5IB3A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and copper
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib3A01
4ZOCA 2KBGA 2GY7B 1R3LB 5B22A 5DURD 3U2SB 1JZ7A 5HGDA 1JHTA 3EO0A 2FATL 1JF1A 2ZSVB 2H3NA 4LASL 4RQQB 1T3FA 1D7FA 4RX4A 3V5HB 3MV7E 4C56A 1W2KT 1P2CB 2MFNA 1C5BL 3KLAA 4R3SA 2DM2A 4R2GC 3GO1H 1C8PA 2OCFD 4AH2A 5FECA 2AJUH 2AXFB 4M9PA 1YY8A 1RZ7H 2WAHA 4PR5B 4F8QA 2MSPA 1HDMB 1T1WB 3LEVH 4WJ5A 2FNBA 4J4PA 2FD6L 3K7UA 3MOBL 5L7XH 4BA8A 12E8L 1K4DB 3E6HB 1NFDB 1SY6L 5C0EA 4NHUB 4JFYB 1SHMA 3ZE1E 1N5YL 5ACZB 5B38G 1CFNB 1Y0LB 1XT5A 4BFIB 2YBRA 4KXZH 3FMGL 5F7MC 4TUKL 3RHWF 4Y5VC 5CEZD 4G6JH 3WN5B 3EYSL 4U6HB 4NZJA 1YEFH 5DD0H 1AGBB 5F9JA 5SWSD 3A6CH 2YZ1A 3GJEB 3CZFA 1GGBL 3MLWL 4D9LH 1M71B 1ZLSH 4YHNB 4ISVA 4JRXB 4JY6A 3UEZA 1M05A 2X10A 1FFQA 1IGJB 4TUOA 4YFLI 4J6RL 2VXSL 5DVNA 3BPNB 1MCFA 4I77H 2G2RB 3OJDA 4D0BB 2COQA 5DLML 3HA0A 5IB2B 1INDH 4TUJA 3QI9A 4LRIA 4JFOB 1QSFB 4JKPH 1KELL 4F7PA 3L3JB 5ESQB 1NCDL 3UYRH 3IDMA 3ME0A 3TWCH 4OCXH 3VA6A 2YD8A 1CD8A 2VNCA 5D7KE 1AKJD 1BJ1H 4K3DL 1K85A 1CWVA 4U0QB 3ESVF 3LZFL 4RBPH 4QF1A 5FYJU 4X6BA 4UT6H 4LGSB 1QVOB 2Q7NA 2BY1A 5C0GA 1LEKA 1J87A 5JXEA 4PLNC 4YZFF 2NR6D 4CU8A 1HYRC 4FFYL 5CEZH 1KB5L 4U0RC 6FABH 3DBXB 3T77B 1IM3A 2VAAB 1T21B 2QSCL 3RVXC 1R3HA 4HUVA 4HF5L 4Q2ZA 4P9HH 5EUOB 2Z93B 2DN7A 3CZJA 1FSKC 4LAJH 1CDHA 2LQRA 4YXKH 4O2FB 5CSZB 3C2AL 1ZLWK 4RFEB 2BVQA 1DVFA 1IGFL 4JFDB 1YNLH 1KCLA 4NJAH 3RVWC 1U36A 5CEXB 1QG3A 4RWYL 1G9MC 3IFPA 5D7JA 3TNNA 3QEHA 3O3EA 4G7VL 4C83A 3V6FB 3QFDB 5IHZA 2K3TA 4N0CA 4GKSB 1XGRB 1VPOH 5T1DL 5I1JL 1TJIH 1J86A 5CEZE 4UINL 3SDDC 1XGUB 3VGGA 1I4FB 4JHAH 3WCYA 5C0NC 2VQUA 2CKBB 2W60B 3IDIA 3OX8B 4YAQA 4P2OD 4PYGA 5D1XC 3T8XA 5MP6L 4P59H 1F4YL 3MV9D 2ZUVA 4GMTH 1B9ZA 4M1CD 4X0KB 1QKZH 1GSMA 1WSST 5C3TA 1NC2A 3CFEB 4Y4KD 1JMZA 4PB9L 3FN0H 4OAWB 1JN6A 5J3HD 4Z7VA 3TJHC 1CGYA 4C57C 4Y16D 4LLUB 2X7LA 3KPQA 1LDPH 4O5LL 5T3ZL 4PG2C 1NGYA 1BHGA 2EE9A 3MJ9A 1YJDC 1DBAL 3WIHL 3SDAA 4AEFA 1QUNA 2GJ6E 5DD1H 3BKCL 1BQUA 4LSUH 4OLXL 3DRQB 3QUXB 4WW2A 4S1RH 5HYEA 1ETZB 3B43A 1FG2B 1QR1B 1Q0YH 5TE7H 5JO5A 4IJ3B 4LRNH 2FJHB 2W65A 5EZOH 4ENED 3CVIH 3CFCL 4JFZH 1QLRB 2F53D 4ZS7L 2HKHH 4R9HA 2BJML 3TPKA 4UI2A 3JWDC 4WHCA 1J1OL 2C3WA 4X99B 1J1XH 4GUPB 3MLXH 4FZEL 3KVQA 3QHTC 4N0YH 3U0TB 3BAEL 4E42B 3SCMC 2QL1A 2PO6C 5EO0A 5AD0A 3C8KB 2VXTH 4KUZL 1NLBL 1N6QL 1J12A 5M95B 1QO3A 4JZNA 1WUNT 1WBYB 3EHBD 5TE4H 4JG0L 4IDLA 4LQFH 4WTXA 2C3HA 1B88A 3MA9L 4PTTA 2VL5A 3HRZA 4PJ8B 4PJAE 4OV5B 5EPMB 4PJBB 4UTBH 5EA0H 5J06A 3QEGH 1BVKB 4P9ML 4IMKC 4G8IB 3DIFB 5IW6B 1KJ2B 4OT1H 1ZLVK 2W0FB 1WTGT 3KPNB 3EKCA 4XRCA 2BCKB 4ZPVA 3MV9E 4OLZH 3VGEA 3GK8H 4U33A 5I1LA 3LKRB 5D5MA 5FDWA 2KZ1B 4E41E 3F8UB 3ARGC 5IIEA 5MHSD 4QOKE 3FT3B 2DQIH 2XT1B 4HK0B 3RPIB 2RCSH 5CJQL 5EDXA 4XMPL 4NNYB 4GLRH 1I8LA 1FLTX 4OIAA 4KZEH 1NGPH 1R0AL 5FCSH 2XXMB 4MXQD 1KIQB 2Z31A 4NO2B 1EXUB 3OPZH 5TE6L 1ZMYA 1LK3H 3RWHA 3G6JB 3STZA 4DQOL 4KMQA 3C09C 2C5DC 4NUJA 4XT1C 1CXLA 1RIVL 5T5FL 5DDHB 2OI9B 1FFRA 3QDGA 1LO3L 5SWZD 5KVGH 4PLKD 3QDMA 3QCVH 2UWEB 1PLGH 4A6YL 5ECJE 5IW1B 4XH2A 5GS0C 3RU8L 4LPVA 5IGXH 1YEJH 4PJXF 4BKLB 3O4OB 3RWIB 4Z5RA 3GUTA 1D5BB 1HKLH 3LEXB 2Z4QB 4R8WH 4U1KA 5D6DA 4MB4A 1OM3L 4X7TB 5FM4A 1MY7A 2PW1A 5D71L 3P9MB 4QYOB 2FEDD 2V5TA 2DI9A 5DQ9B 1LE5A 2JK5A 4G43A 3MCKB 3UXFA 4HWBL 5BV7H 1IGIH 4HJGB 1JFQH 2XQYG 1HHJB 3NOIA 4HKZA 3V0VB 4HPYL 4L3EB 3VXNA 4CU7A 1ZT1B 2DQUH 3IJYA 1T0PB 1KF9B 5E2UL 4LVNB 3HNTL 4UAOB 2IMMA 2AGJL 3U7YH 3QDJB 4POUB 5L2KE 1TJHL 2H32A 1DQTA 3QXVA 5ISZE 2YXMA 1R3IH 5EC2A 4WEBH 1I1FB 5I30H 3HAEB 3OZ9H 1U93B 3IGAB 1KJMA 4CN4A 4K7PY 1MCNA 3CFJA 4IM8A 3G08A 4P23A 2YPLA 1YC7A 4ZNEE 3GSWA 2DQEH 3RKDD 1BECA 1JPSH 3TBTA 2F74B 3IJHA 1HCFX 2MQCA 1OW0A 3O6FA 1QLEH 3TIEB 1R5IB 3GHEH 1F90L 2HJKB 3TH2T 5MHSE 4PBXA 5MERB 5IM7B 3T1FA 5FA4B 1MCEA 1RJLB 3BZ4A 4EBQH 4U6YA 3RL1A 2A6DB 1UENA 5HHME 1KGCE 3F58L 1A47A 1KIUA 1A1NB 2XKNB 5E2WH 4JRXD 5HHQA 4WGWB 2DWDB 2HWZL 3SDYH 3REWB 4FNLL 3U9UA 4LCUA 5IOPA 4URTB 5ADOL 1WZMA 2FL5A 2BZDA 1EERB 2HJLB 1HINH 4H20H 2AKRB 5IROC 3I50H 1ZT7A 4CRPA 4XHQA 5KOMC 1QSFD 5E4EC 3B2VH 4DVRH 5EO9B 5SWZE 3BKJH 4HC1H 3FQUB 3OHXB 2VC2L 4ODXB 1T1YB 4W4OA 2WNGA 1MIEH 1JGVL 4WEUD 2FHBA 1OP5H 3WNMA 1LE9A 3BE1H 3EJZC 4HWEH 2VDRL 5BS0A 4R26H 2P42B 3VXUB 5GZOC 4ZUUA 3CUPA 1W72A 5JPMA 1BFSA 2ZOLA 5E6ZA 5E6IA 1GPOL 1OAZH 3HNVH 1NC4B 4NQCA 3DI2B 4XP9L 4KTEH 1G7QA 3QNYA 4KMTL 4GT7A 4G42A 3RBGA 3OKDA 1OP9A 1G9ML 2XZAH 3VE0B 2IQAB 2O61B 1F6AA 3P9WB 3ILPB 1HNFA 1DBML 1SYVB 2A74B 1SQ2N 2J1KA 2PTTB 5HHOB 4PRDB 3GJFK 4DN3H 2QQNL 3C5SB 3RY5A 2ZG2A 5DJ0B 1U92A 2MPAH 3REVB 4JFDD 4ZUSA 1NL0H 5D1QA 1IKFH 5HTSA 4FZ8H 3AREA 3HE7C 3TFKD 3WV0A 2EICA 3EIFA 3QUML 4IOFC 4Q0XH 5E7FA 3V8CA 2P8LA 5C07B 5CD3B 4HGKC 4LLMA 3L5XH 3SE8H 3GM0A 5E03A 3UAJC 1UYWH 5J6HB 5EWIH 1CXIA 2NY2C 4X98A 2E6JA 3DETC 5I18H 3FB8A 3L95A 3PWNB 4HZLB 2VQ1A 1T1XB 1ZVSA 3H8NA 3X3GL 4WI9A 4KGJA 4P2QB 3L5HA 4OM0H 4J3WA 3A67L 3B9VA 3L9RA 3SQOL 5E70A 3IXAB 