5IBNA

Ultra high resolution crystal structure of the apo- form of second bromodomain of brd2.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
110
Chain Sequence
ANPEQLKHCNGILKELLSKKHAAYAWPFYKPVDAALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title A Novel Phenanthridionone Based Scaffold As a Potential Inhibitor of the BRD2 Bromodomain: Crystal Structure of the Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 110
sequence length 111
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ibnA00
5A7CA 5EPBA 3MXFA 5LJ1A 4NS5A 3UVXA 4PS5A 5DLXA 3HMHA 5II2A 2L5EA 5A5NA 5D26A 2R10A 4IOOA 5FH7A 4IR5A 4QY4A 4QSXA 4HXOA 5I89A 2MJVB 4XY8A 5K29A 5BT4A 5ENEA 5HJCA 5AMEA 4TT6A 5KHMA 2DWWA 4NYWA 4O76A 5D3NA 3QZVA 5CTLA 2L84A 4PY6A 2YYNA 2E7OA 2E7NA 4UIVA 4HBVA 5ENJA 5H85A 4OGJA 4HXNA 4O7AA 5D3TA 4UITA 5A5OA 4YH4A 5L8TA 3JVKA 3Q2EA 4O7BA 5CUCA 4NR9A 4O70A 2YDWA 4Z6IA 5JI8A 2RNXA 5DW2A 4QSQA 1JSPB 4F3IA 5D3LA 5ENHA 5HQ7A 3RCWA 5D3JA 5F3AA 4ALGA 4NQMA 2DVSA 4GPJA 4CLBA 3O35A 5E9YA 5EWHA 2D9EA 5EWDA 4TU6A 4YBSA 5I80A 5FE0A 4NXJA 5HRWA 4ALHA 5G4RA 5C4QA 3LQJA 3U5MA 4TT4A 4HXPA 4BW1A 4WHUA 4UYEA 2E3KA 4TYLA 4LYWA 5DFBA 4YYGA 5EV9A 5AD2A 5CQTA 2H60A 5F63A 5FFYA 4CFLA 5FB1A 4A9OA 5DYXA 2YEKA 4LZRA 4J0RA 5HQ5A 5HEMA 4HXLA 4AKNA 3MUKA 5IGLA 5COIA 3U5NA 4IR4A 4KCXA 5A5QA 5DBMA 5EU1A 5ENIA 4O7FA 4O75A 5FH6A 1N72A 5KTXA 5HFQA 4PKLA 4QSWA 3QZTA 5CQ4A 5ETDA 4Y03A 3MULA 4YK0A 4NUEA 4X2IA 4O7EA 4BHWA 4O78A 4NRCA 5HCLA 5ACYA 5FG4A 5CUBA 4YYJA 2RNWA 4YC9A 4YYMA 5F2PA 5EWVA 5I86A 3MB3A 5EQ1A 4HBYA 3P1DA 4Z1SA 4N4GA 4YH3A 3UW9A 4QUUA 5LVRA 4HXRA 4CUSA 2I8NA 5FDZA 4TQNA 2R0YA 2KTBB 5EI4A 5DFCA 5E0RA 2RI7A 5I7XA 4A9NA 2N9GA 4QBMA 4QUTA 4WHWA 5EM3A 2YELA 4NR4A 3JVLA 4J3IA 5CUAA 1JM4B 3P5OA 4YADA 4ZW1A 3DAIA 4TZ8A 4IORA 4HXKA 4UYFB 3JVJA 3TLPA 2RO1A 3AADA 4NYXA 5LKXA 5D0CA 5IGKA 3HMEA 4QSVA 4NRAA 4A9MA 2OSSA 5EP7A 5II1A 5HENA 3DWYA 4HXSA 4LYIA 3UVDA 5F25A 3U5PA 3MQMA 2F6NA 4QSSA 2YEMA 5CP5A 4CUPA 3O34A 2FSAA 4MEOA 5E9KA 5DLZA 3QZSA 5D3HA 3JVMA 3D7CA 4QYDA 5ENCA 1EQFA 5L97A 5I1QA 5E9VA 1ZS5A 5ETBA 4N4IA 4O7CA 4NR5A 5EICA 5EGUA 2WP1A 2D82A 4QYLA 5FBXA 3S92A 5HLSA 4NUCA 5BT3A 4BW3A 5KTUA 5D3PA 5LKUA 4CFKA 5D25A 5DFDA 5FE2A 4UIXA 3Q2FA 4HBXA 4OUFA 3O33A 5CUEA 4QSPA 4NRBA 4LYSA 4QSUA 4QEWA 4UIZA 5C87A 5IGNA 4QC3A 2DVVA 5ENBA 4CUUA 4NR7A 4N4HA 3IU6A 5KTWA 5CPEA 1X0JA 4Z93A 4MR6A 5C89A 2G4AA 5LUUA 3UVYA 4YYKA 5FE5A 3LQIA 4A9FA 5E7DA 4CUTA 5CQ3A 3HMFA 5CGPA 4MENA 3UV5A 4XYAA 5A81A 1WUGA 5TB6A 3SVFA 4BW4A 5IIDA 4J1PA 5DYUA 4LDFA 4Q0OA 5CQAA 5CQ7A 5CUDA 3UV2A 2R0VA 4IR3A 5J0DA 4QZSA 4YBTA 4UYDA 4DONA 5C7NA 4UIUA 4O77A 5AMFA 5FE7A 4PCEA 5E74A 5I29A 5FB0A 3FKMX 4IOQA 4N3WA 5FE3A 5G4SA 5JWMA 3G0JA 5A5RA 4C66A 4Z1QA 3MB4A 5DYCA 4A9IA 5F62A 4XY9A 4O71A 5DYAA 3U5KA 5IG6A 4YYNA 5A83A 5CY9A 4E96A 2RS9B 5H1UA 3P1CA 4YAXA 1E6IA 4KV1A 5L99A 4PCIA 5H1TA 4QR5A 5E73A 4NR6A 5I83A 5CZGA 4J0SA 5TCMA 5EISA 2DKWA 3O37A 4PTBA 5FE6A 4YY6A 3U5LA 4YYHA 4CL9A 4UYFA 5CUGA 5FG5A 5LKZA 5EPSA 3ZYUA 5DKDA 2RFJA 4HXMA 5KO4A 2OO1A 4UIYA 5E9IA 5A5SA 4LC2A 5DX4A 5CQ6A 3P1EA 5EWWA 4A9HA 5I88A 4Q0NA 5F5ZA 4MEQA 5LJ0A 5D7XA 4BJXA 5F1LA 4A9LA 4ZQLA 1F68A 5LVQA 4QC1A 5F36A 3U5OA 3UV4A 5I7YA 2WP2A 4YYIA 5LKTA 4TT2A 4O72A 5EVAA 5E9LA 3LQHA 5HRXA 4A9JA 5CRMA 2L85A 5FE1A 5LJ2A 4TZ2A 5AD3A 4LRGA 5FG6A 4NUDA 4OGIA 2R0SA 5DW1A 5CRZA 5D3SA 5EK9A 4CUQA 4RVRA 5A5PA 5D3RA 4A9KA 4QSTA 5FE4A 3SVGA 5KU3A 2GRCA 4QB3A 2OUOA 4KV4A 5ENGA 5E9MA 5HM0A 5L98A 5L8UA 3U5JA 4QEUA 4IR6A 4MR5A 