5IBNA

Ultra high resolution crystal structure of the apo- form of second bromodomain of brd2.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
111
structure length
110
Chain Sequence
ANPEQLKHCNGILKELLSKKHAAYAWPFYKPVDAALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bromodomain-containing protein 2
publication title A Novel Phenanthridionone Based Scaffold As a Potential Inhibitor of the BRD2 Bromodomain: Crystal Structure of the Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 42
structure length 110
sequence length 111
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ibnA00
5JWMA 5A85A 2I8NA 4J1PA 4UYGA 5CQAA 5FBXA 5LKUA 5DKCA 4O77A 4N3WA 4XY9A 3QZSA 1ZS5A 5CUGA 4TZ8A 4NR8A 5FDZA 5I7XA 2N9GA 4KCXA 4LYIA 4NQMA 4J0RA 5EWCA 5JI8A 4YABA 5F2PA 2DVRA 3LQJA 5ENEA 3O35A 2YQDA 3ONIA 5I80A 3SVFA 4TTEA 5LJ2A 5A5NA 3P1FA 4UYDA 4YATA 4BW4A 5C85A 5H1TA 2RS9B 3JVJA 4YYIA 5F3AA 3S92A 5CQ5A 5HRXA 4X2IA 5HQ5A 5FH7A 5DLZA 5CRMA 2R0YA 5CRZA 4QYLA 3SVGA 4BW2A 5E0RA 4QR4A 5EWDA 2R10A 4HXPA 4O7FA 5FB0A 5II1A 5L99A 4O74A 4NYWA 3D7CA 3U5LA 2DVQA 4A9IA 4QSQA 4XYAA 4Z6IA 4C66A 5EA1A 4LR6A 4HXRA 4QYDA 5FE7A 3O33A 4N4IA 4NUEA 5HELA 4MEQA 5HEMA 3AADA 5CQTA 4UIUA 5CP5A 5J0DA 2L5EA 3JVMA 4NQNA 5HFQA 5F5ZA 4MR3A 5G4RA 2L84A 3NXBA 2F6JA 5D3LA 5CFWA 5IGNA 5ENBA 5DY7A 5DYAA 5KU3A 4HXSA 5A5SA 5F61A 5FE5A 4MR4A 5D25A 5LVQA 4TZ2A 3MXFA 5LKTA 5DX4A 5AMFA 4CUUA 4HBXA 4YK0A 5EPSA 4UYHA 5A7CA 4QZSA 5IBNA 5CU8A 5DYXA 5ENIA 4QSUA 2FSAA 2E7NA 4UIWA 4QR3A 4BW1A 3QZTA 3U5PA 2OSSA 5HCLA 4O71A 5EGUA 4NRBA 4O70A 1F68A 4TYLA 3O37A 5FE1A 4IORA 5DKHA 3UVDA 5H1VA 5E9KA 2GRCA 3IU5A 5KO4A 5HQ7A 4TU6A 5F1HA 4TT2A 5HQ6A 5LKXA 3I3JA 4IR5A 4F3IA 4NXJA 2G4AA 3U5KA 5FE2A 4Z1SA 4QSVA 4YH4A 4ALHA 5BT5A 5F60A 4UYFB 5ENGA 5E9YA 4TT6A 5CUEA 4YYHA 4MR5A 5DLXA 5HRWA 2E3KA 2RNWA 4IR3A 3O34A 5I83A 4O7BA 3P1DA 4UIZA 2OO1A 2LSPB 4O7CA 4QC1A 5E3DA 1JSPB 5D3TA 3JVLA 5CGPA 5E7DA 5D24A 4LYSA 1JM4B 5IG6A 4YBMA 4XUAA 4ALGA 4PY6A 5C4QA 5EWWA 4N4FA 5FE4A 4CFKA 4YYNA 4A9EA 5A5PA 4YYMA 5ETDA 4E96A 4XY8A 4A9OA 5C89A 5I86A 4IOQA 3IU6A 4YYKA 4TU4A 4J0SA 5FG4A 5FE3A 5CZGA 2YDWA 4CUQA 5FE6A 5COIA 2YYNA 4ZC9A 3FKMX 4QEWA 5E9VA 3U5NA 4A9FA 4QUUA 5CQ7A 2RFJA 5E74A 5C8GA 4OUFA 5DFCA 3LQHA 5DFDA 5CQ3A 4UIVA 4UYEA 5L96A 4YY6A 5EK9A 3O36A 4CUPA 3G0LA 5L97A 4LZSA 4LYWA 5FFVA 4PCEA 3AQAA 5CQ6A 5FG6A 5F1LA 5DW1A 5AMEA 5FFWA 2WP1A 5EV9A 3HMEA 2RNXA 4O75A 4QSWA 5A5QA 5H1UA 2RI7A 5LJ0A 4CURA 4A9JA 3P1EA 2OUOA 5HM0A 4O72A 4O7AA 3K2JA 4HBWA 4WIVA 4Z6HA 5KTUA 5IGMA 5D3SA 4TQNA 5EISA 3TLPA 3SVHA 1N72A 3Q2FA 5ENHA 3UW9A 3HMHA 4MEPA 5ETBA 5F36A 5EM3A 4BHWA 5CY9A 4YH3A 4A9MA 5F25A 4YYGA 1E6IA 5D7XA 4UYFA 5HENA 4QNSA 4NRAA 2DVSA 2D82A 4A9HA 3RCWA 5DFBA 5BT3A 4XUBA 3UVXA 4PCIA 4MENA 5BT4A 5FE9A 5G4SA 5L98A 1WUMA 4A9KA 4LRGA 4N4GA 4MR6A 4IOOA 4YYJA 5E73A 4YC9A 4TS8A 4NR5A 5EI4A 3LJWA 4BJXA 5A83A 5I40A 5FH8A 1EQFA 4QB3A 4Y03A 5EICA 4N4HA 5CQ4A 3G0JA 3DAIA 5HFRA 5E9IA 3DWYA 5IGKA 2YW5A 4PTBA 2NXBA 5CUAA 4Q0OA 3UVYA 2DKWA 3U5MA 2KTBB 2WP2A 5CQ8A 5IIDA 4NYVA 5KTWA 5E9MA 4AKNA 5D3HA 5DBMA 4PKLA 4QEUA 3P1CA 4ZW1A 4A9NA 5E3GA 5DW2A 4O78A 4NYXA 4TT4A 5H85A 5F62A 5D3NA 5D0CA 4LC2A 4QSTA 5FFYA 5LVRA 4WHWA 4YBSA 4QUTA 2RNYA 3MB4A 5EWHA 5EPBA 4BW3A 5CUBA 5LKZA 4DONA 5HLSA 3U5JA 4NR7A 2MJVB 4YBTA 5EVAA 5FH6A 4LZ2A 5I7YA 3U5OA 5DYUA 4NR6A 4UIYA 4KV4A 5LUUA 5I1QA 5CUDA 2D9EA 4IR6A 4NUDA 2R0SA 4OGIA 5FE8A 3LXJA 5I88A 5D3PA 4HXMA 4FLPA 4OGJA 5AD2A 4RVRA 5A5RA 4QSRA 3LQIA 5DKDA 4HXOA 2YELA 4NS5A 5ENFA 4CUTA 5II2A 5K29A 