2FX8L 4UNVA 5F1NA 1DVFD 1IGTB 1H3VA 5IB5A 3LKPB 3PWPB 4G3YH 3NCEB 5GRUL 1S78D 1ODAA 3WNPA 4HUKB 1FGVH 5T1KD 2Y5TA 1MCRA 3SDCC 5IW6A 4NZUH 4S1DD 4OFPA 4X6EB 2PN5A 2IQAA 4PGCA 3RGVB 3E2HC 3TYFA 4EI6A 1WICA 2HG5B 1YMHB 3DBXA 3KJ4B 2W0KA 4JM2B 4CADA 3AY4C 1FE8L 2XTJB 3I84A 3NH7L 4QF1B 3V0AC 1FO0A 1YEDA 4XNYH 3SKJH 4Z76A 1KJMA 2XWTB 4EVNA 1KACB 4MJ4A 2BRRL 5IMKB 4X6CF 4Q9RH 3VGDA 2FYYB 4JDZA 3QJFB 3NZHH 5SX4I 4LQFL 4Z7OE 1TTGA 2YD3A 4PJ5B 3QO0A 2AAVA 2E7MA 1KEMH 1CIDA 4Z7QF 5KTEL 4HS6A 2YMXL 3GNML 1BD2B 4I48A 3VG9B 3FO0L 1VADA 2BY1A 4WU7B 1CFVL 2IAMD 3V8CA 5HGDB 4PUBL 5L6YL 1GGCH 5IEHB 3BP5A 5EBLB 1I3VA 4B7LA 1Q94B 5LBSH 1CR9H 4MCYA 4LHJB 1XFPA 3QH3B 4LCYA 3L9RA 4PD4J 1IKNC 1NAKH 4PTTA 3N85H 1QSVA 4HAFA 1T3FA 4XXDB 4KHTH 3OTTA 3MV11 3FB6B 1MIML 1QFWH 4UDTB 3OJVC 4PJIB 2QQNL 1BM3H 2FZ3B 2YD5A 4YQXL 3SJVB 3EFFB 2DL2A 5HDQL 2BVTA 2X4UB 4P9HL 3NFPA 3X17A 5FCUH 2VMFA 1RU9H 3NACH 2EYSA 4P2OD 2XY2A 5EFIB 2QHLA 5E2JA 3VFOA 5I2IA 1GGIL 3MNZA 2UWEA 3PDGA 1U8PA 5FUCE 5LJYH 1YN7B 1RURL 4U6XA 4WDIB 1G9MC 1NC4B 1LEIB 2BJML 3PGDA 1MCNA 2COQA 1TMCB 5JIIA 4QKXB 2P1YA 4X7SL 2VQ1B 4DW2L 3MV8E 1EHNA 3IFPA 3LSOB 3MXWL 3VXRE 3FOMA 3ZYJA 3CVIL 1IBGL 1BBJA 5D7IE 1DLHB 4Q0XL 3QPQD 4Y4HB 5AD0A 1IQWH 5CGMA 3MRLB 1U8MA 5DUPL 4KGLA 4PS4L 4XCNA 1WF5A 4M1CC 3D5OF 3L3GA 1FNLA 3F12A 4MJ6A 4NC1C 1NKRA 3FHAA 4RSVA 5BV7L 4U2YA 1XR9B 2DM2A 4OLEA 1QHOA 5JQ6H 1J05B 1GC1L 4JRWA 2DLFH 3HMWL 5DQDH 4FFVD 3GKWH 4QOKE 4YDLC 1IVLA 3VI4F 5D1QA 1OARH 4PRDA 3SE4A 1O0VA 1UJ3B 3G5VA 4POYA 3HZVB 3HG1B 5I1DA 2K1MA 1WAAF 1U42A 2R0ZH 1H3XA 1FRGL 3MNVB 3ZKQD 3WO3B 4UUJB 4PRIB 3CCHB 1D5IH 4TNVK 4OFVA 1JRHL 2B2XH 4N5EC 4GAFB 1PEWA 4JGUA 4MB4A 5DMIH 