5D24A 5HRVA 5C85A 5ENFA 4UYHA 2DVQA 5L96A 3G0LA 2F6JA 2YQDA 2NXBA 4UIWA 3GG3A 4MEPA 4WIVA 5F60A 3K2JA 5CQ5A 4NR8A 5CQ8A 5DKHA 4YY4A 3O36A 5CS8A 4YABA 2DVRA 3IU5A 4TU4A 5FE8A 4TS8A 2I7KA 4QR3A 4QSRA 5HFRA 4QEVA 2LSPB 5I40A 3ONIA 4BW2A 3SVHA 5EWCA 4ZC9A 4FLPA 5HQ6A 5H1VA 4A9EA 5FH8A 4XUAA 4C67A 4Z6HA 3NXBA 3AQAA 5FFWA 3LJWA 4CURA 3LXJA 5FE9A 4LR6A 5IBNA 4YBMA 5E3GA 4NYVA 5FFVA 5IGMA 4TTEA 5DY7A 4QNSA 4MR4A 5A82A 5A85A 3UVWA 5E3DA 4UYGA 4YATA 2DATA 3S91A 3P1FA 2RNYA 2YW5A 4YYDA 5BT5A 5EPRA 4QR4A 4LZSA 5EA1A 4N4FA 5DKCA 4XUBA 1WUMA 4O74A 5F1HA 5C8GA 5CU8A 4NQNA 5F61A 5CFWA 4MR3A 4LZ2A 5HELA 3I3JA 4HBWA
chains in the Genus database with same CATH superfamily
5A7CA 5EPBA 3MXFA 5LJ1A 4NS5A 3UVXA 3D1DA 4PS5A 5DLXA 3HMHA 5II2A 4AI6A 2L5EA 5A5NA 5D26A 2EJNA 2R10A 4IOOA 5FH7A 4IR5A 4AKGA 4QY4A 4QSXA 4HXOA 5I89A 2MJVB 4XY8A 5K29A 5BT4A 5ENEA 5HJCA 5AMEA 4TT6A 5KHMA 2DWWA 4NYWA 4O76A 5D3NA 3QZVA 5CTLA 2L84A 4PY6A 2YYNA 2E7OA 2E7NA 4UIVA 4HBVA 5ENJA 5H85A 4OGJA 4HXNA 4O7AA 5D3TA 4UITA 5A5OA 4YH4A 5L8TA 3JVKA 3Q2EA 4O7BA 5CUCA 4NR9A 4O70A 2YDWA 4Z6IA 5JI8A 2RNXA 5DW2A 4QSQA 1JSPB 4F3IA 5D3LA 5ENHA 5HQ7A 3RCWA 5D3JA 5F3AA 4ALGA 4NQMA 2DVSA 4GPJA 4CLBA 3O35A 5E9YA 5EWHA 2D9EA 5EWDA 4TU6A 4YBSA 5I80A 5FE0A 4NXJA 5HRWA 4ALHA 5G4RA 5C4QA 3LQJA 3U5MA 4TT4A 4HXPA 4BW1A 4WHUA 4UYEA 2E3KA 4TYLA 4LYWA 5DFBA 4YYGA 5EV9A 5AD2A 5CQTA 2H60A 5F63A 5FFYA 4CFLA 5FB1A 4A9OA 5DYXA 2YEKA 4LZRA 4J0RA 5HQ5A 5HEMA 4HXLA 4AKNA 3MUKA 5IGLA 5COIA 3U5NA 4IR4A 4KCXA 5A5QA 5DBMA 5EU1A 5ENIA 4O7FA 4O75A 5FH6A 1N72A 5KTXA 5HFQA 4PKLA 4QSWA 3QZTA 5CQ4A 5ETDA 4Y03A 3MULA 4YK0A 4NUEA 4X2IA 4O7EA 4BHWA 4O78A 4NRCA 5HCLA 5ACYA 5FG4A 5CUBA 4YYJA 2RNWA 4YC9A 4YYMA 5F2PA 5EWVA 5I86A 3MB3A 5EQ1A 4HBYA 3P1DA 4Z1SA 4N4GA 4YH3A 3UW9A 4QUUA 5LVRA 4HXRA 4CUSA 2I8NA 5FDZA 4TQNA 2R0YA 2KTBB 5EI4A 5DFCA 5E0RA 2RI7A 5I7XA 4A9NA 2N9GA 4QBMA 4QUTA 4WHWA 5EM3A 2YELA 4NR4A 3JVLA 4J3IA 5CUAA 1JM4B 3P5OA 4YADA 4ZW1A 3DAIA 4TZ8A 4IORA 4HXKA 4UYFB 3JVJA 3TLPA 2RO1A 3AADA 4NYXA 5LKXA 5D0CA 5IGKA 3HMEA 4QSVA 4NRAA 4A9MA 2OSSA 5EP7A 5II1A 5HENA 3DWYA 4HXSA 4LYIA 3UVDA 5F25A 3U5PA 3MQMA 2F6NA 4QSSA 2YEMA 5CP5A 4CUPA 3O34A 2FSAA 3D1BA 4MEOA 5E9KA 5DLZA 3QZSA 5D3HA 3JVMA 3D7CA 4QYDA 5ENCA 1EQFA 5L97A 5I1QA 5E9VA 1ZS5A 5ETBA 4N4IA 4O7CA 4NR5A 5EICA 5EGUA 2WP1A 2D82A 4QYLA 5FBXA 3S92A 5HLSA 4NUCA 5BT3A 4BW3A 5KTUA 5D3PA 5LKUA 4CFKA 5D25A 5DFDA 5FE2A 4UIXA 3Q2FA 4HBXA 4OUFA 3O33A 5CUEA 4QSPA 4NRBA 4LYSA 4QSUA 4QEWA 4UIZA 5C87A 5IGNA 4QC3A 2DVVA 5ENBA 4CUUA 4NR7A 4N4HA 3IU6A 5KTWA 5CPEA 1X0JA 4Z93A 4MR6A 5C89A 2G4AA 5LUUA 3UVYA 4YYKA 5FE5A 3LQIA 4A9FA 5E7DA 4CUTA 5CQ3A 3HMFA 5CGPA 4MENA 3UV5A 4XYAA 5A81A 1WUGA 5TB6A 3SVFA 4BW4A 5IIDA 4J1PA 5DYUA 4LDFA 4Q0OA 5CQAA 5CQ7A 5CUDA 3UV2A 2R0VA 4IR3A 5J0DA 4QZSA 4YBTA 4UYDA 4DONA 5C7NA 4UIUA 4O77A 5AMFA 5FE7A 4PCEA 5E74A 5I29A 5FB0A 3FKMX 4IOQA 4N3WA 5FE3A 5G4SA 5JWMA 3G0JA 5A5RA 4C66A 4Z1QA 3MB4A 5DYCA 4A9IA 5F62A 4XY9A 4O71A 5DYAA 3U5KA 5IG6A 4YYNA 5A83A 5CY9A 4E96A 2RS9B 5H1UA 3P1CA 4YAXA 1E6IA 4KV1A 5L99A 4PCIA 5H1TA 4QR5A 5E73A 4NR6A 5I83A 5CZGA 4J0SA 5TCMA 5EISA 2DKWA 3O37A 4PTBA 5FE6A 4YY6A 3U5LA 4YYHA 4CL9A 4UYFA 5CUGA 5FG5A 5LKZA 4AKIA 5EPSA 3ZYUA 5DKDA 2RFJA 4HXMA 5KO4A 2OO1A 4UIYA 5E9IA 3ERRA 5A5SA 4LC2A 5DX4A 5CQ6A 3P1EA 5EWWA 4A9HA 5I88A 4Q0NA 5F5ZA 4MEQA 5LJ0A 5D7XA 4BJXA 5F1LA 4A9LA 4ZQLA 1F68A 5LVQA 4QC1A 5F36A 3U5OA 3UV4A 5I7YA 2WP2A 4YYIA 5LKTA 4TT2A 4O72A 5EVAA 5E9LA 3LQHA 5HRXA 4A9JA 5CRMA 2L85A 5FE1A 5LJ2A 4TZ2A 5AD3A 