4X4YB 1PAMA 1YJDL 3M8OL 3BDXA 3IKCB 1IAKA 1AGDB 3PL6B 4JLRA 1KUMA 4KKBD 3RWDA 3JV0A 2XACC 1MCDA 3DRTA 1MQKH 4FXGA 2CLVB 4HZAA 3WS3B 1C7SA 4MQ7B 1NSNH 2Y06L 2XRAH 4A2MA 4QTHB 2MCPL 2QADB 2A77H 1WICA 5JDJA 4HFWA 4WO4B 2X5PA 2DD8H 1FO0A 3ARWA 3QUXD 3MGAA 2FB4H 4CMMB 3JWDL 5JXEC 2CIKA 2NY0B 1SBSH 3QCUL 5GZND 1ZV5A 5HYJE 4AT6A 4POYA 3BRGC 2GAZA 3GSNB 5I66B 1J8HB 4Y2DC 3KPLA 4PP1D 1DN2A 2HT2D 2CKBH 4FQIL 3B5HA 3P4LA 2ITDA 1MJUH 4Y5XC 4B7IA 1IQWL 1DVFC 5KSBA 2WWMD 3E6FA 1B2WH 4JZOA 5BRZE 1BVLA 4Q9CA 4YHOH 1SYSA 1G6RB 3OKNB 4BZ1L 4KUCD 4JN1L 4APQB 5J12C 4L4JA 4TOYL 3V8OA 2YMXL 43CAA 3OB8A 1HZHL 1WFUA 2EZ0D 3S3JA 2DQGL 4NN5B 4RWHA 2ADIA 3CGTA 4PJ8D 3L3HA 2P5EA 4JHBA 5F7DA 4AM0B 3FOLB 4X80L 4KK9D 1QA9B 2AK4B 4OTXH 1PSKH 5GGTH 3MRQB 4ZFOA 2VABB 2HN7A 3QEQB 5BQ7A 1N4XH 1QRNA 5LGJB 1P4BH 5DRZA 2JELL 4HQQL 5MI0B 3TBYA 4MAYA 2NNAA 3C6SB 4JDTH 4EZMA 3KYOA 2DLHA 3QHZL 1KLGA 5HGAB 1OLZA 4JM2A 4PREB 5CMAA 1ZS8A 3MRGA 2CR3A 2DRUA 5FFLA 2CGRH 1JRHH 1BEYH 4QXUH 4U7MA 4R0LC 4RRPA 1C5CL 2R4SL 3X11A 4HUWB 2GUOB 3QQ3A 2Q3ZA 2MKLC 5KSAC 3VI3F 4JFQA 1FC2D 4K23L 3Q1SH 1XCQB 4OM1H 2A6KB 4DUXA 3NABH 4OD2B 4JPIB 1NBZB 5CJXA 1DBKH 5GS0L 4P5TA 4XMKL 3FONB 3O2DA 3ARDB 1RV6X 3CC5B 4KRLB 1WBZA 1LO0H 4YDLB 4PGCA 5K9OB 3HR5A 2VJXA 5TF1H 1G1CA 1M7IB 4P4KA 4W6XB 3WLWC 2EE3A 2CK0H 1X5YA 2X4QB 1HNGA 2AXGA 2IH3A 2XPGB 5EB9A 3B9KD 4L1HA 4ZAKC 3QUYB 4F58H 3MMEA 1E6JL 5J9PB 1UVQA 3EYQC 1KJ2H 2B2XH 1C5DB 3NN8A 4EEEA 3HHRB 1P84J 2CLRB 4BSVA 1WEJH 4XP6L 4ZOBA 4F2MA 3VG9C 4XCNA 1KV3A 3U30B 3VH8B 5I8EA 4LQ1A 3N85L 3MLRL 3SKUD 4NN6B 4XNYL 3UJTH 4L8CA 5FHAH 5DUPH 4L3ED 4PG9B 3NCBB 4L5FL 1Q9KA 4YO0B 3BGAA 1KCUH 5IK3B 5C09B 4D94A 5TDNB 4M1GH 2W07A 5HI4D 1XAUA 4R7DB 3HAEG 2AEPL 4M6ML 3QDJD 3FFCB 1H5BC 1BZQK 1Z6JT 4WENB 3UDWA 4CVUA 2LV4A 2C1PB 2V6HA 1CDUA 2V7HA 1CBVL 5I8KL 1O7VA 3D9AL 3OSKA 4HJJL 5JW4M 5I1AA 2X89A 2L4OA 4X5XB 4OIIL 5DJZB 2C26A 1NQBA 1ZA6B 4NWUH 1T5XB 4NYLB 2EC9T 1PEWA 5HGBB 5ANMA 3QO0B 1F13A 5I9QC 5TH2B 4CJ0A 4LVOB 2BOCB 1OAKL 1SJHA 5ID1A 1QBBA 1GGTA 4WHTA 2YA2A 3F6LA 2OL3L 4IMLB 3DO7B 5DD3L 4DKFL 3H9SA 1T04A 4BSWB 3L1OH 5IVXF 2VE6B 4W6WB 2EDOA 4HSQA 3VFMA 1A3RH 4Y19A 3G6JE 4GO6B 1BFVH 5HJ3B 1Y6MR 3SKNA 3IDUA 4DN4H 2EXYC 3CH1B 3D25A 2DLTA 4JANB 4YFEA 4RIRA 4JGMA 5ID0A 4C59B 5D6DC 4F15C 2V2XA 5EZJB 3IFOB 1JWMB 2P46B 1XF2B 3KPRA 2D31A 4J7RA 2FX9L 4GXVH 4XC1L 3HAEH 4MJ5B 3AS3A 1ITCA 1CE6A 3VXUD 4JO2L 5E6YA 2CDFB 4KQ3H 1CT8A 5DEFA 1IZKA 3TJEL 1A7OH 3H2WA 1N64H 1K8DA 2XYCA 3LCYA 5C9JB 1NC4D 2CRYA 4MCZA 1RUKL 4JQXC 5E08H 4FFZH 1PKQA 2DB8A 3ZKMD 2Y07L 1G7IB 2WINA 2J88L 4XCEB 4L8BA 5MEPB 3QXDA 1KBGL 3CFKA 4DZBA 3ZKSD 3S4SB 5AWNL 3OXRA 1JNJA 5AEAA 4HS6B 1DN0A 3H42H 3NAAL 1EDQA 2IBGA 3B5GA 1CFVH 4XWGH 3VRIA 3NPZB 5HHOD 4HWNA 4MAUL 3V4VL 2I60H 3C60B 4XGZA 2C3VA 4UV7L 1KT2B 3R1GL 4V3DB 3UTPD 3J7HA 2YSSB 3MLUL 1A1OB 5C07D 2Z91A 4OZHA 1ZA3A 1SJXA 1CF8H 1BD2B 1U3HB 3CD4A 3H7BB 4YK4B 2WBJA 2BVPB 4R4FL 2HTKC 3ARFC 4ZDHA 4CUCA 3V6BR 5IBUB 4U1LA 5F7KC 2NY7L 1LHZA 4OF7A 4ONGL 3BN9C 5GGVY 2IAMC 3O0RH 1A1MA 5IESH 4RNRA 4P2QD 3PGFL 1A7BA 4KY1L 1EJOL 5CHNB 2RGSA 4JZJA 1FGVL 4PJDA 3BPCA 4K7FA 3LS5L 1G7MA 1UZ8A 3PL6D 4LU5H 3CDGA 3HPJB 1OLLA 4P3WA 4L4TB 3D3VB 5A16B 3AXLA 2I26N 5E94B 5DVKA 4YHLL 3KLHC 2AABH 4MS8A 1VFBB 4O9HH 2HAZA 1G7PB 1YPZB 4LSTL 4K94H 2QADD 4PTUB 4GG6F 4S0TD 3BZFB 3QRFM 3W11C 2ZKHL 1BFOA 1SEBB 4WO4D 4OGAC 3QCTL 1QFWL 1IAMA 1RVFL 3EO1B 4N0UB 3TM6A 2NY0D 3CXHJ 2EXWC 1PYWA 3AB0B 1DEEA 2E7MA 3L6FA 4HX1B 1A9BB 3TBVB 3CMOL 5K9JH 4MD0B 2WLZA 5FK9A 2AERT 5CWSB 2UVFA 3MRRA 3VFNA 1U8HB 1R3JA 3NFSL 3GSVB 1JYNA 2AQ2A 1DQDL 4M8QB 4H26A 1J8HD 4NGHH 4K3EL 4PJEA 1JYXA 1H3PH 4TPRH 4J8RA 2IC2A 1D6VL 4YC2B 1IKNA 2O5YH 3OKLB 3UPRB 1LO2L 3NCCB 3K2UH 1RURH 4DUVA 2ARJB 4APQD 1Z9SA 2A0LC 3MUGB 4BQCA 1NDGA 5HI5D 1NPUA 5CP3A 4AEHL 4U1MB 4IRZH 3V7MA 4QXTA 5E8NA 4S1QL 3QAZC 3FQWA 5LCVL 5D7SH 5HDOA 5DFWH 5HVWA 3OAZK 3MV8B 4NJ9L 4HWZA 2AK4D 3D2UA 3MBEB 3MRDA 4LLDA 1RFDL 1MIMH 1I7TB 4N0RA 1II4E 2BSED 4U3XA 3QEQD 1YNTB 3MYJA 5E8OA 2ENSA 3FO2B 3LPFA 3MJ9L 5GGQH 5J1AB 1DQQA 5J13B 3L5JA 4PJ5A 4FTVA 1U8MA 3KPSE 1OPGL 4FFWC 5IT2L 2FJGA 3EUUA 5HPMA 1HHIA 1F11A 4MB5A 4R4BB 2B1HL 3BW9A 3KXFE 5EFIB 5J8OA 3GSNH 4IIQB 1FZMB 1S5IL 3VXRB 4JQIL 5TGBA 4M6OH 1QEWB 4PV8B 4UDUB 5C0BE 3SO3C 3WD5L 4EVNB 2X6MA 4L9LB 2ZCKL 3X14B 2X4RB 1CFTA 5D93C 3MRKB 4LKCB 2A6JB 4UT7L 3ARDD 2PYFA 5MENB 1FORL 5DEGB 1WZKA 4ELMA 1B4JL 1ES0B 2HTLD 3GI9L 2Q6WA 5DHVA 2Q76B 3QJHA 4B5EA 1I85A 2YEZA 4N1HB 1B6DA 3WJLA 4J12A 1GOHA 1Z0NA 5IWLA 3V6OE 5CP7A 3IDNB 3QUYD 4L4VB 3MOAH 4M7KL 5L8KB 4LPCA 1S9WA 4R97C 2NY6B 4M8VA 2G60H 3PWUB 4PJCF 3VH8G 1CDBA 3QA3B 1ORQB 5GGSA 1AHWA 4S2SA 2ENYA 1IGCL 1MCQA 1OWWA 4OZGF 2AXHA 3OJVC 2R39A 5GRYA 5DQJB 1EFQA 2NLJA 4XCCL 3P4OB 2RBLA 5HGDB 1JHTB 1HI6A 5AAMA 1JF1B 2CMRL 2H3NB 1T3FB 5H37G 3NMEA 5C09D 4FQCL 2OBGA 5TFSH 1JZ8A 3JV6A 2XTJE 3DSFH 3FFCD 2PTVA 4O2EB 3T3PF 3DX7A 4AH2B 5FECB 3A6BL 1HYSD 3LN5A 1YY8B 2AV1A 3QEQE 3G04A 4WJ5B 5HDQH 4OCNC 4PRAA 1B90A 5KANI 5TQ2H 