5IB3A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and copper
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
total genus 82
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib3A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib3A01
1VEPA 4OV6F 3L3IB 4JAMA 2P8LB 1J8HD 3ZTNH 1EFQA 1UC6A 4Y2DA 5F6IB 5CBEB 3RJDA 5IG7A 1F4YH 5JIIA 4P2RD 3DETD 5DHXB 4F9PC 3ULVD 4M6ML 1FIEA 4MQ7A 5EULV 3TJHD 1G7QB 1R24A 2V17H 4D9QE 4LQ1A 3BP5B 3RUGB 1SEQL 1XR8B 3QA3A 5FECA 3LEYL 1P84K 4U1HB 4UT6H 3SDYH 2VH5H 1BLNA 4F33A 1WZMA 3VFUB 1JGDB 3O6LH 3N06B 4KWUA 1CLCA 2CMRL 4KDVA 3KPSD 3WUWG 3U2SB 3WLBA 4M5YH 1CLOH 3PGDA 1BM3L 3QEQB 4PGBB 4PJ5A 3MV8B 4PD4J 5DEFB 2WP3O 5EZLB 4ORGA 3KPQB 3O3AA 1ZWIB 5CINL 4H88L 2B2XH 3MRLA 2QADD 3BRDA 3FQTB 1DP0A 5C0GA 1MLCA 2DLGA 5BXFA 1T0MA 3H7LA 1SBBA 2ADIB 1EXUA 3GSOB 3MGAA 1MUJA 3L9RA 3OKMA 1RK0B 1MCIA 3MRGA 3NH7L 5LGJB 3MV9E 1CICD 4JRYD 3VH8A 4XVJL 4K3EH 4YBLC 3S88L 1EEZB 4Z8FL 3HMWH 2Y7QB 2FX7H 3HHRB 1FZOB 3DVIA 2HFTA 4LVNC 3C8HA 1UVQA 1IGIH 2OZ4A 1KN2H 3V4PH 1HI6A 3LB6C 5BW7C 2VL4A 1QNZH 4YDLC 4N0RA 5HYFA 5J13B 4GW5B 3MYZA 4UQ2A 1FJ1B 1QBML 2DLHA 4PP2B 3MRCB 3DX9B 3CLEH 4P2CG 4ZFOL 5I1HH 5SWZD 2X89A 5D93B 3TNNA 4XP6L 4L4VA 5L6YH 5CGYC 2F54A 2P5WA 5B8CB 3MROA 3HZYA 1ZVSB 3B5HA 2XXMB 4MA8H 2J6EA 3N1MC 5EA0L 4FTVE 2XNAA 2BNQB 4HDIB 3QCVH 3OKEB 1VGEL 2OSLB 3LDBB 1CDUA 4XT1C 5DJZA 4CL7A 3MODH 2A0LD 4G8FB 5HGHA 1ZT7A 3FOLB 3U9PL 4HWNA 2BVQB 3KYNB 1F02I 1ZA3B 3FFCA 2GHWB 4HK3J 4M6MH 4MMZC 3WIIL 3CFEB 1CTNA 4YHPA 2VISB 1TZGH 1SY6H 4DAGL 4IRJB 1AH1A 4KK9C 2Z0BA 1PJ9A 2YA0A 4JM2A 4OZ4B 4LDOB 4BSVB 1FP5A 4ZS6D 1FORL 4AY0A 2VLRE 3VRLF 3HN3A 2OL3B 5DMIH 4ZUUA 4FABH 4ALAL 1G7PB 4HX1B 1WBZA 4KZDL 3TIEB 4LPYA 3MLVL 3QPQD 1ES0A 1RIVH 1ZLSH 1KCRL 5GS0L 1CLZL 2EIZA 2NY4C 2PXYC 1KB5L 2BMKA 3B9KA 3O4LD 3WKNA 2XQYG 4PRBB 3BGMB 3RI5K 3GZKA 4YPGB 1CK0H 5EORH 1SBSH 2ID5A 3Q1SH 2YD2A 1N8ZA 1IGFH 2DQJL 2IF7A 1IC4L 4JR9H 3RZCD 5GRVK 3PWNA 1B0GB 4MD4A 3S88H 1J5OH 4PPTA 4TTGA 1A7OL 4M93B 1GOGA 5D7SL 1RUPH 5EN2A 4QT5B 4ZODA 3F7VA 1QSEB 4ZS6C 4MJIE 1OF2A 5MI0C 5JPMA 2DQTH 4WW2B 4XNZB 5GRYA 5IVZB 3VFRB 4X80H 3TVMC 4C57C 5BVPH 1M71A 1E27B 1J0IA 2BDNL 1JP5A 2J8OA 3HPLB 4TOYH 1RMFL 3MBXL 2WINB 2X4OB 5JW5B 1G0YR 4CDHA 3RIFK 3ULSA 4JCLA 3QH3B 2V17L 5ANMB 1LDPH 1MCQA 1NUFA 3VXRB 4QF1A 4XNQA 1QHOA 5KOVC 1JGUH 4OLZH 2VZTA 3AMLA 1U8MB 4RGOH 4PJCB 4OUUB 1S7WB 4JKPL 2IC2A 2L4OA 1LD9A 1NC2A 3EO0B 5ELIA 5LGJA 4OFYA 2VLJB 1CL7H 5T5NF 5CSBA 3HE7D 2Z31B 3EZJB 3U0PA 1RZIA 1X6LA 2VZSA 2A6JB 4Y4KD 2FECL 1SJHA 3VWKB 1JPSH 1S7VB 1U8PB 3AROA 1INQA 1I1YA 4X8XA 5CEZH 4OUUA 3TWCH 2VIRB 2NY1D 3QDMA 3VRLE 4X80L 2ZUUA 3VCLB 4MLSA 3OF6A 1R3JB 1KJ3H 3OKKB 3UZQA 3C2SA 1NLDH 4C4KO 1PEZA 3BW9B 1P7HL 1UKSA 4I0PC 2HLAA 3HKFA 1QKZL 2NW2A 1N6UA 3TYFA 4PBVC 3P4OB 3KPRB 3QAZC 4HKXB 4I9WE 3V5HB 2EDKA 4Q9RH 1NCAH 4JG1H 1HQRB 3PL6B 4PGZA 4C58B 2FJGB 4QHLB 2VWEC 3IB4A 3PIQB 3QUKB 1RZIB 3V52L 4RWHA 4QO1A 2YPLA 3O6LL 3TF7C 1MCFA 4W81A 3TWCL 1FLRH 5C6TL 3OB8A 5DEGB 4RNRB 5EUOB 2QADC 2O93L 4Z7QE 3ES6B 2EIEA 5F1SA 5FA3B 4AEFA 3AU1B 4UIKH 3WIHA 2R1XB 1LGVA 2BJMH 3KYNA 2XG4A 3C2AH 1I9JL 5CBEA 1CGWA 4PGDB 4PJXE 5F9WC 3S9DB 4MB5A 2AEQH 2XKSA 4O9HH 3UTTA 4F3FB 1XIWC 2AQ1A 4L3EB 3GBNH 5C0CB 5KVFH 2OSLA 5DA4A 2J8UA 1OAYH 4B7LA 1CLZH 3QEQD 3PWPE 2B5IC 2CDEA 2NX5D 5DQJB 3SKMB 2OR8A 3MCKA 1BFOA 3QIBD 5E2VL 3KS0J 1FNEB 5JQ6L 1QHPA 4F7TA 3EYUL 1OF2B 4G8GB 4BFBD 2EEAA 2LE9A 4NUGL 4ZQKB 1QSEA 5DD3H 4FOMA 4LVOC 5IW6A 5IB3A 1XGPB 1IE5A 3RVWC 4Q9CA 5IW3A 1W72H 1WBZB 1UVQB 5K9OB 3KLHC 2H32A 3EKCA 2ZG2A 3D48R 4PJFE 4W68A 5A2JH 2V7NA 4Q2ZB 3BP4A 4WI5A 1EHAA 1Q72H 3DRTA 1FIGL 3N1PC 4OQTH 2AXGA 2VLKA 3U4AA 2OXGA 5EC2B 3I9GL 1DBKH 1FGNH 1F4AA 4NWTL 5ICYA 4KQ4H 5BJTB 5SX5K 1T21A 4WO4D 4HKZA 1FO0H 3DGGB 3CFEA 4Y19A 5KVDH 4U6XA 4XTRC 4K71C 5DRXA 3UTPE 2GITA 1QSFD 2WBJA 3GSRB 3T8XA 3B9KC 2QQNH 4P46A 3M8OL 3CVIH 3RWGB 5E8PA 2DMCA 3GMMB 4APQD 1ZLVH 2E9JA 4G6AC 3S35X 3H7BB 4PRIB 1XCTB 4HK0A 4PB0L 2DQHH 2OL3A 1AXTH 1PKQB 1ZVSA 1FNGA 1KN2L 4LSSL 4YGVB 1EIBA 1UB5B 1IKNA 3L5JA 3HZKB 3NZ8B 1RURL 4L9LB 3DROB 5DD0L 4RRPA 1RJZA 3L7EB 1SJEA 4MLIA 4U1MA 3RWJB 1U3YA 4GS7B 4AG4L 3SGJC 1I9JH 2C1PB 5FGSA 4ODHL 5E8NA 2SEBA 5DJAB 4LF3A 1WITA 4PGEA 1QSFB 1FO0L 3ELAT 1MNUL 3HNVL 3V9FA 4YHOH 2JB5H 1RZGA 4XXDB 1J88A 4JANB 4H1LG 4S1RL 4RAUA 1CBVL 2DKUA 4Z7NE 5IHZA 1J11A 2NTFB 3BI9X 3LN4B 1IM9D 3EZ8A 2FBOJ 1CXKA 4YDVB 5FM5O 1NFIA 4BFIB 1N6VA 3B6SA 1HK6A 1D6VL 5I15L 4K7FB 3SN6N 4E5XA 3UJIL 2AJZA 1AI1L 5JO5A 3AB0C 1Z5LB 4J1UB 1T89C 4P23A 4EDWL 1EHLL 2YWYA 3QISA 4F57H 4NHUA 4YE4L 3PUCA 2XTLA 4G8GD 4MNGA 5DJ2B 3VH8B 1VADA 1T66D 5C0DA 3B9EA 4LRNH 1ZHNB 3G04B 5EO1A 2WIMA 1H9VA 2CDFA 2FX7L 1XR8A 3DURA 3QA3B 5KVFL 2MWCA 3BP5A 3ARWA 4WI6A 4O2CA 3RA7L 4LSQL 3H42H 3IDIA 3P2TA 3RTQA 4GG6A 1A1MB 4JFHD 5EBLA 1GH7A 5F7EH 4R3SA 3L5IA 4HS6A 4L9LC 2HG5A 2L7JA 4IHOA 3DMMB 3SPVB 1KNOA 4OTXL 5DRZB 2R8SL 4MCYA 1FFPB 1T1WB 4R6UA 2NY1C 5DVLA 1EK3A 1HKFA 5B39B 1OGAB 1F8TH 3LD8C 3LRGA 3WUZA 3ZL4H 1I7UA 2Z35A 