4LRGA 5FG6A 1PUOA 4NUDA 4OGIA 2R0SA 5DW1A 5CRZA 5D3SA 5EK9A 4CUQA 4RVRA 5A5PA 5D3RA 4A9KA 4QSTA 5FE4A 3SVGA 5KU3A 2GRCA 4QB3A 2OUOA 4KV4A 5ENGA 5E9MA 5HM0A 5L98A 5L8UA 3VKHA 3U5JA 4QEUA 4IR6A 4MR5A 5D24A 5HRVA 5C85A 5ENFA 4UYHA 2DVQA 5L96A 3G0LA 2F6JA 2YQDA 3VKGA 2NXBA 4UIWA 3GG3A 4MEPA 4WIVA 5F60A 3K2JA 5CQ5A 4NR8A 4AKHA 5CQ8A 5DKHA 4YY4A 3O36A 5CS8A 4YABA 2DVRA 3IU5A 4TU4A 5FE8A 4TS8A 2I7KA 4QR3A 4QSRA 5HFRA 4QEVA 2LSPB 5I40A 3ONIA 4BW2A 3SVHA 5EWCA 4ZC9A 4FLPA 5HQ6A 5H1VA 4A9EA 5FH8A 4XUAA 4C67A 4Z6HA 3NXBA 3AQAA 5FFWA 3LJWA 4CURA 3LXJA 5FE9A 4LR6A 5IBNA 4YBMA 5E3GA 4NYVA 5FFVA 5IGMA 4TTEA 5DY7A 4QNSA 4MR4A 5A82A 5A85A 3UVWA 5E3DA 4UYGA 4YATA 2DATA 3S91A 3P1FA 2RNYA 2YW5A 4YYDA 5BT5A 5EPRA 4QR4A 4LZSA 5EA1A 4N4FA 5DKCA 4XUBA 1WUMA 4O74A 5F1HA 5C8GA 5CU8A 4NQNA 5F61A 5CFWA 4MR3A 4LZ2A 5HELA 1ZKRA 3I3JA 4HBWA
chains in the Genus database with same CATH topology
5A7CA 5EPBA 3MXFA 5LJ1A 4NS5A 3UVXA 4PS5A 5DLXA 3HMHA 5II2A 2L5EA 5A5NA 5D26A 2R10A 4IOOA 5FH7A 4IR5A 4QY4A 4QSXA 4HXOA 5I89A 2MJVB 4XY8A 5K29A 5BT4A 5ENEA 5HJCA 5AMEA 4TT6A 5KHMA 2DWWA 4NYWA 4O76A 5D3NA 3QZVA 5CTLA 2L84A 4PY6A 2YYNA 2E7OA 2E7NA 4UIVA 4HBVA 5ENJA 5H85A 4OGJA 4HXNA 4O7AA 5D3TA 4UITA 5A5OA 4YH4A 5L8TA 3JVKA 3Q2EA 4O7BA 5CUCA 4NR9A 4O70A 2YDWA 4Z6IA 5JI8A 2RNXA 5DW2A 4QSQA 1JSPB 4F3IA 5D3LA 5ENHA 5HQ7A 3RCWA 5D3JA 5F3AA 4ALGA 4NQMA 2DVSA 4GPJA 4CLBA 3O35A 5E9YA 5EWHA 2D9EA 5EWDA 4TU6A 4YBSA 5I80A 5FE0A 4NXJA 5HRWA 4ALHA 5G4RA 5C4QA 3LQJA 3U5MA 4TT4A 4HXPA 4BW1A 4WHUA 4UYEA 2E3KA 4TYLA 4LYWA 5DFBA 4YYGA 5EV9A 5AD2A 5CQTA 2H60A 5F63A 5FFYA 4CFLA 5FB1A 4A9OA 5DYXA 2YEKA 4LZRA 4J0RA 5HQ5A 5HEMA 4HXLA 4AKNA 3MUKA 5IGLA 5COIA 3U5NA 4IR4A 4KCXA 5A5QA 5DBMA 5EU1A 5ENIA 4O7FA 4O75A 5FH6A 1N72A 5KTXA 5HFQA 4PKLA 4QSWA 3QZTA 5CQ4A 5ETDA 4Y03A 3MULA 4YK0A 4NUEA 4X2IA 4O7EA 4BHWA 4O78A 4NRCA 5HCLA 5ACYA 5FG4A 5CUBA 4YYJA 2RNWA 4YC9A 4YYMA 5F2PA 5EWVA 5I86A 3MB3A 5EQ1A 4HBYA 3P1DA 4Z1SA 4N4GA 4YH3A 3UW9A 4QUUA 5LVRA 4HXRA 4CUSA 2I8NA 5FDZA 4TQNA 2R0YA 2KTBB 5EI4A 5DFCA 5E0RA 2RI7A 5I7XA 4A9NA 2N9GA 4QBMA 4QUTA 4WHWA 5EM3A 2YELA 4NR4A 3JVLA 4J3IA 5CUAA 1JM4B 3P5OA 4YADA 4ZW1A 3DAIA 4TZ8A 4IORA 4HXKA 4UYFB 3JVJA 3TLPA 2RO1A 3AADA 4NYXA 5LKXA 5D0CA 5IGKA 3HMEA 4QSVA 4NRAA 4A9MA 2OSSA 5EP7A 5II1A 5HENA 3DWYA 4HXSA 4LYIA 3UVDA 5F25A 3U5PA 3MQMA 2F6NA 4QSSA 2YEMA 5CP5A 4CUPA 3O34A 2FSAA 4MEOA 5E9KA 5DLZA 3QZSA 5D3HA 3JVMA 3D7CA 4QYDA 5ENCA 1EQFA 5L97A 5I1QA 5E9VA 1ZS5A 5ETBA 4N4IA 4O7CA 4NR5A 5EICA 5EGUA 2WP1A 2D82A 4QYLA 5FBXA 3S92A 5HLSA 4NUCA 5BT3A 4BW3A 5KTUA 5D3PA 5LKUA 4CFKA 5D25A 5DFDA 5FE2A 4UIXA 3Q2FA 4HBXA 4OUFA 3O33A 5CUEA 4QSPA 4NRBA 4LYSA 4QSUA 4QEWA 4UIZA 5C87A 5IGNA 4QC3A 2DVVA 5ENBA 4CUUA 4NR7A 4N4HA 3IU6A 5KTWA 5CPEA 1X0JA 4Z93A 4MR6A 5C89A 2G4AA 5LUUA 3UVYA 4YYKA 5FE5A 3LQIA 4A9FA 5E7DA 4CUTA 5CQ3A 3HMFA 5CGPA 4MENA 3UV5A 4XYAA 5A81A 1WUGA 5TB6A 3SVFA 4BW4A 5IIDA 4J1PA 5DYUA 4LDFA 4Q0OA 5CQAA 5CQ7A 5CUDA 3UV2A 2R0VA 4IR3A 5J0DA 4QZSA 4YBTA 4UYDA 4DONA 5C7NA 4UIUA 4O77A 5AMFA 5FE7A 4PCEA 5E74A 5I29A 5FB0A 3FKMX 4IOQA 4N3WA 5FE3A 5G4SA 5JWMA 3G0JA 5A5RA 4C66A 4Z1QA 3MB4A 5DYCA 4A9IA 5F62A 4XY9A 4O71A 5DYAA 3U5KA 5IG6A 4YYNA 5A83A 5CY9A 4E96A 2RS9B 5H1UA 3P1CA 4YAXA 1E6IA 4KV1A 5L99A 4PCIA 5H1TA 4QR5A 5E73A 4NR6A 5I83A 5CZGA 4J0SA 5TCMA 5EISA 2DKWA 3O37A 4PTBA 5FE6A 4YY6A 3U5LA 4YYHA 4CL9A 4UYFA 5CUGA 5FG5A 5LKZA 5EPSA 3ZYUA 5DKDA 2RFJA 4HXMA 5KO4A 2OO1A 4UIYA 5E9IA 5A5SA 4LC2A 5DX4A 5CQ6A 3P1EA 5EWWA 4A9HA 5I88A 4Q0NA 5F5ZA 4MEQA 