3RP1A 1FZKA 4ZMAT 5C0EB 2WIIA 3D5OF 1D5XA 3T08A 3QG6B 2R4RL 4KK5D 3WE6A 2R29L 3SE4A 2O93L 2YBRB 2OYPA 2XKSA 1Z9MA 2J6EA 4P5MA 3VFGH 1TQBC 4PY8I 3O9WA 4HGWA 3B3IA 5HHXL 1KIRB 1RUQL 3ETBF 3HUJF 3T04D 5FCUH 4PRIA 3CJJA 4HS8L 5F9JB 1HN1A 5DC0A 1HSAB 3CZFB 3GMOB 3K8KA 3LN9A 2FWOB 4YDIH 1BX2A 1E0OB 2D7QA 1YQVH 4ISVB 3B2UD 3U9PL 4JY6B 1IFHH 1QTYT 32C2A 3VW3H 1MJ8H 3T0BA 4U1IA 4MQXD 1DUZA 1P7KA 1TZGH 4XXCA 3C5JA 4KRNA 1BWMA 2H8PA 3OJDB 2APFA 4MA3A 3V4PH 1G0DA 1YEKL 3CU1A 3QI9B 5H37H 1A4JA 1F2XK 4OCLC 4IDJL 3P30L 2ICWA 3T0DA 1JGLH 4MXVF 3VXMA 1TFHA 5IVXE 4OZIA 5BVJA 5IW3A 5EOCJ 2OTUA 4KMLB 1QBAA 5I19H 4LCYA 1IRAY 1DANT 2D0FA 2E7LA 3S4SG 2DBLL 1GZQB 2DDQH 4AIOA 5IJKA 2HVKA 4QF1B 4X6BB 4O58L 3BHBA 2UY7A 5C0GB 4OF6A 1LEKB 2R1YA 5C09E 4QRPA 4HXAH 3R06A 2XN9B 1ZE3C 1ADQA 2WQRA 3BP7A 1N3NA 4KKAC 2W92A 4HEPG 3ZYJA 3C60D 2DOCA 3RJDA 4I0PA 4Z76A 2JJSA 3GSXA 1A2YB 5I17A 2AJ3A 3LRHA 4UBDC 2H2PD 4JB9L 4IRJA 2YWYA 3QDAA 3IDGA 3U7WH 2UZIH 5IBUG 5GJTH 4D3CL 1EVUA 1BD2D 1DBBL 1DL7L 1KJVB 1U3HD 4JVWA 5GRJH 1RIHL 1UM4H 1KENL 3ARYA 3IFPB 5D7JB 5D70H 5ITBH 3LV3B 2IWGA 3QEHB 3O3EB 4C83B 2Q86B 2FX7L 2IQ9L 5IHZB 2ESVE 2NZ9D 4YGAB 1MVFA 25C8H 5DI8A 4OFDA 1HIML 4WCYH 4UV4L 4JRWA 4KI5E 5A43C 1NCNA 3AC0A 1RUPL 1OGAE 4M5YL 4LSQH 3IDIB 4LSDA 1T0MB 3LQAC 3GKWH 4YAQB 7FABL 4DK3A 2OP4H 3MZTA 3T8XB 4L4TD 3D3VD 3RUGB 3MV7A 1TZHA 3MXVL 1D5MA 5ITFA 1JP5A 2GI7A 3QG7L 4NKMA 4GS7B 4M5ZH 1KSRA 4JFPA 3OL2A 1K3IA 3IDYC 3ZTNL 1T80A 3PWLA 5TDOB 3IFNL 2R0WL 4MJ2A 1NC2B 4TRPH 1RI8A 4KH2A 1JN6B 2XWJA 1NANI 1BFTA 3N1GC 1MFCL 4NZTH 5DJCA 4OLUH 2X7LB 3KPQB 5CSBA 1KJ3L 5D2NC 1XFPA 1GGCH 3UTOA 1NGYB 1VA9A 2D7TL 3SKJL 1FCGA 5IP4A 4YDJA 1F42A 3SDAB 2ERJB 5JR1L 5ADPH 1IAIM 4DAGH 1J7VR 4WW2B 1U2HA 3GIVA 3G6DL 5HI3C 2VITA 5GS1C 5FGRA 2YK1L 4PB0L 1L9NA 1DLHA 2W65B 1E4KA 1YEHH 5E00A 5FOJA 1T66D 4MHHI 3PHSA 4GG6E 4CVWA 5J11B 3WFCH 2H9GA 3QIBA 1DQJB 4YPGA 1UKTA 3RI5K 1IBGH 2VIRA 3NZHH 3I6LD 3VXQB 4Q74A 5C7XH 2WY3A 1YEDB 2W0KA 3SPVA 3PDGA 2R69L 1BD2E 2EO1A 4JZNB 3ZKND 1TQCB 3MV8D 1XF5A 2XZCL 1B0GB 3MBED 5GIRA 5HD8C 3CSBA 4M6NH 4FP8L 1A9EA 1VGEH 3UBXI 5DA0B 2VL5B 3HRZB 2L7JA 5ESVA 1WCBA 3RTQA 3L3GA 3RX7A 3MRPA 5C0AE 4KK6D 1BF8A 1N7MH 4GRMA 1J88A 2UY6A 4NQVA 1RK1A 4YHKL 2APBA 1I7UA 2ATPA 4EN3A 4UUJB 3LH2L 5C6TL 4L4TE 2MTPA 3JBG7 4XRCB 4ZPVB 1T2JA 1TDQA 3RDTC 4HXBH 3S35H 3VXRD 5I1LB 5D5MB 3RGVB 2BFVH 5B21A 4QXGH 5D1ZC 5F96H 3MV11 2C7UA 4K8RC 4WV1C 1DQLH 4FG6D 4GRLB 3S36H 5F6IB 3MRFA 4BZ2H 4NIKB 4QGYA 1CE1L 2NXZB 3H0TA 5JHLL 1JNLH 4QHNA 1HEZA 1LILA 1QSZA 5MEND 2D7NA 4LKXA 3TF7A 3GB7A 1OAUL 1G7JB 2CXKA 3NIGF 1JNHA 2XA8L 1IGYA 3RVUD 2Z31B 4TNWK 1A3LH 4DGYH 3KG5A 3RVTD 2OR9L 5F89A 3RWHB 3STZB 2APVA 4PD4J 5HYSA 4W68A 1E28A 5E1HB 5EOQL 1NUGA 5FUOH 4L4VD 2OJZL 4OQTH 5EH1A 2NMSA 4V1DB 2DQFA 5EZIL 2F19H 4X5WA 2NY6D 4BM7A 3THML 1GC1C 1T2XA 2KQNA 4NRYA 4G8EA 3HLAA 4S1SL 4XH2B 3UTTB 5I73C 1WK0A 5E2TL 4KUCF 3DXAE 5DK0A 1RK0A 1V7MH 5K9KB 3CSYA 1CLYH 1CL7I 2KL6A 4TSCL 2XQBH 2B5IB 3H3PH 3C87A 3PG2A 1VHPA 1YEIL 4QXWA 4JKLA 3TO2B 4Z5RB 3GUTB 4U1KB 2VLLA 5GJSL 3ROLA 2UUDH 2LU3A 4RX4D 3ES6A 3T0EE 2QBWA 1JIBA 1KFAH 4TSBH 2JK5B 4G43B 1NMCB 1DSFH 1IC7H 2YRZA 2CJUH 1OGTA 3IJYB 4GQ9L 2GJ6A 2YC1A 4JM4L 1LO5A 4KVNL 4PJCE 3K4AA 4NP4L 1AKJA 2CDGA 4J4PD 4OKVA 1FNFA 4P99A 2EDTA 2H32B 5DD5H 4G6KL 4F7CB 1LVEA 1S3KH 2A83B 2AEQL 5EC2B 3GRWA 2Y9RT 4F9PC 4WFFD 3ULUH 1KJMB 4EIGB 2AJSH 3NCEB 3G08B 3QO1A 2VUYA 4NPYA 5HVFB 3VXRE 3GSWB 1X6LA 4MQSB 1BM3H 4HBQA 5JOFA 3WFDH 3O6FB 2DLIA 3C2SA 3I9GH 4MNGE 4Q9QL 5FUZL 3T1FB 1R3KA 3BZ4B 3RL1B 1G9NH 1I7RA 3TN0A 1I85C 3MLSH 5HHQB 4NQEE 3QPXH 5FYKL 5IWLC 3UTZA 4JPVL 4N5EC 3U9UB 4FQXC 4QO1A 2UWEF 5IOPB 3DURA 1DUYA 3LS4L 2X1WL 4PJAA 5D8JL 1NCCH 3ULUE 2OZ4H 3ILQC 1YEGL 5E99H 3QI9D 4YDVA 1FPTL 3WFEH 2DJUA 2ADGA 5DGRA 1C16A 4XAKE 3U0WH 3HUJE 4U2YA 4EI5A 2Q8AH 4UDTB 5E8EB 2ZCHH 4ESKA 4HFUH 1T89A 1KTDA 2IPUK 5DWUH 1ZHLB 3MV9A 2FJFB 3G5XA 4MMZC 1LE9B 1CL7L 1QPPA 3L7EA 4RFOH 4UIKH 1ED3A 4NZDA 5BS0B 3DV6A 4QOKA 5IB1A 1W72B 5JPMB 1PG7L 2ZOLB 1RUAH 5E6IB 1TJGH 4GAYA 1QD0A 2XN9D 4ORZC 4OGZA 1U91A 3QNYB 3NA9L 4BH7A 3OKDB 1K8IA 2ZNXA 3QDHA 1FAIH 3E0GA 3TPUE 1C08B 3ELAT 1VGKA 1BBDL 3U83A 4MXVE 1FNLA 3MNZA 1VADA 2XOTA 5F3BA 4LVHC 5HSFA 2AAVA 2AP2A 1IGML 1A6WH 1QNZH 1U92B 3P0VL 5I15L 4KKLC 1AH1A 4ZUSB 2J8OA 1NUNB 2DJ4A 3T4YA 3QXUA 2QJDA 3MLZH 2OK0H 1TTFA 5D1QB 3BKYH 5D7JD 3LQAL 4PLOB 4WFFE 3UPCA 3EO9H 1NLDH 3T2NL 1GGUA 5BOPA 4N0CD 3TT3H 2P8LB 2QEJA 4NNPL 5HYQA 4LLMB 4WY7H 1QHOA 3MNWB 2BVEA 2JCCF 4OCWH 5INDA 4Z8FL 4LEXL 1FL6A 4X98B 4PJGB 3FB8B 5LBSL 4XVSH 4KKCC 2VQ1B 5DRXA 1UEYA 1ZVSB 4DJMA 2VSCA 2BVYA 4NQTA 5F88A 2CDEA 3DI3B 3DX6B 4WVRA 3L9RB 5CKGA 1UC6A 3ABZA 3INUH 3RVVC 2Q20A 3DMMA 3PXHA 3RL2A 4NBYB 1NC2D 15C8L 4GJTB 3RWDB 3NIDF 3ARBC 4OLYH 4I18A 4FXGB 4LMQE 3EGSA 5L2KA 4JJHA 2EDWA 3EDFA 3KPOB 5FYLL 5ISZA 4M9OA 4FA8A 2ICWJ 1OARL 3TYFA 2LABA 3ZT6A 2E7LC 1BPVA 3SDAD 2BX5A 1EFXA 1QBMH 4YFLF 3RIAF 2X4SB 4F7MB 4HFWB 1UKSA 4O4YH 1FO0B 4TNVK 4ZNEA 4ZD3L 4GKNA 4LEOA 