5IB4A

Crystal structure of hla-b*27:05 complexed with the self-peptide pvipr and nickel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-27 alpha chain
publication title Metal-triggered conformational reorientation of an HLA-B*27-bound self-peptide
rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ib4A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5ib4A01
2JJWA 3RIFF 5KOMC 3NACL 5C08A 3ZE0F 2X4NA 4AM0B 3D2UB 3QEGL 4OF3A 4XCYB 3PWNB 3LEXA 3OG4B 1M1SA 4DVRH 4JM2F 4CU6A 5E6ID 1TTGA 4UIKL 4XNUL 4Z7UA 4LVNB 4L4TE 4EI5C 4PY7A 5EPMB 3TO4D 1T6WA 2R2HB 4P2QA 4E42A 1T5XB 2VABA 3TN0B 3H0TB 4CDGC 5BJTB 1A0QH 1EFXA 2CGRL 4NN7B 4UU9B 2HKHL 5BRZE 5ETUB 1CZ8H 3A6CL 3LV3B 3BP7B 2NMSA 3UTSB 3JTCA 2YRPA 3TNNA 1NL0L 4WW1A 2A6JB 1RUAH 4JREB 3ALWA 1ZLUK 2DQDH 4TSCL 1AXSB 5E24E 4YGVA 4JFYA 3L6FB 3SE9L 1JHLH 3Q6FA 4W4OC 4I0PA 4ZDHB 2ZSWA 5GGUB 2YPVH 4U6VH 4PV8B 1MJJB 1VFBA 1IKNC 2R0WL 4H0IA 4I4WA 2X7LB 4X7SH 4NO0B 5F9DC 2BCKB 4KJWC 3RWEB 1R5IB 2EEDA 1HZHH 3IDJB 1JNHB 5DURB 3QISA 5HYSB 3LN5A 4ODWB 3MMEB 4JQXA 3SDAC 1NCDH 4TVPE 3EIFA 2BDNL 4H5SA 1MEXH 1P53A 2EYRB 3HNTH 1F42A 4P3DA 4LMQE 4U05A 4N68A 3GM0A 4LVEA 3PHSA 3CXDH 4M5ZL 3EYVA 2D0GA 1CFTB 3TNMB 5BOZG 2NZIA 5KG9B 5KSAC 1NC4D 4X7TA 5FGCB 5LQBL 4MB3A 2B8OT 3NA9L 3KR3H 4N5EC 4Q6IB 3F7VB 1G9MH 1RK1B 1XCQA 3QDGA 3ZYOA 2O5ZL 3QI9B 5DT1H 2AK4A 4FFVC 4M7ZC 3MLZH 1D9KC 3MZGB 4DKEH 4WRLA 4L4VE 1AQDB 4J6RL 1AQKH 3GO1L 1MJ7L 3HRPA 1A6PA 4XWGH 3H2WA 4RGNB 3MLPA 4QRTB 4NNXB 1D5ZA 2ED9A 1UVQB 3RKPA 2BSTB 3QHFH 5BXFA 5D70H 3WJJA 3A67H 4GKNB 5H94B 3GSOB 2WQRA 3QIBC 5CGMA 4YFLI 5EOCL 3NN8B 3X3GL 1UH3A 2HVJB 5CP3A 1DBJH 2ATPB 4Q9QL 1WK0A 3UBXI 3CVHH 4Z77A 4BFIA 1JWMA 5F9JA 3MNWB 2YA0A 5C09E 4YGAB 5HHNB 1IC5H 2V7HA 2NNAA 4RGOH 2VQ1B 3K8MA 3U1SH 2Q1EA 1LD9B 4DZBA 1T5WA 3U9UB 1I1AA 3IXTA 4RISL 4GAJH 3CC5B 3HB3D 4XXCA 3B8SA 3PP3H 3GSUB 1CE6B 1DCLA 1MFEH 4JVPA 3O9WA 3RGVD 3VJ6B 2R2BA 4ZFOL 3REVA 3B5HA 4Y4FD 3U0PA 1CL7I 5DJ2B 3VH8B 3S36H 1EAPA 1NFDF 5C0CD 5J12C 1MCIA 1KPRA 4HKXA 3RZWA 1IE5A 4XCEB 2JJSA 3NCYS 4XZUB 4G9FD 1FSKC 4FABH 3DYPA 1RULL 5DR5L 3OKNA 5BS0E 3MRDB 5C9JA 4ZPTB 4JQVC 1IC4L 2VXVH 5KS9B 1RZFH 4QRSB 1WFOA 1RJYA 3LPFA 3F62A 1MCNA 4NGHL 3MLRH 2X4TB 3BKCL 3C5SA 5I9QC 4YBLB 2J8UA 3QDJB 3STBA 3QXUA 5A40E 4JHAL 1VEOA 2X6MA 1V3MA 3BP4A 3G04A 4YXKL 3CCHB 4RDQF 5ISZB 2H26B 1K6QL 1I3RA 1BQHA 1IGJB 3MRGA 3P0YL 3RZCD 1I8MA 4GBXD 3V0WL 4JRXA 4QWWC 2O61B 1CFSA 1WLHA 3BEWA 4PFEA 2VLME 4DCQB 1FNGA 3DXAE 4OGZA 3UTPD 4M9OA 5C0IA 4S1RL 2XXCB 2DOCA 5A2IH 3NZ8A 4NIKB 4RMRA 3HRZB 5KSBE 4WNQA 3E2HB 2IALB 1T21A 1J0ZA 3QNZB 1T89C 4MHHI 3TF7A 5FEBA 1A7QL 4JN2A 5AG8A 1U8LA 1Z9LA 5IWLC 1X6LA 4HWBA 2AJYH 2G75B 2QSCL 2NY4C 3IJSA 4PREB 4PS4L 3IDXH 1UADC 3ULUE 3DX9A 5HSFA 4P4KB 1U3ZA 1U41A 4L8CB 3VXSE 1NGQL 3DBXB 3DVNB 4WO4C 2DQTL 4UNTA 5HVWA 1RURL 4UINL 1E4KA 2C4FT 2VLKE 4AJ0A 1YPZF 5HHPA 3QIWB 2A77L 1MIEL 3Q6GL 3E6HB 4K2UH 5FCUL 5GRVL 3CFBB 4JPKH 1XZ0B 4I48A 3IT8D 2J5LC 5D7LD 3DMMC 5T33H 4XPBH 4ZO7A 2RFXA 3LOWA 4K55A 3CZFB 1ZLSH 5JLZA 4UNUA 4Z78B 5D2LB 2X4QB 3CDYA 4N0RA 3NFNA 1DE4A 3TZVB 1I1FA 2IBZX 1AFVL 3MRQA 2OTUB 2H32A 3MV7B 5EU6A 1RIHH 1ZLWH 4D0BA 3UJTH 3KPRE 2IQAB 1HHKB 2EDYA 2ZCLL 4QXGH 5HVFB 4GRLA 2QQNH 5K59F 1PLGH 1UH2A 5H8DA 2VLLB 5J57B 2LAGB 3AREA 4X5WB 4QHUB 1SY6H 4OFPA 2OI9C 1R3KB 2R69L 2A0LD 4OZHF 3AROA 4P9HH 2XY1A 4PJ8A 3SOBL 3VFTB 3QIUC 2WWMD 1S7QA 4P0DA 5HI3C 1CD1B 1LK3H 4X7CC 1XGYL 2JCCA 2Q76B 1JGUH 2X40A 3NZHL 3WUWG 3TN0D 4LEOB 3QZWA 2BSRA 4G9FA 2EH8H 4IRSC 4P2RD 2EC9U 2HTKD 3HAEH 4QRRA 3UTSD 1KXQE 1QFUL 5AUMB 3CFKB 1M7IA 3DUSB 4NQTA 4QHMB 4LCWE 3JBG7 2C3VA 2OL3L 4M4PA 2JELH 1DLFH 3LKQA 1UZ8A 5I8KL 4BKLA 4GXUN 4NYLA 3O6FB 5IVZA 1WC7B 3VI4E 1YYLH 2J12B 3VD3A 4XXDB 3V7MA 2CUMA 5I17A 3QUZC 1M05B 4K7FA 4JHWL 3KNBB 1RY7B 1OF2A 4EBQH 3WLBA 3RZCA 4WTWA 5DJDB 4FQ2L 4NO0D 4KK5D 3VD9A 1ZHNB 2AP2A 3MRMB 1VFAB 5DURD 3T8XA 4E41E 4UILH 3N1PC 5HHVH 3TP4A 3EDEA 1DQMH 3ZSTA 5I1EH 3GHBL 1QR4A 4CADB 4OIIL 3PIQB 2D4FA 1DQDH 4ZFZB 2P5WB 1PEWA 2YD9A 4OTXL 5ABDE 4ODVH 3C8KA 3L3OA 5FECB 1RD6A 2LTQC 2E9BA 1S78C 2Y36L 2Q8BH 1BVLA 3QI9D 3TV3H 5DFVD 4Y4KD 4JFXA 1XGTA 4JFFE 1T0MA 1BFOA 3GJFA 2R9HC 1PKOA 4V2CB 1FLRH 2HFGL 4HUKB 5DQDL 3RI5F 4X6DA 3PL6A 1IFHL 3NIGE 3P0VH 4G43A 5E8DH 4JJHA 1A6AA 1F3DH 5F6IC 3RQ3A 5CSZB 2FR4B 2XQYG 2C1OB 1LQVA 3DNKA 3MO1A 3D9AH 4J4PA 2JK5A 2H9GA 2NY0C 3SDCB 3WS3B 2CLVB 1P7KA 5BVJB 3MRHA 2AJZB 4U1LA 2QADD 4LCCB 5JHDE 1JTOA 2HMID 2Z93A 5HI4D 4ZTOH 4WFED 12E8H 5H2BA 1IGCH 4XPFL 5GSRA 1L7TL 2K7PA 2R23B 3OKDA 4K7PY 3FN0H 4ZS7L 2F54A 1J1XH 1HSBA 2DAVA 1AHWC 4NC1E 1E6OH 3GSNA 1IM9A 2NX5E 2E6PA 2XY2A 2VE6A 5A3IC 3R0NA 3HMWH 3VFPB 1T0PB 1CDCA 4YXLL 2VXTL 4PGJA 1DUZA 4D9RD 1FV1B 4PR5A 3AAZB 3TA3A 4N1CA 5D7IA 4KI5D 3RVVD 4JE4B 1A1NB 1K5NB 4HUUA 5MEOB 1K8IB 5EU4B 3BPNB 3VGAB 4FNLH 1GZQB 5TPWL 1YN6A 3VDAA 1EZVY 3B9KC 2G5BA 3FFCE 3KYNB 3GMQB 4H0GA 3MRIA 4ODSH 4NZRL 4KZDH 2IAMB 5DLML 1EO7A 2AQ3A 1MAML 5LAXB 3QUKB 5DD1L 1FCCA 2FBJH 4WUUB 1BQSA 3W2DL 3QDJD 1ACYH 1TENA 2LE9A 4NHUB 1LE5B 4I3RH 