5LJ0A 5D7XA 4BJXA 5F1LA 4A9LA 4ZQLA 1F68A 5LVQA 4QC1A 5F36A 3U5OA 3UV4A 5I7YA 2WP2A 4YYIA 5LKTA 4TT2A 4O72A 5EVAA 5E9LA 3LQHA 5HRXA 4A9JA 5CRMA 2L85A 5FE1A 5LJ2A 4TZ2A 5AD3A 4LRGA 5FG6A 4NUDA 4OGIA 2R0SA 5DW1A 5CRZA 5D3SA 5EK9A 4CUQA 4RVRA 5A5PA 5D3RA 4A9KA 4QSTA 5FE4A 3SVGA 5KU3A 2GRCA 4QB3A 2OUOA 4KV4A 5ENGA 5E9MA 5HM0A 5L98A 5L8UA 3U5JA 4QEUA 4IR6A 4MR5A 5D24A 5HRVA 5C85A 5ENFA 4UYHA 2DVQA 5L96A 3G0LA 2F6JA 2YQDA 2NXBA 4UIWA 3GG3A 4MEPA 4WIVA 5F60A 3K2JA 5CQ5A 4NR8A 5CQ8A 5DKHA 4YY4A 3O36A 5CS8A 4YABA 2DVRA 3IU5A 4TU4A 5FE8A 4TS8A 2I7KA 4QR3A 4QSRA 5HFRA 4QEVA 2LSPB 5I40A 3ONIA 4BW2A 3SVHA 5EWCA 4ZC9A 4FLPA 5HQ6A 5H1VA 4A9EA 5FH8A 4XUAA 4C67A 4Z6HA 3NXBA 3AQAA 5FFWA 3LJWA 4CURA 3LXJA 5FE9A 4LR6A 5IBNA 4YBMA 5E3GA 4NYVA 5FFVA 5IGMA 4TTEA 5DY7A 4QNSA 4MR4A 5A82A 5A85A 3UVWA 5E3DA 4UYGA 4YATA 2DATA 3S91A 3P1FA 2RNYA 2YW5A 4YYDA 5BT5A 5EPRA 4QR4A 4LZSA 5EA1A 4N4FA 5DKCA 4XUBA 1WUMA 4O74A 5F1HA 5C8GA 5CU8A 4NQNA 5F61A 5CFWA 4MR3A 4LZ2A 5HELA 3I3JA 4HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A7C A;  5EPB A;  3MXF A;  5LJ1 A;  4NS5 A;  3UVX A;  4PS5 A;  5DLX A;  3HMH A;  5II2 A;  2L5E A;  5A5N A;  5D26 A;  2R10 A;  4IOO A;  5FH7 A;  4IR5 A;  4QY4 A;  4QSX A;  4HXO A;  5I89 A;  2MJV B;  4XY8 A;  5K29 A;  5BT4 A;  5ENE A;  5HJC A;  5AME A;  4TT6 A;  5KHM A;  2DWW A;  4NYW A;  4O76 A;  5D3N A;  3QZV A;  5CTL A;  2L84 A;  4PY6 A;  2YYN A;  2E7O A;  2E7N A;  4UIV A;  4HBV A;  5ENJ A;  5H85 A;  4OGJ A;  4HXN A;  4O7A A;  5D3T A;  4UIT A;  5A5O A;  4YH4 A;  5L8T A;  3JVK A;  3Q2E A;  4O7B A;  5CUC A;  4NR9 A;  4O70 A;  2YDW A;  4Z6I A;  5JI8 A;  2RNX A;  5DW2 A;  4QSQ A;  1JSP B;  4F3I A;  5D3L A;  5ENH A;  5HQ7 A;  3RCW A;  5D3J A;  5F3A A;  4ALG A;  4NQM A;  2DVS A;  4GPJ A;  4CLB A;  3O35 A;  5E9Y A;  5EWH A;  2D9E A;  5EWD A;  4TU6 A;  4YBS A;  5I80 A;  5FE0 A;  4NXJ A;  5HRW A;  4ALH A;  5G4R A;  5C4Q A;  3LQJ A;  3U5M A;  4TT4 A;  4HXP A;  4BW1 A;  4WHU A;  4UYE A;  2E3K A;  4TYL A;  4LYW A;  5DFB A;  4YYG A;  5EV9 A;  5AD2 A;  5CQT A;  2H60 A;  5F63 A;  5FFY A;  4CFL A;  5FB1 A;  4A9O A;  5DYX A;  2YEK A;  4LZR A;  4J0R A;  5HQ5 A;  5HEM A;  4HXL A;  4AKN A;  3MUK A;  5IGL A;  5COI A;  3U5N A;  4IR4 A;  4KCX A;  5A5Q A;  5DBM A;  5EU1 A;  5ENI A;  4O7F A;  4O75 A;  5FH6 A;  1N72 A;  5KTX A;  5HFQ A;  4PKL A;  4QSW A;  3QZT A;  5CQ4 A;  5ETD A;  4Y03 A;  3MUL A;  4YK0 A;  4NUE A;  4X2I A;  4O7E A;  4BHW A;  4O78 A;  4NRC A;  5HCL A;  5ACY A;  5FG4 A;  5CUB A;  4YYJ A;  2RNW A;  4YC9 A;  4YYM A;  5F2P A;  5EWV A;  5I86 A;  3MB3 A;  5EQ1 A;  4HBY A;  3P1D A;  4Z1S A;  4N4G A;  4YH3 A;  3UW9 A;  4QUU A;  5LVR A;  4HXR A;  4CUS A;  2I8N A;  5FDZ A;  4TQN A;  2R0Y A;  2KTB B;  5EI4 A;  5DFC A;  5E0R A;  2RI7 A;  5I7X A;  4A9N A;  2N9G A;  4QBM A;  4QUT A;  4WHW A;  5EM3 A;  2YEL A;  4NR4 A;  3JVL A;  4J3I A;  5CUA A;  1JM4 B;  3P5O A;  4YAD A;  4ZW1 A;  3DAI A;  4TZ8 A;  4IOR A;  4HXK A;  4UYF B;  3JVJ A;  3TLP A;  2RO1 A;  3AAD A;  4NYX A;  5LKX A;  5D0C A;  5IGK A;  3HME A;  4QSV A;  4NRA A;  4A9M A;  2OSS A;  5EP7 A;  5II1 A;  5HEN A;  3DWY A;  4HXS A;  4LYI A;  3UVD A;  5F25 A;  3U5P A;  3MQM A;  2F6N A;  4QSS A;  2YEM A;  5CP5 A;  4CUP A;  3O34 A;  2FSA A;  4MEO A;  5E9K A;  5DLZ A;  3QZS A;  5D3H A;  3JVM A;  3D7C A;  4QYD A;  5ENC A;  1EQF A;  5L97 A;  5I1Q A;  5E9V A;  1ZS5 A;  5ETB A;  4N4I A;  4O7C A;  4NR5 A;  5EIC A;  5EGU A;  2WP1 A;  2D82 A;  4QYL A;  5FBX A;  3S92 A;  5HLS A;  4NUC A;  