4WU5A 1H9VA 4NO5A 1FVEA 2CIKB 4LSRL 3CFDA 3VDAA 2FO4B 1CDYA 1PFCA 3MLVL 5HHMA 4AT6B 2LAGB 1UKQA 2GAZB 1JCKA 2XN9E 2ED9A 1PQZB 2FHFA 4XBEH 1AE6H 4FMFA 4I9WD 3KPLB 3NACH 4ZYKA 2CLZB 4IRJC 2UV3A 3D0VA 4JGUA 5E1AA 2ITDB 4F57H 4MD5B 1K4CA 3BYTA 5K59E 5FEBA 1X4ZA 3TNMA 5KSBB 3L3OA 4JZOB 2N56A 4K71C 4MNQB 1Q9OA 4MJ6B 4PRHE 5DZLA 5BZDA 4G8GE 3E3QE 5SWZA 4P3CH 5T1MA 43CAB 3F7YB 3FT4A 5CAYB 4U4BA 5JMRA 1RZ8A 1E6OH 1LK2A 2Y5TA 5EU4A 5A2FA 4KKNA 2ADIB 3NPSB 3KYMB 5HDBE 5IVNA 4I3SH 3L3HB 2P5EB 1J8KA 5F7DB 1JVKA 2OLDA 3EBAA 3LB6C 5I1IH 1R3LA 2B7DT 4ZXBB 5AYUL 4YEFA 4K8RL 4CGTA 2V9RA 2ZSVA 1KCVH 4ZFOB 1QRNB 5BOZG 3HC4L 1CLZH 3RUGE 1CGSL 3TBYB 4UILH 3KYOB 4KJQD 3RGVD 1KLGB 4U05A 4X6EA 4YBHA 3W39B 4JM2B 5HGHA 1ZS8B 4X7DC 2WM0A 4HC1A 1MNUL 3SY0A 3SE9L 1T1WA 3H3BC 4GRLD 4TVPD 4R2GB 1QBLH 2VLKB 1KCKA 3X11B 1GVIA 2NXZD 3QQ3B 1RUMH 2H6PB 1K4DA 1NJ9A 4KAQL 2B4CH 2V9TA 5KW9L 3T3MF 3X3FH 4HG4K 4FQ1H 4JFQB 5C71A 3HCVB 3LMJL 1GC1L 2O5ZH 2Z31D 3BO8A 3TYGL 5F7WC 1CTOA 3PGDA 4OUOA 4WU7A 4P5TB 1ZTXH 5I2IA 1X7QA 4Q7DA 3NTCL 3WN5A 1FDLL 4U6VH 1WBZB 4ZTOH 2QQKH 4V1DD 4PGCB 4M93B 3X12B 1MFDH 5CS7A 4Y5VB 4HS3A 4WFGD 3SOBL 4P4KB 4GSDL 1M71A 5IHUH 1D3CA 2AXGB 3UTTD 5CUSH 1I9RH 5D2LF 3W9DA 3MMEB 3LIZL 4NSKB 1JPTL 1Q1JH 1UVQB 1IGJA 3NN8B 3BRDA 3TT1H 2NX5E 4XWOD 2EDQA 1W8OA 4QRSA 2X4UA 3NIGE 2G2RA 1F4WH 2Z35B 2A6IA 4XCNB 2Y36L 5H8DA 5AZ2H 1QACA 5GRZA 5JPNA 1A7RH 3WHXA 3L3JA 1JGUL 4L8CB 2MKWA 4TVPH 1JWSA 2YN5A 1Q9KB 3FO0L 1A7QL 5TQ0L 4OJFL 1A14L 5CZVL 3QIUA 5F9OL 1L7TL 5IUSA 4DGVL 5I71C 2V7HB 2PYEB 3O2WL 4UT9H 2VWEE 2W9EH 5HYJA 2PNDA 2PF6A 5A2LH 2KQMA 8FABA 3CK0L 1IGTA 3BISA 1TPXC 5ANMB 3VXPA 2RB8A 1MCBA 3O6FD 1U8PB 2VLJE 3BEVA 2Z93A 3PWVA 2WK2A 4QRUB 3WKML 1SJHB 1EUTA 4O2FA 4TVPE 1Z3GH 4WHTB 5BRZA 1TVHA 2VL4A 1EX0A 4XPFL 2D03L 1X44A 4GAJH 1BJ1J 3RWEB 1N5YH 3H9SB 4Z7UF 2DBJA 3FMGH 4TUKH 1PG7X 3TVMA 3V6FA 3VFMB 3FAXA 3CSGA 2Z9TA 3CX2A 4NRZA 1NCBL 4P9HC 1I4FA 5D4QA 2WUCL 1OD7A 3NA4A 3UYOD 2DAVA 3MFFA 2CKBA 3IAPA 3KYKL 4V1DE 4HULB 3QZWA 3BDYH 1MHHB 2ZUQC 2R2EA 4RIRB 5ID0B 3UTTE 1FVCB 2VLMD 4L3AA 4UOJA 2V2XB 3KHOA 2H32H 5TDPB 3KPRB 4X0KA 5BS0D 2ZUTA 1J10A 1CE6B 2HH0H 3C6LA 4XNUL 4OAWA 5DEFB 5E6ID 5IBLD 4YUEH 4JREB 5MEQA 4MCZB 4F37F 1EGJL 1ODAA 1XR8A 1PKQB 3IT8D 4UB0L 2WINB 2ICES 5GRVL 2FIRT 4L8BB 2ICCA 3KLDA 1KC5L 2EH7L 4G9FE 4DZBB 3E2HC 3OXRB 4G5ZL 1DN0B 4JFXB 3LZFH 3HTLX 3BIKA 5CJOH 2R8SL 4OD1H 2MQ0A 4FMKA 1ETZA 5EU6E 4H5SB 3GZKA 2VSDA 1FG2A 1XGPA 1PX3A 2NR6C 2ORBL 5C70A 1NGWA 4AL8H 4XGZB 2DM4A 1AD9A 1BF2A 2C3VB 3IKKA 5EZLA 5D1QD 1QSVA 2FJHA 4FQLL 5IEHB 5J89A 4TTGA 3OAUH 3VGAB 4JKMA 4KHXL 1P69B 3M07A 1OVZA 3V5KA 2QR0A 4DOHB 2Z91B 4OZHB 1ZA3B 3WXWH 4LBEB 3JUZA 2EDDA 4HIJA 1AR1D 1WAAE 4ZDHB 2XNAB 1A0QL 1O5DT 3HZYA 1A1MB 3QNZB 4RNRB 4WNQB 3DO3A 4F9LC 2VDNH 3I85A 4HK3J 1CYGA 4JZJB 3SCMB 3SJVE 4PJDB 3BPCB 4OSUL 4W70A 4X7SH 4HK3N 3QQ4A 1W72H 4Z7WF 1NBVH 1UZ8B 3IDXH 4LLQA 4YEEA 4UNUA 4M7ZB 3AXLB 3IFLH 4P2OC 2NY5H 1LO4L 4LARH 1EPFA 3DIFA 1KJ2A 4KDTA 2EKSA 2JCCE 3CSPA 2J4WL 3VD5A 4NC2B 1KN2L 3WJJA 1A6VH 4M1CC 1GGIH 4H88H 1BFOB 2BCKA 2W91A 3TBWA 1U41A 1K2DA 1R5WA 5CFHA 4Y4KC 1UH4A 3VFOB 5FM5M 5J3HC 3N1PC 3C5ZA 4Y16C 3OKEA 1KCSL 2EDEA 5F21B 3RY6C 4KXZI 1PYWB 1DEEB 3FT3A 4TQEL 1DBJL 3L6FB 4HK0A 3BT2H 5FYJL 3OKKA 5IMMA 3VFNB 5FK9B 1WT5C 1F45A 3MRRB 3GSRB 3JVGA 3NIDE 2B39A 3ARGB 2HYMA 3GIZL 4H26B 2R23A 1KLUB 4PJEB 3FQRB 1I7ZA 5K33A 3EOTL 1S9YA 1MOEA 3VFWB 5DMKA 4Q9RL 4J8RB 4NO2A 4NC1E 2SEBA 5IBTL 2EDXA 5JDSB 4B53A 3G6JA 1QHPA 4ORGA 4MNQD 5GISL 5F7EL 2DL2A 1UACH 1KB9K 1YQ2A 1FRGL 4ENEC 1JV5A 1DFBL 1UWEH 3DX8A 1J11A 4NO3A 3LRGA 4RDQF 3C09B 1NDGB 1A7NL 1UB5B 4X83A 1EUUA 3FQXA 5T3ZE 1PZ5B 4HT1H 5E8NB 1UG9A 2P5ED 3FQWB 2CR6A 4FZEH 4G6AD 3EFDL 3DARA 1L6XA 3GHBL 3RWIA 4KPHL 4M7JL 4HWZB 4LLDB 3D2UB 3HI1B 3MRDB 4X7TA 1ZAGA 4PJGE 5DVMA 3VG0H 2VXVH 1QRND 2X9WA 3EHBC 3MYJB 5E8OB 1JZ6A 1FIGH 1FO0H 2P45B 3ARZA 1Z9OA 5E5MA 4PJ5B 4FTVB 1U8MB 1U8JB 5M7QA 3M45A 2FJGB 1HHJA 5LXGL 4GRWB 5HPMB 1HHIB 3V0WH 3V0VA 4FQHA 1F11B 4JM2D 4RRPG 1ZT1A 3O3BB 3S7GA 4KJYA 3DUSA 4I4WA 3GO1L 4P9MH 4TVSa 4R2GD 2X4PA 5GGVL 1RJZB 3BW9B 2J8UF 5CILL 2AJUL 4H25A 5TGBB 1J5OH 2PR4H 2CK2A 5J56B 2R2BB 2DQCH 4LGRB 4XNZC 1I1FA 3GMLB 3QQ9D 5E5UB 5L7XL 2EEAA 4RGND 1AR2A 3ZE0E 5BV7C 4GH7B 3OGCA 3ARUA 4KVCL 4LCCA 4P5TD 4UZGA 2O26U 4MX7A 4JJ5A 4EUPB 2AK1H 4S10A 2F74A 5J57B 2V7NA 1R5IA 1MJJA 2HJKA 5DHVB 3MQIA 5MERA 3QJHB 5IM7A 4XMPH 5FA4A 3EFFB 2YEZB 4G6JL 2AEIT 4P4KD 5IFHH 4MXQC 1YEFL 5DD0L 4OI7A 5F8QC 1VFMA 4KV5E 3A6CL 1RMFH 1EHLH 3REWA 2KH2B 2JB5L 2NYYD 4D9LL 1ZLSL 1S9WB 3N1MC 1T03H 3V95A 5GGSB 1A6AB 4XNMA 1AHWB 4S2SB 2PW2B 2AKRA 4MNQE 3T0WA 3DSNA 4PLKC 4Y5YA 4GOSA 3VJ6B 3KJ4B 3GBML 2OL3B 1INDL 1HI6B 5E8PB 2X05A 3MOQA 1FBIH 4YDKH 1T1ZA 1VFAA 4HMEA 2K9UA 1T1YA 1LWRA 5E4EB 1CTNA 3JV6B 1W8NA 4KHTH 4NC0B 2VXUH 1H0DA 1HILA 2BSRA 5D2LE 2FEDC 3F7PC 3IU3A 3TWCL 4OCXL 5FXCH 2FX8L 1RZJH 3H6JA 2PYED 3LN5B 2AV1B 4Q6YA 5CZXD 2OJEA 3G04B 1NC4A 1JWUB 4PRAB 1MELA 2X89D 1UJ3B 4HPYH 5I6XB 2YRPA 