2VKWA 4PJEE 3KPRB 3HZMB 1MHHA 3U7YH 1AE6H 2J1KA 2XZAH 2D7TL 3V7AE 2WY3A 5I73B 3UXFA 4TTGA 1DSFL 5LQBL 3D6GA 5I8KH 1JN6A 2MCPL 2VKXA 2ADGA 3C5JB 4P3CH 3VFGL 1UM5H 1B0GA 4Z7VE 4WENB 1F4HA 4TVSa 1RUML 5KW9L 3U0WH 3QBTB 1PG7H 3IETA 5FA3B 2H45A 3UTQA 5F7EL 3BPNC 5D7LE 2IWGA 5SWZD 2YA2A 4CMHC 1MJUL 1AKJB 1N64H 1D5ZA 3KPOA 5IT2L 4ZUSA 1P5VA 2G60L 3SGEH 2LVCA 4XPHH 4P59H 2DQJH 3ILPA 3CDCA 1QSFE 4W6XB 3GO1H 4C59B 2ADIB 1XGPA 4CAGA 1QBLL 1OP9A 3VG0H 5D1XA 3VMPA 1OM3L 3PWJA 2RFXA 2WBJB 4R4BB 3QULA 4Z7UB 1U92B 4JO4H 4IOIA 4JHWH 4GKZA 1FGNH 1EHAA 1C5DA 5IFAH 2GKIA 2X4NB 2YXMA 2HJFA 3I75A 1XF5A 3S37H 3FB8A 1JUFB 1LP9E 3RVUC 4K3DH 1HWGB 4WUUA 5BOPA 2VXQH 5HYIA 3STZB 4OLVL 1UCBL 2NY4D 4OCXL 3V6BR 3ZYZA 2E7LE 2R56H 1DBAH 1G6RH 3C8KA 4UT9H 4KMTH 3WIFA 3WLWD 4XMKL 1CK0L 4JFED 4GXUN 4ZMAT 1F90L 5MP6H 4HWEH 1YQ2A 3PNWB 4JHAL 3JTSA 1C1EL 3RVTD 4UI2A 5C9KA 2R69L 4LEXH 1KIRA 4YZFE 5CJQH 3SO5A 3BXNA 5C0NC 3C6SA 3ET9F 1UVQA 3MJ7A 4LVNC 3BQUC 4RBPH 5K9OB 3OKEA 1KCGC 4IRJA 4ESKA 3GHEH 3WCYA 5F9OL 4JCMA 5GGTA 1Q9OA 1R3JB 3LY6A 3T65B 4XAKD 3JUZA 5D1ZD 1BIHA 4PRBB 1PKQB 4FQ2H 3ZE1F 5DUBA 5EIVA 3EO1A 1BQLH 2R2EB 1JPST 4I0PC 2RJMA 3O8XD 5I1KL 5TGBA 3ULVL 4L8CA 1U6AH 4LLYB 4R7NA 1IGYA 1B3JA 4RWYH 2V5SA 4C58B 3UTTB 2GSIB 5JW4Q 1YJDH 3PP3K 1SYVA 5ESAA 1S7SB 4YXKL 5B8CC 5KSVB 2EIZA 4U1MA 4HHAB 4MA8L 1P84K 2Z35B 5IVZA 3WEXA 1HHJB 4LCIH 2FGZA 4N0FB 5C6TL 3LS5L 3LIZL 3D85B 3VE0B 2FO1A 3ZT7A 3QCUH 3ILQD 4RZCA 3O2WL 1LK3L 3W0WE 1CXKA 1A7NH 3ARBC 3GSUB 4H1LH 5GS0D 3QI9B 1UH2A 1L0QA 1I7UB 1Q72L 3KYAA 3WNLA 5C0EA 4ZAKD 3V4VH 4LLVB 4QHLB 1NEZG 3C6LD 3LQAH 1JWUA 4UNUA 3TWCH 3GSNH 4WV1B 2DI7A 3DROB 1TCRB 4XCFL 1HEZB 5T3XD 1A7OH 3EOYG 