5BT3 A;  4BW3 A;  5KTU A;  5D3P A;  5LKU A;  4CFK A;  5D25 A;  5DFD A;  5FE2 A;  4UIX A;  3Q2F A;  4HBX A;  4OUF A;  3O33 A;  5CUE A;  4QSP A;  4NRB A;  4LYS A;  4QSU A;  4QEW A;  4UIZ A;  5C87 A;  5IGN A;  4QC3 A;  2DVV A;  5ENB A;  4CUU A;  4NR7 A;  4N4H A;  3IU6 A;  5KTW A;  5CPE A;  1X0J A;  4Z93 A;  4MR6 A;  5C89 A;  2G4A A;  5LUU A;  3UVY A;  4YYK A;  5FE5 A;  3LQI A;  4A9F A;  5E7D A;  4CUT A;  5CQ3 A;  3HMF A;  5CGP A;  4MEN A;  3UV5 A;  4XYA A;  5A81 A;  1WUG A;  5TB6 A;  3SVF A;  4BW4 A;  5IID A;  4J1P A;  5DYU A;  4LDF A;  4Q0O A;  5CQA A;  5CQ7 A;  5CUD A;  3UV2 A;  2R0V A;  4IR3 A;  5J0D A;  4QZS A;  4YBT A;  4UYD A;  4DON A;  5C7N A;  4UIU A;  4O77 A;  5AMF A;  5FE7 A;  4PCE A;  5E74 A;  5I29 A;  5FB0 A;  3FKM X;  4IOQ A;  4N3W A;  5FE3 A;  5G4S A;  5JWM A;  3G0J A;  5A5R A;  4C66 A;  4Z1Q A;  3MB4 A;  5DYC A;  4A9I A;  5F62 A;  4XY9 A;  4O71 A;  5DYA A;  3U5K A;  5IG6 A;  4YYN A;  5A83 A;  5CY9 A;  4E96 A;  2RS9 B;  5H1U A;  3P1C A;  4YAX A;  1E6I A;  4KV1 A;  5L99 A;  4PCI A;  5H1T A;  4QR5 A;  5E73 A;  4NR6 A;  5I83 A;  5CZG A;  4J0S A;  5TCM A;  5EIS A;  2DKW A;  3O37 A;  4PTB A;  5FE6 A;  4YY6 A;  3U5L A;  4YYH A;  4CL9 A;  4UYF A;  5CUG A;  5FG5 A;  5LKZ A;  5EPS A;  3ZYU A;  5DKD A;  2RFJ A;  4HXM A;  5KO4 A;  2OO1 A;  4UIY A;  5E9I A;  5A5S A;  4LC2 A;  5DX4 A;  5CQ6 A;  3P1E A;  5EWW A;  4A9H A;  5I88 A;  4Q0N A;  5F5Z A;  4MEQ A;  5LJ0 A;  5D7X A;  4BJX A;  5F1L A;  4A9L A;  4ZQL A;  1F68 A;  5LVQ A;  4QC1 A;  5F36 A;  3U5O A;  3UV4 A;  5I7Y A;  2WP2 A;  4YYI A;  5LKT A;  4TT2 A;  4O72 A;  5EVA A;  5E9L A;  3LQH A;  5HRX A;  4A9J A;  5CRM A;  2L85 A;  5FE1 A;  5LJ2 A;  4TZ2 A;  5AD3 A;  4LRG A;  5FG6 A;  4NUD A;  4OGI A;  2R0S A;  5DW1 A;  5CRZ A;  5D3S A;  5EK9 A;  4CUQ A;  4RVR A;  5A5P A;  5D3R A;  4A9K A;  4QST A;  5FE4 A;  3SVG A;  5KU3 A;  2GRC A;  4QB3 A;  2OUO A;  4KV4 A;  5ENG A;  5E9M A;  5HM0 A;  5L98 A;  5L8U A;  3U5J A;  4QEU A;  4IR6 A;  4MR5 A;  5D24 A;  5HRV A;  5C85 A;  5ENF A;  4UYH A;  2DVQ A;  5L96 A;  3G0L A;  2F6J A;  2YQD A;  2NXB A;  4UIW A;  3GG3 A;  4MEP A;  4WIV A;  5F60 A;  3K2J A;  5CQ5 A;  4NR8 A;  5CQ8 A;  5DKH A;  4YY4 A;  3O36 A;  5CS8 A;  4YAB A;  2DVR A;  3IU5 A;  4TU4 A;  5FE8 A;  4TS8 A;  2I7K A;  4QR3 A;  4QSR A;  5HFR A;  4QEV A;  2LSP B;  5I40 A;  3ONI A;  4BW2 A;  3SVH A;  5EWC A;  4ZC9 A;  4FLP A;  5HQ6 A;  5H1V A;  4A9E A;  5FH8 A;  4XUA A;  4C67 A;  4Z6H A;  3NXB A;  3AQA A;  5FFW A;  3LJW A;  4CUR A;  3LXJ A;  5FE9 A;  4LR6 A;  5IBN A;  4YBM A;  5E3G A;  4NYV A;  5FFV A;  5IGM A;  4TTE A;  5DY7 A;  4QNS A;  4MR4 A;  5A82 A;  5A85 A;  3UVW A;  5E3D A;  4UYG A;  4YAT A;  2DAT A;  3S91 A;  3P1F A;  2RNY A;  2YW5 A;  4YYD A;  5BT5 A;  5EPR A;  4QR4 A;  4LZS A;  5EA1 A;  4N4F A;  5DKC A;  4XUB A;  1WUM A;  4O74 A;  5F1H A;  5C8G A;  5CU8 A;  4NQN A;  5F61 A;  5CFW A;  4MR3 A;  4LZ2 A;  5HEL A;  3I3J A;  4HBW A; 
#chains in the Genus database with same CATH topology