4QSXA 5I29A 4KV1A 4IR4A 2RO1A 4A9LA 4UIXA 3Q2EA 5A81A 4GPJA 4HBYA 4NR9A 3MUKA 5I89A 2DWWA 5AD3A 4Q0NA 4NRCA 4Z93A 4QSPA 2E7OA 5A5OA 4CUSA 4PS5A 4QBMA 5EPRA 3UVWA 1X0JA 4WHUA 4HXKA 5IGLA 5KHMA 3S91A 2YEKA 3GG3A 4CFLA 5E9LA 5CUCA 2F6NA 4HXLA 4NR4A 5HRVA 4Z1QA 5D3JA 4QSSA 5FG5A 4O76A 4C67A 5F63A 2R0VA 3P5OA 4QR5A 5EU1A 5EQ1A 5ACYA 5FB1A 3MQMA 5EWVA 2DVVA 5TB6A 5FE0A 4YAXA 5TCMA 4QC3A 3ZYUA 5CPEA 4CLBA 3QZVA 3UV2A 3HMFA 4O7EA 5C7NA 5CTLA 5ENJA 4YY4A 4YADA 2DATA 5D3RA 3UV5A 5A82A 2YEMA 3MB3A 5D26A 2L85A 5DYCA 4UITA 5LJ1A 5C87A 4HXNA 4NUCA 4CL9A 4YYDA 4J3IA 4QY4A 3JVKA 5L8TA 4MEOA 1WUGA 5KTXA 5EP7A 2I7KA 5ENCA 5CS8A 4ZQLA 5HJCA 5L8UA 4LDFA 4LZRA 4HBVA 3UV4A 3MULA 2H60A 4QEVA
chains in the Genus database with same CATH superfamily
5JWMA 5A85A 2I8NA 4J1PA 4UYGA 5CQAA 5FBXA 5LKUA 5DKCA 4O77A 4N3WA 4XY9A 3QZSA 1ZS5A 5CUGA 4TZ8A 4NR8A 5FDZA 5I7XA 2N9GA 4KCXA 4LYIA 4NQMA 4J0RA 5EWCA 5JI8A 4YABA 5F2PA 2DVRA 3LQJA 5ENEA 3O35A 2YQDA 3ONIA 5I80A 3SVFA 4TTEA 5LJ2A 5A5NA 3P1FA 4UYDA 4YATA 4BW4A 5C85A 5H1TA 2RS9B 3JVJA 4YYIA 5F3AA 3S92A 5CQ5A 5HRXA 4X2IA 5HQ5A 5FH7A 5DLZA 5CRMA 2R0YA 5CRZA 4QYLA 3SVGA 4BW2A 5E0RA 4QR4A 5EWDA 2R10A 4HXPA 4O7FA 5FB0A 5II1A 5L99A 4O74A 4NYWA 3D7CA 3U5LA 2DVQA 4A9IA 4QSQA 4XYAA 3D1BA 4Z6IA 4C66A 5EA1A 4LR6A 4HXRA 4QYDA 5FE7A 3O33A 4N4IA 4NUEA 5HELA 4MEQA 5HEMA 3AADA 5CQTA 4UIUA 5CP5A 5J0DA 2L5EA 3JVMA 4NQNA 5HFQA 5F5ZA 4MR3A 5G4RA 2L84A 3NXBA 2F6JA 5D3LA 5CFWA 5IGNA 5ENBA 5DY7A 5DYAA 5KU3A 4HXSA 5A5SA 5F61A 5FE5A 4MR4A 4AKIA 5D25A 5LVQA 4TZ2A 3MXFA 5LKTA 5DX4A 5AMFA 4CUUA 4HBXA 4YK0A 5EPSA 4UYHA 5A7CA 4QZSA 5IBNA 5CU8A 5DYXA 5ENIA 4QSUA 2FSAA 2E7NA 4UIWA 4QR3A 4BW1A 3QZTA 3U5PA 2OSSA 5HCLA 4O71A 5EGUA 4NRBA 4O70A 1F68A 4TYLA 3O37A 5FE1A 4IORA 5DKHA 3UVDA 5H1VA 5E9KA 2GRCA 3IU5A 5KO4A 5HQ7A 4TU6A 5F1HA 4TT2A 5HQ6A 5LKXA 3I3JA 4IR5A 4F3IA 4NXJA 2G4AA 3U5KA 5FE2A 4Z1SA 4QSVA 4YH4A 4ALHA 5BT5A 5F60A 4UYFB 5ENGA 5E9YA 4TT6A 5CUEA 4YYHA 4MR5A 5DLXA 5HRWA 2E3KA 2RNWA 4IR3A 3O34A 5I83A 4O7BA 3P1DA 4UIZA 2OO1A 2LSPB 4O7CA 4QC1A 5E3DA 1JSPB 5D3TA 3JVLA 5CGPA 5E7DA 5D24A 4LYSA 1JM4B 5IG6A 4YBMA 4XUAA 4ALGA 4PY6A 5C4QA 5EWWA 4N4FA 5FE4A 4CFKA 4YYNA 4A9EA 5A5PA 4YYMA 5ETDA 4E96A 4XY8A 4A9OA 5C89A 5I86A 4IOQA 3IU6A 4YYKA 4TU4A 4J0SA 5FG4A 5FE3A 5CZGA 2YDWA 4CUQA 5FE6A 5COIA 2YYNA 4ZC9A 3FKMX 4QEWA 5E9VA 3U5NA 4A9FA 4QUUA 5CQ7A 2RFJA 5E74A 1PUOA 5C8GA 4OUFA 5DFCA 3LQHA 5DFDA 5CQ3A 4UIVA 4UYEA 5L96A 4YY6A 5EK9A 3O36A 4CUPA 3G0LA 5L97A 4LZSA 4LYWA 5FFVA 4PCEA 3AQAA 5CQ6A 5FG6A 5F1LA 5DW1A 5AMEA 5FFWA 2WP1A 5EV9A 3HMEA 4AKGA 2RNXA 4O75A 4QSWA 5A5QA 5H1UA 2RI7A 5LJ0A 4CURA 4A9JA 3P1EA 2OUOA 5HM0A 4O72A 4O7AA 3K2JA 4HBWA 4WIVA 4Z6HA 5KTUA 5IGMA 5D3SA 3VKHA 4TQNA 5EISA 3TLPA 3SVHA 1N72A 3Q2FA 5ENHA 3UW9A 3HMHA 4MEPA 5ETBA 5F36A 5EM3A 4BHWA 5CY9A 4YH3A 4A9MA 5F25A 4YYGA 1E6IA 5D7XA 4UYFA 5HENA 4QNSA 4NRAA 2DVSA 2D82A 4A9HA 3RCWA 5DFBA 5BT3A 4XUBA 3UVXA 4PCIA 4MENA 5BT4A 5FE9A 5G4SA 5L98A 1WUMA 4A9KA 4LRGA 4N4GA 4MR6A 4IOOA 4YYJA 5E73A 4YC9A 4TS8A 4NR5A 5EI4A 3LJWA 4BJXA 5A83A 5I40A 5FH8A 1EQFA 4QB3A 4Y03A 4AKHA 5EICA 4N4HA 3VKGA 5CQ4A 3G0JA 3DAIA 5HFRA 5E9IA 3DWYA 5IGKA 1ZKRA 2YW5A 4PTBA 2NXBA 5CUAA 4Q0OA 3UVYA 2DKWA 3U5MA 2KTBB 2WP2A 5CQ8A 5IIDA 4NYVA 5KTWA 5E9MA 4AKNA 5D3HA 5DBMA 4PKLA 4QEUA 3P1CA 4ZW1A 4A9NA 5E3GA 5DW2A 4O78A 4NYXA 4TT4A 5H85A 5F62A 5D3NA 5D0CA 4LC2A 4QSTA 5FFYA 5LVRA 4WHWA 4YBSA 4QUTA 2RNYA 3MB4A 5EWHA 5EPBA 4BW3A 5CUBA 5LKZA 4DONA 5HLSA 3U5JA 4NR7A 2MJVB 4YBTA 5EVAA 5FH6A 4LZ2A 5I7YA 3U5OA 5DYUA 