2PR4L 3GSQB 4MJID 2G60L 2CH8A 1I8MA 3TFKA 2NY6B 1BGXH 4OIBA 1X5GA 2YSSA 4YQXL 1A1OA 5DC0A 2BP3A 4ELME 4ZFGH 5HJ3B 3LRSB 4TUJB 5DYOB 3IXAB 3O3EB 4UOW1 3UROR 1INDL 1SEBB 5I8OL 1FGVL 1G6RA 3LQAL 1KB5A 4MQXD 4ZAKB 5LXGL 4RGMB 1I9EA 1N6QH 3MLZL 4IOFD 1GSMA 1DN2A 4PGJA 1Z9OA 3QDGA 1RU9L 4YX2L 4XPHL 3L3GB 2HYMA 3KAAA 5CSGA 4PS4L 1HOCB 5T3ZL 2P7TB 43CAA 4R2GC 4ZUSA 3BHBB 2AJVL 1L6ZA 3WV0A 5DLML 2E27L 3AXLB 4NRXB 5KAQG 2W0LA 1DLFH 5H2BA 1Q9LA 4LLMA 2W59A 4I3RH 5EPMA 5LGHL 4OZFB 3NMEA 4M7KL 4K94H 4MX7B 2M2DA 4YXKH 1A7BA 2APVA 3LN5B 1YQ2A 4PDCE 3O2VL 5HI3D 1M05A 3KLAA 4L9LA 2XN9A 4QTHB 5MP6H 5AWNL 3C9NB 4NKQB 4L5FL 3V5DB 1AHWB 3RVVC 5C09D 1CDBA 4KUZH 4H1LB 4LFHG 1S9YA 1ZA6B 3SDDD 3B3IA 2DJSA 1Q9WB 2G2RB 4WCYH 1MJJA 4XC3L 5DGQA 1Z0NA 5FM4A 4J3XA 2VDQL 2AJ3A 3ARPA 3SGDI 1JZ2A 1AI1H 1NAKH 2HTLC 3LD8B 4X7TA 3JTTA 4OLYH 1U92A 1FL6B 5KSUA 2YWZA 4K3GA 1YQVL 1VB9A 4PIRF 3BXNB 4CGTA 3KPRE 2AK4B 2QHLA 4YDLB 4NNYA 2VN4A 1A6WL 4X9BA 4MAYA 1YNLL 4G6FD 5EC1B 3LOWA 5SWSE 5FDWA 5EZIH 3LQZB 3MRQA 1A9BA 1J1OH 2AKRB 3H0TB 2AEWA 3L95A 5SV3A 5EU5B 1V7NL 1IC7L 3QFJD 1AO7B 4KTYA 1VGEH 3ZZ1A 4F7PB 5C07B 2A6IA 1NGXA 5K9OA 4NHCL 3NTCL 3VFMB 5GSRA 1UB6B 1TENA 1XGPA 3D25A 5IOPB 5C9JB 3O41A 3O6ML 3R4DA 1KCUL 3EDEA 1L7TH 4KK9D 1FNEA 4QRRB 4BZ1L 1RSFA 5FO7B 1U93A 5ISZE 1HIMH 2I60H 1YEJH 3O9WC 4B7IA 1KYOJ 1V5JA 5C0CD 4HXAH 3V4PL 1DR9A 1RZKC 1QPPA 3ZT6A 2JJUA 2AP2A 1CDGA 1ACYH 5D2NC 3LKPB 1RIHL 5F7EL 3BDYH 5C0BB 4W6YB 3CMOH 3IS1X 2OJZL 1FNHA 5FO9B 3PWUA 2WY3A 4Y0GA 4YIQB 4HIHA 3ULVH 1U0QA 3K4AA 3ULUL 4PJ7A 4DVRL 1NEZA 5T33H 4L29A 1FSKC 3QUZB 1DLHB 2FZ3B 1FFRA 3MV9A 3GMRA 2A9NL 1FZJA 4PGCB 4CJ1A 3RAJH 4D9RE 1W72B 4WU5A 3HG1E 2QHRH 4OQTL 4FQPA 4LLQA 3C8DA 4MS8D 4IJ3C 4F80A 1XIWA 5IMLB 1QSFE 3WJJC 2H9GB 4GAJL 3UBXB 2VKWA 4JQVC 4YFLF 4IRSB 1H5BA 3BRFA 3U1SL 2CIIB 4KTDL 1XGTA 3VW3L 3TYFB 1QBLH 1XGTB 3H9SA 4NO0A 1MJJB 3OXRB 4K23H 1EDQA 2HFGL 4PRNB 4ZUTA 4J3VA 1D9KA 3T0EE 2V5MA 2H9GA 1OTTC 2WBKA 5CZKA 2D7TL 3V5DA 3THML 3IS0X 4RBPH 2DYPA 1C5BL 3DTXB 3TF7A 4MA7L 4Q0XL 1INQB 4GRWH 4JN2B 4LSTL 4UV7L 1AIFB 3GSXB 3QNZA 3UZEA 2AEIT 4L1DA 3KPTA 1MELA 5IBTH 1FFQA 5F7MC 1H3PH 1SYVA 4MNGE 4MB3A 2R0ZL 4YR6B 3MACL 4OCNC 3OF6D 4BH8B 3UTOA 1QLRA 1U8MA 2DQFA 2XWBB 3S34H 5CCKH 2EDEA 4XGZB 4D0DB 1KOAA 2Q8BH 5HYJD 3C5JB 3G08B 2OI9C 4MD0A 2WLYA 4G6JH 1CFTA 5EBMA 4RZCB 3GSUB 4HFUL 5J06A 3U7YL 5CD5C 1JV5A 1BOYA 1TVDA 3JV4A 1HDMA 4JCMA 3HMXA 5F8QC 1S5HB 1XH3A 1YPZB 2C1OA 3FT3B 5C07A 3WJLA 3JTSB 1G9NL 1LQSR 3CDYA 4KJPD 1K3ZA 3O4OC 3MMEB 5BVJB 4Q6YA 2DAVA 4G9FE 1DQLL 2ZUQB 3HUJF 5J11C 2N7BA 1MFEH 3SCMA 4KK5D 2A6KA 3WHXA 1JPGB 2XTJE 1TJHH 4MQSB 3HG1A 1I4FB 2AABH 2Q8AL 3O8XD 3WMSA 2YUVA 4JZOA 1B0GA 4JO4L 5GRVL 5HPMA 3QUXC 1LE5A 4JM2D 1U8IB 3RBGA 1G9ML 3GSNA 4NNYB 5E4EC 3T4AA 1KEMH 3O6KH 3VFNB 2QTEA 3DJ9A 3ZTNL 3C6SB 5LQBL 3SGJA 4NIKB 4PRBA 3MXVL 1WEJL 2DWEA 3VXPA 4HWBH 1KPRA 2XZAL 5D6CB 2R2CA 3ZT5A 3F7QA 1LEGA 4XCEB 2F19H 3QDME 1IKNC 4WU7A 2JIXA 4CNIA 4PB0H 4PY7B 3QDJD 4OBSA 3WXVL 1WZKA 5D71L 3SY0B 4TPRH 1WT5C 4BFIA 3WCYA 2DLTA 3MRPB 3DXAE 4TVPL 4Z7UF 1R3HB 3W11D 1JNNH 1GGUA 2EDQA 3TZVB 4Z7VE 4P3DB 3QQ3A 3TV3H 4N1EA 3PQYE 4PY8I 4WY7L 2YPLE 1NBZA 3QXDB 4TVSa 8FABB 5T1MB 4EN3D 4ZFFB 1YMME 4MZ3A 3BHBA 4CRPA 5D1XB 2LAAA 2BVQA 2SEBB 1JK8B 4ZUVA 5CZVH 4AEIH 3LS5L 3UO1L 3DV4B 3IJHA 4NGHL 3K2UH 2WUBL 4XAWL 4GMTH 3W9DB 2GTWA 5F9JB 5E2JA 3V6BR 4K7PY 4EI5D 5EC1A 1PBYA 3FAXA 1D5MA 5TPWL 4TVPE 3VFGL 5I17A 3K46A 1AO7E 4LSUL 5CP3H 5DT1H 2V7HB 4LIQE 1J9CT 4TOYL 4FQQA 1X5HA 4PTTA 1PG7W 3GI8H 4QOKA 1P7QA 4TVPD 5J0BA 5A2LH 1BF8A 4GS7C 4HH8A 4LHJB 3SDXA 1U92B 2NMSA 4G9FA 2AW2A 4JO2L 1T0PB 4NQCE 1KYOK 1Z9LA 2IPTL 4O51B 2ZP0T 3BMVA 1G9EA 2IQ9H 3DHMA 4XHJC 5FYLD 4WUUD 5DK2A 1KCGC 4NCC2 1NFDE 4NP4H 4GG8B 1H3XA 4CMHC 4IIQA 3R1GL 4P4KC 1NLDL 4RGNB 5FCSH 5GGSA 5DRWA 3EYQC 4K2UL 2XZAH 4HWBL 2VERN 4NN6C 3CLFH 2GCYA 4PG9A 4LP5A 4R3SB 5I1CL 4R0LB 4Y19B 5I1AA 1VKXB 1Q8MA 4NQSB 2BVEA 1FPTL 4LNRA 3U4EA 4N5UA 3O11B 5ITFA 2IMNA 4PJGF 4RMUA 2FR4B 4MJ5A 2NYYC 1JGEB 2CDFB 2AEQL 3BPOC 2FO4B 4PRHD 2DM7A 4L4TD 5FO8B 2FO4A 5EO9A 5I8KL 1RIUL 4YZFF 3ZHKA 5DDHA 1A0QL 1FH5H 3D5OF 3DOSA 5TDNA 1F2XK 4Q2ZA 5AD0A 3DMMD 1ZVYA 3G6DL 4C56D 4DVBB 2P7TA 4JFZH 4QWWD 4F7MA 3CK0H 3LZFH 1C5BH 4RQQA 3ARDD 3IDYB 1FRGH 4FG6D 3L6FA 2J8UF 4XNYH 1QA9A 1J1PH 5SX4H 1FV1A 4M7JL 4P4RB 4P3WA 2LFGA 3HAEH 5E56A 5T1DH 1Z9MA 4FTVB 4F7TB 2XA8L 3QCUL 5D71H 4JLRA 4F9LC 1RMFH 4NCC1 1FYTE 1MCSA 4DKDC 2AJUH 1BFOB 4LGPB 1YMMA 4LSRL 2AV7B 1DBBL 1YPZF 2EDJA 4KAQL 5IFJA 2DS4A 4WHDA 5I75B 2V2XA 1BQHG 1JWMA 3H9SE 4M9PA 5KSAA 2QQLL 2DM3A 4KKBC 3H3PH 4P59H 1HH6A 5FDYA 4DAGH 1DQQB 3WFDH 1P53A 1K85A 1XF2A 5IV2B 3MTRA 3O6KL 4HLJA 2IG2H 3B2VH 1KJ2H 4M8QA 5F9DC 3MACH 1X5ZA 3ROLB 2CLRB 1FFOB 1NBZB 3NH7H 2B7DT 4UI2A 2NY0C 3O2DA 3FL7A 3A6CH 5EU4A 1KB9J 2DQJH 3SCMC 2B4CH 4J7RA 3MLYH 5KBNC 5J6GA 3ARGC 4OGYL 4P3CH 5IF0A 1MCJA 3ARQA 2H8PB 5E5RB 5K9KB 3BUYA 3QUYC 5ABDE 1LE9A 5EB9A 4JB9H 3O45A 3L1OH 1XGYH 4OZHB 2VL5A 4L3CA 2HLAB 4RSVA 3X13B 4I9WD 3BW9A 3U30C 1NGPH 