3A6BL 5JO5A 5C6WH 3D2UB 5FF6A 2GTWB 2VRAA 5D96C 4H8WH 4N1EA 3UYOD 4MJ5B 4N8CH 1DQML 3WKML 4OZIF 1N3NA 4XNQB 1YYML 3AREA 1OLZA 3RX5A 4XCEB 3I9GH 1L0YA 4OV5A 1JNHA 2V2TB 1FAKT 4PJ7A 2MQCA 1BFVH 5HHOD 5IMLA 3QIUA 4P3DB 5JW5B 4FXLA 4GQ9L 3R06A 3L5XH 4QRRE 3VFUB 1CD9B 4NKMB 4RGNB 1FO0L 2WBKA 2APXA 4JLRB 3ZDYF 4RMSA 2DIJA 4GKNA 3O4OB 4K71B 1P7QB 3QFJA 1ADQH 2ORBL 3CJJA 3T0DA 4OTXL 4MAYC 1CFQA 3KVQA 3JVGC 2HT3C 4U7SA 1EEQA 2VSDA 1W72H 5EZOH 4WRLA 3MO1B 2QBWA 4X4YA 5DVNA 4NP4L 3QWOB 3ALPA 3OPZH 3RVXC 1A3QA 3HNVH 5DDHB 5E8DH 3MLRH 3MRIB 3RIFF 2NY7H 4NUGL 3QUMH 1HSAA 5DQJB 4U0RC 4PJCF 4M7KL 4OKVA 4HX1B 4DEPC 4LLQB 4G7VH 3NA9L 3MFFA 1N6UA 3QQ9D 4NJAL 4NWTH 3VWKA 2PO6C 3IVKA 4IMKC 4X6DA 1OQOA 3DX8B 1T21B 1CYGA 5C08A 4J4PD 1I1AD 3MJ8A 1MWAH 3SOBH 1T20A 3MLYH 5CBEA 1ED3B 1RJZA 1U8QB 4PGDA 3SGJA 4AM0B 3MLXL 5E7BA 5TDOB 4IDJH 2OSLB 1D9KA 1NCAH 3UJJL 1HZHL 3NN8A 3P4LA 3MGTA 1BGXL 4HDIB 3VXSE 1MFCL 5TH2B 1A14H 5GGVH 2H32A 3MA9H 3TFKD 3V6OA 3DOSA 3IT8D 5JZ7D 2JELL 5IROA 4TQEL 5KG9B 3OQ3B 5GGSY 5DRZB 3IXAA 3GBML 5DJXA 1WV7T 2VDNH 2I60L 4UQ2A 2DQTL 2JF1A 3N1MC 4KC3B 1UFUA 1MCDA 4DKEL 2PW1B 1YEFH 4V2BA 3S88H 5H2BA 3HE7C 1KTDA 1MLCA 3B3IB 3CVHH 5EC1A 1FPTL 5E9DE 1Q1JL 3VRIB 1PSKL 4JM4L 4ZFZA 3V6ZB 3JV4A 2ZJSH 1CFTB 3MJ9A 2X7LA 4NKQB 3LQZB 3QDGB 4GRLC 1U9KA 4MA3B 3NIGF 4MXQA 1NDMB 3LH2L 2XWBA 1INDL 3ARFA 1SJVA 4XVUC 4KPHL 3H7LA 2BVQA 2VLJE 3O4LB 3B5TA 3Q1SL 1MHPL 3Q6FA 2VR5A 5SWSB 4CMMB 1UM4L 1TVBA 2HRPH 3CDYA 4HQQL 1VERA 2HN7B 1HIML 1R3LA 2AEPH 1I7ZB 1QD0A 1KJ2A 4HJJH 3WKNA 2BNUA 4WO4B 3MRJB 1PFCA 2Z91A 4G6FB 4C56B 1HQRA 5T1LD 4H25A 4OM1L 5HYEA 4F2MA 1QFPA 4RDQG 1HH9A 4Z95H 1Q9LB 2FIKB 5AG9A 4N0UE 1MCEA 1ZAGA 