4NR6A 4UIYA 4KV4A 5LUUA 5I1QA 3D1DA 5CUDA 2D9EA 4IR6A 4NUDA 2R0SA 4OGIA 5FE8A 3LXJA 5I88A 5D3PA 4HXMA 4FLPA 4OGJA 5AD2A 4RVRA 5A5RA 4QSRA 3LQIA 5DKDA 4HXOA 4AI6A 2YELA 4NS5A 5ENFA 4CUTA 5II2A 5K29A 4QSXA 5I29A 4KV1A 4IR4A 2RO1A 4A9LA 4UIXA 3Q2EA 5A81A 4GPJA 4HBYA 4NR9A 3MUKA 5I89A 2DWWA 5AD3A 4Q0NA 4NRCA 4Z93A 4QSPA 2E7OA 5A5OA 4CUSA 4PS5A 4QBMA 5EPRA 3UVWA 1X0JA 4WHUA 4HXKA 5IGLA 5KHMA 3S91A 2YEKA 3GG3A 4CFLA 5E9LA 5CUCA 2F6NA 4HXLA 4NR4A 5HRVA 4Z1QA 5D3JA 4QSSA 3ERRA 5FG5A 4O76A 4C67A 5F63A 2EJNA 2R0VA 3P5OA 4QR5A 5EU1A 5EQ1A 5ACYA 5FB1A 3MQMA 5EWVA 2DVVA 5TB6A 5FE0A 4YAXA 5TCMA 4QC3A 3ZYUA 5CPEA 4CLBA 3QZVA 3UV2A 3HMFA 4O7EA 5C7NA 5CTLA 5ENJA 4YY4A 4YADA 2DATA 5D3RA 3UV5A 5A82A 2YEMA 3MB3A 5D26A 2L85A 5DYCA 4UITA 5LJ1A 5C87A 4HXNA 4NUCA 4CL9A 4YYDA 4J3IA 4QY4A 3JVKA 5L8TA 4MEOA 1WUGA 5KTXA 5EP7A 2I7KA 5ENCA 5CS8A 4ZQLA 5HJCA 5L8UA 4LDFA 4LZRA 4HBVA 3UV4A 3MULA 2H60A 4QEVA
chains in the Genus database with same CATH topology
5JWMA 5A85A 2I8NA 4J1PA 4UYGA 5CQAA 5FBXA 5LKUA 5DKCA 4O77A 4N3WA 4XY9A 3QZSA 1ZS5A 5CUGA 4TZ8A 4NR8A 5FDZA 5I7XA 2N9GA 4KCXA 4LYIA 4NQMA 4J0RA 5EWCA 5JI8A 4YABA 5F2PA 2DVRA 3LQJA 5ENEA 3O35A 2YQDA 3ONIA 5I80A 3SVFA 4TTEA 5LJ2A 5A5NA 3P1FA 4UYDA 4YATA 4BW4A 5C85A 5H1TA 2RS9B 3JVJA 4YYIA 5F3AA 3S92A 5CQ5A 5HRXA 4X2IA 5HQ5A 5FH7A 5DLZA 5CRMA 2R0YA 5CRZA 4QYLA 3SVGA 4BW2A 5E0RA 4QR4A 5EWDA 2R10A 4HXPA 4O7FA 5FB0A 5II1A 5L99A 4O74A 4NYWA 3D7CA 3U5LA 2DVQA 4A9IA 4QSQA 4XYAA 4Z6IA 4C66A 5EA1A 4LR6A 4HXRA 4QYDA 5FE7A 3O33A 4N4IA 4NUEA 5HELA 4MEQA 5HEMA 3AADA 5CQTA 4UIUA 5CP5A 5J0DA 2L5EA 3JVMA 4NQNA 5HFQA 5F5ZA 4MR3A 5G4RA 2L84A 3NXBA 2F6JA 5D3LA 5CFWA 5IGNA 5ENBA 5DY7A 5DYAA 5KU3A 4HXSA 5A5SA 5F61A 5FE5A 4MR4A 5D25A 5LVQA 4TZ2A 3MXFA 5LKTA 5DX4A 5AMFA 4CUUA 4HBXA 4YK0A 5EPSA 4UYHA 5A7CA 4QZSA 5IBNA 5CU8A 5DYXA 5ENIA 4QSUA 2FSAA 2E7NA 4UIWA 4QR3A 4BW1A 3QZTA 3U5PA 2OSSA 5HCLA 4O71A 5EGUA 4NRBA 4O70A 1F68A 4TYLA 3O37A 5FE1A 4IORA 5DKHA 3UVDA 5H1VA 5E9KA 2GRCA 3IU5A 5KO4A 5HQ7A 4TU6A 5F1HA 4TT2A 5HQ6A 5LKXA 3I3JA 4IR5A 4F3IA 4NXJA 2G4AA 3U5KA 5FE2A 4Z1SA 4QSVA 4YH4A 4ALHA 5BT5A 5F60A 4UYFB 5ENGA 5E9YA 4TT6A 5CUEA 4YYHA 4MR5A 5DLXA 5HRWA 2E3KA 2RNWA 4IR3A 3O34A 5I83A 4O7BA 3P1DA 4UIZA 2OO1A 2LSPB 4O7CA 4QC1A 5E3DA 1JSPB 5D3TA 3JVLA 5CGPA 5E7DA 5D24A 4LYSA 1JM4B 5IG6A 4YBMA 4XUAA 4ALGA 4PY6A 5C4QA 5EWWA 4N4FA 5FE4A 4CFKA 4YYNA 4A9EA 5A5PA 4YYMA 5ETDA 4E96A 4XY8A 4A9OA 5C89A 5I86A 4IOQA 3IU6A 4YYKA 4TU4A 4J0SA 5FG4A 5FE3A 5CZGA 2YDWA 4CUQA 5FE6A 5COIA 2YYNA 4ZC9A 3FKMX 4QEWA 5E9VA 3U5NA 4A9FA 4QUUA 5CQ7A 2RFJA 5E74A 5C8GA 4OUFA 5DFCA 3LQHA 5DFDA 5CQ3A 4UIVA 4UYEA 5L96A 4YY6A 5EK9A 3O36A 4CUPA 3G0LA 5L97A 4LZSA 4LYWA 5FFVA 4PCEA 3AQAA 5CQ6A 5FG6A 5F1LA 5DW1A 5AMEA 5FFWA 2WP1A 5EV9A 3HMEA 2RNXA 4O75A 4QSWA 5A5QA 5H1UA 2RI7A 5LJ0A 4CURA 4A9JA 3P1EA 2OUOA 5HM0A 4O72A 4O7AA 3K2JA 4HBWA 4WIVA 4Z6HA 5KTUA 5IGMA 5D3SA 4TQNA 5EISA 3TLPA 3SVHA 1N72A 3Q2FA 5ENHA 3UW9A 3HMHA 4MEPA 5ETBA 5F36A 5EM3A 4BHWA 5CY9A 4YH3A 4A9MA 5F25A 4YYGA 1E6IA 5D7XA 4UYFA 5HENA 4QNSA 4NRAA 2DVSA 2D82A 4A9HA 3RCWA 5DFBA 5BT3A 4XUBA 3UVXA 4PCIA 4MENA 5BT4A 5FE9A 5G4SA 5L98A 1WUMA 4A9KA 4LRGA 4N4GA 4MR6A 4IOOA 4YYJA 5E73A 4YC9A 4TS8A 4NR5A 5EI4A 3LJWA 4BJXA 5A83A 5I40A 5FH8A 1EQFA 4QB3A 4Y03A 5EICA 4N4HA 5CQ4A 3G0JA 3DAIA 5HFRA 5E9IA 3DWYA 5IGKA 2YW5A 4PTBA 2NXBA 5CUAA 4Q0OA 3UVYA 2DKWA 3U5MA 2KTBB 2WP2A 5CQ8A 5IIDA 4NYVA 5KTWA 5E9MA 4AKNA 5D3HA 5DBMA 4PKLA 4QEUA 3P1CA 4ZW1A 4A9NA 5E3GA 5DW2A 4O78A 4NYXA 4TT4A 5H85A 5F62A 5D3NA 5D0CA 