2X1OA 4LSRH 3VXQA 2XIDA 4Y2OA 1QR1B 1MHPL 2HTLD 1JHLL 3QDMB 4XP6H 1BIIB 1U8HB 2Y6SD 3GGWB 3QJFA 4DW2H 4KY1L 4GUPA 3B6SB 1S7SB 2IPKA 3L5HA 4YC2B 5T1DL 3FMGL 4GKSA 3EDKA 3TA3A 1ND0A 3OJDA 4TN9A 3O2WL 4MVBD 4GJTB 5E1HB 2X1QA 5C0AA 2HFFB 4J8RB 2YMXH 4WV1A 3VRIB 4J2XA 5EIVA 2O5XH 3CDGA 3QUYD 4S1DC 3GUTA 1MWAL 2NY0D 3RFZC 1QLFB 5C09A 1IL1A 1DFBL 3FQXA 3BP4B 3SE8L 1V8HA 4BFGA 2N1KA 4U0QB 5DHVA 5E8NB 2X4NB 2NY4B 5EFIA 4HPYL 1T66C 4HC1L 1EUTA 5GISL 5EA0H 4LKXB 4MD5B 5LAXA 4I3SH 2I26N 4IDLA 3L5WA 3K7UA 3E6FA 5J7CC 3WSQL 4PJ5E 3D39E 1DUYA 5C0RL 1A3RL 4HPOH 5IFAH 4MDIB 2DTSA 3B9AA 3RGVC 3QEGL 4F7EA 3DX8B 4GRWB 5DO2D 2XWTB 1YECL 2DTML 5BS0A 4UINL 3CJJA 5IEHA 1DSFL 1KUMA 1MSPA 4Z7WB 2F53D 2OZ4L 4N8CL 4LMQI 5ADOH 5F21B 2DQFB 2XWBA 5KAQF 5D6DC 2OQJB 1JTPA 3G6DH 4QCIB 3VRJA 3L3KA 2AJXH 4NC1E 1WLHA 3QIBB 4GOSA 4K3HA 5T1MA 3DMMC 8FABA 4HF5H 2R1WA 2ADJA 5D6DA 4NM8H 5BJTA 4JFDB 4ZXBB 5IJKA 3ARDC 2CIKB 3MGOB 5DUMH 4QRPD 4QWWC 2X42A 5C08B 1AKJA 3UTPD 4R8WL 1XF5B 2F54D 1AIFA 1OTUC 2IANA 4XPBH 2EDTA 3EYOB 4HMCA 4EXPX 1PQZA 3BPNC 5HHOA 5T1KB 1NMCC 3SY0A 4YNYB 3ZYZA 1HH9B 5BV7B 4G8EB 2D9QB 1EH9A 3KXFE 3IFLH 1MHPH 2FO1A 4Q6IC 3V4UL 3CFKA 4G8GA 3MCLL 4APQC 4ZNEE 5J12B 1WFTA 4KXZI 1CLOL 1U8PA 3MRBA 4S1SH 1QNZL 4U4BA 4BSVA 5BRZD 4CAGA 3T0WA 3F7YA 2NZ9D 5DMKA 4NQXB 5F7KC 5E6IB 2Q3ZA 1KCVH 3QUZA 5T3XH 5BW7A 5CD3A 4DK6A 4BH7B 1AXSA 4TQEL 5HHVH 1PX3A 2IFFL 4W4OA 3BQUB 2HJLB 3MJ9A 2P49B 1AC0A 1WIOA 4UIMA 4YX2H 4NYLA 5IHLB 1IAII 2CKBB 1EFXA 4IOFC 3UBXI 4RGNE 3QHZH 5JW3H 2JCCB 3FB6B 1I1FA 5IT2L 5DMKB 1I75A 5EU6A 5FUZH 2A9MH 4P2OB 1X44A 5JR1L 4QXGL 3LMJL 3PJSB 5E00A 3HUJE 4KV5E 4I4WB 2EKSA 2ITDB 3U0TA 2JCCA 1RFDL 3FB6A 4JHWH 4GW5A 5ESQB 1T1ZB 2AS5M 3WNMA 1EFXB 5F89B 4V1DE 3BEVA 4O02H 1ZEAH 1C12B 3JWNC 2HP4A 5D96C 1MQ8A 1EEZA 3F6IA 3KJ4B 1M1SA 2IANE 3C5SA 2EECA 3U0PB 3OAZK 4F58L 5CFHA 5I1LA 2XTJB 5GJSL 2KPNA 4NQUA 3A67H 1KTDA 2EH8H 5K59E 5E9DD 1JHTA 1LD9B 2ZZUT 3BKML 3M17B 3QIUC 5E6IC 2VAAB 1TVHA 32C2A 4O2EB 1FNAA 2WW8A 1D6EA 5INDB 4OZFH 1F4WL 4UTBH 2FWOA 1P4LA 3OJVC 2VAJA 3CFKB 4UB0H 3QWOA 3PV6B 3EGSB 1HQ4A 3X3FL 5FYLL 4D94A 3FOMB 1ZSDB 3VGGA 2YXFA 3MUHL 4MXWH 1YC8A 4NN5B 1JYNA 3PGFH 4KJPC 4H1LA 1JGDA 4HUMB 2N4IA 3RUGE 1DUYB 2C3HA 3U46B 1W72A 3CFCL 4WU5B 5IB4A 4Z7WF 1RZJC 3KYMA 4CUCA 2HVKA 3E6FB 3MUGA 4LCWA 4L8DA 4JHAH 5I19H 4Y4HB 2OP4H 3AXLA 4S0UC 4OCSH 5CZVL 2ICEA 4YO0B 4Q6IB 2HWZL 1UXWB 1HOCA 2QSVA 3ARFB 3L3IA 5BS0B 5AZ2H 5CD3B 4QRPB 2FD6H 4XVSL 2X4UB 2O5ZH 4IRSC 2KKQA 3CAFA 4IRJD 1A3LH 2NLJB 4N9OB 1I1AD 3WHE0 4UTAH 2HTKC 2L7UA 5C09E 5E95B 3BKYL 2AVGA 2LVCA 3LKNB 4G6AD 4A6YA 2BVTA 2M8XA 1UEMA 1UGNA 2EIZB 2VDOL 2PN5A 2VLRB 3FB8B 4BZ1H 3MLYL 4KTDH 4X8JA 3SO5A 1A14L 3AY4C 3VXTA 3D39B 1YYMH 1HYSC 1Y6KR 3GBNL 2BNRA 1PQZB 3HNTH 3FQXB 4JFED 4PJIF 2AJYL 5J6GB 4KUCD 5D7LD 5KZCB 3WIFB 3X12A 1IT9H 1CQYA 1LWRA 4IS6A 4MHHG 1P4BL 4XZUA 5FDWB 4X6DA 1J0YA 1KPVA 3H9HA 4YHKL 1KELL 3O2DH 2OLDA 1FC1A 3CVHA 2W0KA 1TVBB 1FBIL 3KLHD 1E4WH 2AEPH 2OQJA 3GMNA 2PYFB 4CVZA 2BC4B 3EO1B 1HZHL 4EJ1C 3HE7C 5DFVD 4EIZC 6FABH 1D5BA 3OKDB 4M9OA 3S7GA 2VMFA 2NY0B 3MUJA 4NQVB 3WFEH 4AM0B 2MSPA 4HH9B 2CUHA 5EZLA 3VXMD 3ARGA 1XF3A 2IBZY 4M6NH 3OB0K 4U1JB 5D5MB 2F5AH 5HHPA 2EDBA 2VXSH 4OLEA 5FUCE 3QFDA 2FIKA 5FXCH 1DN0A 4KJYA 1WWBX 7FABH 2AJZB 5JO5B 3HZYB 5CKGA 5HHQB 1NUGA 1XGUA 5EOQL 2NY3C 1P4IH 3M07A 4F7CB 3UJJH 4ISVB 1ZHLB 3LRHA 3MBEC 3BVNB 4CBPA 3OKOA 5IBUG 4RMQA 1GRWA 4D9LL 2B1AL 4L8SA 3RI5F 4TNVF 3L6FB 1DQML 4GW1B 4E0RB 4LGRB 1T22B 1TTFA 4LCUB 5E4IA 5M95B 3CUPB 5TJWK 5E08L 1WK0A 3CUPA 3VXUA 4LF3B 1S7UA 1HXMB 4M62L 3L3GA 2NXYC 1MREH 1NLBL 5K9JL 1QSVA 3C60C 2BJML 4KHXH 4ENEC 3E8UL 4PRAB 2OTWB 3QT2A 1A6VL 4NN6B 3QB7C 2PO6C 4S1DD 3SO3C 5IMMA 4MCZA 5C0GB 1JI2A 5IFHH 1N3NA 4MA7H 3E2HC 2EDDA 4HJJH 4FTVA 4LQFL 3MJ7A 4QRQA 1N6QL 3BPOB 1J8HB 2WNGA 3BZFB 4XH2B 3NGBC 3ZDYF 3X13A 1WCBB 2VDNL 4JVWA 3GSQA 5D5MA 4U1JA 2LABA 4MDJB 4RX4A 3ILPB 4PJXF 1KLGA 1MI5D 2NX5A 5IK3B 5IB1A 1J8HA 3QHFL 1JPFA 2DLFH 1QYGL 3SDDC 1FCCA 5DZNA 5DVNA 2JCCE 3UDWA 5EO9B 5F44A 5SWQB 4MYWB 4RWYH 5IMMB 3T04D 3GRWL 3MJGX 1IEAB 3L5XH 1JWUA 3GSWB 1U58A 4Z76B 1A6WH 3BZEB 5D1ZB 4U1SA 5C0DB 4D0BA 1ORQB 1QQDB 2OR9H 2HJKB 3Q3GB 4OCXL 1NCBL 4YUEL 2FHCA 5INCB 2X09A 2FH8A 1NEZG 5DK2B 3LKRA 5ILTH 4WGVB 1UKTA 3NA4A 3UYOD 3QIUD 3V52H 4UZGA 1EO8L 1QEWB 5HYEA 2R4RL 3FO9A 4Y19D 1SVCP 4R4NC 1VEMA 3SDXF 4EBQH 2ERJB 4KUZL 2VLLB 1U8NB 1IM9B 2IGFL 2J7LA 4QOKE 5KSBF 4PTTB 3PHOA 1X5JA 3MJ9L 4FZEH 2MQCA 3CU1A 3KPSA 2Z4QB 1KCUH 2D31B 5HD8D 3GBLA 2R56H 5HVHC 1UZ6E 1G1CA 2FIKB 3P0VH 4HJJL 5IHZB 3LV3A 4WUUB 1Z6JT 4JKMA 4APQA 4FFZH 3L3DA 3D9AL 4BSJA 3ARGB 4P2QB 5D7LB 4U1NA 4PRPA 3CDCA 1RD6A 1I3RA 1OHQA 3O3DB 1CXIA 3WS6A 4Y4HA 3W5NA 4MJIA 1SJEB 5HGDA 4RDQG 4U31A 5J1AA 1BFVL 3WS6C 1H3VA 1G9NH 2YD1A 1BAFH 2P8PB 4PY7A 1FNGB 1W0WB 4XMLL 1FL3B 1GIGL 1G7IB 1KXVC 2PCPA 4H8WC 4KK6D 5JW4R 1ETZB 5JNYA 4IEFB 5HYQA 3FO0H 2FEEL 5IIEA 2WWKO 2XA3A 1UQSB 3LHPL 3C5ZB 1KN4L 2XZQH 4HH9A 4WFFD 3ARFD 2MKWA 1LO2L 3OX8B 4JZJB 1NCWH 3MLWH 4XMKH 3V5KA 