5HD8D 1I9IH 3V6BR 1FAIH 2Q7NA 3D25A 3UZVB 4HXAH 1S8DB 5INDA 4FOMA 1A4KB 3WN5C 1KACB 1LP9E 2CLRA 4RMWA 4LVOB 5C6TH 3UJJL 3V52H 1DBML 5ENWA 4MD4A 1JGVL 3SGKC 5AEAA 4TUKL 4DVBB 1HILA 1TZGH 3OHXB 5F7DB 4LPXA 5FB8A 1CQKA 5F3BB 4FFYL 1F11A 3X3FH 4JHBA 2PF6A 1S9YB 2AVGA 5AZ2L 3W82A 4IOIB 3PQYB 2FX7L 4MZ2A 1QLFB 5INCA 3PHOA 2FJFA 4BUHA 3IDNA 2VOTA 1QVOB 3B83A 3LHPH 2Z8SA 1GH7A 3MXVL 1A3QA 4FZ8L 3MBXH 4B7LA 5I1AA 4YHYB 1KJVB 4N8CL 2NW2A 1KB5A 3F5WB 2R0LH 4P4KD 4L3CA 4QCIA 3SJVE 1NCBL 3SDDB 1IBGL 4M3KB 3FN9A 4JFZH 1YMHA 2OJEA 1HOCA 3VFWA 3TVMA 1TJGH 1N6UA 3QIWD 4GG6F 4QTIL 4NDMA 3C6SA 2DWDB 4KPHH 2GTZA 2M26A 3S3PA 1CFNA 3OG6B 4XVTH 3TCLB 5GRVK 5LBSL 1DTUA 4TUJB 3VGGA 3CK0H 4UV7L 5J9PA 5BCAA 3MRNB 1FNEB 1ONQA 2EIZA 2Y23A 4X4XA 4L1DA 2H8PB 2FH8A 3QAZC 4Z9KB 3RL2B 1VGEH 3VGEA 4QOKB 1KCRH 1LO4H 4ERSH 5F7HA 4MJIE 1LDPH 2K1MA 4NM8H 4MA3B 3TZVD 2BJMH 1NAKL 5JHLL 1DZBA 2E8YA 1G7HB 1VEMA 3RDTA 2A6KB 4YFDB 2H2PC 3B9EA 3FMGL 2Y4SA 1NQBA 5DWUH 1UM6L 4MVBD 4PRBB 5CJOL 3DURA 2HJKB 4O2CB 3E3QC 2IG2L 3ES6B 1QSEB 1WZ1L 1HHIB 1C12B 4HPYL 4QTHB 4Y5YC 1FZKA 5A2KH 4OT1L 3WCYA 3NH7H 4V3EB 5ICYA 4LLMA 2R1YB 2ZUQC 2DN7A 4U1KB 4XPGH 5FYKD 3EO1B 3WSQH 3QEQB 5JW4Q 1G7PB 1URLA 2FJHB 4PJ7F 3BQUB 4Y5VB 4EUPG 4MMXC 3FONA 5LCVH 2I9LA 3LEXB 4Y4HD 5J06A 2NCMA 5CFHA 5T3ZH 1OGAA 1S7WB 1HSAA 3VWJC 2ERJB 3VI3E 2H45A 3UPRB 4LNVA 5AAWA 4P2QB 1NAMH 3BIKB 4UNVA 2VABB 3ARGB 5EC1B 4BJLA 1WAAA 3S35X 5KW9H 5FYJE 5EBLA 1JMXA 3EJYD 5D1XC 1BX2A 4NQEE 3SO5A 4BQ6A 4X4MA 4ZO6A 3C09C 1YMME 3WFBL 1BJ1J 5E94B 1WBYA 1MCWW 3G5XA 3Q5OA 4KHTH 4KH2A 5J1TC 3MLWH 4C57C 4I2XB 2X09A 3MBED 4OCXH 4UB0L 3JV4A 4L8SA 5C0DA 4WW2C 3MJ9A 3CDCA 4O9HL 4I0PB 3LIZH 2HLAA 5GSVB 5JIIA 4ISVB 1E6JH 1LO3H 3T0EC 3MA9L 1MLBB 1ND0B 2WV3A 4HBCL 5FYLL 4DGIL 2BVEA 3MOAH 5DVNA 4M1DH 4X0KB 3OXSB 3VRIB 4R4ND 4LNRB 1FH5L 4OCSH 3LN5B 5D1ZC 3S4SG 1HQ4B 4PJCF 3W0WB 4MWFA 4H5SB 3DX8B 2W38A 3L9RA 3I02A 4PGDA 4HKJB 2EDOA 4P3DB 1U2CA 2IJ0C 3QJHA 3X11A 2P48B 1JPTH 4JR9L 5CINL 2EYTA 3HR6A 1IQDB 1DSFL 3GMPB 5MEPA 5IHLB 3MR9A 4H20L 4Q74A 2QSQA 2P4AB 4K8RL 1RQ5A 3QDGB 2VNCA 1F58L 1BOYA 3O11B 3RWDB 2AK4B 4AIOA 5I1KL 3NVQA 3NTCH 4HG4K 4ONFL 4ZAKC 3QG7H 1NUNB 1CXEA 2ZNXA 1CFBA 1ZLVK 2NW3B 4BSVA 4NZJA 4N0YH 3DVIA 2XWJB 1RUQL 4YAQB 5CIPH 5EG6C 5IEKB 3BHBB 4YHPA 5EZIL 4R7DA 1JF6A 4AEHH 3MV11 4QEGA 1ZA3A 2EZ0D 5SWZA 1EVTC 1U92B 3D0VA 1H5BC 4ZXBB 1G6VK 5E4EC 4KAQH 3VA2C 4FQCH 5FFLA 2E7LA 1OAKL 1JWMB 4X6CE 1A7NH 3EFDH 5FAAA 2V7HB 5D7JA 1QYGH 5JA9A 3D39B 1NAMA 1AXTL 4DZBB 4KUZL 3IXTB 4IOFC 5C1MB 1CICB 1BGXL 1M4KA 1ZA6B 3TBWB 4GW5A 4BZ1H 1VKXA 5MENE 1UYWL 4YHIB 3REVB 1Z2KA 1K4CA 4H1LH 1KIRB 4N5UA 3VDCA 5JOPD 4NJAL 3U0PB 4U1SA 1A3LH 4NKIH 1EAPB 1YUHA 1JN6A 2EH7L 3O2DA 1OT2A 1P7QB 2IAMD 1V8HA 1RZIB 3VFNA 4UT9H 4EN3A 1U6AL 4OZHA 4QT5A 4HPOL 5CILH 5HJ3B 3ZDZE 3NAAL 4M43H 4LRNL 1M7XA 4ZTPL 5TDNA 2IBZY 1H9VA 5F7WC 1T1YA 5C07D 2MPAL 3RAJL 1CD9B 4PV9B 8FABA 3MX0A 2APWA 3VXQA 2OCFD 5IFJA 3EYSL 1NDMA 4J8RB 5DJXA 5I8CB 3SKUD 5MI0B 3VGBA 1QHPA 1AC0A 3OZ9L 1BZ7B 2DQEL 3BP4B 3G04B 3MBEA 2P8MA 3ZE2E 4X4YA 3BFOA 1KT2A 3HI6L 3JWDC 3JTSB 4Y19D 3ULVD 5IQ7L 2GSIA 2PYEB 3SGJC 3O0RL 3UEZA 1S7TB 4LSPH 2XV6B 3BEWB 1JRHH 3PQYD 4NJ9H 4ORGA 5C0IB 2WANA 3I6KA 1U58B 1IAOA 3C5ZB 4Z7OF 3NZ8B 4YHKL 1MSPA 1NKOA 4PJXE 4WNQB 3S37X 1U8QA 3M17B 4KXZI 4LARL 1Q9WB 4IRJB 2DL9A 3SDDD 4MYWB 2ICWB 5F8RC 1TMCB 2VO5A 1T1ZA 5IVXF 2X89A 2O26U 4U0RB 5I76A 1TXKA 2QSTA 1KTLA 3ARPA 2IPTL 3DX9B 4KRPC 2AEPL 1DR9A 4HHAA 4XP4L 1E28A 3NFSH 3MRCB 2MHAB 1ZHKB 3VXUA 2EEBA 1CDIA 4K3HA 3QQ4B 2XN9E 3EKCA 1P4BH 4OZFH 3GIVA 3U6RA 2VYRE 2XG4A 2X1XR 5HYJA 2DLFL 4PJIF 4QOKD 4XAKE 2D9QB 3CVHB 5GISH 5F1SA 1SVCP 4R2GC 3GBNL 4PJ9A 4OM0H 5GRYA 3OQ3B 4X6BB 1MWAA 1VB9A 1C1EL 3I9GL 2CXKA 1G7IA 4NWUH 2DICA 4CMMA 2HVKB 3NFNB 5DD0H 5FYJU 5GS2D 43CAA 5J89A 1DE4B 5HGHA 5IHUH 3MTRA 3MRQB 3PWPB 1QSED 2AJVH 2W9LA 2H32B 1OAQH 5DEGB 4GQ9L 5F93C 4LHUG 5MHSE 4I0KA 2X4OB 4OZ4A 4M02A 1UWGL 1Y0LA 3C60D 4CN4A 3P9LA 3HZMA 5MEQB 2HT2D 1L7IL 4P2CG 5FO9B 4XWOC 15C8L 3HHRB 1JIBA 1LO0H 3P9MA 3AREB 4CVZB 1JTTA 3QEQD 4L8BA 5IESL 1OSPL 5IHBA 3BQUD 1WGOA 4KKNA 5I1JL 3CFCL 1FC2D 4PJ8B 1C7TA 3WLWD 4POZC 4ZFGH 4P23A 4ZOEA 1T1XB 1KEMH 3ZKMD 2FL5B 4XNZC 2F8OA 2JCCB 2JJTC 3T2PA 5F8QC 3ARGD 1XR9B 3NGBB 4ZUSA 4XNMA 3CLFL 3WUWA 1P9MA 1EDQA 4OD1H 1OB1A 4QRRB 1FL3A 1KLGA 3MJ8A 4X99B 3ZT6A 5ID1A 2VZ1A 2DM4A 5T1KD 3KPSA 5I1IH 3K7UA 1DFBL 5E7FA 4Y1AA 1HIML 4OKVA 5I0DA 2IGFH 5HDLA 4NYLB 4OLWL 5IVZB 1HXYA 4BSWB 1J1OH 2Y1VA 4EKXA 1KCGC 5HHMB 1CGUA 4K7FB 1JHKH 4S0UC 1AGCA 1IAKA 2HH0L 4AL8L 2ICES 3CPLB 4YHML 3P4LA 4LGPB 3QCUH 1QSFA 1ODAA 1K4DA 3T8XB 1BHGA 5C6WH 2FECL 3MV8B 4MXQC 2YR3A 5DS8B 1F6FB 4HWBL 4JB9L 1MREH 4EXKA 3W0WD 3QFJA 1J5OL 3PWUB 1U8PA 3ZTNH 1OSZB 2Y7QB 1F8TL 4M8QA 4CL7A 1CGTA 5F7EL 1QBBA 3JXAA 4W81A 3FO1A 1E27A 2HJLA 1MAJA 4X80H 3CDGB 4ELKB 2B1AL 2HAZA 1UQSB 3NPSC 5EFIA 2JB5L 5L0QB 2OBGA 1EVUA 1A7OH 1Y18A 4JFXB 3MA7A 4HIIB 4Q9CA 3O2WL 3GJFB 1T22B 4KGLA 2IFFL 4R0LA 3KYOA 3SGDH 3G5ZA 4U6XB 2VXQH 1O0VA 3PL6B 4UMGA 4PJGA 3TC9A 