2WLYA 5SX5H 1BX2A 2QL1A 1J1PH 3DMMA 4R7DB 2WUCL 4LVHB 1SVCP 1YJDC 2FIRT 3ZE2F 3RTQA 4NRYA 4H1LG 2GYSA 2CRZA 3PQYB 3F7VB 3HZKB 4NQED 4JY6A 4NHUA 4LKXA 5IK3B 2VLRB 2A9NH 4P23C 4A6YB 5BOZG 1JYNA 3NTCL 3VFTA 4RQQA 4GAYB 1IGCH 2BSTB 2D7NA 2CO7B 5DD3H 1NGYA 3VFVA 1SJEB 1FL3B 4UV4L 1CE1L 4F33B 3S98A 4M6OH 2DBLH 4HZLA 3VFSB 5IKCA 1BVKA 4PJXE 1UT9A 4O9HH 3GDBA 1M1SA 4LHUB 2XRAL 4M7ZB 1DFBH 1JPGA 3EYUH 4Z8FH 3U0PA 2BX5A 1FVCA 3E8UH 2BNQE 2J8OA 4NZTL 4FQHA 3ZDZE 1XIWC 3WIIL 4P2CG 4LSVH 1BVLB 4H8WC 1A6UL 1CG9A 1AO7B 3AFLA 1QKZH 1NAMB 3N1QC 4JFOA 1A3RH 4I1NB 4RAVB 4PFEA 2ATKB 2NY1D 1UYWH 4PJDE 3T2NL 4EBQH 5K93A 4GMTH 1NCCL 4XCCH 1EEZB 3OF6D 1WCBB 5TE4L 1IC5L 1IC7H 4GJTB 1GGBL 5GRJL 3TH4T 1TJGL 5CJ8A 1AXTL 3F58L 3DVIA 3PGCA 3D0VA 3UPCA 1SQ2N 2D31A 3L5JA 3TBYA 4HGMA 2ARWA 1N0XL 4LVOC 3OXSA 4UB0H 3C60C 4LNRA 5GGTL 1GXEA 1MLBA 2VDML 4L3EA 4D9QE 4EI5C 4G7YH 5CUSL 2XKNB 3IFOA 4CRPA 4WW2A 5DMGC 5FGCE 5JUEL 3OKYA 3MUHL 1HKFA 5BRZA 3QR2A 5K9QG 5IB1A 2DIAA 3QNYA 3VFPA 5T1MB 4NC2B 3ZDXE 1G9EA 5KAQF 4P46D 4DFHA 5DTFA 4FTVE 5B3NA 4TVPL 5BS0A 5B4MC 1KF9B 3T3MF 1EXUB 2UZIH 2MPAH 1OP5K 1VFBA 4RFOL 3T0BA 4ZO7A 5FKPB 3NCJL 3L5WB 4OD1H 4YGVA 2VAAB 3RWEB 3OAYH 5DLML 2YRZA 4NJ9L 2D03L 3TVMA 4CKVX 1VSCA 3HPJB 5IBUG 5IVXE 5J11C 4YFLF 3WJLC 4JR9H 1QSEA 3HUJA 4LSPL 3NGBC 4KQ4L 3MOBH 3MLUH 1ES0A 1WZLA 1J18A 2XN9E 4XWOD 3WMSA 4MXWH 1VGKB 1IGTA 5DFTA 2EDYA 4Y8AA 3BO8A 1S9XB 2M26A 3LKPA 5ID0B 1H3PL 2WNGA 1DLFH 2VQUA 2AI0L 1HQ4B 2A1WL 5KSBB 4JREB 3X13B 2N4IA 1YMHA 3P9MB 4HC1A 1K85A 4JM2A 3O3EB 3RZCA 4QF1A 1BAFL 3RQ3A 5KSAB 1U8IB 2XWTA 2Y6SD 2CO6B 4Z5RB 2FYYA 5TF0A 3QJFA 3VGFA 2F54E 2QJDA 3ARGB 3BYTA 1EHLL 3CXHK 1E0OB 3C09C 1CLOH 