2AJSL 4UQ3A 4OGZA 2R0KL 3DGGA 3I6LE 4M1CC 4WV1C 3B4NA 4OGAD 1SY6A 1XCQB 1FNLA 2CLVA 3MUY1 1E28A 5IESH 3NFPA 5L9DH 1PZ5B 1T4KB 3ARBB 4C56A 2IBBA 4FQCL 4ZUVB 3V0VB 5HYSB 4EIGB 3GHEL 2XKUA 4PREA 2YD8A 4X6BB 5FHBL 4PP8C 4HUUA 3FMGH 1F45A 3OGCA 4ZO8A 4GSDH 3KNBB 5TDOA 2WMPA 3VXTB 3BEVB 4KJWD 1NC2D 1XFPA 4OFDA 3S5LG 4UDTA 1NQBA 5JA8B 1XZ0B 2PW1A 2F9BT 3MUGB 1CFNB 1NGZB 5KJRH 1Q94B 3DVNA 1JL8A 3FFCE 4YLQT 3GSVB 5FA4A 2YBRA 2IGFH 4YWGL 3RWCB 1C5CH 4OLWH 2ITDA 1F3JA 3W2DH 4HBQA 2P5EE 1J0HA 3OR6B 2EE6A 4WU7B 3U1SH 1D5XA 1ZLSL 4PJEE 4UNVA 5E9DB 3F7PC 2M1KA 2GSGB 3MRKB 3QXTA 4YQXH 2BNQE 4XCCL 1N0XH 3TFKD 3D2UD 3U0WL 2VZ3A 1E4KA 3EYQD 3V6FA 4GFTB 3EGSA 2ICWI 3NIFE 3VFWB 1T03H 4U0RC 4JFQB 2K9UA 4GLRH 5GQBA 1U8LA 2VAAA 1ZGLB 4M3JA 5IBUB 2C3VB 2DQDL 4MD4B 3TBYB 3MV11 4S1QH 2HVKB 5D72H 1UENA 4MXQD 2HJFB 4FFVC 5E6IA 1FVDA 4LK4A 3U46A 3ULVE 1Y18B 1CGYA 4JFPB 3F12B 3TVMA 4NRZB 2R2HB 1A21A 3MRBB 1JZ4A 2WV3A 3GIZL 1ADQL 1QFWI 1MFCL 1UCBH 5F9OL 4XWGL 4I13B 1J86A 1JRHL 3T0EA 3MRDB 4RMVA 1ZT1B 2XA8H 2IQ9L 1LO0H 3W2DL 3DX6B 4KK5C 2EEBA 1G1YA 1QG3A 1G7LB 3MLUL 2VYRE 1F6LL 5F7LB 4P9MH 5HI5D 1DBBH 2F8XC 2EXWC 3K81A 1D5XB 5D1QD 2AK1L 2VLJE 4JQXC 1L6XA 4Z95H 3WO4C 5I9QC 4AZ8A 1HHKA 5E2VH 3TPKA 3V7MA 1PZUB 1O7SA 3M17A 3O41B 3VWKA 3PJSA 3EIFA 3LKQA 2VLJD 3ILQC 3W0WD 1RPQA 1GYAA 2D7NA 5I71B 1P7KA 3IFOB 5GSVB 2Z92A 1EX0A 4Y4FD 2A6IB 4KMLB 4BH8A 4HUUB 2HVJB 5EOCH 2AI0H 4HHAB 5ERWB 1X4XA 3AAZB 4P4KB 3HG1D 1JZ6A 5CMAA 1FO0B 5FFLA 1IAMA 4QYOB 1Z2KA 1ZLVK 3NZHL 2W9LA 1MCOH 2VDMH 1JNHB 2HJLA 4PRPE 3AGVA 1L8JA 1LP9B 1BFSA 4NSKB 4OFYD 1AXSB 3C08H 2NY2B 4NCDA 4KVCL 3P0GB 2Q7NA 1PW3A 3GSNH 3OAUH 4PTUB 25C8L 4F7EB 1RURH 1KJ2B 1JYWA 2QR0A 3QNXA 5MERA 3DHJA 1QSZA 3QUZC 3G5YA 4MDIA 2PYEA 4HJ0C 2Z31C 4WHTA 3S5LA 4DKFH 5D7KD 3TCXA 4PJCF 4L4VB 3QBTB 4POUB 4PRDB 4WW2A 1OP3H 1E4KC 2AJ3B 4JY4B 4FQ2L 1KIPA 4F7PA 1ETZA 2A9ML 3HE6B 2LVEA 2GK0B 4JO2H 4M7JH 1C5DA 4N5EC 4G8IB 5GGUB 1UJ3C 5I74C 1U6AL 3QUMH 4R4BB 5IMLA 4HUVA 2AKRA 3H0TA 5CEZL 3RVTD 2HT3D 5HHOB 3MV9B 3A6BL 2FB4H 3BQUA 2AI0L 3GUTB 2ZUYA 5HHNB 2FX8H 5E5UB 1A7RH 1NSNH 1R3KB 3UMTA 3T4YB 2CIKA 3RIAK 5C2BL 2H3NA 1JZ7A 4JFQA 3TT3H 3SEPA 3O4LB 3VXNA 1WBYA 3MQIA 4TQEH 4U1NB 1O5DT 3TN0C 4Z7UB 3LKPA 2R0WL 4P57A 1EGJH 3CFJB 1AY1L 4OCYL 1BX2B 4WJ5B 3KXFA 5DJDA 2VL5B 5A3ID 5FO7A 3GMPA 5IBLD 3CVHL 1R5VB 3PHOB 1RZFL 4LFHD 2R4SL 4WIQA 4KVCH 2VZVA 2IPTH 4G9FD 1M6OA 1PSKH 4YBHA 1PYWA 5FYKD 4RAVA 3SGKA 1IAKB 5ID0B 1BP3B 4FQXA 4OQ1A 3QIWC 1X5KA 2Z35B 3MCG1 8CGTA 2OK0H 3MRJA 4V1DA 2VISA 3ROLA 3U30B 4FXGB 1Q9KA 1OGTB 2G9HB 5GGVY 2WUCH 1DANU 5F1IB 1JN6A 1MOEA 1UM6L 3ARBA 5DFWH 4TSBH 4TSAH 2GEEA 4M93C 3ET9F 4ZXBC 5DJZB 2PYEE 2E9BA 1XCQA 2VLKD 1OW0A 1VACA 2VLMD 3FB7B 1HCFX 3WLWC 3IFNL 3KPNB 5KSAB 1ZKAA 2C26A 4NRYA 1EAPB 4K8RD 1HNFA 3P9MA 3MOBL 4F2MB 1B9ZA 2KH2B 3MLRH 4HUNB 2FJHA 1YMMB 2JE8A 4X7TB 3G5XA 3FRPG 4TVPH 5I71C 15C8H 3QNYA 4GKZB 2BRRH 5GGRB 2DM4A 1A14H 2JJTC 3RDTD 2DQTL 4PJ8D 1T7VA 1MWAB 2X9YA 1D6VH 4LLWB 4C55A 1KCRH 5JHDD 2UWEE 2AK1H 4K3DH 4WI7A 1WWCA 3QHTC 3SJVA 3W39A 3P9LB 3ESUF 2E7LA 3RWHB 4AEHL 3OV6A 5DI8A 1V05A 3QRGL 3WSQH 4NZTL 5FIEA 1RQ5A 3VGAC 3C9NA 3MV8E 4MCZB 5E99H 1A1MA 2MNUA 1CDIA 1QLFA 3W9EA 4PJEA 5IB5A 4LNVA 4DZ8B 3MLSH 3WEXB 4MX7A 5ADPH 3AS0A 3GMLA 4JR9L 3LQAC 4Z6AT 3ULUH 4KRMB 4LEXH 2VXVH 3GSOA 1TZGL 4ODTH 3NCJL 1J1XL 5E2TL 5LG1A 3DYPA 4HS8H 3TT1L 4MNGB 1QFPA 5DJ2A 4JGJA 4OZGA 5ENWA 3WE6A 5DJCB 4WTZG 2OP4L 3MRMB 3CCHB 5DI8B 2ZOLB 1LEKA 5LJYH 4X98B 3BPCB 4W6WB 2KBGA 1VFAA 5AZEH 4RFNC 4WTWA 4KKLD 1Z5LA 3VXQB 1HILA 4M5ZL 1T1XB 3PHQA 4DFHA 4NFDA 4WUUE 4ODXA 4ZAKA 4G42A 3MNVB 2DQEH 3VW3H 1U3HA 1ZHLA 4YWGH 3O45B 3OR7A 5KTEL 2GKIA 2BHUA 3LRSA 1AD9B 4WI3A 1EEQA 1FSKB 3VFUA 1O7VA 4A2LA 2A77H 1Z3GH 2W9EH 3MNVA 4PRHB 1S9XA 3JUZA 4U6YB 4DGVH 2GTWB 1INEH 1MCRA 5AYUL 4UAOB 3NIFF 5E94B 3VXMB 2ADFH 4CVZB 4NDMB 1V7MH 2K7QA 5DRXB 5IP4A 1TPXB 4NO3B 2AJYH 1IQWL 5E9DE 1CXLA 4Z7VB 1TITA 5KSVA 2QSTA 3I75B 5D7IE 1NPUA 2HT3C 4NM4H 5FYJE 1K2DA 4TNVK 1W72L 5EU7C 1A6PA 4XBPB 4QTIL 4TULL 2A83B 1JPFB 2J5LC 1NAKL 2E3VA 4XC1L 4R0LA 2EC8A 4JRYA 1KJVA 2A6DA 2BOBB 2NY3B 3DUUA 4MDJA 1KBGH 4NHUB 5KSAD 2D7TH 1T5WA 1AE6L 2P8MB 1P69B 3S36L 2VLRA 2ZUWA 3WD5L 2MPAL 3SQOH 2YR3A 1J05B 1YZZA 3TBWA 1T83C 4O2FB 1S9KC 4LDLB 5GS1C 3FO1B 5CJQL 1QFWL 1A6AB 3ARVA 3KPOB 4QXGH 4NQDD 3P9MB 1KFAL 5FOJA 4YHNA 1S7QA 2D7MA 3O8XC 1DBAL 2VDRL 4FQQB 2BSSB 5J57B 1RAMA 3WS3B 1WQVT 4QRPA 5KSVB 3CXDL 1W0VB 4PLKD 3FONB 5BZDB 1B4JL 4TYUA 4Y16C 1LO3H 4G7YH 3QP3A 3ULVC 5I30L 2H6PB 2E8ZA 1T22A 1YUHB 2A1WL 1FE8H 4M7ZC 1MCNA 4O4YH 5DRWB 4GRWF 2XQBH 4LASH 4UV4L 1WICA 5HHVL 1JYXA 4I5BA 1DQDH 1RUMH 3L7EA 2DTMH 4V2CB 1YEHH 4YJZL 1BWMA 5D8JL 1NCTA 2ZCHL 5FYJU 1L7IH 3DI3B 1A7PH 4XRCA 3QEUA 1KENL 5HHXL 4DUXA 1AGCB 5GIRA 3RHWF 1QKZH 4FN0A 2E7HA 5JLZA 5E2UH 2R2EB 5F3BB 4GKOA 4OM0H 2J1KA 5IMKB 3UYRH 1N64H 2MKLC 4MS8A 1BQSA 5HGBB 3RL1A 3LS4L 3T1FA 4UTBL 1E4XI 5HHPB 5EBMB 3ARRA 5E2WH 3V4UH 4CMMB 4L3EA 3QDAA 3KXFB 1BBJA 1D5IH 3TO4C 3S8WA 1S5IH 4U1IB 4JO3L 1KPRB 4HPYH 