 5A7C A;  5EPB A;  3MXF A;  5LJ1 A;  4NS5 A;  3UVX A;  3D1D A;  4PS5 A;  5DLX A;  3HMH A;  5II2 A;  4AI6 A;  2L5E A;  5A5N A;  5D26 A;  2EJN A;  2R10 A;  4IOO A;  5FH7 A;  4IR5 A;  4AKG A;  4QY4 A;  4QSX A;  4HXO A;  5I89 A;  2MJV B;  4XY8 A;  5K29 A;  5BT4 A;  5ENE A;  5HJC A;  5AME A;  4TT6 A;  5KHM A;  2DWW A;  4NYW A;  4O76 A;  5D3N A;  3QZV A;  5CTL A;  2L84 A;  4PY6 A;  2YYN A;  2E7O A;  2E7N A;  4UIV A;  4HBV A;  5ENJ A;  5H85 A;  4OGJ A;  4HXN A;  4O7A A;  5D3T A;  4UIT A;  5A5O A;  4YH4 A;  5L8T A;  3JVK A;  3Q2E A;  4O7B A;  5CUC A;  4NR9 A;  4O70 A;  2YDW A;  4Z6I A;  5JI8 A;  2RNX A;  5DW2 A;  4QSQ A;  1JSP B;  4F3I A;  5D3L A;  5ENH A;  5HQ7 A;  3RCW A;  5D3J A;  5F3A A;  4ALG A;  4NQM A;  2DVS A;  4GPJ A;  4CLB A;  3O35 A;  5E9Y A;  5EWH A;  2D9E A;  5EWD A;  4TU6 A;  4YBS A;  5I80 A;  5FE0 A;  4NXJ A;  5HRW A;  4ALH A;  5G4R A;  5C4Q A;  3LQJ A;  3U5M A;  4TT4 A;  4HXP A;  4BW1 A;  4WHU A;  4UYE A;  2E3K A;  4TYL A;  4LYW A;  5DFB A;  4YYG A;  5EV9 A;  5AD2 A;  5CQT A;  2H60 A;  5F63 A;  5FFY A;  4CFL A;  5FB1 A;  4A9O A;  5DYX A;  2YEK A;  4LZR A;  4J0R A;  5HQ5 A;  5HEM A;  4HXL A;  4AKN A;  3MUK A;  5IGL A;  5COI A;  3U5N A;  4IR4 A;  4KCX A;  5A5Q A;  5DBM A;  5EU1 A;  5ENI A;  4O7F A;  4O75 A;  5FH6 A;  1N72 A;  5KTX A;  5HFQ A;  4PKL A;  4QSW A;  3QZT A;  5CQ4 A;  5ETD A;  4Y03 A;  3MUL A;  4YK0 A;  4NUE A;  4X2I A;  4O7E A;  4BHW A;  4O78 A;  4NRC A;  5HCL A;  5ACY A;  5FG4 A;  5CUB A;  4YYJ A;  2RNW A;  4YC9 A;  4YYM A;  5F2P A;  5EWV A;  5I86 A;  3MB3 A;  5EQ1 A;  4HBY A;  3P1D A;  4Z1S A;  4N4G A;  4YH3 A;  3UW9 A;  4QUU A;  5LVR A;  4HXR A;  4CUS A;  2I8N A;  5FDZ A;  4TQN A;  2R0Y A;  2KTB B;  5EI4 A;  5DFC A;  5E0R A;  2RI7 A;  5I7X A;  4A9N A;  2N9G A;  4QBM A;  4QUT A;  4WHW A;  5EM3 A;  2YEL A;  4NR4 A;  3JVL A;  4J3I A;  5CUA A;  1JM4 B;  3P5O A;  4YAD A;  4ZW1 A;  3DAI A;  4TZ8 A;  4IOR A;  4HXK A;  4UYF B;  3JVJ A;  3TLP A;  2RO1 A;  3AAD A;  4NYX A;  5LKX A;  5D0C A;  5IGK A;  3HME A;  4QSV A;  4NRA A;  4A9M A;  2OSS A;  5EP7 A;  5II1 A;  5HEN A;  3DWY A;  4HXS A;  4LYI A;  3UVD A;  5F25 A;  3U5P A;  3MQM A;  2F6N A;  4QSS A;  2YEM A;  5CP5 A;  4CUP A;  3O34 A;  2FSA A;  3D1B A;  4MEO A;  5E9K A;  5DLZ A;  3QZS A;  5D3H A;  3JVM A;  3D7C A;  4QYD A;  5ENC A;  1EQF A;  5L97 A;  5I1Q A;  5E9V A;  1ZS5 A;  5ETB A;  4N4I A;  4O7C A;  4NR5 A;  5EIC A;  5EGU A;  2WP1 A;  2D82 A;  4QYL A;  5FBX A;  3S92 A;  5HLS A;  4NUC A;  5BT3 A;  4BW3 A;  5KTU A;  5D3P A;  5LKU A;  4CFK A;  5D25 A;  5DFD A;  5FE2 A;  4UIX A;  3Q2F A;  4HBX A;  4OUF A;  3O33 A;  5CUE A;  4QSP A;  4NRB A;  4LYS A;  4QSU A;  4QEW A;  4UIZ A;  5C87 A;  5IGN A;  4QC3 A;  2DVV A;  5ENB A;  4CUU A;  4NR7 A;  4N4H A;  3IU6 A;  5KTW A;  5CPE A;  1X0J A;  4Z93 A;  4MR6 A;  5C89 A;  2G4A A;  5LUU A;  3UVY A;  4YYK A;  5FE5 A;  3LQI A;  4A9F A;  5E7D A;  4CUT A;  5CQ3 A;  3HMF A;  5CGP A;  4MEN A;  3UV5 A;  4XYA A;  5A81 A;  1WUG A;  5TB6 A;  3SVF A;  4BW4 A;  5IID A;  4J1P A;  5DYU A;  4LDF A;  4Q0O A;  5CQA A;  5CQ7 A;  5CUD A;  3UV2 A;  2R0V A;  4IR3 A;  5J0D A;  4QZS A;  4YBT A;  4UYD A;  4DON A;  5C7N A;  4UIU A;  4O77 A;  5AMF A;  5FE7 A;  4PCE A;  5E74 A;  5I29 A;  5FB0 A;  3FKM X;  4IOQ A;  4N3W A;  5FE3 A;  5G4S A;  5JWM A;  3G0J A;  5A5R A;  4C66 A;  4Z1Q A;  3MB4 A;  5DYC A;  4A9I A;  5F62 A;  4XY9 A;  4O71 A;  5DYA A;  3U5K A;  5IG6 A;  4YYN A;  5A83 A;  5CY9 A;  4E96 A;  2RS9 B;  5H1U A;  3P1C A;  4YAX A;  1E6I A;  4KV1 A;  5L99 A;  4PCI A;  5H1T A;  4QR5 A;  5E73 A;  4NR6 A;  5I83 A;  5CZG A;  4J0S A;  5TCM A;  5EIS A;  2DKW A;  3O37 A;  4PTB A;  5FE6 A;  4YY6 A;  3U5L A;  4YYH A;  4CL9 A;  4UYF A;  5CUG A;  5FG5 A;  5LKZ A;  4AKI A;  5EPS A;  3ZYU A;  5DKD A;  2RFJ A;  4HXM A;  5KO4 A;  2OO1 A;  4UIY A;  5E9I A;  3ERR A;  5A5S A;  4LC2 A;  5DX4 A;  5CQ6 A;  3P1E A;  5EWW A;  4A9H A;  5I88 A;  4Q0N A;  5F5Z A;  4MEQ A;  5LJ0 A;  5D7X A;  4BJX A;  5F1L A;  4A9L A;  4ZQL