4LC2A 4QSTA 5FFYA 5LVRA 4WHWA 4YBSA 4QUTA 2RNYA 3MB4A 5EWHA 5EPBA 4BW3A 5CUBA 5LKZA 4DONA 5HLSA 3U5JA 4NR7A 2MJVB 4YBTA 5EVAA 5FH6A 4LZ2A 5I7YA 3U5OA 5DYUA 4NR6A 4UIYA 4KV4A 5LUUA 5I1QA 5CUDA 2D9EA 4IR6A 4NUDA 2R0SA 4OGIA 5FE8A 3LXJA 5I88A 5D3PA 4HXMA 4FLPA 4OGJA 5AD2A 4RVRA 5A5RA 4QSRA 3LQIA 5DKDA 4HXOA 2YELA 4NS5A 5ENFA 4CUTA 5II2A 5K29A 4QSXA 5I29A 4KV1A 4IR4A 2RO1A 4A9LA 4UIXA 3Q2EA 5A81A 4GPJA 4HBYA 4NR9A 3MUKA 5I89A 2DWWA 5AD3A 4Q0NA 4NRCA 4Z93A 4QSPA 2E7OA 5A5OA 4CUSA 4PS5A 4QBMA 5EPRA 3UVWA 1X0JA 4WHUA 4HXKA 5IGLA 5KHMA 3S91A 2YEKA 3GG3A 4CFLA 5E9LA 5CUCA 2F6NA 4HXLA 4NR4A 5HRVA 4Z1QA 5D3JA 4QSSA 5FG5A 4O76A 4C67A 5F63A 2R0VA 3P5OA 4QR5A 5EU1A 5EQ1A 5ACYA 5FB1A 3MQMA 5EWVA 2DVVA 5TB6A 5FE0A 4YAXA 5TCMA 4QC3A 3ZYUA 5CPEA 4CLBA 3QZVA 3UV2A 3HMFA 4O7EA 5C7NA 5CTLA 5ENJA 4YY4A 4YADA 2DATA 5D3RA 3UV5A 5A82A 2YEMA 3MB3A 5D26A 2L85A 5DYCA 4UITA 5LJ1A 5C87A 4HXNA 4NUCA 4CL9A 4YYDA 4J3IA 4QY4A 3JVKA 5L8TA 4MEOA 1WUGA 5KTXA 5EP7A 2I7KA 5ENCA 5CS8A 4ZQLA 5HJCA 5L8UA 4LDFA 4LZRA 4HBVA 3UV4A 3MULA 2H60A 4QEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWM A;  5A85 A;  2I8N A;  4J1P A;  4UYG A;  5CQA A;  5FBX A;  5LKU A;  5DKC A;  4O77 A;  4N3W A;  4XY9 A;  3QZS A;  1ZS5 A;  5CUG A;  4TZ8 A;  4NR8 A;  5FDZ A;  5I7X A;  2N9G A;  4KCX A;  4LYI A;  4NQM A;  4J0R A;  5EWC A;  5JI8 A;  4YAB A;  5F2P A;  2DVR A;  3LQJ A;  5ENE A;  3O35 A;  2YQD A;  3ONI A;  5I80 A;  3SVF A;  4TTE A;  5LJ2 A;  5A5N A;  3P1F A;  4UYD A;  4YAT A;  4BW4 A;  5C85 A;  5H1T A;  2RS9 B;  3JVJ A;  4YYI A;  5F3A A;  3S92 A;  5CQ5 A;  5HRX A;  4X2I A;  5HQ5 A;  5FH7 A;  5DLZ A;  5CRM A;  2R0Y A;  5CRZ A;  4QYL A;  3SVG A;  4BW2 A;  5E0R A;  4QR4 A;  5EWD A;  2R10 A;  4HXP A;  4O7F A;  5FB0 A;  5II1 A;  5L99 A;  4O74 A;  4NYW A;  3D7C A;  3U5L A;  2DVQ A;  4A9I A;  4QSQ A;  4XYA A;  4Z6I A;  4C66 A;  5EA1 A;  4LR6 A;  4HXR A;  4QYD A;  5FE7 A;  3O33 A;  4N4I A;  4NUE A;  5HEL A;  4MEQ A;  5HEM A;  3AAD A;  5CQT A;  4UIU A;  5CP5 A;  5J0D A;  2L5E A;  3JVM A;  4NQN A;  5HFQ A;  5F5Z A;  4MR3 A;  5G4R A;  2L84 A;  3NXB A;  2F6J A;  5D3L A;  5CFW A;  5IGN A;  5ENB A;  5DY7 A;  5DYA A;  5KU3 A;  4HXS A;  5A5S A;  5F61 A;  5FE5 A;  4MR4 A;  5D25 A;  5LVQ A;  4TZ2 A;  3MXF A;  5LKT A;  5DX4 A;  5AMF A;  4CUU A;  4HBX A;  4YK0 A;  5EPS A;  4UYH A;  5A7C A;  4QZS A;  5IBN A;  5CU8 A;  5DYX A;  5ENI A;  4QSU A;  2FSA A;  2E7N A;  4UIW A;  4QR3 A;  4BW1 A;  3QZT A;  3U5P A;  2OSS A;  5HCL A;  4O71 A;  5EGU A;  4NRB A;  4O70 A;  1F68 A;  4TYL A;  3O37 A;  5FE1 A;  4IOR A;  5DKH A;  3UVD A;  5H1V A;  5E9K A;  2GRC A;  3IU5 A;  5KO4 A;  5HQ7 A;  4TU6 A;  5F1H A;  4TT2 A;  5HQ6 A;  5LKX A;  3I3J A;  4IR5 A;  4F3I A;  4NXJ A;  2G4A A;  3U5K A;  5FE2 A;  4Z1S A;  4QSV A;  4YH4 A;  4ALH A;  5BT5 A;  5F60 A;  4UYF B;  5ENG A;  5E9Y A;  4TT6 A;  5CUE A;  4YYH A;  4MR5 A;  5DLX A;  5HRW A;  2E3K A;  2RNW A;  4IR3 A;  3O34 A;  5I83 A;  4O7B A;  3P1D A;  4UIZ A;  2OO1 A;  2LSP B;  4O7C A;  4QC1 A;  5E3D A;  1JSP B;  5D3T A;  3JVL A;  5CGP A;  5E7D A;  5D24 A;  4LYS A;  1JM4 B;  5IG6 A;  4YBM A;  4XUA A;  4ALG A;  4PY6 A;  5C4Q A;  5EWW A;  4N4F A;  5FE4 A;  4CFK A;  4YYN A;  4A9E A;  5A5P A;  4YYM A;  5ETD A;  4E96 A;  4XY8 A;  4A9O A;  5C89 A;  5I86 A;  4IOQ A;  3IU6 A;  4YYK A;  4TU4 A;  4J0S A;  5FG4 A;  5FE3 A;  5CZG A;  2YDW A;  4CUQ A;  5FE6 A;  5COI A;  2YYN A;  4ZC9 A;  3FKM X;  4QEW A;  5E9V A;  3U5N A;  4A9F A;  4QUU A;  5CQ7 A;  2RFJ A;  5E74 A;  5C8G A;  