4PJ7E 3GKZA 5E24E 1FZKB 3PHQA 5DTFA 1MUJA 1E27A 5L88H 3VE0A 5EBMA 3S3SA 3VI4E 6FABL 2IQAA 2O61A 4KTYA 1SYVA 5CINL 5FKAA 2XG4A 2VLKE 3KAAA 3C5SA 4P9HL 4HWUA 3SDXE 4P5MB 3C9NB 2DF3A 3O9WB 4HGWB 3H9SD 3B3IB 2KKQA 3NCJH 3B5TA 4PRIB 4MA7H 3RKDC 3LEYL 1CZ8H 3WN5C 2A1WH 5EOCH 5KG9A 4NJAL 1BOYA 1B4RA 2NW2A 3V52L 5C6PB 1OAQH 1BZ7A 4HAGA 32C2B 1VPOL 1TJIL 1T1XA 1DUZB 1P7KB 5F7NC 4JHAL 3C5JB 1U95A 3STLA 3KPSA 5JLZB 5ADOH 1A4JB 3BPNC 1RIUH 3PF2A 4U1GB 3KPRD 4XPGH 4P59L 3PL6A 3FT2B 3WBDA 4Z7UE 1OAYH 3VXMB 5F3HA 1MCCA 4FABH 5BVJB 1PZUB 4OZIB 4GMTL 4OCYH 3MXWL 3KXFA 4LLYA 1QKZL 3HMXH 4B7LA 4MQ7A 2DKUA 5C0BA 4JRYB 2HVKB 1JBJA 5DA4A 3ULVD 4HKJB 2DTSA 3BHBB 1WJ3A 4LHJB 1LDPL 4XBGB 1YYMH 4GLRI 2R1YB 3R0NA 3UMTA 1V05A 1HKFA 3SE3C 3BP7B 1N3NB 3MBXH 2EC8A 1MCWM 4NKOA 5DD1L 3QXTA 4LSUL 4I0PB 1MFBH 4S1RL 3UTQA 2PYEE 4Z76B 4MDIA 1DE4A 2AVGA 4KMTH 5I17B 3V6OA 3MODH 4ZFGL 5TE7L 3CVHA 4CW1B 3IDGB 3BWUC 1MCRA 5EZOL 2YZ8A 3TC9A 4JFZL 4BFEA 1JTTA 2HKHL 2VZTA 5B3NA 4Z0BH 4MQTB 3F6IA 5FV1L 5DI8B 1J1XL 3MLXL 1J0ZA 3OKNA 3Q6GL 3TFKC 4N0YL 5ERWA 4K2UH 1DR9A 9CGTA 3SCMD 3BQUB 3HS0A 2VXTL 4PJIB 5DJ8A 2C1OA 2EO9A 5IR1A 5A3ID 5TE4L 1TZHB 4JPWH 1D5MB 5D7IE 4AM0A 5GGUA 4LQFL 5ITFB 2G75A 3N0PB 1UCBH 3JTCA 3UJJH 5SX5K 4NKMB 3ULVH 4MS8D 4JFPB 4KRMB 1NFIA 3MJ8A 2VABA 3QEQA 1NKOA 1WWWX 3FN3A 3BUTA 5DSCB 5LGJA 4UTBL 1T2QH 3QEGL 1EMTH 1YJDH 2XWJB 3GMNA 5E4IA 4OT1L 2EDJA 1CLOH 5DJCB 3VFRB 4KKBC 3T0VA 4RMTA 2FEEI 5EORH 3UPAA 5HBBA 1KN4L 5CJBA 4YDJB 3LKOA 3GK8L 4Z7WE 4U1HB 2QV2A 1S9VB 4HCRH 4HUWA 3ZTJG 3MRLA 4C54A 3ARGD 3GIVB 4OFPA 2DQIL 3SGJA 2RCSL 1T20B 3QUXC 3ULVE 2EIEA 2VITB 3F7QA 4OD2A 4JPIA 2BY0A 1NBZA 1DLHB 3O2VH 4KZEL 3LSOA 5E00B 3NZ8B 1I9JH 3FONA 4IJ3C 5GZNC 3WNPA 3ARSA 3CC5A 3OPZL 3U4EA 3QIBB 1LK3L 3NCYS 4YPGB 4IBLT 4PRPE 2VIRB 4PP1C 1ACZA 1T6WA 4OF8A 2HT2C 2X4QA 3ZHLA 4UQ2A 4LIQH 5I1DA 3QUYA 4KZDH 4Z95H 1E4XH 1TZIA 3GM8A 2GCYB 1P5UA 3QCVL 5J9PA 1PLGL 1R6VA 5ICZA 3PDOB 3GGWA 3LQZA 3GJFB 1C5DA 4OFKA 5GIRB 3D2UD 4K55A 4MGXA 4NBXB 5IGXL 2VDPH 1YEJL 2VDQH 5IVXA 2CLRA 5ALCL 4LLAA 4HIEB 2MWCA 2DQJH 1HKLL 4LSPL 4R8WL 2EZ0C 1HZHH 3ALXA 4JFFB 3L3GB 3RTQB 4OCRH 4PJ5D 4DEPB 4FTVD 3MRPB 2DQGH 4JR9H 4PJ8C 4P49A 3OR6A 4GRMB 2BNRE 4PY7B 4NQVB 1RK1B 3DECA 4N8PA 4DWHA 4KK9C 1I7UB 3RA7H 4EN3B 5C09A 4Z7VF 5IK3A 4CKVX 5BV7L 1JFQL 5TDNA 2YUXA 2AJZA 4RMVA 5HVHC 3HE6B 4LIQE 2ILLA 2DQUL 1GH7A 1KXQE 3WJJC 3HC3H 5JW5B 3QIWA 4W6YB 3ZTJH 2C7UB 4HQQH 1JZ4A 3OG4B 3U7YL 2GTZB 2VR9A 3MRFB 5EUKA 5IMKA 4EUPG 5DJDA 1R3IL 3KGRA 4FQ2L 4YWGH 5GHWH 3TH3T 4WEBL 5I30L 3H0TB 3OZ9L 3DJ9A 1JJUA 1HEZB 2FEEL 1FCCA 3CFIC 3ZDZE 3L3KA 3GB7B 3UYPA 2FIKB 2BOCA 1JNHB 4QHKI 4OUUB 1IGYB 1T5WA 2UYLA 2DQEL 2ESVA 5DF0A 1CQKA 3GHEL 5F89B 5HYSB 3P0YH 1E28B 3I02B 1PD6A 3OBAA 2J8UE 4GFTB 1MEXH 4EBQL 1CGUA 1OGAA 1ZLWH 2VE6A 4X5WB 3BVNB 4E9LA 3MC0A 4NRYB 4G8EB 4QRRE 1P9MC 2OI9C 2KUTA 3DGGA 5DK0B 4NQUA 5HJ3A 4NN7B 3CSYB 5IKCA 4GRWH 2RAMA 1HINL 5LGKA 3B9KC 4H20L 1Z5LA 2JTDA 2VLLB 3I50L 3VA2C 3ROLB 1L9MA 3O4OC 3B2VL 4DVRL 3BWAA 1ZLUH 3ES6B 5EZJA 4GXUM 2DM7A 1UWGH 3BKJL 1JWMA 5IMOB 4GAGH 1IC4H 5ALBH 2BSTA 1MIEL 2Y6SD 2CQVA 2PN5A 1OGTB 3BE1L 4R7NB 1BQSA 2GJ6B 2YC1B 4U3CA 4JHWH 1AJ7H 2EDLA 3LHPL 2CDGB 4OKVB 4EUPH 1MHEA 4LVNC 4L5FH 1LP9B 4OFYA 4UAOC 4XCEA 5C0CE 3HNVL 5MEPA 5DHVH 5HI4C 4QHMA 2M1KA 1CN4A 2A73B 2DYPA 2HFGH 3OTTA 3RWFA 5KN5A 4M6MH 4HS6A 1Q72H 5SV3A 4I2XE 2ZUUA 3KPTA 1YC8A 3MRIB 3VRLE 4Z7NF 2DMCA 5L8LB 4GG6A 5KVEH 5TPWH 2XZAL 3QO1B 3P73A 3D9AH 3ARRA 1TIUA 3C60A 2F8VA 3VD4A 3O9WD 1CGXA 5JOFB 5L6YH 4CN1A 5CGMA 3VXOA 5EBGA 4OIIH 2HFFA 4PRID 4DN3L 2AJVH 2IFFL 1ZWIA 2MPAL 4L9DA 2QSTA 1NL0L 1IKFL 1IEAA 3TN0B 1BD2A 4FZ8L 4YHPA 1U3HA 4Q0XL 2OL3H 4YR6A 1D5IH 3UTZB 1A4KA 1KTRL 1NFKA 3SE8L 1EHXA 3DURB 1DUYB 5J1TC 1UYWL 4PJAB 3Q3GB 4XXDA 2XFXB 3V7AE 5I18L 1EVTC 5JNYA 5CHNA 5C0AA 5A2IH 4YDVB 3PP3K 4KK8D 3WO4B 1XF1A 2ADGB 1TENA 1R24A 4LCIH 3VXMD 4EI5B 4L4TA 2QHRH 1X5FA 4CVZB 4K07A 1KTDB 2N7AA 5E94A 3G5XB 4XPTH 3L7EB 3QFJE 4XCFH 1ED3B 4ERSH 4E41B 4P2CG 1JRHI 3BGMA 3QXAA 1G7PA 4JRYD 1KCGC 3DV6B 1ULVA 4WHYG 4QOKB 5IB1B 1NSNL 2XRAL 1ZLVH 3V6ZA 4WFED 2OTPA 2J6EH 4QRQB 2W38A 3DVNA 2A77L 4PP2A 1U91B 2I07A 3VWKA 1X5XA 4XCYA 3TJEH 1IQDB 3U46A 2DD8L 3Q6FA 1ZANH 1MCOH 4I0PD 3TBVA 3ZKMC 2KZWA 2E7BA 4OGYH 2FB4L 1NGQH 4JQVA 1DDHB 1U8HA 1VADB 1SBSL 5F3BB 4K94C 5BCAA 4BFGA 5T3XD 5AG9A 3NAAH 3T4YB 4KTDH 1QQDA 1AFVH 4ODWA 1MCJA 4GMSH 3NCFB 3DXAA 4YBLB 2NY1B 5DR5H 1V3LA 1HE7A 1IEBA 2MNUA 1JTOA 1WTLA 5HYQB 1UQSA 3GEWB 3R1GH 4HKXB 1B2WL 1K6QH 5INDB 3F7RA 2IADA 2ZOKA 3D48R 4R6UA 1FL6B 4N68A 1S7UB 3BQUD 4X9FA 4YHOL 2OM5A 4U1MA 2HRPH 5DGQA 3U1SH 3T0EA 4D0DA 1ACYL 5F88B 3RNQA 3GMQB 2DJSA 4ONGH 3MBEA 5D7LB 1CU4H 3WNLA 4TULH 3PGFH 3QH3A 3DMMB 2ZP0T 1YNTA 3RL2B 1V8HA 3D69A 4PJCA 3VD7A 4F37K 4OTXL 1PSKL 4WHYH 5GGTL 3IJSB 4I18B 2YPVH 3PL6C 3EGSB 5L2KB 5FO7A 3HC0A 2C3XA 1N4XL 3QISA 5C2UB 5ISZB 1P4BL 1UADC 5EU5A 2VR5A 4JDTL 1X5ZA 1VSCA 3W9EB 5IF0A 2ITCB 1EFXB 4YGVA 3VFVA 3VXRA 5T3XH 1INEH 2QADC 1QEWA 4GKNB 4LEOB 