A;  1F68 A;  5LVQ A;  4QC1 A;  5F36 A;  3U5O A;  3UV4 A;  5I7Y A;  2WP2 A;  4YYI A;  5LKT A;  4TT2 A;  4O72 A;  5EVA A;  5E9L A;  3LQH A;  5HRX A;  4A9J A;  5CRM A;  2L85 A;  5FE1 A;  5LJ2 A;  4TZ2 A;  5AD3 A;  4LRG A;  5FG6 A;  1PUO A;  4NUD A;  4OGI A;  2R0S A;  5DW1 A;  5CRZ A;  5D3S A;  5EK9 A;  4CUQ A;  4RVR A;  5A5P A;  5D3R A;  4A9K A;  4QST A;  5FE4 A;  3SVG A;  5KU3 A;  2GRC A;  4QB3 A;  2OUO A;  4KV4 A;  5ENG A;  5E9M A;  5HM0 A;  5L98 A;  5L8U A;  3VKH A;  3U5J A;  4QEU A;  4IR6 A;  4MR5 A;  5D24 A;  5HRV A;  5C85 A;  5ENF A;  4UYH A;  2DVQ A;  5L96 A;  3G0L A;  2F6J A;  2YQD A;  3VKG A;  2NXB A;  4UIW A;  3GG3 A;  4MEP A;  4WIV A;  5F60 A;  3K2J A;  5CQ5 A;  4NR8 A;  4AKH A;  5CQ8 A;  5DKH A;  4YY4 A;  3O36 A;  5CS8 A;  4YAB A;  2DVR A;  3IU5 A;  4TU4 A;  5FE8 A;  4TS8 A;  2I7K A;  4QR3 A;  4QSR A;  5HFR A;  4QEV A;  2LSP B;  5I40 A;  3ONI A;  4BW2 A;  3SVH A;  5EWC A;  4ZC9 A;  4FLP A;  5HQ6 A;  5H1V A;  4A9E A;  5FH8 A;  4XUA A;  4C67 A;  4Z6H A;  3NXB A;  3AQA A;  5FFW A;  3LJW A;  4CUR A;  3LXJ A;  5FE9 A;  4LR6 A;  5IBN A;  4YBM A;  5E3G A;  4NYV A;  5FFV A;  5IGM A;  4TTE A;  5DY7 A;  4QNS A;  4MR4 A;  5A82 A;  5A85 A;  3UVW A;  5E3D A;  4UYG A;  4YAT A;  2DAT A;  3S91 A;  3P1F A;  2RNY A;  2YW5 A;  4YYD A;  5BT5 A;  5EPR A;  4QR4 A;  4LZS A;  5EA1 A;  4N4F A;  5DKC A;  4XUB A;  1WUM A;  4O74 A;  5F1H A;  5C8G A;  5CU8 A;  4NQN A;  5F61 A;  5CFW A;  4MR3 A;  4LZ2 A;  5HEL A;  1ZKR A;  3I3J A;  4HBW A; 
#chains in the Genus database with same CATH homology
 5A7C A;  5EPB A;  3MXF A;  5LJ1 A;  4NS5 A;  3UVX A;  4PS5 A;  5DLX A;  3HMH A;  5II2 A;  2L5E A;  5A5N A;  5D26 A;  2R10 A;  4IOO A;  5FH7 A;  4IR5 A;  4QY4 A;  4QSX A;  4HXO A;  5I89 A;  2MJV B;  4XY8 A;  5K29 A;  5BT4 A;  5ENE A;  5HJC A;  5AME A;  4TT6 A;  5KHM A;  2DWW A;  4NYW A;  4O76 A;  5D3N A;  3QZV A;  5CTL A;  2L84 A;  4PY6 A;  2YYN A;  2E7O A;  2E7N A;  4UIV A;  4HBV A;  5ENJ A;  5H85 A;  4OGJ A;  4HXN A;  4O7A A;  5D3T A;  4UIT A;  5A5O A;  4YH4 A;  5L8T A;  3JVK A;  3Q2E A;  4O7B A;  5CUC A;  4NR9 A;  4O70 A;  2YDW A;  4Z6I A;  5JI8 A;  2RNX A;  5DW2 A;  4QSQ A;  1JSP B;  4F3I A;  5D3L A;  5ENH A;  5HQ7 A;  3RCW A;  5D3J A;  5F3A A;  4ALG A;  4NQM A;  2DVS A;  4GPJ A;  4CLB A;  3O35 A;  5E9Y A;  5EWH A;  2D9E A;  5EWD A;  4TU6 A;  4YBS A;  5I80 A;  5FE0 A;  4NXJ A;  5HRW A;  4ALH A;  5G4R A;  5C4Q A;  3LQJ A;  3U5M A;  4TT4 A;  4HXP A;  4BW1 A;  4WHU A;  4UYE A;  2E3K A;  4TYL A;  4LYW A;  5DFB A;  4YYG A;  5EV9 A;  5AD2 A;  5CQT A;  2H60 A;  5F63 A;  5FFY A;  4CFL A;  5FB1 A;  4A9O A;  5DYX A;  2YEK A;  4LZR A;  4J0R A;  5HQ5 A;  5HEM A;  4HXL A;  4AKN A;  3MUK A;  5IGL A;  5COI A;  3U5N A;  4IR4 A;  4KCX A;  5A5Q A;  5DBM A;  5EU1 A;  5ENI A;  4O7F A;  4O75 A;  5FH6 A;  1N72 A;  5KTX A;  5HFQ A;  4PKL A;  4QSW A;  3QZT A;  5CQ4 A;  5ETD A;  4Y03 A;  3MUL A;  4YK0 A;  4NUE A;  4X2I A;  4O7E A;  4BHW A;  4O78 A;  4NRC A;  5HCL A;  5ACY A;  5FG4 A;  5CUB A;  4YYJ A;  2RNW A;  4YC9 A;  4YYM A;  5F2P A;  5EWV A;  5I86 A;  3MB3 A;  5EQ1 A;  4HBY A;  3P1D A;  4Z1S A;  4N4G A;  4YH3 A;  3UW9 A;  4QUU A;  5LVR A;  4HXR A;  4CUS A;  2I8N A;  5FDZ A;  4TQN A;  2R0Y A;  2KTB B;  5EI4 A;  5DFC A;  5E0R A;  2RI7 A;  5I7X A;  4A9N A;  2N9G A;  4QBM A;  4QUT A;  4WHW A;  5EM3 A;  2YEL A;  4NR4 A;  3JVL A;  4J3I A;  5CUA A;  1JM4 B;  3P5O A;  4YAD A;  4ZW1 A;  3DAI A;  4TZ8 A;  4IOR A;  4HXK A;  4UYF B;  3JVJ A;  3TLP A;  2RO1 A;  