5FO7B 3S6CA 1KCLA 2Y06H 2CDGA 1A6AB 1MI5B 3RY6A 5GJSL 3MGTA 3BPLB 4HT1L 5DDHA 1DN0B 3D69B 4TPRL 1NMBH 2WNGA 2LABA 4TRPH 5IB2B 5LWYH 1EHXA 2H6PB 1KCVH 1CU4H 4LCUA 5GRJL 5J11B 1C5BH 2HT3D 2H1PL 1P7KB 4Y5XA 4MCYB 3MRHB 1WFTA 3GBMH 4C54A 2DQJH 5JDSA 5F96L 4ZXBD 4LEXH 5D96B 2Z93B 2JB6B 4JRWA 1ES0B 3TPUE 4Z0XA 1KLFA 3FOLB 4OLUH 3L3HB 4OLXH 2B5IC 3GJEA 3T3MF 5CD3B 3ZO0A 5D2NE 1HSBB 4H25A 5FUOL 4LLVA 32C2A 1F45A 3D39D 3WD5L 5ADOH 2E6QA 2DI7A 1CICD 1OP5K 1FQ9C 3PV6A 1MCLA 2Q8AH 2VE6B 3QUXD 1A6VL 4LCIH 1K2DB 3HAEB 5EUKA 5EUOB 4TNWK 5CJBA 3LB6C 3TA3B 5FF6B 1UT9A 1A1MA 2QKIB 4OSUL 1SEQL 3O3AA 3VFSA 4DKFH 1P7QD 1IMHC 5TDOA 4HFUL 3GKZA 1HI6A 2DQIH 2D7OA 1C8PA 1GGUA 1BBDL 2FO4A 2D7PA 2YD8A 4FXLA 4YXHL 5KVMC 4HK3N 3HC3H 4GRWB 5I74C 3S98A 4RGMB 3MJ7A 4DW2H 1JWSA 4WW2F 1KIPA 1LEGA 5EC2A 3TIDB 1AY1L 3M8OL 1YY8B 4PLJC 2C26A 5T1KA 4MGXA 1V7NH 1BVKA 4HZLB 2AXGB 1T2JA 3HG1B 3IDYC 1RUMH 3MPCA 4R3SA 4CW1A 4JM2B 3KYAA 5EO0B 2VSDA 2FGZA 3VFUB 2UZIL 4YZFF 5EIIA 5D93C 4O58L 3LKOB 2BNRB 1H3GA 2FGWL 2CLRB 4XBGA 2PYED 1RMFL 3UTTE 2W9EL 4L9LB 4XI5C 3ZDXF 4O51B 1CLZL 2AQ2A 4GXVH 3ALXA 4ODUA 5HVHC 4DUVA 2DKSA 1MHPH 1QKZL 3C5ZD 1NDGA 1RVFL 1UJ3A 1X5YA 5GZNC 4P5MA 1RU9H 5AWNL 1RK0B 4IRJD 4FQXC 4O4YH 1RI8A 3NCJH 4G80B 5HHXL 3IDNB 1EJOL 1H3TA 4JDZA 3MXWH 1G0DA 1J0KA 3TBVB 3EBAA 1GAFL 3O3EA 3A0OA 1G1CA 1T6VN 2NW2B 4JCLA 2E27H 3ETBF 1QQDA 2HN7A 2V9TA 3BE1H 3PGDB 4AIZA 2APVA 2NTFA 2EIDA 1OTSD 1B0RA 1AKJD 4YH6A 3WNPA 1YMHB 3LRHA 4XPHL 1I9JH 3VFWB 3D18A 3VXRB 3IFPA 5GGSA 5SV4A 2MWCA 3C6SB 4OM1H 2PO6D 1RZJC 2C7UA 2MMXA 2XG5A 1MCEA 1X7QB 3R06B 3GNMH 1FAKT 5ANME 1HXMA 1AH1A 4YFLF 1FN4A 3H9HA 4U1MB 1KENL 2KUTA 4L4TA 1MFAH 4IIQA 1A4JB 4XMPL 5DUBA 2XA8L 4XPAH 5E00B 3RGHA 4ACPA 5D4QA 2F53E 1ZMYA 2BMKA 3QDMB 4F7PA 3V7AE 4MNGB 1XF5A 5BRZA 4AMKH 2BP3A 3PWPD 1NBVL 1I7RB 1HH6B 3U9PH 3MCLH 4MA1C 4CBPA 5E8PB 3QHZH 5ACLA 5C92A 1GOHA 2BVPA 3FZUD 4G7YH 2GK0A 4MA7L 1ZEAH 4K9EC 2BC4B 2RCSH 3SKNA 2ZCHH 1Q1JL 1KLUA 3O8XD 1PX3A 4XBPA 2X2YA 2X9XA 3HE6D 2EIBA 1WISA 4PJDF 1QNZL 3MSPA 2WQ8A 2QQKH 2Z31D 3QPXH 3B3IB 3FO9A 4LP4A 1H3XA 1U8OB 2APTA 4KV5E 4NNPL 3PDDA 3DRTA 1R3HA 3BGFB 3O4LB 4EUPA 4I18B 1OGAB 2VLRE 1IZKA 1MRDL 4MD5A 4JDVB 3NABL 3NIDE 5HGBA 1RZ8A 5T5NF 5D71H 1MPAL 4M6ML 1EFQA 5DK2A 4KKBC 2DF3A 3MREA 1A47A 1I7TB 3BW9B 4N0CC 1A1OA 3L5HA 3AY4A 1NFDB 5EZLB 3SQOH 3VXSD 5EBLB 2XFXB 4Z7VE 3WV0A 4IMKC 4M7JL 5KSVA 3FO2A 5L7XH 4RMUA 4G8GA 2EDFA 4P5TC 4L4VA 1Z9MA 5IK3A 5E5UB 5FDWA 3QFDA 4M3JA 4K23L 2XRAL 5CZVH 1T1WA 3JV4B 3QPQC 1MNUH 1KTDB 3L5XL 2PTTB 3MV8D 2FEDD 2HLAB 4NPYA 1EGJH 1IT9H 4XBEH 4NC2B 1CBVH 2BFVH 4R97B 3EO9L 3AXLA 3V79C 3EJZC 3GUTA 4RGNC 4KROB 2YA1A 3ARDC 3H9SA 1TQCB 2UZYB 4DGYH 4AEIL 1FNHA 4HIJB 4Y2DA 1MJUH 1X5KA 3GI8H 2APFA 1PZ5A 1UFUA 2AGJH 4K71C 2GITB 2NY2C 1ZHLA 1H8OA 1DQQB 5FKAB 2R1WB 3OKMB 1KN4H 4OZGF 4HWUA 3S4SA 3EDFA 1YNTB 5JNYB 4PGDB 5C09A 1MCJA 1CIUA 2R39A 2Y07H 3TWCL 1JHTB 2IH3B 1GC1L 4X8XA 1J7VR 2DM7A 1GIGL 4PJBF 5AYQA 4EEEA 3I84A 4JRYE 4J3UA 2VISA 5LXGL 4TUOB 3GHEH 4U6YB 1MI5D 3MOBH 1KJ3H 4HV8B 2DTML 5D9SA 2YN3A 5F21B 3ROOA 4ZUUA 4PTTB 3C6LA 1NCAL 1IQWL 3QCVL 4N0UB 3QXTA 3FB5B 5TF1H 3QYCA 4EI6A 2PW1A 4BSVB 3JWOC 5BS0A 3B6SA 2Y6SD 1FL6A 3P77A 5HHQA 2IQ9L 4NCC1 3RUGE 1UKQA 3HS0A 2NZ9C 4FQJL 1UCTA 1EHNA 5D7KE 1N4XH 3MUZ1 4JFEE 5CJXA 4YBQC 2E6JA 3MFFB 5CWSB 4R96A 2EXWD 3BJ91 2HLFD 4GLRH 3TFKC 2GCYB 1NAMB 4L3AA 5I19H 1B4JH 2UWEE 3KPLA 5FHBL 4HKZA 5EWIH 4LDOB 4XNXL 4E41D 2NR6C 3DXAA 2UVFA 1TJIH 3LY6A 2XIDA 3I50L 4NWTL 4PG2C 1E4XL 3V6OE 1R6VA 3OR7A 3QUML 4JFDE 3TYGL 5JMOC 5KSBA 1R0AH 2GTWA 2HFTA 2OX5A 3CXHK 1EHAA 1HDMB 4RMQA 2JTDA 1JP5A 2F58L 2O5XH 4WFFD 5JXED 1JZ3A 2XYCA 3MJGX 3RTQB 2NXYC 1F4WL 4JKPH 4EN3B 2F19H 4OZHB 2FECI 5DRZA 1Q94B 4HDIA 5IOPB 3BMVA 2Q7YA 3HG1D 4M6NH 4JM2D 5HGGS 1UA6H 3LN4A 3SE3A 5JPMA 1U93A 5TDNB 3VXSA 1YEFL 4JFFD 1YYMH 3WUZA 1IGMH 3HE7C 5H37H 3D87B 1UXSA 2XZQH 4G6KL 2VLKA 3S34H 3T04D 1QP1A 2OMNA 4M5YH 3IAPA 1T03H 5FCSH 1V7MH 1OWWA 1RZGA 3FQWA 5I8OH 4DN4L 5IQ9A 3PF2A 4MNQA 2YK1H 3DV6A 4YHOL 4GMTL 2ZOKB 1UG9A 4X6EA 5ACMA 3AU1B 2Z4QA 3OX8A 1KT2B 4OCLC 4YHLL 2ZUVA 2YXMA 1JNLH 1OPGH 4U1IB 4G9DA 5F7YC 3WFEH 3BOVA 1YEHL 3EYFA 4JG1H 3TBSA 4PB9L 2WBJD 4M03A 3RU8L 4LLWA 1IAOB 4O2EB 1TZIA 3FFDA 4GG8A 5KSUB 3J7HA 4NUGL 3I2CH 4IRZH 3MFGB 3PDOA 2CO6B 3MNVA 3WKMH 3KPRA 3SPVA 4WHCA 3RKDC 5K9QI 1AJ7H 1JNNH 4M93C 1FZOA 3JUYA 4HUXB 3RPKA 3FRUA 5I76B 3WFZA 3RL1B 2YXFA 3RVUD 3VXRD 2B0SL 3T4AB 3CX5J 3BO8A 3W9EA 1IGTB 4G59A 1FORL 5CIPB 1KJ2H 4HLZH 2YPKA 3QXDA 4Z0BH 1ZTXH 4WWKA 4MXVE 4XB8A 5C0EB 2I07B 4NKOA 4HS3B 4FFWD 4M1GH 5CBAB 2P47B 1FO0H 4NCC2 1I7UB 4N8VG 1TITA 4P9MH 1CK0H 1IILE 1TQBB 1U3HB 4YO0B 1VENA 3U6RB 1OCWL 2VQTA 4E0RB 3QUYA 1AO7E 3O2VL 3E6FB 1OAZH 3QDMD 3KWWB 2W0KA 3FFCD 2MCPL 2F5AL 4NQDE 4AZ8A 3ZKQD 2IWGA 2QHRL 4CVWA 5C0GA 4PJ9B 1EO5A 1F3RB 1NEZG 5T1LB 1G6RA 4WI5A 4LCWA 4TTDC 4YEEA 3EYOA 3T65B 1WWWX 3ARUA 1NCWL 4CMMB 5A43C 5JORB 1EUTA 4QXTB 3W39A 3FQRA 4TNVF 1R5WA 4H1LB 1AGDA 3KYMB 1G9EA 1H3PH 1WT5C 5JR1H 3BRDA 1W0VA 2HWZH 4JO1H 5FYKL 4KKCD 