5MEOB 3HFML 1SBSL 2J5LB 3FT2B 3V5KB 1DN2A 5DRNB 4WU7A 5LGKA 2VOTA 4MD5B 1OP3H 4GBXD 4RRPA 4GG6A 2HVKB 3ULVE 2LTQB 5IEHA 2VZ3A 5EBLA 4JO2H 1JCKA 3BDYL 1U91B 1TFHA 3QH3A 3UZVB 5I1GL 4L29B 3MUY1 2OP4L 4XB8A 4DUVA 3CNKA 4IRZH 5FUCC 5C0CB 2Z4QB 3WDJA 5DGQA 4PP8C 1BP3B 4BFGA 4XXDA 1MELA 1G1CA 3BGMB 3FB6A 4M4RA 2AK4D 3HPLB 3NIFF 2D4DA 4JKLA 2EZ0C 4G8GA 3SDDB 3T3PF 4PJIA 5BZDB 3BEWB 1GHFL 2FZ3A 4MVBD 4U1HB 3MC0A 5EZIH 4X6BB 2F9BT 1GYAA 3QO1B 2X4UA 3BH9A 2DDQH 1AHWB 1AQDB 3LVEA 4IRSB 1T03L 3QIWC 1OT2A 1QPXA 1F2XK 1KB5H 2AJUL 1MFBH 3SDCD 3D25A 4NNYA 5EFIA 1JGUL 4ONOA 3FRPG 1U8LB 4NQSB 3E6HB 4HIIA 1YN7A 5HI3D 4X83A 5B22A 1CL7I 4WDIA 2A9MH 1CDBA 2W07A 2B4CL 5I17B 3GI9H 3P4MA 4WCYL 4S0SD 1DCLA 5FHBH 1TMCA 5JLZA 1DR9A 2VQ1A 1NPUA 3LSOA 3K4DA 3TGXA 4UU9B 1DVFB 4PG2A 3LS4L 4PB9H 5HGAB 1DLHA 4JFZL 1HINH 1FIGL 4Y4HA 3MRLA 2CSPA 2IH1A 1MAJA 5DJ0A 5ICZB 3ALWA 3HE6C 1R3KB 4XPBL 5T1KB 3UTZA 3VI3E 4AEIL 1ITBB 5EU3B 3RWHA 3B5HA 1Y18B 3STLB 2VTFA 3V7AG 3F6IA 2BHZA 2B20A 3VXUD 3MJ9L 3TJHC 2E3VA 1J05A 2HP4A 1IAII 3B9DA 3EZ8A 4UMGA 1U95B 5SWQA 1OAZL 2VDQH 5ERWB 3HCVB 1EEYB 2HMIC 1NBZB 3DETC 5JHDA 3QZWB 3TA3C 1B6DA 3CXDL 1PLGH 3FMGL 3HG1A 1KJ2L 3CMOL 5B3JE 4HH8A 4JPKH 4K7PL 4UUJA 2IAMB 4BZ1L 3MODL 3BAEH 4NT6B 4BK5A 4PRIA 3RUGA 4W4NA 5INDB 1JNJA 3UYRH 2QTEA 1UB6B 3CD4A 2GEEA 3RAJH 5E2VH 1QZ1A 3GB7B 3KPRA 5F7LB 1WGOA 2ZCKL 2XNAB 4X5WA 5J12C 4O2CB 1U3HA 4UTAL 5CILL 2FX8H 2I5YH 3FB7A 1UGNA 5CD5C 2E9BA 2R2HB 3MGAA 3I6GA 5D2NB 2YD9A 4U6YA 3U1SH 2J8UB 5GRUH 3C5JA 4L8DA 3OAUL 4NQDD 3OR7B 2IBZY 1OGAD 3GSWB 4TULL 1MHEB 3W82A 3ZKXC 2WLZA 2UWEE 3DVNB 5FA3A 3DTXB 4MHHG 4M1CD 2R1WA 3DO3A 2K7PA 4P2OB 1TQCB 1FE8H 5DFWH 5EO9B 1AKJA 