4OUF A;  5DFC A;  3LQH A;  5DFD A;  5CQ3 A;  4UIV A;  4UYE A;  5L96 A;  4YY6 A;  5EK9 A;  3O36 A;  4CUP A;  3G0L A;  5L97 A;  4LZS A;  4LYW A;  5FFV A;  4PCE A;  3AQA A;  5CQ6 A;  5FG6 A;  5F1L A;  5DW1 A;  5AME A;  5FFW A;  2WP1 A;  5EV9 A;  3HME A;  2RNX A;  4O75 A;  4QSW A;  5A5Q A;  5H1U A;  2RI7 A;  5LJ0 A;  4CUR A;  4A9J A;  3P1E A;  2OUO A;  5HM0 A;  4O72 A;  4O7A A;  3K2J A;  4HBW A;  4WIV A;  4Z6H A;  5KTU A;  5IGM A;  5D3S A;  4TQN A;  5EIS A;  3TLP A;  3SVH A;  1N72 A;  3Q2F A;  5ENH A;  3UW9 A;  3HMH A;  4MEP A;  5ETB A;  5F36 A;  5EM3 A;  4BHW A;  5CY9 A;  4YH3 A;  4A9M A;  5F25 A;  4YYG A;  1E6I A;  5D7X A;  4UYF A;  5HEN A;  4QNS A;  4NRA A;  2DVS A;  2D82 A;  4A9H A;  3RCW A;  5DFB A;  5BT3 A;  4XUB A;  3UVX A;  4PCI A;  4MEN A;  5BT4 A;  5FE9 A;  5G4S A;  5L98 A;  1WUM A;  4A9K A;  4LRG A;  4N4G A;  4MR6 A;  4IOO A;  4YYJ A;  5E73 A;  4YC9 A;  4TS8 A;  4NR5 A;  5EI4 A;  3LJW A;  4BJX A;  5A83 A;  5I40 A;  5FH8 A;  1EQF A;  4QB3 A;  4Y03 A;  5EIC A;  4N4H A;  5CQ4 A;  3G0J A;  3DAI A;  5HFR A;  5E9I A;  3DWY A;  5IGK A;  2YW5 A;  4PTB A;  2NXB A;  5CUA A;  4Q0O A;  3UVY A;  2DKW A;  3U5M A;  2KTB B;  2WP2 A;  5CQ8 A;  5IID A;  4NYV A;  5KTW A;  5E9M A;  4AKN A;  5D3H A;  5DBM A;  4PKL A;  4QEU A;  3P1C A;  4ZW1 A;  4A9N A;  5E3G A;  5DW2 A;  4O78 A;  4NYX A;  4TT4 A;  5H85 A;  5F62 A;  5D3N A;  5D0C A;  4LC2 A;  4QST A;  5FFY A;  5LVR A;  4WHW A;  4YBS A;  4QUT A;  2RNY A;  3MB4 A;  5EWH A;  5EPB A;  4BW3 A;  5CUB A;  5LKZ A;  4DON A;  5HLS A;  3U5J A;  4NR7 A;  2MJV B;  4YBT A;  5EVA A;  5FH6 A;  4LZ2 A;  5I7Y A;  3U5O A;  5DYU A;  4NR6 A;  4UIY A;  4KV4 A;  5LUU A;  5I1Q A;  5CUD A;  2D9E A;  4IR6 A;  4NUD A;  2R0S A;  4OGI A;  5FE8 A;  3LXJ A;  5I88 A;  5D3P A;  4HXM A;  4FLP A;  4OGJ A;  5AD2 A;  4RVR A;  5A5R A;  4QSR A;  3LQI A;  5DKD A;  4HXO A;  2YEL A;  4NS5 A;  5ENF A;  4CUT A;  5II2 A;  5K29 A;  4QSX A;  5I29 A;  4KV1 A;  4IR4 A;  2RO1 A;  4A9L A;  4UIX A;  3Q2E A;  5A81 A;  4GPJ A;  4HBY A;  4NR9 A;  3MUK A;  5I89 A;  2DWW A;  5AD3 A;  4Q0N A;  4NRC A;  4Z93 A;  4QSP A;  2E7O A;  5A5O A;  4CUS A;  4PS5 A;  4QBM A;  5EPR A;  3UVW A;  1X0J A;  4WHU A;  4HXK A;  5IGL A;  5KHM A;  3S91 A;  2YEK A;  3GG3 A;  4CFL A;  5E9L A;  5CUC A;  2F6N A;  4HXL A;  4NR4 A;  5HRV A;  4Z1Q A;  5D3J A;  4QSS A;  5FG5 A;  4O76 A;  4C67 A;  5F63 A;  2R0V A;  3P5O A;  4QR5 A;  5EU1 A;  5EQ1 A;  5ACY A;  5FB1 A;  3MQM A;  5EWV A;  2DVV A;  5TB6 A;  5FE0 A;  4YAX A;  5TCM A;  4QC3 A;  3ZYU A;  5CPE A;  4CLB A;  3QZV A;  3UV2 A;  3HMF A;  4O7E A;  5C7N A;  5CTL A;  5ENJ A;  4YY4 A;  4YAD A;  2DAT A;  5D3R A;  3UV5 A;  5A82 A;  2YEM A;  3MB3 A;  5D26 A;  2L85 A;  5DYC A;  4UIT A;  5LJ1 A;  5C87 A;  4HXN A;  4NUC A;  4CL9 A;  4YYD A;  4J3I A;  4QY4 A;  3JVK A;  5L8T A;  4MEO A;  1WUG A;  5KTX A;  5EP7 A;  2I7K A;  5ENC A;  5CS8 A;  4ZQL A;  5HJC A;  5L8U A;  4LDF A;  4LZR A;  4HBV A;  3UV4 A;  3MUL A;  2H60 A;  4QEV A; 
#chains in the Genus database with same CATH topology