3PDGA 4NBXB 3QXUA 1VFAB 4AT6A 4X6CB 1FYHB 1NKRA 4RCAA 1GCFA 4POZD 4YR6A 1BOGA 2Z8VC 4UT7L 1MH5B 4OGAC 3ZKNC 4NQEA 3SDAD 1BJ8A 3QFJA 5A16B 4JPIA 2ADFL 4PJXB 2X1XR 3UEZA 1HEZB 2AXGB 4UMGA 3O2WH 4I0KA 4OD3L 4U6HA 3UZVB 2V2TB 5JORB 3CGTA 5L8LB 4XPHH 3OKNA 3I02A 1RFDH 2A6KB 1JHLH 1F6FB 1ZTXL 2GK0A 2NY2D 1C16B 2VQTA 5DHYB 4YDKL 4HLZG 4R96A 3DX6A 1IGYB 4KJQD 4PJIE 4YFEA 1REIA 4OGXL 2UZXB 5HYJA 2D2OA 1TIUA 4NFCA 2ZUSA 4M48H 3UBXA 3WJLC 2DMKA 5TE4H 3PL6D 1P1ZA 1EHNA 1V3KA 1CIDA 5MERB 1SVZA 4JFPA 5AYQA 3KPRD 3T0VA 4Y4FB 3IDNA 2RFXB 1G0DA 2DOCA 3CSPA 4MD0B 4WWID 2PO6D 4I8DA 1U8KB 4L29B 1AKJD 4YUEH 4QXTB 1JNHA 5GISH 4K7PH 4XGZA 3UC0H 2XTJC 4DGIH 4OCRH 3PWVA 4JRYE 3H6JA 1NGQL 4M7LH 2ZOKB 2UYLB 4ORZC 4PJDB 4GAYA 4L8DB 2O26U 3QQ9C 1TLKA 5ESVA 4MNHA 1OTSC 2IAMB 3FRUA 3QRGH 2RFXA 5IGXL 1BD2B 2X9XA 4FQXB 1G6RH 2VDPH 4KI5E 4IM8A 5E9DA 2P47B 4PY8J 4U1LB 1CFVL 5LBSH 1OAXH 2ZUXA 3T0BA 3OJMB 3PABA 5CJQH 4YHYC 1YY8A 4XAKE 4KZDH 4ZNEA 3BH9A 2QQKH 3QZWB 2WSKA 4D0CB 3F7VB 5JHDE 3DO3A 1HQ4B 3BD5A 3RVXC 4JFOB 4AK1A 1P4LB 2R29L 3CFJA 1F8TL 1NBYB 1QP1A 4NM8L 3RVWD 4KMQA 4IRZL 3L3HB 4ZO9A 5C0BD 3T0XA 3F12A 3JV5A 5DMYA 3GMRB 1NLBH 1P2CB 3HZMB 3W82A 4FFEX 2DQCL 1X6NA 2NW3B 2BVPB 3SOBH 2RJMA 3LH2L 4UNTA 3JWOH 1U8LB 3NABH 5L0QC 2D03L 4QRPE 3L3KB 2Y07H 2IFGA 3VRJB 3DARA 5ESAA 1YECH 5TH2B 4HIJB 5GGQH 5ADPL 4QF1B 4XNQB 3TO4B 2OMNA 1JWSB 2XICA 4JY5H 1RHFA 1HHIA 3EJZC 4JPWH 5CHNB 3LKSB 1WT5A 3VWJA 1XGYL 4WUKL 5DC9B 4PRDA 3VFVA 3RVXD 4EDWH 4IDJH 3KDMA 3R0MA 4L8SC 3T65B 1FL3A 5EH1A 5EU6B 3T2NH 4DFIA 1HHJA 2P5EA 4XX1G 4KKAC 1T7YA 3V8OA 1V3JA 1IGIL 2FATH 1DLHA 2FZ3A 4NC2B 4PP2A 9CGTA 1JF1B 2HH0H 4Q97A 3P4MB 1GOHA 1DL7H 1IAIH 4LCYB 4QRTB 4TSAL 3MGTB 3VFMA 4X6CE 4NT6A 3TT1H 1AGBB 4MA3A 3VMNA 5KVGL 5BV7H 3VD4A 2CJUH 2IH1B 5HDOA 2CDGA 1AO7A 5TE6L 5AAMA 1LHZA 4BKLA 2FLBT 1Q72L 1TJGH 4PREB 1OL0A 3F62A 4NKDA 3QO0B 4FFYH 4YHKH 3CFDA 3C5ZD 5A2IH 3QI9C 5EIIB 5I1IH 2AGJH 3L9RB 1P7KB 2QQLH 3IFOA 3LQZA 1MHHA 3FCTA 3GB7B 1AJ7L 1DL7L 4AH2B 4KAQH 4YPGA 2AV1A 4X5WA 2VXQL 1G6RB 1NGPL 43C9A 1OAZH 1MF2L 3SKUD 1F4HA 4FQXD 4JZNB 2HRPL 1BD2D 5IWLA 3DRQA 4J6RL 1N4XL 3HC3H 1OSZA 5DFVC 3OAUL 4YNYA 2APBA 2UUDK 4GRLB 1GGCH 3UTSB 2A6DB 5MEQA 2NYYD 2ZPKH 5GRUH 5A43C 4M43L 3B3IB 5TF1H 4XBGB 3HAEB 3SDXE 3X3FH 1XF5A 4HBCL 1EEYB 1S7TB 4YFDB 1U8OB 4F33B 1A7RL 2JELH 5F7DA 3ROOA 1FVDB 1MUJB 2HKFL 4X7FC 2OR7A 5I1JH 1CVRA 3IF1B 5T5FH 2IJ0C 3Q6FA 2H26B 2APXA 2E5EA 1XMWA 1HHHA 5I66B 4PJDF 1IBGH 2BCKA 3FO2B 5EUOE 2C7UB 3FOLA 2IBZX 4GKNB 4GAFB 4EN3A 3LEVH 2X4RA 2XFXB 5FM8A 1FL6A 1MJ8L 5TE4L 1KPUB 5JHDA 3VXSE 4K3JH 3MV8A 5D9SB 3HS0A 1ITCA 2ZJSL 3MBED 5J9PB 4HGWB 1RZFH 3IDGA 5CZXD 2GSGA 3MRKA 3U82B 2NXZB 4Q74A 3IDUA 3LMJH 3QDHA 3MJ7B 4QRQB 1AP2B 5C3TA 2YZ8A 5J6HA 1HN1A 2P5WB 2V5RA 2AXHA 3C6LD 3GSNL 4U2YA 4PJHF 3IVKA 4JVUA 1A6ZB 2YBRB 1PFCA 3PP4L 2H41A 5I9QB 2OTUA 3TYGL 4H26B 2VQUA 4NO2A 3VFGH 1HYRC 4MD5A 1YMHA 2DMBA 4FZ8L 3MJ8A 4XXDA 4TSBL 3ZE2F 1MCHA 4HT1H 1FZOA 4EN3C 4YXKL 4DCQB 2DLIA 3V0WL 2IFFH 5AD0B 3TPUE 5DRZA 4DCQA 2XFXA 3LB6D 3I6LD 3TT3L 1WV7T 1IC5H 5HPOA 2FCBA 1FLTX 1DEEA 3MRFA 3FT2B 4MZ2A 5DD5H 4EUPH 5GXBB 4PUBH 4RFOL 2IMMA 3QIUA 4G7VL 2DDQL 2MFNA 3O3EA 4RGOL 3HCVA 3PWPD 1VHPA 1VADB 1SJVA 3P9LA 4NQCD 3R0NA 1X5AA 1MJUL 1X5YA 3NN8B 4IIQB 1MFBH 4FQLH 1G7JB 1K8DB 5D9SA 2KZ1B 1OGAA 2QSCL 4XTRD 4DEPB 1MIMH 1BJMA 1KJ3L 5I76A 3SPVA 3IDYC 4MMXC 5JOPE 2B1HL 3HCVB 3QG6B 4NC1C 5DUML 1Q1JH 4YHLL 3Q2CA 3X3GL 1IRAY 1NFIB 1SY6L 3NOIA 1LO3L 4LPXA 4YDVA 4KK6C 1P84J 4BQBA 1DVFB 3VXUE 1BQHB 2CLRA 2B39A 2GAZA 2DJUA 3KYOB 4ETYA 5DWUL 4OCWL 1TCRA 5JA9A 5DQDH 1C7SA 3IETA 2YD6A 3LPFA 3ZKMD 3BFOA 5I73C 5B3JF 5ITBH 3IJHB 5BCAA 4NKDB 2W38A 1J12A 2R0KH 1VFOA 4Y5YC 2G5RA 3QXDA 4LCUA 1A4JB 4NKMB 1TZIA 3L3DB 4D9QD 1DUZB 4E41A 3E3QE 1F58H 2ZWLT 3MGTA 3FB8A 1JGVH 2V9RA 3WFHB 1HIML 5IB3B 1R3LB 2AV7A 3OKOB 2YPKB 1Y0LB 1WISA 4FXKB 2LTQB 5BS0E 5D5ME 4Z95L 1MI5E 1K4DA 3ECBB 4XAKD 1FZMA 2AV1B 2JIXB 2DI7A 4TUKL 5I1GL 3RIAF 1AD0B 3BP7A 1UCBL 4QHMA 5D6CA 5D70H 1MHHB 5F6HJ 4TUOB 2X4UA 1JTTA 4QHNB 5E8PB 4JFYA 4F7MB 2Q76B 2COQA 4Q6IA 3GHEH 4AM0A 1M7IB 2MHAA 1NDGB 4F3FA 4P46B 2VE6B 2ORBH 4JFEB 5DDHB 2ZCKL 2XKNB 4N90E 5ESAB 4CN4A 4EZMA 3W0WE 1AGBA 2Z9TA 4MA3B 3WL9A 3I50H 4XMPH 3MYJA 4KKAD 5BZWA 1JGEA 2X44D 2ZCLL 4GG6F 4BQ8A 4DGVL 2CXKA 2A74B 4YEFA 4K8RH 4KC3B 1YN7B 4KY1H 3MZGB 3UX9B 4MWFB 3X11B 5I1EL 2VXTL 4OZGE 2B4CC 2PW2A 3DIFB 2Y23A 3MODL 4WHCA 2NX5B 5IK3A 3RP1A 3SKOB 4ZNCD 4FQLL 2BZDA 2FGWH 3EYVB 4UNUA 2JJWA 1HDMB 1CFVH 4YHYB 1YEGH 2JB6A 2YRPA 2HLFD 1HSAA 2NXYB 3SDAA 4M6OL 1TVHB 4A6YB 1YPZE 1YY8B 3C8KA 3U9UB 4BZ2H 4PRAA 5FOBA 2ITCA 3ZE2E 2NXZD 4WENB 3VWKC 4XVUD 3E3QA 1H0DB 4PJ9B 5JQHC 5DLMH 5C0CA 2G5BA 3UC0L 3AAZA 4P4KA 5IVNA 1U3JA 4YDJA 2ICEB 2IAND 4RWYL 3H3PL 4P59L 5I8CB 2ARJA 2E9IA 5TQ0H 1MVUA 2NR6D 1QR4A 3NFNA 2ZSWB 5D1XC 4CDGC 3K8LA 1ODAA 1EHXA 4CVWA 3DPBA 4QY8A 2P24A 2QSCH 4D0CA 1X7QB 4ZTPL 3ZHLA 4KKBD 4Y5XA 4RNRA 5EUOA 5DUPH 3W0WB 5JOFB 1CE1L 1XR9B 2J8HA 2Y5EA 3GNML 1TZHA 5I2IB 1BPVA 2CMRH 4I0PB 