3NH7H 3TNMB 1TQBC 4D9LL 3EJJX 3OG4B 1G7QB 4X4ZA 1A64A 3HR5B 2BRRH 2CIKB 2ICWJ 5DRXA 2E7LC 2ADIA 2NY3C 1KC5L 2WBJA 4R4BA 4NNXB 5HDBE 3G5YA 1U92A 2H41A 3SO3C 4EOWL 2NQCA 5KTEH 2YMXH 3GNMH 5K9QI 2X4NA 4J1UB 3FO0H 3WN5C 3EO9L 2MKLC 3R0NA 2EC9T 3QEGH 4LGSB 3MREA 1CFVH 1K3ZA 4PUBH 3ZT5A 5L6YH 1WISA 5J9PB 4WTZG 1AJ7L 4L8SA 3STZA 4XVSL 5I71B 4N5ED 1A4JB 3RIAF 4X7CC 2Z31D 1M05A 2HYMA 3FRUB 1KELL 5EOQL 2Z8WC 4C55A 4APQC 1F4AA 1MIMH 4RDQF 2DQUL 5E8NB 5FXCH 5I74B 2GY5A 2QQNH 5LGHL 4MD4B 3S3SA 4EXKA 4YQXH 3DRTB 5HDQH 1GOGA 2F53A 4P9HH 4P9MH 1TJIL 2HTKD 5AWNL 4YBLB 4N90E 2CDEB 5K9OA 2PXYD 4EIGB 4WHTB 1AGCA 4K8RD 5E4EB 5E94B 1GGIH 1MJJA 5CZXC 5DO2D 4U1GC 3KLAA 2CRMA 1R3JA 1RURH 1YNTB 4R3SB 3T65A 2EDXA 4LLDB 4I77H 2BJMH 3EJYC 4PRBA 4Z9KB 1PKQA 1BZ7B 1MI5D 3TCXA 5I1LB 3KHOA 4X7SH 1P6FA 4DW2H 1YEJL 2XPGB 3MXWH 4LLYA 5CIPH 3CVIH 5CGYD 1F4WL 1IBGH 4AIZA 4Q0XH 1HSBB 2H26B 1EJ6A 4V2CB 1P4LA 5DUPH 1VFAB 5KSVA 4PS4H 5IW3A 4HHAA 2YHGA 4OF0A 1NFKA 5JOPD 3KYOB 2Z35A 4OCLC 4XNXL 1PDKA 4YHPB 5BV7H 1FP5A 3D85A 3R4DA 4YAQB 5DRWB 3TT1L 5SWZB 1J0YA 1QLFA 1OP5H 2KBGA 1R5IA 2AK1H 2DAVA 4U3HA 1ZS8B 4MXVF 1FFQA 1GC1H 3QI9A 5JA9A 3GBNL 4HUVA 1I7UA 4KDTC 4OZGB 5JDSA 1E4XH 3WFZA 4DOHE 4R4NC 3VH8B 4QHLA 5M7QA 1TCRA 1KGCD 4LFHD 4WUUE 5C0ND 1FRGH 4MB3A 5AAWA 1CD1A 1T22B 3D2UA 2VLME 1JHLH 2GTWA 1JRHH 4DVBB 4MJ5A 3RX8A 3QQ4A 4XNQA 1A9BB 4XCEA 2NY4B 1FYTD 5EU4B 2GK0B 1RZKL 2V2TA 3JV0A 5EB9A 5IM7B 3K1KC 4HC1L 2D7TH 3FN0L 4P3DA 4JFEB 1DSFH 1SEBB 2C1PA 4POUB 4K2UL 4NKMA 1CXFA 2MCPH 2YPVH 3OR6B 3IJHA 1MREL 4JLRA 4RGOH 3U7WL 3BDBA 1MFDL 4UV7L 5DS8B 5I75C 3BD5A 2VITB 5EORH 1RUMH 5KW9H 4FQIL 1F4XL 3D3VD 4PRHD 2AEIT 3VRLE 5F7EH 4XPTL 5FK9B 