3H9ZA 2DS4A 3VFMA 1B0GB 4LHUA 3QRGL 4OUOA 4ZO9A 1CE1H 5TQ0H 4AENA 4F37F 4Q7DA 1T66D 5EN2B 1HINL 3Q3GA 3P9MB 3VXTB 4MX7A 4U1HA 3QCTH 4FXGB 4E41A 1AE6L 2X4PA 5EBMB 5AAMA 3DETC 4HULB 1HHGA 4P5KA 1BQLL 5BV7B 4WGVB 3WO3B 1G9NC 1CD8A 3UP1A 5GGQL 4A6YA 3BUYB 1FYHB 1YECL 4MLSA 4N0FB 1FDLL 2ADFL 4OGYH 4DN3L 4ZUSB 3SJVD 4M62L 4XNMB 1HHHB 2R4SL 3EZJB 4ELMA 2EKSB 1SEBB 4GMSH 2NY1C 1DVFB 3K8LA 1KLGB 5KANG 5L8LB 1ZLUH 4XNYL 4JFPA 5CJQL 3QNXA 2YA2A 1CL7H 1X4XA 1GL4B 4OF8A 1SYVB 1XIWC 4K3DL 1I3GH 1M7DA 3KLHC 1YDPB 1WBZB 1HXYB 1ADQH 1ORQA 4MXWL 4S10A 1A22B 3BT2L 3LSOB 1P4LA 4K3JH 4Z7WF 4K94C 1ZGLM 5B39G 3BPCA 1IAKB 3HI5L 1VDGA 3IDMB 1RHHA 3ZKXB 1DANU 4HEPG 4MJID 3JVGA 1QSFB 4JN1L 4YX2H 4ODTL 1K4DB 4JO3L 2X41A 5JHDA 2FZ3B 1MHEA 1ITBB 3BJLA 4V1DB 4KVNH 2AJSL 3SDCC 1FO0A 5AYUL 4YJZL 3IKCA 3QEHA 4MS8D 4OZFB 4MQ7B 4LCCC 4BFGA 5ITFA 1NGWA 1XF2A 4UI2A 1RZKL 4NRZA 5C0BE 2UYLB 3NIFF 5KSAB 2NX5A 4HIEB 3B5TA 4NQVA 2AERT 2HJLB 2ICCA 4GW1A 4KMTL 2A38A 1CVRA 3DO3A 5CAYB 1H15B 1F5WA 1NMAH 3MA7B 3RWJA 4HX1B 4QRQB 5DHXB 4M7ZB 3ROLA 4R8WH 2WM0A 4KKAD 4YE4L 1OTUC 2NY6B 4UTAH 1V3JA 3FRPG 2APXA 1P1ZA 1W0WA 5E8OA 4XTRD 4YDVA 3GBLA 4QNPE 4OF6A 5I1HL 4JY4A 3HNVH 2KQMA 5TGBA 4WI4A 4GG6B 3VGAC 4Z7NF 4LLDA 1DUYB 4MAYA 1PZUB 4Q0XH 4MQSB 1SBSL 5ILTH 4M6AA 2DQUL 2GY7B 3WIIH 4NZUL 4I1NB 2VDLL 1FVCA 1MCPH 4JPIA 4LIQH 5FUZH 3OTTA 1UM4H 2WIIB 4Z0XB 3AS0A 5T3ZD 3UBXA 1LP9A 4NKQB 1KB9K 5IMLA 4H25B 3GSXB 32C2B 4LASL 1M71B 5EZJA 4YPGA 1LE9A 4RFOL 1QRNE 3PV6B 4Y16C 2BVQB 3ME0A 3QQ9D 5LVEA 3LEVH 3DX6A 4PGCA 4PGBA 1S7RA 4X9FA 1T7YA 2H3NA 5EUKB 4FTVD 3BD4A 4PRPE 5FA4B 3S88H 5F1NB 1C16B 2A6DA 5K33A 5J12B 2B1HH 5I16A 4PJHF 3P40A 4LSVL 5DHYA 3RTQD 4LPVA 1TCRA 1B2WL 4LVHB 4OD2B 4KWUA 5FA3B 3VG0L 4D94A 3ZL4L 1ZT4B 1JYXA 3DRQA 4I5BB 3ESUF 3PJSB 3MV9B 4Z76B 1FSKB 5IBUB 1ZVSB 5GIRA 3MJ7B 2VDNH 1JWSB 1ZGLA 1X44A 3ARXA 1KIPB 1LEGB 3R1GH 5EORH 1JZ5A 4O00A 2VDRL 1U8MA 4D0CB 3GEWB 5E99H 3NFPB 1OAXH 1JZ7A 5F7UA 2B4CL 3ARWA 3LEYL 3MZTA 5I9QB 1A9BA 2CDEB 4R3SB 5E8NA 2VB5A 2NY7H 3DX7A 3ULVL 2VWEE 2E5EA 3CLEL 1VCAA 3QWRA 5B38G 4LSSH 4L8DA 5DJZA 4YHZL 2GUOA 3HZYA 1UWEH 3EYQD 1CDGA 2WLYA 2KH2B 3DSFL 4MA8H 1H0DA 4XP9L 1OD9A 4O2FA 4Z7QF 3RPIB 2R8SL 2QEJA 4OZIF 3V7AG 2VTFA 3L95A 1S5HA 5FKPB 5EU5A 1FYTB 2PCPA 3OV6A 3DV4B 3SKOB 3GI9H 1CLOL 3L3JB 1GCFA 1NDGB 5KVEH 4OFYA 5IIEB 3UYRH 4P5MB 2ZUWA 4F58L 4F7TA 5DD5H 5IT2L 4KVCL 4JO4H 2ZKHL 4QRUA 4ZD3L 1OAYL 2NY4B 4PLKD 2GHWB 4ZPVB 1J8HA 3U48A 3D85D 5KVDL 1BAFL 3T0AA 1QA9A 5HGDB 5EZOL 1SJHA 3DGGB 3O6ML 3U7YH 3OR6B 5DJCB 3MROA 4FZEL 5EBWB 1BFTA 3R4DA 1YA5A 2VL5A 4PJCB 5JPNB 3LS5L 4D9LL 3P4MA 5GGSB 4XP1L 5KJRH 4GAYB 3BZ4A 2C7UB 1F4YL 4WY7L 1CT8B 1YC7A 4OD3H 5C0AA 1MVFA 4XH2A 5KS9F 4M7KH 2J5LB 4PJBA 3DMMB 3D6GA 4MAUH 3ECBA 4GW4B 5T1LD 5DUBB 2LFGA 4HCRA 5DA0B 4PY8I 4FQPA 4XAWH 1E4XI 5ALCL 2JLLA 4KJPD 3FQXB 5A16A 3VXOB 2XTLA 4Z5RB 1A2YA 1BOGA 2G60L 5IM7A 3HFML 3L7EA 4EIZC 3GGWA 4NQEA 4K7PL 5IFHL 5I18L 4C4KT 3L1OL 4RWYH 4U6HA 1YMMA 4HKBA 2YWYA 3AC0A 1NC2B 1NCTA 4G6FB 4ZSOB 2ADIB 3NACH 3UO1H 5IFAL 2OI9B 3QEGH 3EGSA 1J1PL 1NKRA 3SKNB 2CK2A 3X13A 3QIUB 4UIKH 1KNOA 3OAZK 4XBPB 4I0PC 1OGTA 4XNUH 1FRGL 4AIXA 5C0NC 4EI5D 3FQUA 4LAJH 4M00A 4AEEA 4DKAA 1CR9L 3DRTB 4GAFB 1KC5L 1FC1A 2C4XA 2C9AA 5D8JH 4D8PA 3A6CH 4IRSB 1F6LL 4JQXC 5HGBB 5E5RB 2P5EB 1LDSA 1UZ6E 1NH6A 4KQ4L 5DSCA 5HTSA 4NP4L 1A1OB 3SE9H 5GZOC 1MIML 3G9VA 4YNYA 1CLYL 1XGRA 2XN9D 1KG0B 1NCCL 1TVHA 1FP5A 3FO2B 2HKFH 4G8GB 4JY5L 4U33A 1ITCA 5GGTA 2FB4L 4L4VB 4LU5L 1J05B 5EU7E 2C1PA 4E5XB 2EDXA 3KPQA 2CR3A 1T7VA 4KJWD 3CSPA 3H9YA 3QRFM 1BLNB 2NY5L 4MQXC 4NPYB 3UMTA 3FTGA 5KBNC 1FZJA 4RAVA 3SDAD 4V1DD 4RFNB 3ZKNC 1TJHH 4LSUL 2WY3A 1BD2B 3H9SB 2VZSA 1IGIH 3UTPE 5FM5M 1NBQA 4M5ZH 2D2OA 5AD0B 4GS7C 3ARVA 1ZHLB 3WJJC 3BSZH 4N5ED 4EQ2A 5DEZA 3F7QA 3SCMA 4X6CA 2O5ZH 5DMJB 4M6OL 5MP6H 5CCKH 3IVKB 2BK8A 4FFVD 3R8BB 1AD9A 5DJ0B 1D9KD 7FABL 5D1QA 1LEIB 1A64A 1MJ7H 3ARBA 5MENA 1FZMB 3K81A 3ET9F 1PD6A 5CHNA 1I1AC 5IVXB 4P57B 5F6IB 4XXCC 1JE6A 1JGDA 3B5GA 4ETYA 1S3KH 3GMRB 3O9WC 4RX4D 5FUCE 1WF5A 4KU1A 4PJEF 2QLVB 2AJ3B 3L5WA 3GKWL 2DL2A 1WQVT 3L3DA 1U91A 4MQTB 2JJUA 2ZUYA 2NY0B 4HC1H 5EOCH 3QIBD 1XF3B 2PW1B 4NO3A 1JPFA 1QEWB 2GAZA 2RBLA 5D7LE 5BS0B 1UEYA 4NNYA 1RZJH 4Q9QH 3UAJC 2FO1A 1RJZA 3VXNB 2JJSC 4PJIB 4OCWL 1QBMH 1A0QL 2NY3C 1OW0A 1CXFA 4F3FA 1AHWB 3ZTJH 4RISH 2OQJB 5H35A 5L8JB 2PYFB 3K46A 2YUVA 1XF1A 3Q48A 4HBQA 2G2RB 1NCNA 2K9UA 1RUAL 5B4MC 3LH2H 4LSDA 3ALPA 2V17H 4CN1A 1VADA 5E95B 2H2SC 4KZEH 1G7JA 3BAEL 4IOSD 2P8PB 5CSBA 1BZ9B 4D2NA 4CGTA 4TVPL 1S7VB 3KPLB 3HPJA 4JZJA 4JCMA 2MSPA 2V5TA 2AK1H 3O3UN 4LOUC 4PP1D 4P59L 4PJXA 4NM4L 3L3GA 3WE6A 3MV9D 1RULH 4OGAD 2VAAB 4P2OD 1JYVA 1HZHL 5J3HC 4HUVA 3TH3T 1JWUB 3WJLA 1X5ZA 3BKCH 5DEFA 4OLEA 3TBTA 3U2SA 3EZ8A 4L3ED 2OSLB 3TF7C 2C3WA 3FB6A 1MEXL 3HNTL 3LN4B 4NRYA 3V9FA 3UTSE 1PQZB 3CXDL 3ILPB 4RAHA 5M7QA 1PX4A 3WFCH 4QLRA 3G08A 5HPOA 1K6QH 1UXSB 3P0YH 3V0WH 5B8CA 3W5MA 1RZGB 4QWWD 1DEEB 5ESQB 1G9ML 4MNQB 3KJ6L 1YEEH 3CSGA 5DD3L 2D3VA 1RAMA 1C5CH 1E4KC 4S1RH 