 5JWM A;  5A85 A;  2I8N A;  4J1P A;  4UYG A;  5CQA A;  5FBX A;  5LKU A;  5DKC A;  4O77 A;  4N3W A;  4XY9 A;  3QZS A;  1ZS5 A;  5CUG A;  4TZ8 A;  4NR8 A;  5FDZ A;  5I7X A;  2N9G A;  4KCX A;  4LYI A;  4NQM A;  4J0R A;  5EWC A;  5JI8 A;  4YAB A;  5F2P A;  2DVR A;  3LQJ A;  5ENE A;  3O35 A;  2YQD A;  3ONI A;  5I80 A;  3SVF A;  4TTE A;  5LJ2 A;  5A5N A;  3P1F A;  4UYD A;  4YAT A;  4BW4 A;  5C85 A;  5H1T A;  2RS9 B;  3JVJ A;  4YYI A;  5F3A A;  3S92 A;  5CQ5 A;  5HRX A;  4X2I A;  5HQ5 A;  5FH7 A;  5DLZ A;  5CRM A;  2R0Y A;  5CRZ A;  4QYL A;  3SVG A;  4BW2 A;  5E0R A;  4QR4 A;  5EWD A;  2R10 A;  4HXP A;  4O7F A;  5FB0 A;  5II1 A;  5L99 A;  4O74 A;  4NYW A;  3D7C A;  3U5L A;  2DVQ A;  4A9I A;  4QSQ A;  4XYA A;  3D1B A;  4Z6I A;  4C66 A;  5EA1 A;  4LR6 A;  4HXR A;  4QYD A;  5FE7 A;  3O33 A;  4N4I A;  4NUE A;  5HEL A;  4MEQ A;  5HEM A;  3AAD A;  5CQT A;  4UIU A;  5CP5 A;  5J0D A;  2L5E A;  3JVM A;  4NQN A;  5HFQ A;  5F5Z A;  4MR3 A;  5G4R A;  2L84 A;  3NXB A;  2F6J A;  5D3L A;  5CFW A;  5IGN A;  5ENB A;  5DY7 A;  5DYA A;  5KU3 A;  4HXS A;  5A5S A;  5F61 A;  5FE5 A;  4MR4 A;  4AKI A;  5D25 A;  5LVQ A;  4TZ2 A;  3MXF A;  5LKT A;  5DX4 A;  5AMF A;  4CUU A;  4HBX A;  4YK0 A;  5EPS A;  4UYH A;  5A7C A;  4QZS A;  5IBN A;  5CU8 A;  5DYX A;  5ENI A;  4QSU A;  2FSA A;  2E7N A;  4UIW A;  4QR3 A;  4BW1 A;  3QZT A;  3U5P A;  2OSS A;  5HCL A;  4O71 A;  5EGU A;  4NRB A;  4O70 A;  1F68 A;  4TYL A;  3O37 A;  5FE1 A;  4IOR A;  5DKH A;  3UVD A;  5H1V A;  5E9K A;  2GRC A;  3IU5 A;  5KO4 A;  5HQ7 A;  4TU6 A;  5F1H A;  4TT2 A;  5HQ6 A;  5LKX A;  3I3J A;  4IR5 A;  4F3I A;  4NXJ A;  2G4A A;  3U5K A;  5FE2 A;  4Z1S A;  4QSV A;  4YH4 A;  4ALH A;  5BT5 A;  5F60 A;  4UYF B;  5ENG A;  5E9Y A;  4TT6 A;  5CUE A;  4YYH A;  4MR5 A;  5DLX A;  5HRW A;  2E3K A;  2RNW A;  4IR3 A;  3O34 A;  5I83 A;  4O7B A;  3P1D A;  4UIZ A;  2OO1 A;  2LSP B;  4O7C A;  4QC1 A;  5E3D A;  1JSP B;  5D3T A;  3JVL A;  5CGP A;  5E7D A;  5D24 A;  4LYS A;  1JM4 B;  5IG6 A;  4YBM A;  4XUA A;  4ALG A;  4PY6 A;  5C4Q A;  5EWW A;  4N4F A;  5FE4 A;  4CFK A;  4YYN A;  4A9E A;  5A5P A;  4YYM A;  5ETD A;  4E96 A;  4XY8 A;  4A9O A;  5C89 A;  5I86 A;  4IOQ A;  3IU6 A;  4YYK A;  4TU4 A;  4J0S A;  5FG4 A;  5FE3 A;  5CZG A;  2YDW A;  4CUQ A;  5FE6 A;  5COI A;  2YYN A;  4ZC9 A;  3FKM X;  4QEW A;  5E9V A;  3U5N A;  4A9F A;  4QUU A;  5CQ7 A;  2RFJ A;  5E74 A;  1PUO A;  5C8G A;  4OUF A;  5DFC A;  3LQH A;  5DFD A;  5CQ3 A;  4UIV A;  4UYE A;  5L96 A;  4YY6 A;  5EK9 A;  3O36 A;  4CUP A;  3G0L A;  5L97 A;  4LZS A;  4LYW A;  5FFV A;  4PCE A;  3AQA A;  5CQ6 A;  5FG6 A;  5F1L A;  5DW1 A;  5AME A;  5FFW A;  2WP1 A;  5EV9 A;  3HME A;  4AKG A;  2RNX A;  4O75 A;  4QSW A;  5A5Q A;  5H1U A;  2RI7 A;  5LJ0 A;  4CUR A;  4A9J A;  3P1E A;  2OUO A;  5HM0 A;  4O72 A;  4O7A A;  3K2J A;  4HBW A;  4WIV A;  4Z6H A;  5KTU A;  5IGM A;  5D3S A;  3VKH A;  4TQN A;  5EIS A;  3TLP A;  3SVH A;  1N72 A;  3Q2F A;  5ENH A;  3UW9 A;  3HMH A;  4MEP A;  5ETB A;  5F36 A;  5EM3 A;  4BHW A;  5CY9 A;  4YH3 A;  4A9M A;  5F25 A;  4YYG A;  1E6I A;  5D7X A;  4UYF A;  5HEN A;  4QNS A;  4NRA A;  2DVS A;  2D82 A;  4A9H A;  3RCW A;  5DFB A;  5BT3 A;  4XUB A;  3UVX A;  4PCI A;  4MEN A;  5BT4 A;  5FE9 A;  5G4S A;  5L98 A;  1WUM A;  4A9K A;  4LRG A;  4N4G A;  4MR6 A;  4IOO A;  4YYJ A;  5E73 A;  4YC9 A;  4TS8 A;  4NR5 A;  5EI4 A;  3LJW A;  4BJX A;  5A83 A;  5I40 A;  5FH8 A;  1EQF A;  4QB3 A;  4Y03 A;  4AKH A;  5EIC A;  4N4H A;  3VKG A;  5CQ4 A;  3G0J A;  3DAI A;  5HFR A;  5E9I A;  3DWY A;  5IGK A;  1ZKR A;  2YW5 A;  4PTB A;  2NXB A;  5CUA A;  4Q0O A;  3UVY A;  2DKW A;  3U5M A;  2KTB B;  2WP2 A;  5CQ8 A;  5IID A;  4NYV A;  5KTW A;  5E9M A;  4AKN A;  5D3H A;  5DBM A;  4PKL A;  4QEU A;  3P1C A;  4ZW1 A;  4A9N A;  5E3G A;  5DW2 A;  4O78 A;  4NYX A;  4TT4 A;  5H85 A;  5F62 A;  5D3N A;  5D0C A;  4LC2 A;  4QST A;  5FFY A;  5LVR A;  4WHW A;  4YBS A;  4QUT A;  2RNY A;  3MB4 A;  5EWH A;  5EPB A;  4BW3 