3S4SG 3MO1A 1MJUH 3ARTA 2ZG3A 1IM9D 3QWOA 3GMNB 5HYJD 3SDAC 4L4JA 4XBGB 5IT2H 1AY1L 2G60H 5MEPB 4NFCA 1XAUA 5D1ZB 3ARBD 2WWMC 4Y8DC 5DQJA 1QBLH 3IDYC 3KLSA 4X8XA 4HX1A 3BJLA 1OM3H 3TF7A 3O8XB 1OAXH 4MQ7B 2O5XL 4TVPE 1AD0A 2NX5A 3QUYC 3AB0B 4G42B 4Z0XA 3AMKA 4LASL 1T21A 4U33A 4F9LA 4Z7OF 4HKXB 4Y89A 3H42H 1FFPB 1ED3A 4OLVH 3VFWB 1UCBH 4QTIH 2YK1L 1S5HA 1KT2B 4AM0A 4OCXH 5TDOA 2OSLA 4GRMB 1AGEA 3OJ2C 4XMKH 1CK0H 2DF3A 3EFDL 1F90H 4HDIA 2NY6C 5TH2A 1C1EH 3B5GA 4OZHB 2JJTC 4ZAKB 3C6LB 1QR1B 3FFDB 5F9AC 1UZ8B 2GUOA 4ZQKB 2YD1A 5DRZA 2F74A 1YY9C 4MAYD 2VL5B 5F9OH 1L9NA 3H9SA 1OAYH 1CQKA 3BP6B 4PJ7E 4FHBD 5D7JC 4R8WH 1EMTL 2PW1A 3UJTH 4PR5B 3B3IA 5MENA 5I1KH 2E7HA 5HHOB 3VRIA 3ULVH 1S7XB 4TNVF 4LRNL 3V6ZA 4AMKH 4GMSH 2VDLL 3LQZA 5E1AB 2OL3B 3OJDA 3MBED 2OI9C 3QFJE 5EUOA 2PO6D 1NDMA 2V9RA 3UBXI 4YXKH 3ARDD 4ENEC 4MA8H 2AP2A 1JZ2A 2P5WD 5D7IF 1S7TA 1MJ7H 5C6TH 5ICYB 2EXWC 2ZCHL 2HN7A 1GAFH 2M1KA 1I7ZA 4P9HC 3O2WH 1QBBA 4HMDA 1LK3H 4ZFGL 3F7QA 4WO4A 5T5FH 5J6HA 3MRJA 3OKKB 4C56A 5DMJB 2WV3A 4POZD 5J89A 4PJCA 4WFGE 3C8HA 1Q72H 1FZJB 1TZIB 3RWIA 4X6DE 3SCMA 1Q9LA 4XB7A 3BGFB 3CK0H 4LARL 5C08E 1WT5C 4PB0L 5GGRY 2YD8A 3A6BH 4MZ3A 3RHWK 1I1AB 5KVGL 4NCC1 4R7DA 1A8JH 5HVHC 1SJHB 3PUCA 1DQMH 5FAAA 3PQYA 3F7VA 4HEPG 1RMFL 2CPCA 3UDWA 5C0BD 5IK3A 2VLRA 2ZOLB 3HE7D 3LPFA 3OKLB 4GQ9H 3V6OE 5BV7C 3JZ7A 4LLAA 2EDHA 2M2DA 1BPVA 1JP5A 4GAYA 1FO0H 2YA1A 2Z92B 4PJEF 2BSTA 5GRVL 4GRLD 1T6WA 2DQIL 2HKHL 1T0PB 4U1KB 4Z7WB 1WZ1L 4XXCC 1A7BA 4QHNB 4XTRD 2ADJA 4XVUD 4F33A 2R1YB 2P5ED 2NY5H 3VFSA 5C1MB 1M6OB 5ACLA 4Z7VF 4NP4H 2VJXA 1MRCL 4HKZB 1S8DA 1A1OB 2CH8A 2N7AA 4LP4A 1GZQB 5LAXB 5TQ0H 4GLRH 3QUXD 4WFEE 2QQKL 5T5NF