1FYTD 4QHLB 3C5JA 5FO8A 4HH9A 4ZYKB 1F4XH 2VR9A 3IS0X 3MRFA 3EYUH 4POUB 1A7QH 4HWEH 3EYFB 1A6ZA 2BNUA 3OSKA 3HCVA 3TBSB 3MGOA 2QSCH 5DUPL 4LLWB 2F9BT 4LSQH 1TZIB 2AV1B 3BISA 3FFDB 1TNNA 4PS4H 5HHOA 2N4IA 3N1QC 3PDOB 1Z5LA 1AI1H 1AGFA 1JZ8A 3QHFL 2IANB 2R2EA 1BM3H 5D70L 3A67L 3SPVB 1KJMB 5IV2A 1NGQH 4GRMB 5BVPH 4ESKA 4WO4D 4U1JB 1RURH 4UINH 1XCTB 1DBJL 5BW7A 2BNQB 2Z35B 5DXWA 5FGCE 3CFDA 5CEZE 2CKBL 2A77H 1U8HA 5DJYB 1XR8A 1ZT7A 3W9EB 1IM3A 1ZHBA 3CVHL 3OGCA 1A9EA 2CLZA 3QQ3A 2YPKB 4GRLC 4NKOB 1F13A 4RGOL 1S7UA 3AREC 3BXNB 3MLSL 3MNZB 4GAJL 3DMMD 2YZ8A 3WIFA 4RX4A 3QAZB 3MRPA 4N8VA 5T3XE 4PJ8C 4AQ1B 4DAGH 1FG2A 1AFVH 1ZSDA 5C0GB 1T7WA 4NRXA 4DKDC 2ZCLH 5T5FH 1NEZA 1FFQA 1NC2D 3M07A 4X7FC 2ENSA 4FABL 1KULA 4WFEE 3FQRB 5ECJE 4U7KA 4N9GA 4NQXB 4TN9A 3IDGB 3ARFA 4UOW0 2R69H 3G5YB 3PWVB 4OKDA 1E0OB 4Y5YB 1ZS8A 2YBRA 1QO3B 3BEVB 3UTTD 3SOBH 2WUBL 3PWJA 4FXKB 3HZKB 4LHUB 3QIUD 1EO8L 3DYOA 5DK0A 5HI3D 2FX8H 4U1HB 1JBJA 3RZCC 4G5ZL 1HHGB 2LV4A 1NFKA 4KI5E 3ZDYF 4IRSD 4P2OA 3O45A 1OVZA 5B22A 3VE0B 3VWJB 2CK0L 2EE2A 2YD2A 1QFUH 2P5ED 3BGAA 1INQB 3RVWC 1U8JA 5I8KH 1V5JA 1PKQE 5JO5A 2LQRA 3IFNL 4ELMB 4G3YL 3RVTD 4RA0C 1CYGA 3D3VB 4LSTH 1P69B 3O6LL 1NJ9B 4PJHA 3UTQA 2Z92B 2AJYL 4S2SA 1NGXA 4R4FL 4JHWH 3QUZD 3C09B 1T3FA 5C0JB 3QDJE 3DO7A 1HE7A 4FQ2H 3ARQA 1SJEB 1J0YA 1M7DB 1T4KB 4P3CL 4WW2B 5CEYA 5ISZE 1ORQB 1CXHA 5A2JH 5BZWA 3BPCB 3T0EB 3BKJL 1MCRA 3PL6C 3V4VH 1RHHB 4KK6C 1BD2D 1G0XA 5B39A 5DI8A 4OIIH 1F90H 3ULSA 2OZ4L 1KJ2B 3DJ9A 4OTXH 5D1ZB 1MHEB 5T33L 3RWIB 4J4PC 5ELIA 3TPUA 2Y36H 2GFBB 1DBBH 1FO0B 1S78D 3CH1B 3DSNA 4DOHB 3IKCB 3T4YA 3DARA 1YEGL 5D2NA 3EOAA 4KMQA 5ITFB 2PXYA 3UJIL 1XF2B 3TYFB 2R9HD 1HH9A 1Q9OB 3KPNA 4MDJA 1RIHL 3UJTL 4J2XA 1Q0XL 4QXGL 3QEUA 3RWJB 3CU1A 1PLGL 4Z7UF 4TNWF 4KXZH 4OV5A 1NBYA 2PNDA 5EO1A 3SN6N 1SY6L 4ZAKB 2ARJQ 1Y6NR 1UB6A 4YK4B 2NY0D 2AEQL 1WCBA 1P1ZB 1S9WB 3LKNA 1G6RL 1W0WB 3TA3C 4YDVB 3V6FB 3WIHA 2NYYC 3C08L 3FRPA 4U7SA 4JY4B 3O81A 5TGBB 2P8LB 4XPFH 4I13B 5D2LE 4LLDB 1S7XB 3MRJA 1W8NA 5CMAB 2Q3AA 1C08A 3SBWA 1FFPA 3UC0H 4RGMC 1H5BB 4UDUA 5F88A 4CNIB 3MV7E 2HRPH 4GQPH 5E4EB 4I3SH 5A3ID 3CH8A 4LLUA 1N64L 1R3IL 3UBXB 2XQBH 2VXTH 4G42A 3P3YA 4ETQB 5IMLB 1DLFL 3SE4A 4AT6A 3UTTA 3MRLB 4YDIL 2CMRH 3JV5A 4XC3L 1OT1A 2OL3A 3S5LG 2XTJC 3B43A 4EZMA 2A74B 2XZCL 3FT4A 4GT7A 2PR4L 4PGBB 4XC1L 2H3NB 4EBQL 1JL8A 4PG9A 2V2TB 3B9KD 5JZ7D 4FMKA 5FYKE 1IEAB 2A6DB 1A7PH 2ZZUT 4F33A 2DQCH 4PJAE 3WEXB 5I16B 1DLHA 5DLMH 3BVNA 4UILL 2Q6WA 1MAMH 5HHVL 1NUGA 2ORBL 1QLEL 2EYSB 5T1DH 1D6VL 1DQML 1EBPA 5GGRA 4GUPA 1MCWM 3NCBB 4C59B 3OGOE 4PJDB 1ZGLB 2DM3A 1DQDL 1G9NH 1QLRA 3RNQA 3UJJH 3STZB 1XGUA 1DBMH 4ODVL 1VHPA 5DRNA 1HK6A 4JRYD 1JGVH 5E8NB 3KJ4C 1DQLH 3DX7B 3R0MA 2N1KA 2NLJA 4NKDA 3TV3L 2BY1A 3TVMC 5ANMA 4L8DB 2GUOB 1HNGA 2ADJB 4G8IB 1JGLL 1I85A 5B38A 2B2XH 3V6ZA 3I6GA 4OQTH 5AZ2H 4UDTA 5AZEH 2FX7H 2IH1B 4MDIA 3KPTA 3MV01 3QA3B 1MFNA 2F53A 2CIIB 3L95B 1S5HB 1PYWA 5EU5B 3MXVH 5DMGC 4FZ8H 4R4BA 5E5MA 5KZCB 3N0PB 2XZAH 4PTUA 1JNJA 1CCZA 4F7TB 3ZE1F 5IEHB 2AV7A 4R7NA 4FQ1L 3PWLA 3VRLE 2V6HA 1NCBH 1MH5A 2IAND 1FG9C 1MAKA 4K94H 4OUUA 1MUJB 1RFDH 4WFHD 4NFDA 1WITA 2P5WE 4X9GA 2CUHA 4S1SH 5D7KD 3SHSA 2BNQD 4U1NA 4XVSL 3RDTC 1J8HB 4ZTOL 4QTIH 1PG7X 1FJ1B 4OAWA 2ICEB 1JV5A 4KRPB 2Y5TB 3VW3H 5IB1B 3PGCB 5F7LB 4LLYB 1OOAA 2WSKA 3P11H 4UV7H 4R26H 4W68A 5LG1A 4Y0GA 1I9RL 5I8EA 4OZGB 3T09A 3PP3K 3HMWL 3BKYL 5TDPA 2IC2A 3UDWA 2ARJB 5C0AB 3W9DA 5JHLH 5HGAB 3WDHA 5B3JE 3BWAA 2VLRA 3EOTH 4PJBB 4OFKA 4F57H 3SKJL 5DMKA 4N9OB 2H2PD 4FNLL 4G8EA 3AUVA 2QHLA 2J8UF 4PRAB 3HN3A 4LMQI 1UM6H 3MUGA 4F7EA 3H7BB 5CBEB 5CJOH 4HGWB 4MSWA 3GMNB 1HYSC 2IG2H 3QG6B 2YPLB 4Z7VA 4WI3A 3P4OA 3REWA 1YMMB 2GSGA 3MLVL 2FBJL 1ZWIA 4FA8A 1IC7H 1I9IL 5IBTL 1FAIL 1TPXC 3RBGA 2P46B 1Q9LA 2HT4C 1GGYA 2QBWA 4HF5L 2DBLH 1MFDL 4L8SC 3X13B 1TZGL 2DYPB 4MD0A 3L3IA 1EMTL 1VPOL 3WXVL 4XNZB 2CUIA 4U6TA 3X3FL 5DTFA 1T0NB 4F15C 1I8KA 4KROC 3IRPX 2EDNA 3CFJB 5D1XD 4WU7A 3DVGB 1BJMA 2DM2A 3BH8A 3LHPL 3WFBH 3MBXL 2GEEA 5D5MF 4JFHE 2R0LL 4JRYA 2XXMB 1CXKA 4UB0H 4O9HH 4JFZL 3EFFA 3IFLL 5C07E 4NUJB 1B4RA 1J0JA 1AP2B 4HIXL 3IFOA 3T0ED 4V2BA 2D03H 3I3DA 4HBCH 5EDXA 5FYLH 2C1PB 4X5XA 1QFHA 4IHOB 5IR1A 1D6EA 4K07A 4XVTL 1FH5H 2XKNA 3CK0L 4F7MB 3O3BA 3I75A 1FZJB 2EXYC 5D1ZD 4FS0A 1EEYA 3PQYE 4JAMA 4M4RA 1T83A 5J1SC 1NGYA 2HTLC 1LO4L 2G9HA 4ERSL 3RUGA 5IVOA 6FABL 3TJHA 1MFBH 3SKMB 1LDPL 4NM8L 4XVJH 4LLQA 3DTXB 5DQJB 1J11A 3GDBA 2WP3O 2FRGP 3S35L 3LS4L 1PJ9A 4JFEA 4H20H 4XCCH 2BVUA 3WNKA 5DWUL 3FCTB 1KSRA 1AIFB 4UUJB 2J6EA 3BX7C 2W07A 3K1DA 2E7LC 2UWEA 3O41B 5DHVA 4YHNB 5D1QB 1J9CT 3V6OA 4KUCF 3ISWA 1D5IH 5D7JC 4JFDA 3U83A 2EDEA 4M61B 5CHNB 3NH7L 3E8UH 5FYKU 4O02L 3VCLB 5EZIH 5FOBA 4KJQC 4DZ8A 5FYJL 4X6FB 3MODL 2ADGA 4QOKE 3ZSSA 2BHZA 2IF7A 5TQ2L 1LK2A 2VIRB 5LCVL 5SV3A 3ZYJA 5T3ZL 1VFOA 3U82B 1X5LA 2VKWA 4EN3C 1RJZB 3BD3A 5MERB 4G8FA 3CUPB 3BPOC 4QHNA 2A83A 5I1DA 2DMCA 3P4NB 2B5IB 2ZNWA 1KB9J 3BESR 5CGTA 1AXTH 2R4RL 1GZPB 3INUL 1MRFH 4EJ1C 1QSEE 4U4BA 5IW1A 1BGXH 5F3HB 4W6YB 