3OG4B 4WFHE 3TN0B 1K5NA 4I0CC 3UTSD 4GRLD 2RQ8A 4JREC 4HKXA 3QCUH 4ZS7H 4L8CA 1RK1A 5HGAA 4RFOH 4YBQC 5D1QA 4FA8A 3TO4A 2ZOKA 4R7NA 1XIWB 3MNWB 4LHUB 2CK0H 1JZ8A 4GKNA 2R1YB 4YHZH 2PYFA 1T7ZA 2EICA 1VESA 4U6HB 1QLEL 3ULVL 3OHXA 4KKCD 3PWNB 2APWA 2ORBL 3ULUC 2C3VA 3U36B 1ERNA 3IDNB 3V79C 3G6AB 4N1CA 1NC4A 1MFDL 4OM1H 1D5ZB 4KJQC 3FFDA 4LCIH 4GG6E 1OQOA 1RUQL 3MFFA 5FF6A 1NBYA 5HGAB 4H25A 2PYED 4CU7A 4TUKH 3KPLB 1JBJA 5FAAA 2ESVA 3CXHK 4H88H 4F15C 3S37X 3OKKA 5J56B 3GIVB 3D2UB 5J1SC 1MAMH 5DVOA 4N68A 2Y25A 3CFIC 3D3VB 1T3FB 1EO8H 4XMLH 3PNWB 1A7PL 4NQDA 5JOFA 3IGAA 1E6OH 2R2BB 4EBQL 4RZCA 3VJ6A 2R2EA 5IMKA 1IAIM 1BFVH 1FN4A 2DIBA 1IM3A 4H1LH 4UDTB 3NBNA 5E1AA 5FCUL 3O0RL 4WGWB 5JPMB 2A1WH 3O3UN 3UCRA 1GAFH 4QRRE 2QQQA 5JDJA 4LIQL 2HAZA 3IFNH 4FXLA 1NC2B 5SWSD 5TPWH 1H5BC 4WEMB 1YJDL 4ETQA 4JFEE 3A6BH 3CXDH 2BSTA 5JXEA 4ZYKA 5BQ7B 5FB8B 2YXMA 1LQVA 5J3HC 2Q86B 3QFJE 4Z7OE 4FZ8H 3QH3A 4JM2F 1U8KA 3CU7A 4L4VD 2XZCL 5B3JE 1JF1A 4HT1L 4R97B 1KLUA 4LRNL 4L4JA 3BXNA 3HC3L 1XAUA 4HAGA 4YHNB 1UM5L 5GS0C 4LCCC 5JLZB 1VPOL 1MCBA 4JO3H 1A6AA 1OAZL 5AG8A 4X7SH 4M02A 4KK8D 4F57L 5IIEB 4D8PB 4UQ2B 5AAWA 3RNKB 2FNBA 3ZTJG 1UYWH 4ZOCA 4G8EA 3O2VH 1HH9A 4Z18A 5J89A 3DO7A 2GI7A 4LLQB 1OT2A 4FFWC 5TH2A 5IFHL 3HRZA 1ZHKA 1I8LC 3UYPA 1BHGA 5B8CC 5C09B 4KHXL 2BVPA 4MHHI 4PJGB 3LN5A 1RUML 3H42L 5L8JB 5F6HI 4QXWA 1KGCE 1P4BH 3MRNB 5I19L 4BSWB 4LARH 3MOAL 5GGTH 3U79A 5F7YC 2X05A 3O2DL 1HINL 4JM2C 4N1HB 3QHFH 3O6FD 3WNOA 1LMKA 5H35A 2IPKB 2YUZA 1EA9C 3MRLB 5SWZB 4P2QD 5CEZE 3QUML 5L2JA 3QQ9D 3VGFA 3TLRA 4C83B 2GJZB 4H20H 1BECA 4ZFGL 4CMMA 3EOBB 3MV7B 4LKCA 2E7LC 1TETL 2NCMA 2X70B 4G43B 4IMLB 5EOTB 1BZ9B 5SV4A 1OVZA 2EKSB 2E7CA 2BOCA 4RMTA 4GAJH 5IOPA 1MRCH 2OX5A 5B8CA 3BT2H 3DV6A 3L7FB 1N7ML 1NCNA 5GIRB 4EOWH 2YSSB 4LSVH 1C8PA 5BMFH 3R06B 5DS8A 1JPTL 4EVNA 1I3UA 5FECB 3PF2A 5ISZD 2IAMA 2A73B 1HILB 2NY6D 2BY1A 1VSCA 4MQ7B 1PAMA 5ALBL 3GMQA 3FN0H 4JPVH 2A38A 5L2KB 3L95B 2HJKA 3EYSL 2VDML 4IHOB 3UTTD 5I1KH 1DDHB 3HC0B 3TO2A 3S34L 3PWVB 4PJBB 2GY7B 3HA0A 2EO1A 1IL1B 3W11C 1KELH 4PV9B 1C1EH 4BH7A 5I73B 3MRIB 1CFQA 3DURB 4M43H 3S4SB 1W0YT 5B4MC 3E2HA 1LO5B 4R9HA 4EUPB 4QNPF 2UY7A 5DD6A 5F9WB 1MFEL 1HWGB 5C0AB 4M48L 2HMID 4RGMC 1MEXH 4XNZC 2QJDA 1N4XH 1A7NH 4HKJA 4LVNB 3MZTA 3UXFA 2VDOH 3QXAB 4IDJL 4LHQB 3TCLA 4OF8A 4GQPH 4WI8A 1ORSA 1KTRL 1J7VR 1IGYA 5FYKE 4HQQH 5CWSA 5FUZL 4W4NA 3INUH 4J1UA 5JUEH 5HTSA 5CWSB 3ZKND 2JJTA 4OFVA 2Y9RT 4XP4L 4KVNH 2ZNWA 4JFFA 4OT1L 3CLEL 1ORSB 4OI8A 5JW4M 3ARED 1A3LL 4OD3H 3EYOA 2XN9B 1H3TA 3B9VA 1H15A 2BY2A 2OTWA 3WN5A 1A7NL 3IFPA 4EI5C 1JYVA 4FQCH 5AZEL 5TE6H 4OCRL 5T3XE 3WUWA 1J1OL 1EO5A 4NRYB 3BGAA 1MFAL 4Z8FH 2QKIB 3ZKSD 5IB2A 5A16A 3SBWC 4Z5RB 4E9LA 1IAIL 1OWRM 2GCYB 5DD0H 1NCWL 3L3OB 1DDHA 3HC0A 4H0HB 3KR3H 4PJ8A 3P30L 4KQ3H 1OGTA 2G9HA 4M3KB 4Y2DB 5AG9A 3TH3T 1FAIL 2CUIA 2OJZH 4J3UA 1NJ9A 3FKUS 1WIUA 5GS0D 5DXWA 3B5GA 5DD3L 4I2XE 3O0RH 4J4PD 2WANA 1L7TL 1MLBA 5FYKL 1UB5A 2MCPH 5EZOL 2YPVL 1P5VA 4Y16D 4ZUWA 5ICZA 4B0MM 5EU7E 4ZFZB 3D0LA 2PF6A 1E6OL 4WW2F 3MXWH 5E8OB 4J3SA 5A2FA 2AERT 2DBLH 3D3VE 1L7IL 3DXAD 4XRCB 1MLBB 2J88H 4OBRA 5F3HB 1BBDH 3EOBA 2FD6L 2W65B 1A5FH 1NJ9B 3EFDH 4PRID 2CR6A 3BPCA 3P9WB 1AQKH 5L2JB 4M7KH 4X9FA 2X4SB 3RX8A 3LEYH 3LEXB 4OLXL 4GT7A 1MQKH 2UZIL 2X4NA 3GMNB 5LGKA 1TVBA 1NL0L 5DURD 3VXOB 4ZPTB 4DKEH 5FYJL 1HHHB 4BQ6A 3FONA 2EIBA 5T3ZH 4O58H 5ICYB 5MENB 3OMZA 5FO8A 2EYTB 1E4XL 3IKCB 1R3KA 2EDXA 4XZUB 4WO4B 3WYRA 2WUCL 3MRRB 3U4EB 1PYWB 4HG4K 2EDYA 3UJTH 3ZE1F 4FQ2H 1U95A 1NH6A 1DTUA 3MNZA 3QQ4A 1VGKA 1KG0B 1T1YA 2DL9A 4NUJB 2R23A 2C3WA 5GGSB 5I1DB 3MV7D 1D5IL 4Y4KC 4NZUH 5HHXH 4WW2C 2XI9A 4E5XB 3KGRA 2GYSA 5CJXC 3OZ9H 3D18A 5JTWA 1CG9A 3MNZB 3O3BA 1G6RL 1X9QA 2BOBA 2BXZA 4XC3H 2ED8A 4U3XA 3LN4A 4MXVE 3MRRA 4XBPA 4LSPH 4Y88A 1TTGA 3FQRA 5DK0A 4WWKD 4OD2B 1CFQB 3S4SA 3FN9A 4PJFB 1EV2E 4JG0H 4Z7VA 3NCEB 4F58H 1XF1A 3HLAA 4PJBF 1UWGL 3BP6A 2WIIA 4YXHL 5IQ9B 3PQYD 2UWEA 1IGJB 3VMOA 1S9WB 3E1F1 1E4XH 4MNQE 4WI2A 5C2BH 1TNMA 3RWJA 4LPWA 5L2KA 5DJXB 4ZFFA 3QQNA 4X4ME 4Y4HD 5T3XL 1YPZA 2A73A 1F3DJ 3RGVA 5T3ZE 4LVEA 4XP4H 3ZTJH 4OZFG 2V5YA 1YC7A 2P46B 3IRZA 4XP9H 3V6OA 1JV5B 5LWYL 3ZE0F 2JK5B 1DJSA 1BZ9A 3OR7B 2X70A 3BOVA 4IMLA 1FHGA 5EOTA 2IPUK 3EFFA 3KPMA 1CFTB 2NW2B 3QEGH 4NNXA 1QRNA 4N0FA 3O81A 1T1XA 2Y36H 4Z7WE 3IU4L 2W07A 4DN4L 3K80A 4I18B 4OJFH 35C8H 1N5YH 3B9DA 4X98A 2XQBL 4LASL 2WBJB 3GSRA 5C9KA 4JRXB 4S1RH 3MO1B 4G80A 3CX5K 5D7SH 1NMAH 2ENSA 1IQWH 4XB7A 5JMRA 1A2YA 3VDBA 4OZGB 4NKOB 4ONOA 3G5ZB 1NCBH 2HVJA 1UWGH 5TDNB 3RPKA 5SWSB 3CD4A 4Y5YB 2WAHA 5FKAA 3TVMB 5JDSB 4LVHB 3P4NB 1WZ1L 4I2XA 1WTGT 3OL2A 2X4TB 1INEL 5AYUH 4D9RD 3MREA 3FQNB 4M4PA 3VI4F 4DKEL 4LSQH 3C6LB 3KHOA 1YJDH 3EYFA 5C70A 5D2LA 4K8RC 1LEIB 3VXSD 2H32B 2H2PC 1H8OA 1ZE3C 2YN5A 3HRZB 4P23D 1C12A 3MNWA 4L8BA 4OZIA 3NCYP 5KS9B 5C0AE 4DZBA 1JNJA 1ZOXA 4GG8A 3FT3A 3S4SG 4LEOA 3EOAA 2BRRL 1EFXD 1TETH 4DW2L 4OLWL 2I27N 4IMKC 4NO5A 5AEAA 4HKJB 3NIDE 4HWZB 3CPLA 4G9FB 3MCKB 5CEXA 1DQDL 2J6EL 2PUQT 2YRZA 