3AAD A;  4NYX A;  5LKX A;  5D0C A;  5IGK A;  3HME A;  4QSV A;  4NRA A;  4A9M A;  2OSS A;  5EP7 A;  5II1 A;  5HEN A;  3DWY A;  4HXS A;  4LYI A;  3UVD A;  5F25 A;  3U5P A;  3MQM A;  2F6N A;  4QSS A;  2YEM A;  5CP5 A;  4CUP A;  3O34 A;  2FSA A;  4MEO A;  5E9K A;  5DLZ A;  3QZS A;  5D3H A;  3JVM A;  3D7C A;  4QYD A;  5ENC A;  1EQF A;  5L97 A;  5I1Q A;  5E9V A;  1ZS5 A;  5ETB A;  4N4I A;  4O7C A;  4NR5 A;  5EIC A;  5EGU A;  2WP1 A;  2D82 A;  4QYL A;  5FBX A;  3S92 A;  5HLS A;  4NUC A;  5BT3 A;  4BW3 A;  5KTU A;  5D3P A;  5LKU A;  4CFK A;  5D25 A;  5DFD A;  5FE2 A;  4UIX A;  3Q2F A;  4HBX A;  4OUF A;  3O33 A;  5CUE A;  4QSP A;  4NRB A;  4LYS A;  4QSU A;  4QEW A;  4UIZ A;  5C87 A;  5IGN A;  4QC3 A;  2DVV A;  5ENB A;  4CUU A;  4NR7 A;  4N4H A;  3IU6 A;  5KTW A;  5CPE A;  1X0J A;  4Z93 A;  4MR6 A;  5C89 A;  2G4A A;  5LUU A;  3UVY A;  4YYK A;  5FE5 A;  3LQI A;  4A9F A;  5E7D A;  4CUT A;  5CQ3 A;  3HMF A;  5CGP A;  4MEN A;  3UV5 A;  4XYA A;  5A81 A;  1WUG A;  5TB6 A;  3SVF A;  4BW4 A;  5IID A;  4J1P A;  5DYU A;  4LDF A;  4Q0O A;  5CQA A;  5CQ7 A;  5CUD A;  3UV2 A;  2R0V A;  4IR3 A;  5J0D A;  4QZS A;  4YBT A;  4UYD A;  4DON A;  5C7N A;  4UIU A;  4O77 A;  5AMF A;  5FE7 A;  4PCE A;  5E74 A;  5I29 A;  5FB0 A;  3FKM X;  4IOQ A;  4N3W A;  5FE3 A;  5G4S A;  5JWM A;  3G0J A;  5A5R A;  4C66 A;  4Z1Q A;  3MB4 A;  5DYC A;  4A9I A;  5F62 A;  4XY9 A;  4O71 A;  5DYA A;  3U5K A;  5IG6 A;  4YYN A;  5A83 A;  5CY9 A;  4E96 A;  2RS9 B;  5H1U A;  3P1C A;  4YAX A;  1E6I A;  4KV1 A;  5L99 A;  4PCI A;  5H1T A;  4QR5 A;  5E73 A;  4NR6 A;  5I83 A;  5CZG A;  4J0S A;  5TCM A;  5EIS A;  2DKW A;  3O37 A;  4PTB A;  5FE6 A;  4YY6 A;  3U5L A;  4YYH A;  4CL9 A;  4UYF A;  5CUG A;  5FG5 A;  5LKZ A;  5EPS A;  3ZYU A;  5DKD A;  2RFJ A;  4HXM A;  5KO4 A;  2OO1 A;  4UIY A;  5E9I A;  5A5S A;  4LC2 A;  5DX4 A;  5CQ6 A;  3P1E A;  5EWW A;  4A9H A;  5I88 A;  4Q0N A;  5F5Z A;  4MEQ A;  5LJ0 A;  5D7X A;  4BJX A;  5F1L A;  4A9L A;  4ZQL A;  1F68 A;  5LVQ A;  4QC1 A;  5F36 A;  3U5O A;  3UV4 A;  5I7Y A;  2WP2 A;  4YYI A;  5LKT A;  4TT2 A;  4O72 A;  5EVA A;  5E9L A;  3LQH A;  5HRX A;  4A9J A;  5CRM A;  2L85 A;  5FE1 A;  5LJ2 A;  4TZ2 A;  5AD3 A;  4LRG A;  5FG6 A;  4NUD A;  4OGI A;  2R0S A;  5DW1 A;  5CRZ A;  5D3S A;  5EK9 A;  4CUQ A;  4RVR A;  5A5P A;  5D3R A;  4A9K A;  4QST A;  5FE4 A;  3SVG A;  5KU3 A;  2GRC A;  4QB3 A;  2OUO A;  4KV4 A;  5ENG A;  5E9M A;  5HM0 A;  5L98 A;  5L8U A;  3U5J A;  4QEU A;  4IR6 A;  4MR5 A;  5D24 A;  5HRV A;  5C85 A;  5ENF A;  4UYH A;  2DVQ A;  5L96 A;  3G0L A;  2F6J A;  2YQD A;  2NXB A;  4UIW A;  3GG3 A;  4MEP A;  4WIV A;  5F60 A;  3K2J A;  5CQ5 A;  4NR8 A;  5CQ8 A;  5DKH A;  4YY4 A;  3O36 A;  5CS8 A;  4YAB A;  2DVR A;  3IU5 A;  4TU4 A;  5FE8 A;  4TS8 A;  2I7K A;  4QR3 A;  4QSR A;  5HFR A;  4QEV A;  2LSP B;  5I40 A;  3ONI A;  4BW2 A;  3SVH A;  5EWC A;  4ZC9 A;  4FLP A;  5HQ6 A;  5H1V A;  4A9E A;  5FH8 A;  4XUA A;  4C67 A;  4Z6H A;  3NXB A;  3AQA A;  5FFW A;  3LJW A;  4CUR A;  3LXJ A;  5FE9 A;  4LR6 A;  5IBN A;  4YBM A;  5E3G A;  4NYV A;  5FFV A;  5IGM A;  4TTE A;  5DY7 A;  4QNS A;  4MR4 A;  5A82 A;  5A85 A;  3UVW A;  5E3D A;  4UYG A;  4YAT A;  2DAT A;  3S91 A;  3P1F A;  2RNY A;  2YW5 A;  4YYD A;  5BT5 A;  5EPR A;  4QR4 A;  4LZS A;  5EA1 A;  4N4F A;  5DKC A;  4XUB A;  1WUM A;  4O74 A;  5F1H A;  5C8G A;  5CU8 A;  4NQN A;  5F61 A;  5CFW A;  4MR3 A;  4LZ2 A;  5HEL A;  3I3J A;  4HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...