2XWTA 4QF1B 4F9PA 1UYWH 1NBZA 3TT3L 3X14A 5HYSG 3FB7A 3MBEC 3MLWL 4K3GA 3RIFK 1IL1B 43C9A 2EH7H 5DC4B 3F8UB 1KCSL 3QEQE 3LIZL 1HQRA 3OKOB 5CEXA 5J4MA 3EDDA 4QY8B 2QTEA 2W9DL 3V8OA 4LRNH 5IW6A 3MOAL 5I74B 3EOBA 5IKCB 2FATL 4MB4A 2MPAH 4BZYA 3RAJH 1FNLA 5DEFB 3EYSH 4X6DF 4K7PX 4GKSB 3IDYB 4ZUTB 4LKCA 2D0HA 1SYSB 5GGTL 1QBAA 2DQEH 1CIDA 2HFEA 4KJYB 5TH2A 2VN4A 5D93B 1JZ2A 1JPTL 2GJZA 4ZUVA 5IG7B 3O0RH 5B8CB 2W59A 4GOSA 4ZOCA 4NQCA 1RZKC 3HA0A 4I2XE 3IRZA 5F89A 3RWFA 3T0VA 3VDBA 2BOCB 3SDXE 1IC1A 2DIJA 5DVKA 1AO7A 1DN2A 1BIHA 5HVHB 2X4UB 4RAUB 1KF9B 1WWBX 1YNKH 4NQDA 4F2MB 4M48L 1OQXA 5KAQF 1T2QL 5JDJA 2X4RA 2DIAA 4HFWA 2DI8A 4LARH 2MKWA 3L3KA 5EO9A 1TLKA 1CTNA 3QG7L 3TO2B 2EIEA 4FQXB 3TIEB 1IAMA 3IU3A 5FGRA 4S0TD 5KVFH 3UZQA 1VACB 4Z7WB 4PJ9C 3PV7A 1B6DA 4NT6B 5HHOB 3W0WE 5IMMB 4XP4H 4KRPD 2A6IA 1T80A 2ZCKH 5CLTA 1KCKA 4NQSA 5IF0B 5D7IF 5F7KC 1OP9A 2MJWA 2ZUUA 1ZHBB 1EXUB 2DWEB 2DLFH 2Q86A 4P46A 2HG5A 4H88H 2L7UA 3EFDL 3O3DA 4GRWF 1P84J 1QYGL 2DJUA 3OF6A 4PRNA 4R2GD 1QACA 4J12A 3TBYA 4HQQL 5CP3H 3DIFA 5I1CH 3OJDA 4BZ1L 1J0HA 3MRPB 3B2VL 4BH7A 1C1EH 5BV7C 3HR5A 3MCG1 4P23C 1VFUA 5TE6H 5JW3L 1DBKL 4F9LA 2ESVB 3KPOA 4ZFOB 4P4RB 1U8IA 3S37L 1MHHA 2YPLD 2L0DA 4HD9A 3KGRA 1D5MB 3BZFA 4PRHB 1JZ6A 4MA1B 3AMLA 1UWGH 3VWKA 5F1OB 1NEZB 3BWUC 1P9MC 3C2AL 3STLB 3VXPA 3DOSA 4PJFE 1L7IH 5E9DB 1DVFC 15C8H 3HI1B 4XWOD 2WUCL 2LVCA 4WHYG 3MGAA 5TE4H 3Q2CA 1OSPH 4HXBH 3ARFB 1EK3A 3CZJA 1ZS8B 3CFCH 2IBBA 2GKIA 3AS3A 4WUKL 3D39E 1SMAA 2DKUA 2DYPD 4S1DC 4POZD 5IMOB 1A6TA 1N3NA 1PBYA 3GMLB 5BMFL 3K1KC 1EX0A 3ULVC 1GPOL 3HZVA 3ZKXC 5EIVA 1W72A 3DROB 4LSPL 4H8WL 3ZMRA 1NLBH 3N1MC 5I66A 5DD6A 5D6CB 4ODXA 3IF1B 3O45B 4OBRA 2CDFA 3BIBX 2CJUH 4PPTA 4DTGH 4FRWA 1BFVH 3GMMA 5C0BA 4NKMA 1DFBH 5CJ8A 1EV2E 3BGMA 1M6OB 1N8ZB 4OLWH 3C8DA 5F9OL 4QRPB 4PJHB 5BZDB 4C83B 3CSYB 4C56B 3VMPA 2BZDA 4LF3A 3CVIH 3VFVA 4AL8H 4P5TB 3DO7B 4WI9A 3GSRA 5LJYH 1MHCA 4YHMH 4YQXL 2I9TA 3NFSL 3HMXL 5CEYB 3BN3B 1D5XA 1JF1B 1YEIH 2KQNA 2VR4A 3AM8A 3QH3A 4R0LC 4XP5L 1FFRA 3N06B 4NO5B 4MXQD 2PYEE 4R9HA 2PW2B 4HWBH 1P4BL 2NY6C 5I6XB 1SM3L 3H6JA 1J5OH 3ARDB 2CRIA 1YEJL 2OXHA 3RY6C 4ZFFA 3F7YB 4BH8B 4X8JA 5KN5A 1CXLA 1G7QA 4DFIA 1FL5B 3LKRA 1XMWA 4JLRA 1CG9A 4K71B 3VG9C 2NY2B 4OM0L 3OAUH 1AD0B 2FIKA 3G5VA 1I75A 4OZIB 4LHQB 2JB5H 4Y5XC 2DQFA 1JI1A 2F5BL 5DD0L 3EOAB 4FP8H 1L9MA 3GSWA 2PXYB 2IFFH 1QRNA 3VXMB 3S96A 2AJVL 3KPNB 1XF4A 1R5VA 5KVGL 2CD0A 5DZNA 4G6AC 3RA7H 5CZXC 1PFCA 1RIUL 2PTVA 4PRPA 5GJSH 5GS1A 4APQA 2DD8L 4HT1H 3UZEA 4WV1A 3IETA 4TPRH 2AABL 1LO0L 4YR6B 5EO1B 4WDIA 1OM3H 1LGVA 1F4AA 3QBTB 3T0WA 4PIRF 2FSEA 2H32H 1WAAF 5GRJH 3T3PE 25C8H 5ACZA 1EERB 3LKNB 5E6IA 2BOBB 35C8L 3ZKMC 4UIMA 1I8IB 4LVHC 5DRWA 3QXVA 2DMBA 4HIHB 3TO4A 4HEME 5L6YL 4FQHA 3G6DL 3BYTA 5HYQA 3RJQB 2WINB 5D6DA 5F88B 3WD5H 3F12A 1CFQA 3PWPE 4EDXA 3H3KA 5EU3A 4UAOC 5JW4N 4ZUWB 3WHXA 3T77B 2X9YA 1H3UA 3SE8H 5I1IL 1A6VH 3THML 2YEZA 4G42B 1A7RL 5C6PB 2IGFL 3LB6D 5ALBL 3DYMA 4MNHB 4OSUH 4D3CL 2DLIA 1SEQH 1YEDA 5IB5A 4HFUH 2EO9A 1JUFA 2P7TB 1W8OA 3U4EA 1JHKL 3FT2A 4YXHH 4PG9B 5IJVB 3OAYH 3AB0B 3QCUL 2Z8WC 3RWHA 2Z91A 1QHOA 2VJXA 1OTTC 2R0ZH 2JCCE 4EQ3A 1UJ3C 1AY1H 3S36X 1D5BB 3M8OH 1FLTX 2NXYB 2XPGA 3G6AA 2JIXD 4PLJD 5E2UL 1MREL 3QJFA 3U36B 5DC0A 4JKLA 4GUPB 2P45B 3D0LB 1JK8A 4QRRE 3OJ2C 1JPSL 2UZIH 4O58H 4NO2A 1VGKA 3HE7B 2FGWH 1I3UA 1N6VA 1NC4A 1QLRB 5CKGA 5I2IA 1MY7A 2YD7A 5E2VH 4XT1C 4EOWL 4AQOA 4X80L 1CD0A 2ZSVA 2VDPH 4XI5D 1FVEA 4JY6B 1Z9OA 5IMKA 2LAAA 4CRPA 1A7OL 4UT7L 1QKZH 5HHME 3HUJF 5ANMB 2OP4L 4UQ2A 5D5MA 4YDLB 2BSED 3G6JF 5M95B 2CPCA 1QBLH 5GZND 3V6ZB 3V5KA 4CVXB 2GT9B 2VXQL 2YSSA 2AS5M 3P73B 1VEPA 4UDTB 4FQXD 3BN9C 2F53B 5HHXH 4JJ5A 1EJOH 1PYWB 4RFEB 5DMYA 5HI5C 3MV8E 3RFZC 1XGPA 4R4BB 3KYKL 3LRSA 2ITCB 4IIQC 5EOQH 3GJFH 2AV7B 4PBXA 3TJEL 1MLCA 4I9WE 5BO1L 3UTZA 1KCVL 1CU4L 4M93B 3JV6A 4XPHH 2DQJL 4LEXL 1TIUA 2YMXH 5K9JL 1S7SA 4PJ5D 5IGXL 2KDGA 3GB7A 5F71A 1I9EA 1R24B 4OLXL 1F6AA 3ORJA 5J6GA 3RI5K 5ADOL 1KENH 5J13C 2N56A 1U8KB 3WIHL 2Q8AL 3RGVA 3D2UD 4XMPH 1I4FA 4YIQA 2XA8H 5J6HB 4JZNB 1LNUA 1ZV5A 4LCIL 5JQ6H 4Y4FA 3M1BA 1MI5E 5C8JA 1MELA 4KTEH 1AR1C 1BBJA 2IADB 1HHJA 2ESVD 5C0CA 1ERNA 4XMLH 4DKFL 3GSNH 4PRHD 1KPVA 5DJAB 3ZKSD 2RAMA 5HY9B 1XH3B 3CJJA 3MUGB 1NUFA 1UM5H 4UV4L 5E9DD 1UB5B 3WHE0 4MA7H 4DW2L 2XWBA 3P4OB 4PJEB 4PP2A 2OTWB 4GKZA 3QXAB 5CD5C 4H26B 1V7NL 1OWRM 1WSST 1A14H 3AY4C 1F97A 4IS6B 4RRPG 2ID5A 2IMNA 4GRWH 1QNZH 1JPGA 1MRCH 1Q9LB 3PHQB 3T2OA 5ITBH 5E8EB 1JGEB 5EUOE 4GBXA 1U95A 1YQVL 3VFRA 4LL9A 2V9RA 4JZOA 3NABH 1MHPL 3SDYH 4M6MH 3FQNA 4RFNC 2BVOA 5DTFB 1FFNB 4R6UA 3K8KA 1RU9L 4JANB 4KKBD 4Y2DC 5ERWA 3NCJL 2F8VA 4WFFE 4QRPD 3WHE1 2MNUA 2NY1B 4M7JH 5SX5K 2AJXH 3ZE0E 2B39A 4ZQKB 1QR1A 4C56D 5C2UB 4IJ3C 5FHAL 2MFNA 5CEZD 1N5AA 4HWZB 1U8NA 3HG1E 2MCG1 3PGFL 4P5TD 3LPWA 4WEMB 5GGVY 1HEZB 4K23H 4XNQB 2XRAH 1S9VA 3BE1L 1XIWB 5DQ9B 2E3VA 2FWOB 2MQ3A 3QPQD 4BK5A 2BNRE 3EFFB 1I9JL 3L5XH 3GIZL 5DUML 2EECA 3RWGA 1TZHA 3HC4L 2GJ6B 5F44A 4U3CA 2DQGL 3EO9H 3EUUA 4DUXA 3EJZD 4RGND 