5KANI 3OR6A 5I1EH 4XHJD 3L1OL 2QBWA 5I1HL 1N5AA 4ONGL 1KLUB 3WFCL 1I8LA 1LILA 1A6UL 4QY8B 1CGTA 3B83A 4KV5F 2B4CL 4X6FA 2UYLA 3VXRE 4OFIA 2ZSWA 2G75A 5IBLC 1V7ML 4NFBA 3U48A 2APFA 1JZ3A 5C0BA 1U91A 4QXUL 2YMXL 5KVEL 3VXSB 2V5SA 3QPXH 3MLXL 4BZ2L 5E8DH 5MHSD 4WWKC 3N85L 5GSVA 2QLVB 1M4KA 4HFWB 2BY3A 3QO1B 1X4YA 1CD0A 1OP5H 2YPLB 3F7YB 2CK0L 4LRIC 4PJHE 1AGEB 5DJYA 2ITCB 3TN0D 2HN7B 3L7FA 3NPZB 4KXZH 3G6JF 1HQRA 3PL6A 4OAWB 2R2BA 3B9KB 2P5ED 1CGUA 4N0CD 2DYPB 3WIHH 1KT2B 4Y8AA 3GMPB 4AEHH 1I1AB 5EOQH 1CFNA 1MIML 4XCEA 3CVIL 1YEKL 1K4CB 3C09C 1UB6A 1IAOB 1NFDA 3LAFA 4C83A 2RIKA 1NGXB 5HYQB 4N8VA 4ZFOB 3OGCB 2BNUA 4M6NL 4P5TA 2EH7H 3B43A 4V2BA 5CKAA 2IANB 1J1PL 4JGMA 4KROB 3T3MF 3QEHA 3V0VA 5HYSA 5GGTL 4AQOA 4HS8L 1CDCA 3L3JA 3LS5H 2X5PA 4F15B 4AYFA 1PZ5A 1T4KA 1FVEB 1B4RA 2H45A 1E28B 1JVKA 2VLJA 5EBGA 4WFGD 2ADJB 5TQ0L 2DICA 2FB4L 1FH5L 5ID1B 3BPLB 2BK8A 2Q1EA 2ZCLH 4KI1A 2FSEA 3L3JB 2R1YA 4YIQA 1UZ6F 1WSST 4YDIH 5KSUB 1IT9L 3FQWA 3ZO0A 4AT6B 2ZUVA 4U1IA 5ANMA 4X7DC 1IKFL 1AHWC 2E7BA 2WP3T 7CGTA 2X4QB 5D5MF 4D8PA 4QGTA 1R6VA 4NZTH 3SGEH 1NUDA 4K2UH 2XNAB 4EOWL 2EDWA 2VR9A 4I0PA 3JV4B 4DUVA 3ZYJA 4LOUD 4GRMA 4JJ5A 2OL3L 1MRDH 1XR9A 3K2MC 1M05B 3KLAB 5C9JA 3E6HB 3T2QA 3ILQD 1GZQB 5FHAL 4I5BB 1ZANL 4XAWH 3VFTB 2GJ6D 2WUBH 3RDTA 3EW3B 5JZ7C 2K1MA 4OF0A 1NCCH 4PJ7E 1MPAH 1MVUB 5DT1L 5IKCB 1Z0MA 2RR3A 5I6XC 4ZUSB 1U3ZA 4RIRA 43CAB 4EI6B 1S3KH 4J3OC 3V6OC 4OCSL 3EOYG 4R2GB 2FBJH 1Q1JL 3S37L 1G0XA 4AL8L 1DQLH 3BN9D 3LN9A 1N0LA 3V8CA 2B2XL 4K9EL 3QUYB 1FN4B 4KKNA 5DWUH 3ALXA 3F58L 4WHYH 1HSBB 3C8KB 4HIXL 4LLAA 2AK4A 2AJUL 4GKSB 4NP4L 5I8EA 3TV3L 4MNQA 2WWMD 3IDMB 5DD1L 4ELKA 4DKFL 1MAML 4XP5H 4M5YL 3OX8A 3VDCA 4GBXB 1B6UA 5ISZA 2IALA 4NN7B 3GNMH 2QADB 1CWVA 3EYVA 3MBEA 3MFGB 1HXYB 3LKRB 4HMDA 1YJDC 1TTUA 1G7PA 1ZT1A 4XWGH 5SWZE 3BYYA 5E5MA 1ZA6A 4V1DD 2DKSA 1MJUH 4ELMF 1OCWH 1MJ8H 3RY4A 4OZ4A 2ICES 2UUDH 3CMGA 5IHUH 3FQUA 3I75A 2YK1L 2GFBA 3HE7A 2VO5A 2NZIA 1DQJB 2EDLA 2QV2A 1CDHA 4ZOAA 2DQUH 1IC4H 5HVGB 1K8IA 3OKYA 5BZWB 1ZGLA 2O61A 2ICWJ 5F97E 1Y6MR 4XPAH 5GGRY 5HVFB 3CC5A 4PJEF 3FHQA 1IC5L 3G5ZA 3I2CL 2RBLA 2JJSC 2MQ0A 3J7HA 5CBAA 2VDLL 1UM4H 1WCBA 1FNSH 1UG9A 2GSIA 4KRNA 1VFBA 3LPGA 3I6KB 2E6JA 4XB8A 5T1KD 4NQCB 3WDHA 1NCAL 1EVTC 3ECBA 1T7WA 4RFEB 3S96A 3QCTL 4RFEA 3S96B 5EZJB 3CSYB 3WLWD 3ZHDA 3LSOA 2YHGA 3GSVA 1Y6NR 1Q94A 4P9ML 4M1CD 3AREB 4NWUL 2JF1A 4N0UA 3UTQB 5GGTA 5CBAB 5SX4I 1SYSB 5E0QA 4KUCF 5JXED 5KS9E 5KN5A 1WBXB 2VSCA 3LPWA 4LVHC 1EZVX 1BFTA 1RUQH 5ACMA 1RZ8A 3DVGA 3GMOB 1KNOB 1SQ2N 4H0GA 1KEML 2VITA 3W81A 2ZSVB 5MI0B 2PNDA 4C56B 1MIEH 5CIPH 4ODSL 2AABL 2VZUA 2Q8AH 1K8IB 5D1ZA 1A9BB 5D72L 4L8SB 5CLWA 3HR5A 3WEXA 1DVFA 2VR5A 1BQHA 2O5YL 4PJFA 3BVNA 5F8RC 1VCAA 3EBAA 4ZDHA 3A0OA 3HZKA 4UUJB 3FQTA 5CP3A 4XVUC 1G7MB 2JELL 3EJZD 1EEYA 1S7TA 3WFBH 1QO3B 2OL3H 5HHQA 2K3TA 2P5WD 3CZJA 5IB1B 5CSZB 1SM3L 3QFDB 3QIWB 5GRUL 2JKXA 1MWAA 4LLWA 2YS4A 3D18B 3QEQA 4PGBA 3MBEB 1JGLL 5JNYB 4O51A 3NCMA 2HLFC 3KJ4C 5K9QG 5FK9A 5CSZA 3KWWA 5JXAL 2EXYC 5DMGC 2R23B 1OAKH 2BC4A 5DZOA 5DUPL 3QI9D 3UTSE 3HR6A 3JWOL 3NABL 4WFED 1G9MH 2RCSH 4HKZB 1YN6B 1OPGH 1KC5L 1T21B 5F7FA 3DYOA 3QIUB 2QL1A 5HDQL 4M1DL 1IGTA 3MRFB 2WK2A 1AQDB 3S36X 5EC2A 1JN6B 4CN1A 1HXMA 2ZSVA 1I3RB 4LMQE 2X2YA 3CMOL 5I75C 4NJAL 1U8JA 3DSFL 2C4XA 5DQ9A 4YPJA 2FEDC 2HT2D 1U3HC 3K8MA 4V1DB 2P8LA 4L4VE 4HWUA 1WZ1H 2WWMC 4X8JB 4JZJC 1YMHB 4APQB 3FRPA 3ARXA 3PHSA 1NGWB 3NAAH 3P4MA 4ZSOA 3RTQD 4ZQKA 4K7PX 3C87A 4X4YB 3MLUH 1KB5B 1BM3H 4HUXA 5IB4B 1I9RH 1QBLL 2J6EH 2Y72A 3SDCA 3U6RB 3IXAA 4XBEL 2VQ1B 4TUJA 1MRDL 5C0IA 3S35H 1Q0YL 4H5SA 1AP2A 2Y1VA 3QXVA 4MA8L 5DQJA 3SKMA 2L0DA 1WUNT 3VGDA 1R3LA 1ED3B 1YEKH 4Q7DA 4BZYA 3V6ZA 4WJ5A 1BX2A 4HPOL 1A3RH 2LU4A 2Y5TA 1JPST 5CIPA 3VXPB 2HRPH 1W2KT 3A6OA 2W1NA 4U1GC 3J8F7 3GJFA 3FB5B 4R90L 4X4MA 2W0PA 4JPKL 3OKDA 1JWSA 1S7RA 3CX2A 4LLUA 1ADQA 4Y4FC 2GJJA 2DQCH 1YNKH 3BMWA 1FDLH 3EO1A 5GJSH 4J23A 2R1XA 4QLRA 1R5IA 1A7QH 3FN3A 4LSDA 1L0QA 5E8DL 5HHNA 3STLB 4U7MA 1Q0XH 5L0QB 2GJ6B 1JWUB 4WFGE 3Q6FB 1CU4H 1KTDB 5EIQA 1FC2D 3HR5B 1MWAH 3EO9L 4E41E 5FYJD 4FP8H 3BIKA 4HC1A 1CR9L 4Y5XC 3QG7H 1H8NA 1NKOA 3ALPA 2FL5A 2FJGA 4QHLA 3O8XB 4PJDE 5D2NB 4XBGA 4DN4H 3D85A 5B38A 5TDPB 4JHWL 4KDTA 2J4WH 2VDNH 1X3DA 3ILPA 3UTSA 5ICXA 4N0UE 4DN3L 5I18L 1AFVL 3TJHA 4L3ED 5KSBA 4P99A 5GRJL 2VIRA 4BYHA 1QO3A 4P9HC 3U0TB 2OCFD 2PR4H 3IDMA 2VDQH 4ELKB 3SDYL 2Z91B 3ARUA 4FQHA 1LK2B 4PBWD 5CGTA 1IGCL 3I2CH 4HGMA 4QHKI 5ETUB 4PJ7F 3FT2A 1OAUL 3FHAA 3IDJA 2XACC 1OM3H 4UOW0 5EIIA 5L88H 2I9TB 4ESKA 1RZGB 3T0AA 3WHE1 5DUBB 3PV7A 1BMGA 3G6JE 1ITBB 4RGND 4NYLB 1NGQH 3QUXB 5DQDL 1CT8B 4P46C 3AU1A 5DTFB 1VENA 1AGFB 3D69B 1S5IL 1WIPA 2YUWA 2P44B 5DA0B 5GRZA 3KYMB 4ZO7A 1LDSA 3WO3B 1CFSB 4ISVA 2BVOA 3WFCH 1FG9C 2R29H 2YD5A 1HHJB 2P5EB 4NN7C 5HYSG 1ZEAL 1NGYA 5E00B 1T20B 4OV5B 4YDKH 4NO5B 5I15H 3KDMB 4UT9H 5JMOC 5CUSH 4P5MB 1JGVL 3OAYK 3KPRA 3V5HA 3BGFC 3SKNA 2EDRA 2EYRA 1RJYA 3MXWL 4RGNC 2F5BL 3F58H 3BEWB 3WNPA 4ODWB 1JZ5A 4LCCA 4KFZC 4Z0XA 1CBVH 