A;  5CUB A;  5LKZ A;  4DON A;  5HLS A;  3U5J A;  4NR7 A;  2MJV B;  4YBT A;  5EVA A;  5FH6 A;  4LZ2 A;  5I7Y A;  3U5O A;  5DYU A;  4NR6 A;  4UIY A;  4KV4 A;  5LUU A;  5I1Q A;  3D1D A;  5CUD A;  2D9E A;  4IR6 A;  4NUD A;  2R0S A;  4OGI A;  5FE8 A;  3LXJ A;  5I88 A;  5D3P A;  4HXM A;  4FLP A;  4OGJ A;  5AD2 A;  4RVR A;  5A5R A;  4QSR A;  3LQI A;  5DKD A;  4HXO A;  4AI6 A;  2YEL A;  4NS5 A;  5ENF A;  4CUT A;  5II2 A;  5K29 A;  4QSX A;  5I29 A;  4KV1 A;  4IR4 A;  2RO1 A;  4A9L A;  4UIX A;  3Q2E A;  5A81 A;  4GPJ A;  4HBY A;  4NR9 A;  3MUK A;  5I89 A;  2DWW A;  5AD3 A;  4Q0N A;  4NRC A;  4Z93 A;  4QSP A;  2E7O A;  5A5O A;  4CUS A;  4PS5 A;  4QBM A;  5EPR A;  3UVW A;  1X0J A;  4WHU A;  4HXK A;  5IGL A;  5KHM A;  3S91 A;  2YEK A;  3GG3 A;  4CFL A;  5E9L A;  5CUC A;  2F6N A;  4HXL A;  4NR4 A;  5HRV A;  4Z1Q A;  5D3J A;  4QSS A;  3ERR A;  5FG5 A;  4O76 A;  4C67 A;  5F63 A;  2EJN A;  2R0V A;  3P5O A;  4QR5 A;  5EU1 A;  5EQ1 A;  5ACY A;  5FB1 A;  3MQM A;  5EWV A;  2DVV A;  5TB6 A;  5FE0 A;  4YAX A;  5TCM A;  4QC3 A;  3ZYU A;  5CPE A;  4CLB A;  3QZV A;  3UV2 A;  3HMF A;  4O7E A;  5C7N A;  5CTL A;  5ENJ A;  4YY4 A;  4YAD A;  2DAT A;  5D3R A;  3UV5 A;  5A82 A;  2YEM A;  3MB3 A;  5D26 A;  2L85 A;  5DYC A;  4UIT A;  5LJ1 A;  5C87 A;  4HXN A;  4NUC A;  4CL9 A;  4YYD A;  4J3I A;  4QY4 A;  3JVK A;  5L8T A;  4MEO A;  1WUG A;  5KTX A;  5EP7 A;  2I7K A;  5ENC A;  5CS8 A;  4ZQL A;  5HJC A;  5L8U A;  4LDF A;  4LZR A;  4HBV A;  3UV4 A;  3MUL A;  2H60 A;  4QEV A; 
#chains in the Genus database with same CATH homology
 5JWM A;  5A85 A;  2I8N A;  4J1P A;  4UYG A;  5CQA A;  5FBX A;  5LKU A;  5DKC A;  4O77 A;  4N3W A;  4XY9 A;  3QZS A;  1ZS5 A;  5CUG A;  4TZ8 A;  4NR8 A;  5FDZ A;  5I7X A;  2N9G A;  4KCX A;  4LYI A;  4NQM A;  4J0R A;  5EWC A;  5JI8 A;  4YAB A;  5F2P A;  2DVR A;  3LQJ A;  5ENE A;  3O35 A;  2YQD A;  3ONI A;  5I80 A;  3SVF A;  4TTE A;  5LJ2 A;  5A5N A;  3P1F A;  4UYD A;  4YAT A;  4BW4 A;  5C85 A;  5H1T A;  2RS9 B;  3JVJ A;  4YYI A;  5F3A A;  3S92 A;  5CQ5 A;  5HRX A;  4X2I A;  5HQ5 A;  5FH7 A;  5DLZ A;  5CRM A;  2R0Y A;  5CRZ A;  4QYL A;  3SVG A;  4BW2 A;  5E0R A;  4QR4 A;  5EWD A;  2R10 A;  4HXP A;  4O7F A;  5FB0 A;  5II1 A;  5L99 A;  4O74 A;  4NYW A;  3D7C A;  3U5L A;  2DVQ A;  4A9I A;  4QSQ A;  4XYA A;  4Z6I A;  4C66 A;  5EA1 A;  4LR6 A;  4HXR A;  4QYD A;  5FE7 A;  3O33 A;  4N4I A;  4NUE A;  5HEL A;  4MEQ A;  5HEM A;  3AAD A;  5CQT A;  4UIU A;  5CP5 A;  5J0D A;  2L5E A;  3JVM A;  4NQN A;  5HFQ A;  5F5Z A;  4MR3 A;  5G4R A;  2L84 A;  3NXB A;  2F6J A;  5D3L A;  5CFW A;  5IGN A;  5ENB A;  5DY7 A;  5DYA A;  5KU3 A;  4HXS A;  5A5S A;  5F61 A;  5FE5 A;  4MR4 A;  5D25 A;  5LVQ A;  4TZ2 A;  3MXF A;  5LKT A;  5DX4 A;  5AMF A;  4CUU A;  4HBX A;  4YK0 A;  5EPS A;  4UYH A;  5A7C A;  4QZS A;  5IBN A;  5CU8 A;  5DYX A;  5ENI A;  4QSU A;  2FSA A;  2E7N A;  4UIW A;  4QR3 A;  4BW1 A;  3QZT A;  3U5P A;  2OSS A;  5HCL A;  4O71 A;  5EGU A;  4NRB A;  4O70 A;  1F68 A;  4TYL A;  3O37 A;  5FE1 A;  4IOR A;  5DKH A;  3UVD A;  5H1V A;  5E9K A;  2GRC A;  3IU5 A;  5KO4 A;  5HQ7 A;  4TU6 A;  5F1H A;  4TT2 A;  5HQ6 A;  5LKX A;  3I3J A;  4IR5 A;  4F3I A;  4NXJ A;  2G4A A;  3U5K A;  5FE2 A;  4Z1S A;  4QSV A;  4YH4 A;  4ALH A;  5BT5 A;  5F60 A;  4UYF B;  5ENG A;  5E9Y A;  4TT6 A;  5CUE A;  4YYH A;  4MR5 A;  5DLX A;  5HRW A;  2E3K A;  2RNW A;  4IR3 A;  3O34 A;  5I83 A;  4O7B A;  3P1D A;  4UIZ A;  2OO1 A;  2LSP B;  4O7C A;  4QC1 A;  5E3D A;  1JSP B;  5D3T A;  