5T3XD 4ODHH 3ARDD 1KB5H 1I1RA 2V2XB 5I1GH 2ATKB 4AEIH 3GNML 4LCYA 3QO0A 5D7LA 3C6LC 2NY2D 3SY0B 3QULA 5TJWK 1MFAL 1EEYB 3OKEA 5I75C 3IU4L 3HC0B 3N50A 4YFEA 4ONHA 3TWCH 1WZLA 1MF2H 1LO5B 2R1XA 2EDQA 2MKLC 3VXMD 4WI6A 5K9OA 4IBLT 4EVNB 5L2KB 5LXGH 1SBBA 4L29A 3GSQA 4G7YL 2DTMH 3IXAA 3VXRE 1ZEAL 5CJXC 5GS0C 1NCAH 2RCSL 1MQKL 5F9WC 4XCYA 1G1YA 3MCKB 1WCQA 3PWNA 3WXWL 2ZCHL 4JGMA 5HBBA 2J1KA 2VUOA 1FGVH 4GJTB 4J7RA 3WFDH 2QR0B 4XP6L 4ENED 3LKSB 5EPMA 2DLHA 2QQKL 2R2HA 5HPMB 2ADGB 2IQ9H 5C7XL 1T5XA 3TN0A 3H0TA 5BJTA 3QDME 5E56A 4U2ZA 2FYYB 4UU9A 1LK2B 4J1UB 2NZ9D 1DL7H 4FQJH 4MNGE 5FGSA 1S9XB 4TTGA 4P2YA 5ETUA 2FD6L 3P9WB 2X4SB 3LV3A 4P2RA 5E08L 2E7HA 3BP7A 5GJTH 3KXFB 3UTSA 5I71B 2W65B 1R3LB 4DQOL 2A6JA 5D71L 4RSVA 3ULUC 1E4WL 4YBQD 4L5FH 1JZ4A 3ULVF 4XCNB 4U31A 5I1DB 3GRWA 1GGBL 3SE3C 1AXSA 5E1AA 3L6FA 3SQOL 3TFKD 5FHBH 2I27N 5ISZD 1NLDH 4XNXH 3DGCR 1AR2A 3U46B 1MCHA 3LRGA 2NR6D 4Y16B 1YN7A 2YN5A 3I50H 4NWTH 4ZDHA 1E4XH 3ZT5A 4JFOB 5GGUA 2ILLA 3QUMH 5SWSB 3TYGH 3IGAB 1KTKE 4NO0A 3KPPB 2W0FA 2BXYA 1GHFH 2F58H 3IDJA 5TE7L 1JNHA 3RRQA 4NFBA 5HYSA 3GMOB 2FEDC 2ITDB 3PG2A 3MMEA 1F4WH 5CEXB 2NXYD 1IT9L 5F7FA 1CBVL 2BFVL 2FHFA 4MJ6B 3IDIA 4HW6A 3O4LE 1Z3GL 5F1IB 4AH2B 1OGAE 3BKMH 2P24B 5HDBF 2X70B 4KTYA 1MJUL 3H3PL 3GI8L 4OLVH 1CFTA 3TNMA 1J18A 5SWQA 3HE7D 3MJ9H 5T1MB 5DJ8B 3I3EA 3VRJB 4Q6IA 3CMOH 3LPGA 1KN4L 4LKCB 3F7VA 4YDJB 1NFDE 4Z95H 4PJGF 4YHOH 4GMTH 3QI9A 1X4ZA 4Y4KA 4X4ME 3UXFA 1FCGA 2Y07L 2VXUL 3CX5K 3QO1B 1VERA 2AW2A 2GJZB 3IJHB 2FCBA 1AQDA 4ZUVB 3RWFB 2EE3A 2D31A 4NQCB 2ICWJ 2F15A 4WWKC 1EIBA 5J1AB 1YEHH 4QRTA 4PP8C 1D3CA 4NNXA 4PB9H 1AO7B 3GHEL 3RU8H 2MQ0A 3P30L 1N6QH 4NN6C 4MCZB 5GXBB 4NUGH 4PRIB 2X4RB 1DBAL 1OY3B 1UVQA 2D7TL 4HFWB 2BSTA 3A6BH 3CIQA 3QUYC 4GKNA 5H94A 1OARL 3GSOA 3RKDD 5TF1L 3P0GB 4PB0L 2HVJA 3V5HB 2I60L 4W70A 1QFWL 2ATPA 3MV7D 2B0SH 3BYYA 1T7ZA 1P7HL 2J6EL 3MNWA 5DA4A 2CH8A 2A6IB 5HHNA 4NQSB 2A73B 3CFEB 2CIKB 1L6ZA 3U9UA 3CC5A 3DUUA 3GSUA 2Y9RT 2VLJB 4P99A 4LLAA 1RIVH 2L7JA 5DJ2A 2MCPH 3RVXC 3I3BA 2QHRH 3FQTA 4UQ3A 4LPYA 1B4JL 5I19L 4WU5A 5C08B 3HNSL 2X4NB 1TJIL 4NFCA 5GQBA 3OJDB 4N0UE 3O4OC 4XCEA 5JOEA 4XZUA 4TTDD 4IDJL 4OF0A 1R0AL 3GK8H 1NCWH 1PKQA 4Z7UB 4ZPTA 5I30H 1YPZE 2HYMA 3QUMA 1U8IB 2C3XA 4PY7B 1MHHB 1BWMA 4E42B 3JZ7A 1EFXB 3VWKB 2R29H 3QDJA 3O6FD 4WFGE 1TETL 1HINH 1YYML 3TNNB 5ISZA 5KANI 2H26A 4WW1B 4WJ5A 5T3ZE 3O2DH 3S34L 5GRWA 4M5YL 5SX4I 2O61A 3OAZH 1BQLH 4YGVB 3LQZA 4JFYB 2QQLL 5A1AA 4DCQA 3EW3B 2YK1L 3Q6FB 4X4ZA 5GGQH 2ZSWB 3HRZA 1VFBB 2ADFH 4I4WB 1JNLL 4FTVE 3MLXL 2IALA 3E2HA 4DN3H 5K59E 4M62H 3JVGC 5DD6B 5CZKA 4OLYH 1CI5A 2NY1D 2G75A 2P5WD 5CJQH 4OZHE 3EDJA 4PREA 4LSRL 4NN5B 4IRZL 4P4KA 1A02N 4HUMB 4G7VH 1XIWD 4L8CA 1DP0A 3EYVB 3DBXA 1AJ7L 3KLHD 4MJ4A 4NC1C 4OCRL 4JPWH 1TTFA 4X7TB 1BP3B 3RX8A 2GJ6D 1G7LA 3QIWA 3VFVB 2J88H 1HKFA 3H42L 3N9GL 1XCQB 3E6HA 3V4PL 1KJ2L 2BHYA 3K0WA 3FO0L 1C7SA 1ZTXL 4JN1H 2C4FU 1XZ0A 2VITA 4FHBD 4HJ0C 4JO3H 2UY6A 2V9QA 2CQVA 5E6YA 3VD4A 1PW3A 1MQ8A 1RUKL 3CZFA 3K80A 4YK4C 3SDCD 5AYUH 4Z78A 2NXZB 5D2LA 3WNMA 2X4QA 4LPUA 1D5ZB 1OAZL 3HUJA 4X8JB 3TZVA 5KN5B 1RZKH 3LKRB 2GYSA 4GS7B 4OGXL 3G6JA 5C0RH 4KKLC 3MV7A 4KMTH 5BXFB 4MAYC 2FIKB 5L2KD 1HHKA 4KDVA 4KQ3L 4X98A 2JF1A 4R90H 4MVBA 4NBYB 3GSWB 4XMKH 2VLLA 3WFHA 5AG9A 3F6LA 4Z77B 1LQSR 4X5WA 4BFIB 4YE4H 5F9JB 4BK4A 1OTUD 1R5VB 5JR1L 4TQEH 2OXGA 2NNAB 1S5IH 4JO1L 3FAXA 3VFTA 1MWAH 5B3NA 1T5WB 1I1AB 4Z8FL 4QYOA 5TQ0L 3NOIA 1CD1A 3O9WB 4PJAA 1UH4A 2Q76A 2WLZA 2R2BB 3QCTL 4WDIB 3F6IA 5ACZB 5JQHC 4Y4HA 2VDMH 2DQUH 1KPRB 4HKXB 1YQ2A 4NZUH 2VDLH 3KXFD 5CSGA 5AUMA 3CFKA 3DUSA 4QHMA 3D1MC 4WUUD 1OP3H 1HN1A 4JFHD 1DQJA 5HYQB 3OKNB 3IDUA 2NY3B 2Z8VC 5C9JB 4LASH 3O6FA 1RJYB 4HUNB 4I8DA 3BIAX 3KAAA 4RFOH 4EDXB 2FDBP 5BV7H 2DJ4A 1WC7A 5F7NC 4Y16D 1M05A 3C5SB 4NZDA 1JFQL 2VDOL 2J8UB 2YEZB 4ZODA 5DJDA 2WK2A 1ZHNA 1I3GL 3MRMA 1W72L 1VFAA 4G6JL 5I15H 2N7BA 1H3VA 1YEDB 1I3RB 1BQHB 3MLUL 3MRGB 3U4EB 1I8MB 3VG0H 1NMCC 4JRXB 1CFSB 5EIQA 3LQAL 4CADA 1FNGB 2Z91B 5HXMA 2E9IA 4D9QD 4YX2L 4ZFZA 5FYLD 3KDMA 2VDRH 3S3SA 4DGVH 5C3TA 4UTBH 1IAIL 2WAHA 1T21B 4YWGL 5KOVC 4KVNL 4BQBA 4Y88A 4JN2B 2QV2A 3ULVH 1U8LB 3JWDL 1K8DA 3V4UH 1NUDA 2MQCA 2M8XA 1WTGT 4FQLH 3IJSB 1WWCA 1VGKB 1GXEA 3QNYA 3DSFH 3EHBC 2X9WA 1BFSA 2ZSVB 2R8SH 3N1FC 5JUEL 2GW5A 2O5YL 4RQQA 1CLOH 3J8F7 5CSZA 5HHPB 2FR4A 5D5MB 4R8WL 4F58H 1F3DJ 1ZOXA 4PRID 4A2LA 3FOMA 1YY9C 5J56B 2ZUXA 1EEZA 1QSFE 3WS3A 2ZKHH 4I48B 2CLVA 4JJ5B 5BVJA 4ZD3H 2AJZA 3GFUA 3V0AC 4PD4K 3HNVL 2RFXB 4V1DE 5JLZB 5KVDH 1QZ1A 2R23A 5EZOH 3IB4A 1GJIA 1RSFA 4Q0XL 4DK6A 1R3JA 4FZEH 3TLRA 5ILTL 1I1FB 5EU6B 3OPZL 5FIEA 4D0BB 3HAEG 3BDYH 1S7SB 4D9LH 2VLJD 1ZXQA 1UM4L 2BHUA 2OJZL 4XP1H 2EDDA 3VFPA 5KSBF 5D7SH 4U1GC 4P3WA 1F4YH 4WY7H 4GRLB 1FV1A 1CGSL 1X5GA 1RJLA 2BRRH 5F97E 4N90E 1F6AB 3AAZA 2E9JA 1NEUA 2ED8A 5C08D 1K5NA 5MEOA 5EU4A 1IEHA 4RMVA 3LEVL 4YIQB 4G6ML 3G9AB 1DEDA 1GZQA 3ULUF 1FFOA 4Y4FB 1PY4A 1C5DA 1BBJB 1HHJB 1S7QB 2G60H 4HMEA 5C0CB 3HFMH 3GMQA 4GG6E 2YD5A 2EC9T 2IAMA 5IFHH 4P2QD 3L1OH 4WEBH 