4NOBA 3QXWA 4WU5B 2CGRL 5K9QG 2FGWH 1FVEB 4XMLH 1JRHL 4F3FB 2VRAA 4WO4C 5JA9A 4JRYE 3BPLB 4MNGA 5DQDH 3CFDB 4GW4A 4U1SA 3X14A 3UX9B 2EE2A 1U8QA 2VUOA 4WFEE 3GNMH 5HHMB 2NY0C 4OM1L 2EYTA 4AENA 3NABL 4NQEA 5B39G 1TETL 1DBKL 3QT2A 5DK2B 4ZYKB 3QIBD 5DD6A 3TEUA 3QUKA 2IG2L 1YDPB 3L3OB 1AQKH 1LO0L 3GSOB 3IRZA 3V4UH 2APTA 1Q9OB 3FZUD 1G0YR 3IDNA 4AG4H 2XZQH 5I75B 4ZFZB 1L0XA 2CK0L 1AXTH 4YIQA 3VWJB 3FT4B 1LO2H 3HUJA 4F58L 1XF3A 5IB4B 1LK2B 3QA3A 2Y5TB 1ORQA 3TZVA 4APQC 3KYNB 1FQ9C 1V7NH 4ODHH 3ORJA 2B2XL 1QFHA 5HI5C 4JFFD 4H8WH 5D7KD 3RTQD 3BP6A 4NN5C 1WEJL 5DQJA 4U1NA 3P4OA 2YKLH 1XF4A 5BMFH 3CH8A 4M62H 5C9KA 5DT1H 5HHVH 4PJIE 1NEUA 4EN3D 4DKEH 2V2TA 5DZOA 3OXSB 2OZ4A 2ZG1A 3HE6D 5DUPL 1KIPA 3SDCA 1HH9B 4HUXA 4S11A 1KCUL 4O2EA 4OBSA 1AI1L 3PGCA 3BN3B 1UH2A 4X6EB 5HGHB 5MI0C 3TPUA 4JY5H 1C1EH 3SY0B 1JPST 4NHCH 1FNEA 4WTWA 4ZODA 3O81A 1KCRH 1NJ9B 4HIHA 1HWGB 2P8MA 1S5IH 4NWUL 4YBQD 5HYSG 3QG6A 3P40A 3LRSA 3BO8B 1OTTD 5BJTA 3PGDB 4WU7B 5DMIH 3WD5H 2VOTA 2E9WA 5I2IB 1CD1A 1X7QB 4MVBA 4LDOB 1KOAA 1MAJA 2GJZA 1Q94B 3UBXB 1U8NA 1KIRA 3GJFH 1AIFA 3ARDC 4Y8DC 5T1KB 5E9DE 4UT7H 5KSBF 1U8OA 4HS3B 4AMKH 5GGRY 1FORH 2HTLC 1HSAA 3GMOA 2FWOA 4YDLC 1CD0A 3L1OL 4O02H 1KEMH 3LY6A 4MNHA 4Y1AE 1W0VA 3S8WA 1AQDA 2X4NB 1OWRM 3W9DB 3D0LA 5CZKA 4BK5A 1A3RL 5ILTL 5EOTB 5F7HA 3QUYC 3DVIA 2BVTA 1BFVL 1B3JA 2OX5A 4QRSB 2X4UB 5I1KH 4JFHD 3QWOB 4DGIL 2A6IB 4DN4L 3CMGA 2JLLA 5JPNB 3H9HA 3WHXB 2GT9A 1IT9H 1CGTA 2JF1A 4QY8B 3U30C 2Y7QA 1EA9C 1WIPA 3CXDH 1JWSB 2B20A 2GJ6D 2P47B 2FBJH 4GXVL 2EDNA 4N9GA 1A6ZA 1FVDA 2NTSP 4JFFE 1GZQA 3PWPE 4FFEX 4KQ3L 4OFVA 3QIUB 5INCA 3KDMA 1KPUA 1A7OL 1N64L 1A6TA 4GW1A 3TA3A 2HFTA 1JZ5A 2ZUYA 5HYJB 3BPOB 2XN9A 3WFBH 1HYSC 5ICXA 8FABB 1IGTB 3O4LE 3H42L 4EIZC 3VXPB 4XWGL 3BEVB 3PWVB 1A2YA 3EJJX 1H3VA 2I60L 4JG1H 1CXHA 1G7LA 1G1YA 4FQPA 1TVHB 5BRZB 4PRHA 2IMNA 4LVOC 1P7QB 3TN0D 4G8GA 1KJVA 4KK5C 2E8YA 4N8CH 3SKOB 3E3QA 4G59A 2VKWA 1FH5H 1BBJA 3I3DA 1W0WA 3EJYD 3LV3A 1CF8L 3KR3H 2Q86A 4RGOH 3TVMB 1J1PH 5JW4R 1CFQA 5D96B 3C08H 5KANG 4Z7NE 4NRZB 43C9A 5JIHA 2PXYB 2Q1EA 3QYCA 1YMHA 3MFFB 1XGQB 3CNKA 3O0RL 4G9DA 3QZWB 5IESL 2HVJA 3B2UC 1T0MA 4QGTA 2R2EB 3EYFB 2EH8H 2CRIA 3PNWB 4EI5D 3RUGA 4HDIA 3U79A 3T65A 2WANA 4MQXC 3WDHA 1AY1H 4LU5L 1JFMA 4PJ9A 3B9DA 5TDOA 4E41D 3GRWH 3LKPA 1IJ9A 4P57A 2UUDK 3C6LB 4NWTH 4QOKD 3Q48A 3D1MC 5A2JH 5D6CA 4O9HL 4JFHE 1WZ1H 4Y88A 5MEQB 4D9QE 5F1NA 4K94L 4WWKA 1HXMB 3S5LB 4PRNA 1XR8B 1JUFA 2VKXA 3AM8A 1MCLA 2J2ZA 2DBLH 3T4AA 1GGYA 5LWYH 3BIKB 1CG9A 4TTDD 1LP9E 1XGPB 5T5NG 2E7HA 1NGWB 2YD6A 3CPLA 4AEEA 1AD9B 1VEPA 2WWKT 5EZLB 2IJ0C 5DMGD 4NGHL 4X9BA 3C60C 5C6WH 2BC4A 3V5KB 4TPRL 1HSBB 1I1RA 2NY1D 2QR0B 1NMBH 2WUBH 5ETUB 2H2PC 1DQJA 4HIJB 5I76B 2NX5A 3HZYB 1PJ9A 3K2UL 5C3LD 3VXQA 1RURL 1U3HC 1YEDA 4PJFF 1TTUA 1S7RA 1E4WH 1Q0XH 1TNMA 1KENH 4S0SD 5FOBB 1I9IH 1FHGA 4P46A 4L8SA 3OG6B 2NZ9C 2F5AH 1F4XH 1RJCA 1B0GA 4NNXA 1I75A 5D7LD 2DTMH 3QQ4B 3JTSA 2DI8A 1HIMH 4UV4H 5D7SL 3DMMD 4LLQB 3UTSE 3ZKXB 1MIML 3KPPA 1KEGH 5L2KD 4YX2L 5ACMA 4HBCL 5ISZD 5GGQL 4PJXB 2CO7B 2EKSB 3K8MA 4UUJA 1OHQA 1V3JA 1YMME 1EFXD 3EOAB 5B8CA 1PGRB 3AGVA 3TBWB 1K2DB 1R5WB 2R0WH 3IFNH 3AY4A 3ZDXE 2CIIB 5KJRH 3PWJA 3RGVA 3ZT5A 3C5ZB 1I1CA 3OKEB 2X2YA 2VLJA 3GSNL 4YQXH 4EJ1C 4GRLA 3K2MC 3T09A 3OKKB 5IMMB 4KWUA 1N8ZB 5HHMD 1KGCD 1KXVC 2AV7A 4HMCA 4NCDA 3U36B 3AB0C 4XNQA 5JR1H 3SEPA 2R23B 2BMKB 1I7ZB 1G7JA 3ULSB 4JQVC 4X6CF 1S9YB 1G6RL 3S96A 5DMKB 5HY9A 2DQHH 4LPTA 35C8L 4MDJA 4NQDE 2SEBB 3SGDI 4OZHF 3I2CH 4ORGB 3K80A 5CLWA 5IFAH 4RISH 2YK1H 1MCIA 1NAMB 4YC2C 3BXNB 4XP1H 1JV5B 1JF5A 3TGXA 4Y4HA 4RMRA 3DX8B 1DJSA 1T66C 4V1DA 4NO3B 3NCMA 3DROA 3VWJD 5E5RB 2I24N 3MOAL 4XHJD 3UTTA 3FQXB 4Z7OE 1GCFA 1SY6A 1IAIH 1URLA 4FFVD 5K9KA 2G60L 4GQPH 3VFTA 3TO2A 5JQ6H 1ORSB 2V9QA 5B3JF 4P4RA 2HT3D 4KJWD 2D3VA 3MJGX 1YY9C 2CH8A 4YPJA 4BUGA 4N9OB 3ZKNC 1BJ8A 3MBEC 2XZCH 3EAKA 5JOPE 4L8DA 2OR7A 5E5MB 1AXSB 5H2BB 2BDNH 4G9FA 5D7LE 4FQHB 3RGHA 5J13C 4XB8A 4KJYB 2E6PA 3DUSB 2BRQA 5BW7A 3DSFL 4KK6C 2A9NH 1N0LA 1SEQH 4I4WB 4YE4H 1NUFA 2X4PB 4R90H 3C8HA 5EU6A 3M1BA 4H25B 4F7CA 3FB6A 4PIRF 2F58H 2A83A 2WP3T 4X6DF 4Q6IA 5F9DC 4HUMB 5TQ2L 3SBWC 1P53A 2P5WE 4IIQC 2GSGB 3T2OA 5EG6C 4GBXA 3HZVA 1CICA 5ELIA 3UBXG 3OGCB 4YHZH 1MFEH 4YHYB 4LCCB 4L9LC 4FG6C 1AD0A 2GSIB 2JJUA 4H0HB 4MX7B 2XWTA 4KQ4L 4JJ5B 2GYSA 1I3UA 1WAAA 5F6HJ 3WUZA 1I3VA 2V7NB 1MJJB 4UTAL 3OKYA 1CFBA 3OAYH 3QPQD 5T1KD 1F8TH 1FYTE 3VFGL 2E27H 2BNUA 1U58B 1N59B 1MHPH 5FCUL 3RVUC 3RVTC 3SJVA 3KNBA 3RIFK 2OR9H 4YDIL 1VB9A 5EOQH 1WC7B 1YQVL 1IFHL 2OJZH 4O2CA 2Y4SA 3VW3L 4XNMB 1XEDA 2NY6C 1J18A 2GITA 4CMHC 1TZGL 4M02A 4Y5YB 4ZS6D 2JCCA 4L1DA 1G9NC 3V4PL 2FR4B 4X8JB 1J0HA 1T1ZB 4UDTA 1VFAB 5E8EA 4TSCH 3S37H 1YEIH 1ZHLA 1H8NA 2FJFA 1JGLL 1KG0B 4I48A 1T6VN 4P5KB 2P49B 5F9WB 1H0DB 1HILB 2BSRB 3IF1A 3QIUD 3VFPA 3MA7B 3IU3B 1AO7E 5CCKL 2DDQL 2OJEB 3EYUH 2H2SC 4PJHF 1HHHA 2IALA 5HYJD 1T0NB 2VH5H 2ZCLH 4OGXL 1QYGH 4JM4H 3MPCA 3CDYA 4PYHA 1QSEB 4HXAL 3PHQB 5DTFB 3DTXB 1MUJB 