4OF6A 2KZWA 4XCFH 1R0AL 2EIDA 4RDQF 4P2OC 1D5BB 4MNQB 1DBJH 2Q7YA 4F8QA 1YEFL 2DDQH 2B0SL 2YKLH 2R8SH 5DSCA 4KGJA 4OCWH 5T1LA 4K94L 1NL0H 3Q6GL 3BRGC 3HZMA 1NCCL 1F4YL 1UKQA 1ULVA 2NNAB 3HI6H 4IS6B 3TIDB 2XY2A 4XPTL 5TF1L 3QUXD 1BVKA 3QIBA 2E8YA 3NFSL 5I1CH 3HPJB 2BNUB 4IRJC 1I3VA 5E7FA 3KJ6H 2I24N 3CH1B 1WC7B 1Z9SA 2CXGA 1FL5A 4JFOA 2RHEA 1T1ZA 1ZAGA 4OIAA 1UT9A 3TA3D 4XBEH 3E6HA 4LAQL 5MEPA 3UJJL 4EEEA 5BRZA 4V3DB 4OF3A 1E27A 3OZ9L 3PABB 4GLRI 2IQAA 3G6JA 5L7XL 3QUYA 3D25B 4JE4B 3DUHA 4JM2B 3P30H 3FCTB 5C2UB 1I1FB 3QO1A 5D7IA 4I3RL 1DCLA 4CU8A 2VC2H 4Q9QH 4WHYG 4AMKL 2BVUA 5DVMA 1AJ7H 1RI8A 5DJXA 2GY5A 4GAYB 5GZOD 5IKCA 2IH1A 2XWJA 3BAEH 1MREL 2EYSA 1S9WA 2CKBH 5C7XH 3F6LA 1S3KL 1IFHH 4LLYB 2KDGA 4X6FB 4QXTA 3SO3B 1TJGL 3MPCA 1IQDB 5DC4B 2VSDA 3OKEA 3I85A 2V9TA 2BNQA 2DIJA 5D7IB 5I1KL 2ESVE 1N5AB 1FVEA 2YD4A 5JHLH 3VWJD 1I3GL 3ARSA 4JM4H 4OT1H 4R4ND 4WV1B 4Y4HC 3BE1L 3QEHB 2I07B 5F7UA 3ZYIA 3TA3B 1DE4A 5CEYB 1YA5A 3HI1A 1FFNB 2ZUQC 1I85A 1IVLA 4LSSH 3KYKL 5LCVL 2FYYA 1R3IH 2DQIL 1S9YB 3FJTA 4OM0L 2NY5C 3GKZA 2R0LL 5EFIB 4ERSL 4Z78B 2O5ZL 4I1NB 5FYKH 2ARWA 3BISA 4Q58C 2ZCHH 3BE1H 2XT1B 3C60A 4JY5L 5ID1A 1RZ7H 2H2SD 2NW3A 3TBTA 4LPCA 5ACLA 3I9GH 1RK0A 3C2AL 2IAMD 4JKWA 2VDKH 5IVXB 2R69L 3PWJA 5H2BB 1MNUH 3HNVH 4ONHA 1B6DA 4MNQD 3VG9B 4JPIB 1PY9A 1A6UH 5F6IC 4HEME 1EAJA 2VJXA 1MH5A 4XI5D 5HHMB 1TPXC 1C08B 4HWBA 5J3HD 1ZT7B 1YYML 2P43B 1MQKL 2UZIH 5J13C 4O00A 1P4IL 1QR1A 1TXKA 3LCYA 2PO6B 5JUEL 1DQQA 4GQ9L 4YAQB 3RL1B 1GHFL 5JQ6H 1XF4A 1OARH 5ACZA 1CDYA 3S6CA 2P48B 1IM9A 1U8NA 4HK3N 4ZFZA 5HJ3A 2OM5A 4QEGA 5I2IA 3VD9A 5I0ZA 3QUZD 1JFQL 1WGOA 2FECI 1YEEL 1JMZA 2VDPL 5EU3A 3PWPA 4KROC 4I77L 4G42B 4ODUA 5EU4B 3RUGA 3QZWG 3S3PA 1J0JA 3BD3A 5INCA 5KSBE 3JZ7A 1T83A 3UAJD 4X9GA 3BKJH 3ZSSA 3QIWD 3OG6B 4HEPG 2CKBL 4ODHH 2G75B 3KR3L 1RJLB 1WFOA 2XZCH 4PRHE 3ARDA 2EE9A 2X9WA 5IQ9A 2WQRA 3GSWA 4X0KB 1KIRA 2DD8L 3IDIB 4GW4A 1I7RA 2UV3A 2WZPD 4Z7VF 4JAMB 4JKPH 2XRAL 1CS6A 2ICCA 2XPGB 3IDJB 3EJYD 3WS3A 4C56E 2D4FA 35C8L 3DXAB 3P4NA 1N5YL 5ITFB 1LNUA 5DVKA 1G7HB 3WN5B 2UY6A 4DKAA 3TC9A 1PDKA 3R1GH 1T6WA 3BZ4A 4GXVH 1WAAF 3QWQB 4KKCC 4PG9B 4CMHB 1MHEB 2NTSP 2Z91A 3ALWA 3N1FC 3O3BB 4LPVA 1RV6X 3B2UC 3JVGC 4LEOB 1ZWIA 4JREB 1XGRB 4X7CC 3QULB 5C07D 1UFUA 4FQJL 1CIUA 2F5BH 1UA6H 2OMBA 1UM5H 2Q20A 4NNXB 5K9QI 4G6MH 3BZDA 2IADA 4HIXH 4DVBA 5IF0B 5CP7B 1PG7X 2V2TA 3NCFB 4NBZB 2EE3A 4NOBA 4XNUH 3O8XA 2NY2C 3WKML 4DTGL 4KGLA 1TFHA 3TJEL 1UJTA 2EH8L 2MCG1 1K9TA 5JW3L 1UM6H 4HZLA 1BEYL 5AUMB 1VFMA 5DJ6B 4Y5YA 5FKAB 5IHBA 1D5MB 4CVXA 2VZ1A 3Q5OA 4ZPTA 4NO3A 5JXEC 5EWIL 1MPAL 2NY7H 4R26L 1BVZA 1RZKL 5IV2A 1QOKA 2X4PA 3DGCR 5D7IF 5A1AA 4FXGA 1E0OB 2EDOA 2ZNXA 4PJGE 4YFLI 2W0FB 3I6GA 4GBXC 1KCVL 1FYTA 3JSSA 1N2RB 4JFFD 3CVHH 3K3QA 3MSPA 3QQ3B 5GS0H 2Y5TB 1LDPL 4QHMB 4LAQH 5EU3B 2ED9A 5IFJB 2JK5A 1VPOH 4ZS7L 4ZUWB 5C0AD 4LHUG 4HK0B 4UB0L 3QJHB 2EKJA 2V7HA 1N2RA 4YC2C 3C09B 3MRCA 2DQGL 3PHQB 3RWGA 1LEGB 4XP1H 1NCDL 4XP9L 2DF3A 3C08L 1NBVH 3T8XB 4UDUA 1M7DA 1DUZA 4E41B 4RQQB 2WLZA 3L3OA 5HHMA 1J5OL 4OSUL 5D8JH 4X6EA 2FGZA 2Y7QA 5ENWB 2AJVH 5D7JB 5L2KD 5IQ7L 4XXCC 1OAQL 4P9HL 3GFUA 3LQMA 1MFDH 4OM1L 1WTLA 4X6DB 4XVTL 4NZJA 4BSWA 5L88L 1ZLWK 3GJEA 1CK0L 1CU4L 3MRHB 5MENA 1S7QB 3TBTB 4XCFL 4AEIL 4O02L 5HXMA 4DZ8A 2V9QA 4LLDA 1YYLL 5HI3C 4JFXA 5HPMB 2OI9A 4NQSA 4NQEE 3MUZ1 5BO1H 4ZO6A 3KPOA 5LXGH 5C6WH 1UWXH 3VI3E 3RZCA 1ZHKB 1KCLA 3OXSA 1S9VA 1F6AB 4CNIB 4UDUB 2X4SA 3K0WA 4OI9A 3P0YL 3I3DA 1ZANH 3U0WH 4NN5C 3JTSA 1XT5A 2EO9A 5HDBF 4HJGA 3QDGD 2DKMA 2DWEB 4PJ5B 1I9IL 1IEBA 1D9KC 5IT2H 5DMIL 4TULH 4AIXA 1BZ7B 2B8OT 2FJHB 4HC1H 5ICZB 1LNUB 2YC1B 5ALCL 3BH8A 3VD3A 3BN9C 2J3SA 1S78D 4EUPA 5F70A 2Z8WC 2EYTA 3IKCA 4DWHA 1CL7L 3U83A 1IILE 1IQDA 3G08A 1FFOA 4R0LC 4U3HA 5F9JA 3W9DA 5T3XD 2VUOA 3ARDB 4XPTH 1CFBA 3MV9D 5HHOD 1A7OH 5C86A 4ZYKB 4J4PC 5CMAB 3SCMB 5GJTH 4LLVB 2YEZB 4X4XB 3RWIA 4MVBA 1RZ8B 3DVGB 3GMOA 1Q9KB 4LCWB 2BXYA 1SYVB 3OJ2C 4FG6C 4PRHA 2NY5H 1QLEH 1D3CA 3GI9H 4P3DA 4EVNB 5E1AB 5HDQH 5ADOL 3PL6C 5A2KH 1HKLH 3IFPB 1M6OB 4JY6A 5HI5C 1LK3L 1NC4D 2XOTA 1BBDL 2EH7L 1HHKB 5M7QA 2FH6A 4URTB 1Q9OB 2YD3A 2W9EL 1Q38A 3OGOE 3PDOB 5DJ8A 1RIVL 1HNGA 4YZFE 5E7BA 3GIZH 3EJJX 5EUOF 2VH5L 2YPVH 4R8WH 4PJ8B 4J4PA 1T04A 4XCYA 3PWLB 1II4E 3GI9L 3HNSH 1D9KD 2BHYA 4ZTOH 3MRMA 3ERYA 4X4ZA 5INDA 4FFVD 1YMMD 3C6SA 4P4KD 1JHTB 3AY4A 3B9KD 3O4LA 1WBYB 3V4VL 1D5ZA 4H8WH 3KPPA 3UPCA 1IGFL 1TQBB 4K8RL 5I66A 1TMCA 1GPOL 1LE5B 2YPLD 5I0DA 1KC5H 3QNZB 5HI4D 2F53A 2GFBB 3HE7B 4GAGH 1F97A 2DQDH 3WN5C 3HNSL 3DX7B 4ZTOL 4XCCH 4TTDD 4N0CA 4Z0XB 4G8IA 5GGUA 1CGSH 2CGRH 3OBAA 4WW1B 5D1QB 4Y1AA 2MPAH 3QUMB 3WD5H 4TSCH 3RNKA 4JY4A 1UEYA 1YY9C 1P6FA 2J8UE 3AM8C 1WWWX 4U7SA 3JV0A 4GXUM 3P0VL 5CJOH 4U1GB 5H94A 1M71B 4JB9L 3S5LB 3DRQB 2PYEB 4B5EA 3INUL 3P0YH 3BKCL 4JN1H 1JGLH 1FZKB 1U93B 2GTZA 4QHUB 4QRRA 1T2XA 3B2UD 2QR0B 4PJ8C 1CFSA 2DQEL 4YK4C 3E2HB 1I9RL 1XF4B 1QBMH 3SDDA 4AH2A 3C5JA 3SJVE 5I17B 4KZEL 2E7LE 3DSFH 1MFCH 4M00A 3RWEB 5E6YA 1QSED 5HGGS 3QRFM 3NFNB