5LAXA 4JQIH 3QUKA 3GSVA 1EFXD 2A9MH 3QZWB 2BSRB 4G9FB 3O6KH 2DLTA 3RP1A 1LE5A 4HS6A 4TSAH 1PVHA 1M7IB 5C07A 3R1GL 1A4KA 2C3VB 5E99L 3NCMA 1OAXL 3SQBA 2M1KA 1UZ8B 3LKQB 1II4E 1J1PH 4BKLB 4X9IA 5D72L 1YJDC 4DVBA 3OHXA 2NY7L 5F7DA 5L9DL 2D9CA 4I0PD 3ILQD 1FRGH 5I17B 1Y6KR 4TSBH 1UWEL 3H3BC 4Y19A 1OF2B 5EA0H 3WLBB 2VC2L 3RZCB 3BDBA 1V3LA 2FBOJ 5DJ6A 1S9YA 3OJMB 4BYHA 1KC5H 4JM4H 3PQYA 3T0DA 4Z18A 1QLFA 3VFRB 3L5IA 4UOJA 4JZOB 2DQHL 1B9ZA 3CFIC 3GI9L 3RWCA 4OI7A 3DI3B 4FQIL 3F5WA 3MUJA 3MV9E 4NP4H 2J7LA 5DD5L 2RJMA 4PUBH 5HYEA 3SDDA 1MIMH 5GZOD 4UT6H 4CAGA 3GZKA 1CLYH 4PBWD 4PJ7E 1QR1B 3C8KB 4LAQH 3L3OB 4L3EE 1QFWI 3SCMC 1FNSL 4UBDC 4LU5H 2DWDA 3QDGD 1BVLB 1FPTL 2X1OA 3U7YL 4QHKJ 5A2FA 1XGTB 2AK4D 1T0MB 1T20A 1BFOB 4TUJA 4MQXD 4LQFL 5D1QC 4GO6B 1FNEA 1TZHB 3FHAA 3MRNA 1MCOH 4X6DB 1I1YA 2H8PA 3ARBC 1PSKH 4LSUH 3RL2A 3ZKND 2B20A 4G43B 4QOKA 1FYTE 4LCYB 4OD3L 4MA3A 1UACL 5C2BH 1G7HA 3VI4F 1N5YH 1F2XK 2A6KA 3MO1B 3QULB 2JK5B 2Y25A 2H9GB 5K9KA 1KN2H 1IGFL 2EE9A 4U1LB 4PRBA 4XCFL 2ED7A 2KZ1B 4OB5L 3ESVF 4O2CA 5H2BB 5GRXG 2XNAA 5GSRB 3ES6A 1QSEA 5K9OB 3OKDB 1HHIA 1C12A 3ABZA 4QTHA 2F54B 1OW0C 3C60A 2VUYA 2P1YA 5E70A 3GSNB 1IM9B 1I1AD 2R1YA 3GSQB 5FXCH 4JGJA 4U1KA 1CVSC 1BF8A 4PJCE 3EO1A 3QEQA 3O9WD 3R8QA 1G7PA 3GKWH 2FJHA 3UO1L 2OR7A 3BQUA 4Y5VA 1DUZB 5ADPL 3VFGH 4PR5B 3U4BH 2E7CA 2Y72A 4ELMF 3MLYL 5D7IB 4JZJC 1S7WA 2EDBA 4HUUB 3UAJD 3UPRA 2UZXB 3IYLW 4OCWH 3BIKA 1YN6B 1J10A 3ARGA 5EC1A 1X5XA 5BOPA 2G5BB 4O5LH 2H41A 5JW4M 2NY3D 3KPMA 2A1WH 4WI7A 5D8JL 3NIGF 3T2NH 3MRIB 2OR9L 4P2RB 2I25N 3WJLC 4H8WC 2JE8A 1RUPL 3WNNA 1X4YA 1QD0A 5E94A 5B4MD 4I77L 4XGZA 2H2SD 3BAEH 5E1AB 4I2XA 5IHZA 4ZSOE 3D25B 4TVPH 3SDXA 5INDB 4EUPH 1F00I 4U49A 2XTJB 1SMOA 5GSVA 4Q58C 1RHFA 1YN7B 4ISVA 4PDCE 5B8CC 4LOUD 4P59H 5ENWB 1MLBA 2HKFL 3N1GC 3Q1SL 1ND0A 4JRXD 4MD4B 4NM4H 4RDQG 1HILB 2W0FB 5FB8B 1FHGA 3OXSA 4X0KA 3MJ6A 3VRIA 4LNRA 5J3HD 3S97C 3PP4L 1F11B 4HK0A 1HQ4A 3IDIB 4WGWB 3W0WA 1TJHL 3DX8A 5INCB 3PHOB 2FJFB 4HKJA 1CDUA 1IGIL 2P5EE 1MFCH 5I1AB 5SWQB 1KB5B 1ETZA 1IQDA 3GMPA 3IKKA 4L3CB 1LILA 4QCIB 3BSZL 3KJ4B 2IPKA 3KJ6H 2P49B 5E2JA 5DD3H 2OJEB 1HOCB 2YS4A 4Y4KB 3O11A 5MP6L 3TVMB 5CCKL 5E1HB 3RWDA 5BW7C 2ZPKH 3BDXA 1DJSA 3TPKA 1YEKL 4G8GE 4NDMB 2A2QT 4XVUC 1WIUA 2ZJSL 2Y5EA 2D31B 3U30B 2GTZB 3AMKA 1CFNB 2NW3A 4Q9RL 1FGNL 3FN3A 2XWJA 5DUPH 4YAQA 2R56L 5J9PB 5IEKA 3BHBA 4OJFL 1ONQB 2EIZB 4X4XB 2WBWB 1S3KL 1BD2E 1LP9F 2AEWA 1EUUA 3H9SE 1ZT1A 3TH2T 5IROA 1U92A 4HC1L 2HFFA 2QADB 3BZDA 4PJFA 4OV6F 4ZXBA 5EU6D 1RZJL 3RDTB 2CKBH 1BEYL 5HDQH 4GRLD 3DURB 1L0QA 1QBML 3KVQA 4HSQA 4Z7OE 1X5JA 3D39A 3BRFA 4YEFA 3MLSH 3ARED 4X9BA 1CICA 3DUUB 1BZQK 3ARFC 1ZA6A 3TBWA 3VFOA 3QUXA 1RZ7H 1FZKB 1OAUL 4YHIA 2NPLX 4PJ8D 3LH2L 5GS3A 2V17L 4ALAL 1KIRA 5ICYB 4LLMB 5IVXE 2VH5L 5ICXA 4KZEL 1BECA 3FQTB 5JTWA 4UQ3B 4WU5B 5JXAL 1P7QA 4J3XA 1RZIA 2AK1L 4PP1C 3FONB 2J4WH 2UUDK 3MYZA 4KUCD 3K4AA 2HJFA 2I9LB 5HJ3A 4K9EL 4YUEL 3UPCA 4OGAC 5GS0H 1PKQB 1HSAB 4P2OC 4QRRD 3GRWL 3QUMB 5B21A 5GPRA 2VZTA 4GXUM 4U2YA 4PJIE 2Q20A 4PV9A 4OIAA 4J8RA 3T1WA 5I8CA 2WUBH 1IAII 4XPTL 2AJUL 1BX2B 1EO8H 1BJ1H 1BZ7A 4B7IA 2PTUA 5HHMD 1TPXB 3WFCL 4WJ5B 3VGFA 5JA8B 3JTSA 1WBXA 2PYEA 3PUCA 4G5ZH 1WBYB 2WIMA 4RCAA 1SHMA 3G5XB 3V5DA 1S7TA 5BQ7A 3LQZB 5C0DB 4L8SB 3ULUH 1MJ8H 1YEEL 2R0KL 3ZZ1A 2CK0H 1C5CL 1U58A 3C5ZA 5I6XC 4OLZL 3TM6A 3RVWD 4F15B 3M17A 1N0XL 1F4XL 1Q9WA 4IRJA 1FIGL 3D5OF 2DIBA 3EYUL 3IFNH 4I9WD 2ICWA 4G3YH 1NGPH 5CEZL 4HWEL 5EB9A 3O6LH 4XB7A 1TMCA 3LDBB 4R4FH 4LSQL 1P6AB 4MWFB 1O7VA 1AI1L 3I02B 3L9RB 1BM3L 5TFSL 5D2NC 3MRCA 2MHAA 1AKJA 1ZHKA 4P3CH 2CRMA 3QJHB 5BVPL 2PXYC 3X11B 1OD7A 2A9NL 1IEBA 2EYTB 3QQ4A 5T3XL 1GOFA 5MEPB 3VI3F 1G7LB 3BKJH 4GSDH 4KK8C 3MR9B 4CMHC 1B90A 2ZWLT 3PL6D 4KK6D 2PO6A 4MNQE 2CKBA 3MACH 2VITB 1MCFA 3CVHA 4FN0A 2OZ4H 2VQUA 4FFZL 2VERN 4P48A 2DDQL 2OYPA 1GGIH 1EEUA 4J4PD 4ONOA 2IFGA 1Q0YL 4PLOB 4RA3A 4X6BA 5E2WH 3EJJX 2HVKA 2WWKT 1YEGH 3AVEA 4H1LG 3HUJB 4YHPB 3UJIH 2EKJA 4DAGL 4R7DB 3PWPA 3G6JB 3B2UC 5DEGA 5ID0A 4LFHD 1ZA3B 2YKLH 2IANE 3SBWC 5SWZB 1Q0XH 2F54D 2X4OA 4X98B 3D0VB 4WFHE 3C87A 5CGYC 5T5FL 5MEQA 3RJDA 1IM9D 1CF8L 4ORZC 4TULL 2BNQE 5FO9A 1WEJH 5DMIH 3WFHB 4CVZA 4HAFA 3JWOL 3SE4C 4BQCA 2AEQH 5D7JB 1G6RH 1NSNH 3TA3D 3O8XA 1LWRA 3C08H 4QYOB 3HE6A 2NYYD 1T1XA 2EDKA 2FL5A 4GW5B 4PJAB 2FX8L 2FHBA 1VKXB 2Z31A 1K4CB 1XR9A 5C0FA 4U1SB 3AB0C 3BZEA 4HK3J 4Y4HB 3U0WL 1YUHB 1JN6B 3S9DB 1ZVYA 4X99A 2VR5A 3VFNB 4KK9C 4D0DA 4QT5B 1N64H 1R3IH 3BPOB 1UWXH 1DQJB 4YDIH 4TNVK 5F72S 3RVTC 3OKYA 4XC3H 4LSTL 3E3QE 1T1YB 2BNRD 4JKKA 4BSWA 2XICA 5E03A 1A5FL 2XTJD 1YZZA 5HHMA 4FG6C 8FABB 2XZCH 3VXQB 5IFJB 1NDMB 2PR4H 5DJXB 4A6YH 3KLAA 4XC1H 1IGYA 4F37K 2VDKL 3AGVA 3UCRA 5IBLC 3CPLA 1INEL 3MBEB 2P8MB 4X4YB 4YDLC 3MV8A 1I85C 3F7PC 5IW3A 2GSIB 2ORBH 1QLEH 5DS8A 3T3ME 1D6VH 2IEPA 4OZFG 5IJKA 3V4VL 2C3HA 4X6CF 3PWUA 4ORGB 1FBIL 3T2QA 2I5YL 4NHCH 3ZHDA 1OSZA 2Y7QA 1F90L 3I6KB 4QO1A 3NBNA 3KDMB 2Q87A 1U8QB 3OKKA 5GRUH 3CDGA 4ELKA 2OZ4A 2VSCA 1UQSA 3K2UL 1DBBL 4ELME 3D3VE 1K8DB