1E27B 3FQNB 4J4PC 1C08A 5EBMB 1FE8L 4J3VA 4HIXH 5F7LB 1SVCP 4I3GA 5ENWA 4G6KH 1UWXH 5FKAB 5BRZD 1YA5A 3HFMH 3G5YB 3W0WE 4ELMF 1P7QD 3D39E 1FP5A 5I8OH 1P84K 4ZTPH 3FO9A 4NO0A 2UZIL 5GJTL 5DS8B 3S97C 1U6AH 2ED8A 3TH4T 3TVMD 2FSEA 5KG9B 2NW2B 1GIGL 1UM4L 4KRPB 3QZWG 3WIHA 1IM9A 5D70L 3MNWA 1GAFH 4CAGA 1XCTA 4YZFE 5ITBL 1BZ7B 2R56H 2PXYD 1KULA 3P3YA 25C8L 4PJGA 4WCYL 4BQ8A 3RI5F 1CLCA 4EDWH 5AYQA 4N8VA 1U95B 3STLB 2K7QA 3KPSB 4MXWH 3DX6A 4MJIE 3GKWL 2H41A 4RCAA 2RHEA 5LGHH 5HPOA 1F3DH 3O41A 4Y4FB 3QUZA 3C6LD 3QI9C 4LRIC 5F3HB 3S5LG 2VDMH 4M5ZL 1RY7B 2R0LH 3KXFB 4LLYB 3OQ3B 5E56A 3KPOA 1MH5A 3AMKA 1YN6A 3D85B 4TRPL 5C0BB 1P1ZA 1WISA 5E0QA 4AK1A 4NZTL 3IS0X 2X4SA 1GGCL 4F7MA 3NFNA 1YEEH 5FYKE 2HKFH 3WEXA 2AJXH 5ADPL 3QR2A 4HJ0D 1I1AA 1XR9A 3O6MH 4NKOB 4I5BA 1MLCB 4DAGL 2FO4A 1H3GA 3UTQB 4MDIB 1DE4B 3NA9H 3IETB 2NPLX 5DJ2B 5KTEL 1EEZB 1HOCA 3Q5OA 1PQZA 3CVHB 2LFGA 4XP5H 2CLZA 1YEHL 1KYOJ 4MD5A 4PS4H 3ZSTA 2ZG3A 3WFCL 3S9DB 4TNWF 2DQTL 2QQQA 4MNQA 5GSVB 2A2QT 5D7JC 1CS6A 1IBGL 4MJ6A 2X1PA 5ERWB 1LMKA 2DQDH 5SX4I 4N0CC 3F7YA 3FKUS 2Z92B 3HS0B 5KS9F 5DJ8B 2C1OB 3KYMA 5IR1B 2XTJB 5CBEA 2MCG1 3LKNB 4M6NL 5GGUB 3HI5H 4D9RE 2G75B 5D2LA 4ZXBA 4OCSH 5EU3B 5FA3A 1NFIB 4K7PH 3MJ8B 4XVUD 3O8XB 3JV4B 1BOGB 2F9BT 4JCLA 4GS7C 3NFPB 1MAML 1ZSDB 1N7ML 1M4KA 1X5IA 5JHDB 3GMNB 4BELD 1DP0A 4PJFE 3MACH 4MLIA 4PJ7A 1NEZB 4NKDA 4A6YA 3W39A 3B6SA 1ERNA 5D72H 3C5ZD 4X6FA 1H3WM 3FO1A 3LKOB 4HXBL 3S35L 1ND0A 4HUUA 4NFBA 3KLSA 3L7FA 1E4JA 2BFVL 4QXGL 5F96L 2VLKA 3L5WA 3MLYH 1OF2A 5ICYA 4AEIH 3SDXA 3SDAC 3MRLB 1DQLL 2ERJC 2H6PA 3ECBA 3FCTA 3S36L 3H9ZA 1TCRA 4D0CB 3QHFH 3HCVA 3BD3A 5C0FB 4WW2C 3NVQA 7CGTA 1JNLL 1X3DA 4NFCA 3TBSA 4HWBA 5D2NE 3EYVB 3WKNA 3LSOB 1MI5E 1HXYA 2DLFH 1A3LL 4QHLA 3EOBA 4DGYL 5F72S 5BO1H 3U4EB 1U8IA 3X12A 5J11C 4Y5VA 3K4ZA 2WBWB 2B4CC 4OQTL 5FYLE 1A5FL 4ODVL 4UQ2B 5GRXG 5I1DB 5I1GH 5IB5A 1TZIB 1KNOB 3AUVA 4NSKA 4RSVA 1V3MA 1MJ7H 5ICZB 1F58H 3GGWB 3LQZB 4Z7UA 1G9EA 5E2JA 1V7ML 5IVXB 1CLYL 1I9EA 4X6CE 2F54B 2ZJSH 3MRBB 1TQCC 1OTSD 2P4AB 2Z35A 3TCLA 1MRDH 1KPRB 5CD5D 1XIWB 1PG7W 3HPLB 4JDVA 2J5LB 3MR9A 1GHFH 3CXHK 3OR6B 2UZYB 1QRKA 5KAQF 1S7WA 1KFAL 1JPFA 4WI4A 2IH1A 1DSFL 3BJ91 1IC7L 2AJZB 4LAQH 2NW3A 2D0GA 2B1AL 3DGCR 3QIWB 1AGEA 4PJXE 1MCHA 1CGSH 2PYEA 3RZCB 3AY4C 4JN2A 1BMGA 5B3JE 4BSJA 4KJQC 1JMXA 3RGVC 4QT5A 5EUKB 5IMKB 1S3KL 5DJDB 3V2AR 2VDKH 3TIDB 4GW5B 5JQHC 2IPTL 3HMXA 4RAVA 3AU1A 2P24A 1NAMH 4GRLC 3R0MA 3L3KB 2NXZC 1U8PA 4QRUA 1I8LC 1T5WB 2UYLB 1UXWB 1N2RB 4WI8A 1MWAB 2ESVB 3WFDL 4LCWE 4NM8H 3I9GL 5KVDH 2Z31C 4M4RA 3RWEA 3U6RB 4LLVA 5JW3H 1OGAB 1G9NL 2YD5A 4MJ4A 5DFTA 1V5JA 4X6DE 3W82A 3BSZH 3MLSL 3QPXL 4FQJH 4DFIA 5D7IA 1CGWA 4QLRA 3DGGB 3VD3A 3UJIL 3SOBH 2MQ3A 3E8UH 5IKCB 1NCCL 2R2CA 2OZ4L 5CEYB 1Z5LB 1MHHA 3BDBA 4NUGL 3SDDA 4WUKL 5E99L 4LOUD 4F7EA 2JJTA 2B5IC 3GI8H 3LIZH 3WFEL 1FVCA 2WV3A 3BWAB 3HZMA 4F8TA 4P2YA 2Q8BH 1YYLH 3U0WL 1QFWI 4L29A 5TDPA 2BSTB 5D1XA 1RJYA 2ZCHL 1ZHKA 4HFUL 1OD9A 5DWUL 3IRPX 5DVLA 2YN3A 3H3KA 4RFOL 2ZUSA 1NMCC 4UIKL 4M61B 4Z7WA 5FB8A 2HLFD 5L9DH 4XPHH 4POZD 3PQYE 1MHEB 2HA1A 2ARWA 1RUAL 1TJGL 1QSED 4QHMB 4C4KT 2DYPB 4OJFH 3RWFB 5KN5B 1OTUD 1A14H 4JFXA 1FFNA 4KJPD 4PG2A 3O6LL 4GG6B 1EEYA 1I3GH 4I1NB 3WNKA 1MREH 1FAIL 4H5SA 3P73B 4TNVF 1J0IA 2Z8SA 4N0FA 5C0DA 4PRPA 3VXOB 4P23C 3P11L 5D9SA 2HFFB 5IEHA 1A6WL 1QNZL 1TMCB 1ZWIB 1SJEA 1D9KB 1OW0C 3O6FC 2OK0L 3MLZL 4HCRA 4PJHE 3BKYL 1IEAB 4KRPD 4LBEA 4YHPB 2WWKO 4OLWL 4AIZA 3EO9L 1NLDL 1A21A 4D2NA 2X9XA 4QEGA 4YR6B 2VISA 1A4KB 2XNAA 4AIXA 3HN3A 5HHPA 4WY7L 3KJ6H 2VLRE 3VXSE 3W2DH 4OCWL 1HH6A 3QNZA 4XXDB 4WNQA 2RFXA 3KPSD 1BREA 4XVSL 5JNYB 4XX1G 5C0AB 4LVEA 5DJAA 3SCMA 1QFWM 2BNRA 4LPWA 1FLRH 2VDOH 3EYOA 1FN4A 1R24B 4NCC1 2I9LB 4Y4FD 5I74B 3BUYA 2HRLA 2I5YL 3BESR 2NY3B 3G5ZA 3INUL 1UM6H 4PGJA 3KXFD 5JXAL 5IEKA 4U2ZA 1N5AA 3D85D 1OL0A 2VN4A 3BGFB 3BGMB 3QXAB 4OLYL 4W4OC 5C0BD 2GK2A 2HP4A 2BRRH 3O3AA 3WUWA 1WWCA 1NAKH 4IMKA 3V6ZB 4I0CC 1RULL 3P2TA 4M43H 3VFOA 4XVJL 2P7TB 1GOFA 3DVNB 4PP2B 1QBML 2I07B 3PV6A 4XCYB 5E6IC 5IBLC 3VWKB 3U46B 2YRLA 5BXFA 5LAXA 3Q6FB 1CDIA 1EGJH 4Z0XA 1FJ1A 2NY5C 5J4MA 2JB6A 3OF6A 4F33B 3GSRA 1P4LA 2EH7H 3LD8B 3BZEA 3ARGA 4NC1C 1ZGLM 2J8UA 1KLUA 3FQRA 3BD5A 1QSEE 3VFWA 1XH3B 1QQDB 4XBEL 3IU4H 1AE6L 1AGFA 4QRRA 4ODWB 5JDSA 1FFPA 3DXAB 5D1QC 2P48B 1IEBB 3AREC 1UQSB 4UNTA 3TO4B 2IADB 2ZOKB 4XAWH 3KPMA 2NTFA 3S35X 4XPAH 1UB5A 2JE8A 4X9HA 1AR1C 1ROWA 3T0EB 1PZ5A 1X6NA 4P3CL 5C08B 4D0DB 2XTJD 1REIA 1A0QH 1E6OL 3RNQB 3S36X 3WDIA 2APWA 3HI1A 5C8JB 4PGBB 3GSUA 1MRFL 3O8XD 5I1IL 3QH3B 5F70A 1NEZG 4WWID 3PP4H 4PJCB 3D69B 5ESAA 5JHDD 1MVUA 4P3DA 4DW2L 1INQA 2FBOJ 4OI8A 1U8JA 5FO7B 2V17H 3HC0B 1CD9B 5C0CA 4OZGB 4XI5D 3UZVB 1CLZL 5EU5B 3MO1A 3O3BA 4M48H 4UILL 4I2XA 5C0JA 4XX1E 1A7PL 1TCMA 5IF0B 4YGVB 3VFVB 2IPUG 1RJZA 5KS9E 3CVHH 2R1XB 5AZEH 5DZNA 3MROA 1RZFH 2R2BA 1QBLL 3R8BB 1YUHB 3GMLA 4MNGB 4GW4B 4U1SB 2VERN 4NKQB 3MREA 1F02I 1RUML 3IDJB 2B4CL 4ODUA 3RWGA 1U8QB 4Y89A 2FRGP 3X3FL 2WP3O 3WFHB 3BIBX 