3JVL A;  5CGP A;  5E7D A;  5D24 A;  4LYS A;  1JM4 B;  5IG6 A;  4YBM A;  4XUA A;  4ALG A;  4PY6 A;  5C4Q A;  5EWW A;  4N4F A;  5FE4 A;  4CFK A;  4YYN A;  4A9E A;  5A5P A;  4YYM A;  5ETD A;  4E96 A;  4XY8 A;  4A9O A;  5C89 A;  5I86 A;  4IOQ A;  3IU6 A;  4YYK A;  4TU4 A;  4J0S A;  5FG4 A;  5FE3 A;  5CZG A;  2YDW A;  4CUQ A;  5FE6 A;  5COI A;  2YYN A;  4ZC9 A;  3FKM X;  4QEW A;  5E9V A;  3U5N A;  4A9F A;  4QUU A;  5CQ7 A;  2RFJ A;  5E74 A;  5C8G A;  4OUF A;  5DFC A;  3LQH A;  5DFD A;  5CQ3 A;  4UIV A;  4UYE A;  5L96 A;  4YY6 A;  5EK9 A;  3O36 A;  4CUP A;  3G0L A;  5L97 A;  4LZS A;  4LYW A;  5FFV A;  4PCE A;  3AQA A;  5CQ6 A;  5FG6 A;  5F1L A;  5DW1 A;  5AME A;  5FFW A;  2WP1 A;  5EV9 A;  3HME A;  2RNX A;  4O75 A;  4QSW A;  5A5Q A;  5H1U A;  2RI7 A;  5LJ0 A;  4CUR A;  4A9J A;  3P1E A;  2OUO A;  5HM0 A;  4O72 A;  4O7A A;  3K2J A;  4HBW A;  4WIV A;  4Z6H A;  5KTU A;  5IGM A;  5D3S A;  4TQN A;  5EIS A;  3TLP A;  3SVH A;  1N72 A;  3Q2F A;  5ENH A;  3UW9 A;  3HMH A;  4MEP A;  5ETB A;  5F36 A;  5EM3 A;  4BHW A;  5CY9 A;  4YH3 A;  4A9M A;  5F25 A;  4YYG A;  1E6I A;  5D7X A;  4UYF A;  5HEN A;  4QNS A;  4NRA A;  2DVS A;  2D82 A;  4A9H A;  3RCW A;  5DFB A;  5BT3 A;  4XUB A;  3UVX A;  4PCI A;  4MEN A;  5BT4 A;  5FE9 A;  5G4S A;  5L98 A;  1WUM A;  4A9K A;  4LRG A;  4N4G A;  4MR6 A;  4IOO A;  4YYJ A;  5E73 A;  4YC9 A;  4TS8 A;  4NR5 A;  5EI4 A;  3LJW A;  4BJX A;  5A83 A;  5I40 A;  5FH8 A;  1EQF A;  4QB3 A;  4Y03 A;  5EIC A;  4N4H A;  5CQ4 A;  3G0J A;  3DAI A;  5HFR A;  5E9I A;  3DWY A;  5IGK A;  2YW5 A;  4PTB A;  2NXB A;  5CUA A;  4Q0O A;  3UVY A;  2DKW A;  3U5M A;  2KTB B;  2WP2 A;  5CQ8 A;  5IID A;  4NYV A;  5KTW A;  5E9M A;  4AKN A;  5D3H A;  5DBM A;  4PKL A;  4QEU A;  3P1C A;  4ZW1 A;  4A9N A;  5E3G A;  5DW2 A;  4O78 A;  4NYX A;  4TT4 A;  5H85 A;  5F62 A;  5D3N A;  5D0C A;  4LC2 A;  4QST A;  5FFY A;  5LVR A;  4WHW A;  4YBS A;  4QUT A;  2RNY A;  3MB4 A;  5EWH A;  5EPB A;  4BW3 A;  5CUB A;  5LKZ A;  4DON A;  5HLS A;  3U5J A;  4NR7 A;  2MJV B;  4YBT A;  5EVA A;  5FH6 A;  4LZ2 A;  5I7Y A;  3U5O A;  5DYU A;  4NR6 A;  4UIY A;  4KV4 A;  5LUU A;  5I1Q A;  5CUD A;  2D9E A;  4IR6 A;  4NUD A;  2R0S A;  4OGI A;  5FE8 A;  3LXJ A;  5I88 A;  5D3P A;  4HXM A;  4FLP A;  4OGJ A;  5AD2 A;  4RVR A;  5A5R A;  4QSR A;  3LQI A;  5DKD A;  4HXO A;  2YEL A;  4NS5 A;  5ENF A;  4CUT A;  5II2 A;  5K29 A;  4QSX A;  5I29 A;  4KV1 A;  4IR4 A;  2RO1 A;  4A9L A;  4UIX A;  3Q2E A;  5A81 A;  4GPJ A;  4HBY A;  4NR9 A;  3MUK A;  5I89 A;  2DWW A;  5AD3 A;  4Q0N A;  4NRC A;  4Z93 A;  4QSP A;  2E7O A;  5A5O A;  4CUS A;  4PS5 A;  4QBM A;  5EPR A;  3UVW A;  1X0J A;  4WHU A;  4HXK A;  5IGL A;  5KHM A;  3S91 A;  2YEK A;  3GG3 A;  4CFL A;  5E9L A;  5CUC A;  2F6N A;  4HXL A;  4NR4 A;  5HRV A;  4Z1Q A;  5D3J A;  4QSS A;  5FG5 A;  4O76 A;  4C67 A;  5F63 A;  2R0V A;  3P5O A;  4QR5 A;  5EU1 A;  5EQ1 A;  5ACY A;  5FB1 A;  3MQM A;  5EWV A;  2DVV A;  5TB6 A;  5FE0 A;  4YAX A;  5TCM A;  4QC3 A;  3ZYU A;  5CPE A;  4CLB A;  3QZV A;  3UV2 A;  3HMF A;  4O7E A;  5C7N A;  5CTL A;  5ENJ A;  4YY4 A;  4YAD A;  2DAT A;  5D3R A;  3UV5 A;  5A82 A;  2YEM A;  3MB3 A;  5D26 A;  2L85 A;  5DYC A;  4UIT A;  5LJ1 A;  5C87 A;  4HXN A;  4NUC A;  4CL9 A;  4YYD A;  4J3I A;  4QY4 A;  3JVK A;  5L8T A;  4MEO A;  1WUG A;  5KTX A;  5EP7 A;  2I7K A;  5ENC A;  5CS8 A;  4ZQL A;  5HJC A;  5L8U A;  4LDF A;  4LZR A;  4HBV A;  3UV4 A;  3MUL A;  2H60 A;  4QEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...