3ZHKA 3ZDYF 2E7LE 2EYTB 2O5ZL 4K9EH 4AENB 4EUPA 1DBJH 4NQEB 4ZSOB 1JHLH 5FYJH 2E9JA 3NBNA 2BNQB 5DD6B 1DLFH 1ZTXL 3QUKB 1I8IB 2X40A 3WIFA 3EFFA 4U6VL 2C9AA 4EDXA 4ZTOL 2QQKL 5JOEA 4CL7A 2AJYH 3MX0A 1OAXH 1MFDL 1M6OA 2J8HA 3IB4A 3O3UN 3ALWA 1CVRA 2W9DH 4YIQB 4JPKH 5IHUL 2AI0H 3MRNA 3VI3E 5CUSL 1I9RL 3HUJB 2IANB 1XF3B 5IQ7H 2ARJQ 2E7CA 3TZVB 1A6AA 2F54D 1FNGA 1Q1JL 2PW2A 1F3JA 5JIPA 1FGNH 1XIWD 3QFJA 1NCTA 3BP6B 3NPSC 1F4WL 3VJ6A 4U1NB 5FYJE 1XF4B 2OL3A 2J7LA 1BQLH 5E8PA 4JFEE 4G6AC 3NCYP 1VEOA 3FOMA 5AZ2L 1T4KB 4M7JH 1A7RL 2V2TB 2B0SL 2YD3A 1KIPB 3SDCB 5IMLB 4TVPL 4HUXB 4JY4B 5DUBA 3MV01 1NCWH 3QIWD 3PGCB 1FFOA 1PVHA 3TPUB 4MAYC 3RZCD 1FNEB 3WYRA 3ZYIA 1JWUA 1JK8A 2C4FU 5LXGH 4JM2C 4U6XA 5JHDE 1UJ3A 4K3JH 4LPUA 5H94A 1EEUA 2Q7YA 4B0MM 1JNNH 4M7LH 4HIHB 4UT9L 2P8MB 2W9EL 4UIMA 5GGVH 3WL9A 3UC0H 5CILH 2DIBA 1P5VA 4GKZA 3WNNA 3KS0J 3LRSB 4ODSH 4XVTL 3ROOA 1B6UA 1BAFH 2GK0A 4FQQA 5BJTB 1WZLA 2ESVD 3QQ9C 3VFUA 3F7VA 4RGNC 1WFOA 1RZJC 3CX5J 1CD1B 3C9NA 4KI5D 2FECI 2R0ZH 2GJZB 4G6MH 5CJXC 1U8NB 1Z3GL 4KVCH 1OGAD 1AIFB 4P5TC 1LGVA 4GAJL 1U8OB 3U48A 4PUBL 1F4HA 4QWWD 1I8KA 2IBBA 3ZL4H 1A6UH 4M93C 4MNHB 1W0VB 2EDFA 1AQDB 1WLHA 3HE7A 3GFUA 2HFEB 2OXHA 3D0LB 3MLPA 4P4KC 4JVUA 2JJVA 2BERA 3I6KA 3ZLQC 3UCRA 3HI6H 2GTWB 4PGZA 1FZJB 2NYYC 2XTLA 1R5VA 2JB5H 5L2JA 3BDYL 5JLZA 4FOMA 4HW6A 3GSQB 4OF5A 4P2RB 4JVPA 1OSZA 3FT2A 3H9HB 2GT9B 4N90E 2Y7QB 5EN2A 1G7HB 2F54E 4LFHG 1OT2A 4XPBH 3GBMH 1OCWH 4N9GB 1A6ZB 2HH0L 3STBA 1FVDB 1S78D 3MRCA 3EDDA 4G80A 5INCB 1WFNA 3KDMB 4JRYA 1KPUB 4LFHD 5C86A 5I16A 3BP4B 4OFYD 5A40E 4YUEL 1J9CT 1A6TB 4GW1B 4HKJA 8CGTA 2VZ3A 5I1HH 3TA3B 2DYPD 3TP4A 4XBGA 1MWAH 4PD4K 3UDWC 1Y18A 3GBNH 2FX8H 1NFDF 5ICXB 3W81A 5CZXC 3RAJH 4XP4H 4U31A 4OBRA 4X8XA 5CJOL 3SN6N 4OD1L 2JJWA 4CBPA 3SGEI 4PFEA 2PTUA 2HJFA 3WO3B 1TNNA 1G7LB 1D9KD 4AL8L 3S88H 4CW1A 4PRHB 3JWOC 4G8GB 3DYMA 3OAUL 5CINH 1ONQA 1BBJB 1SM3L 3PIQA 5I1CH 3OJ2C 1W0WB 3WXWL 1JHKH 4Y2DA 1CFQB 3WSQH 4Y5XA 1BP3B 2FECL 2AW2A 3LEYH 3B9EA 4ODTH 43C9B 3O3DB 4I0KA 5C0AD 1NGXA 3BQUA 1YMHB 4HKBB 2YPKA 4G9DB 4NRXB 4ZPTA 5EO1B 4PJIA 3V52H 1NDMA 2HVJB 3IS1X 2VDNL 2NY3D 4HDIB 5SWQA 3T65B 4X7SL 1W72L 1NBVL 1D5ZA 3IDXL 2JJTC 4PJ9B 5DHYB 3LKPB 4KGLA 3IFLL 4P57B 2QQLH 5DSCA 1ZLUK 5SWSE 2ATKA 2NY5L 3SO5A 2DMKA 2ZPKH 1EIBA 4LARL 1SMAA 5D6CB 1IAOB 2R0KH 4CNIA 3VFRA 3LPWA 5F1NB 2XV6B 4WWKB 4PRNB 1A6VL 1JUFB 3VWKD 3MXWH 1GGIL 4H88L 4JREC 4YLQT 1ZGLA 2GHWB 1VENA 3T4AB 4U1HA 1S9VA 1T7WA 1U9KA 5KOVC 3ULVC 1QFOA 1MF2L 1CG9B 1QFUH 1TVBA 4HUNB 3BT2L 4YXLL 1T20A 5EUOF 4R0LA 2CRZA 5E9DA 3QP3A 4DUWA 3CPLB 4MSWA 5KSAA 5DRNB 1WFTA 2ID5A 1MFAH 2DS4A 3NZ8A 4Y1AA 2BC4B 4W4NA 3DXAD 3NGBB 2I25N 2P43B 5CGYD 3VGAC 4ZFGH 3TO4D 5FM5O 2NX5B 1UACL 5B39A 4ZUVB 2QSQA 1UWEL 4JO1H 3S34H 4OZFA 2WBJC 1S7RB 3T0ED 5C08D 1IVLA 1H3XA 1C12A 1JPGA 2GCYA 4P46B 3QRGH 4XC3L 4L8SB 5F1OB 3PDOA 4E0RA 1J0YA 1QLFB 3I75B 3GJFA 2FH6A 4NNXB 1FYHB 4HT1L 1DTUA 4LSSH 4ZAKA 3JTSB 3Q6GH 3HZKB 4HIEA 4JO3H 5EC1B 4JZJC 5DJYA 2VZ1A 5T33H 4JFFA 3R4DA 3PWPA 3KPPB 3VG0L 2VXVL 2Z8WC 1JYWA 5A3IC 4M7ZC 2NY4B 5FGCE 4PY7A 4OB5H 1FIGL 1FO0L 4LLWA 4LF3B 3ZYZA 1S7TA 3LDBB 4MS8C 5EULV 5B8CB 3OR7B 3V0WL 3HE6A 4HH8A 3O4LA 4YJZL 3PE9A 1OSPH 3PWJB 3VCLB 5JW5A 2O5XH 1PEZA 3BMWA 4MWFA 2B8OT 5GRVK 1MPAH 2GTZA 2PETA 2VLJB 5HVHB 1J5OL 2PR4L 1H5BA 2DQCL 4RMWA 5EU7C 1KN4H 1RSFA 2AV7B 4XNQB 4PGEB 2W0PA 4RGMB 4NQED 5E8DH 4JO4L 2GW5A 2FIKA 2BNQD 1UA6H 3FB7A 3X13B 4OUUA 3CLFL 3VXTA 3S96B 2FH8A 5HY9B 2F15A 1YECL 5LQBH 2AK1L 4I3RH 4MDJB 2R1WA 5E2VH 3ULUD 2A9MH 5KVFH 4YHIB 1MCPH 3I02A 1JGDA 4OLVH 2VAJA 1IKNC 1UGNA 4Y4HB 5IFHL 2XG5A 1I3RA 2EIZB 3RKPA 4HPOH 2BHYA 4XAKD 3BVNA 3DROB 4WEMB 4NZUH 1RMFL 2IAND 3OKOA 5DYOA 1EHLL 3TZVD 1YNKH 1CK0L 2CXGA 3U4BH 4ZFOL 1T03L 1UM5L 3VFTB 3ZDYE 4P4RB 3FJTA 5DO2D 4EKXA 4WUUB 5IB3A 5J6GA 3MGOB 3Q5YA 4PJBF 5C08E 3B9KB 3DOSA 5IMOA 3BEWB 4L8DB 2F53E 5DJ6A 5ALCH 1FBIL 4YDKL 1L8JA 3SDCD 1F6LL 3MLTB 3RZWA 4LSPH 4G9FB 4R7NA 4KHTL 5DUMH 4JE4B 3BKMH 2VXUL 2E9BA 2IPKA 4J3SA 5T1LA 4OD3H 1RZJL 3M17A 5EU6B 3M1BB 1LP9A 1RZKH 5FO8A 4OZGE 3FB6B 1MFNA 4Q6IB 3FN9A 2A73A 3O2DL 5F71A 4JQXA 2WW8A 1JF6A 4ZUTB 5F7UA 4GBXB 1NCAH 3HZVB 1CICB 3MRIA 4DTGH 1FV1A 2AQ3A 5L88L 4C4KO 1AD0B 1GZPB 2I9TA 2XWTB 4MVBD 1I1YB 4JDZA 3H9YA 3SKMA 3VMOA 3S98A 4FQ2H 1WITA 1F3RB 2DLEA 2GJJA 3T3PE 5DFVD 5CJ5A 4HIIB 4QKXB 3G6JF 2BNUB 5I0ZA 3NCJL 4MA7L 4WW1A 1CZ8L 2A1WL 3FTGA 3WJLC 2F5BL 3SJVB 3VGFA 4ZO6A 5EOCL 1BLNA 4ZSOE 4XNXL 4PP8C 4ONHA 5CGTA 3KNBB 2BNQE 3BH8A 1KB5B 2P8PB 1CIUA 1OAQL 3UTSA 4O2CB 1HQ4B 2ADFH 4M00A 4KDWA 3Q3GA 1QOKA 2XFXA 3ARFA 2GITB 2QTEA 1AHWC 4V2BA 3BZDA 4L3CA 3L3DA 2IAMA 4P2RD 1L7IH 2JCCB 5JORA 3WIIH 1FNSL 2IANE 4FXKA 1YMMA 4MB3A 2DIAA 1RIUL 4CVZA 2GFBB 3FRPA 3KJ4C 4XPGL 1JZ3A 1Y6KR 1N0XH 4I48B 2VXQL 1OAYL 2H45A 1U8KA 4MD4B 2BVOB 1FL3B 2VZVA 4FABL 4QTIH 3ESUF 2V5RA 4E41A 3IF1B 4IOIA 4OCYL 3VFPB 3HMXL 4XTRD 3TA3D 3CCHA 3ZE2F 1P6FA 1HHHB 2IALB 2Y6SC 1S7SA 4J3XA 4QRQA 3HG1B 3L3IA 3JWOL 1YYML 4QHUB 1IQDA 5JW4N 2V5MA