5IBTH

Uca fab (unbound) from 6515 lineage
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
225
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARVVADREGFGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Influenza immunization elicits antibodies specific for an egg-adapted vaccine strain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords UCA Heavy Chain
total genus 41
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH01
1C5BL 3U0TB 5KSBF 1TQCB 2Z93A 3N85H 4F9LA 5C9KA 1QSVA 4OD3L 1BOYA 2R2HB 5DJZA 1B2WH 5F71A 4LRNL 1K8DA 4PGCA 4MQ7B 3VCLA 1F4HA 3DSFH 4PLNC 1KXQE 1NCAL 3BDYL 4P5MA 1NSNL 4X98B 4H1LA 2F53B 1VA9A 3ZO0A 5B39G 3STBA 3WFHA 3QBTB 4G8GD 3JTTB 3VXNB 1BECA 3UO1L 1U91A 3K8MA 4GG6E 1NFDE 4L3EB 1S7TB 3QHFL 5E6ID 1T0MA 1A6VH 1U92A 2IQ9H 1S7SA 4NWUL 4EBQH 1DBJH 1I3RB 3MQIA 1T1ZB 1AHWB 4UU9B 3OHXB 1TCRB 2BVOB 3LN4A 3QUXC 4WFEE 3DUUA 5IMOA 1JP5A 5GRZA 2J3SA 1T22A 2DLTA 3BD5A 3VFPA 1YN7A 1KLUA 2NW2B 4L3EA 4O2FA 4S1QH 3CFKA 4AL8L 5DK3A 4RMWA 2PCPB 4MNQA 3HG1B 3N06B 1I9RH 2A77H 3O3UN 1MRCL 3IFPB 4NFCA 1WFUA 1IRAY 5EU4B 1WC7A 4CVZB 3IDXL 1XIWB 2AJSL 3OGCA 4FQXA 5E8EB 1VSCA 4MA3B 1NBZB 3SDCC 2IH1A 2XN9E 3GSQA 4JVPA 3RWEA 5EORH 4ZYKA 4XPTH 4XCNB 3MRQB 3RL2A 3G5XA 1S5HB 4GH7B 3G6AA 3NOIA 4HF5H 2VZTA 5EZOL 3RBSA 3SO3C 1KCLA 2JIXA 4PJHA 3RQ3A 2EEBA 1ACZA 4J7RA 1WAAF 5FGCB 1YJDC 5FXCH 4I9WD 3TNNB 3KPOB 5D6CB 3HNSH 3C5SB 4HAFA 3Q6FA 1J88A 5TPWL 2OR9L 2IAMC 3IXAA 5E94A 3ROOB 2AJUL 3TA3A 3UYRL 3GSRB 2YBRB 4DGYL 2DQUL 4XNZC 2P45B 5DJDA 2DQEH 2RFXA 4W6XB 4LCWA 1F00I 4AH2B 1S7WA 2J5LB 3ARFB 4KHTL 5B8CB 4AY0A 4FFWD 2GFBB 1ZS8A 4L8SC 2X05A 3K74B 3QQ3A 4LPYA 4MCYA 1MY7A 3IJSB 4HMCA 1PYWA 3TC9A 3U7WL 3GBMH 5DC4B 3D9AL 5ESQA 1XF4A 1D5IH 4K55A 5AEAA 4H26B 3LKPB 2QSCL 4K8RH 3TIEA 3HUJF 4DFHA 4F33B 5K9JH 1CIUA 3VXOA 1Q0YL 2YKLH 4JG0H 4H5SA 1MJJB 3RWGA 2NR6D 2VDLL 2D7QA 2DYPB 3QDGA 4Z9KB 3NBNA 3OKDA 4QHKJ 1BD2D 1YC8A 1MFBH 5MEOB 4K3DL 3LN5B 2B5IC 5F7WC 5KVEL 5I16B 1OAQH 2CIKA 4PRHB 2EYRA 3IDYB 3VFTA 3D85A 3AMKA 4HS8H 5I1LB 3MXVL 5CMAB 4B41A 5EO0A 3WDIA 3GM8A 2YA0A 2BRRH 3VI4E 2ZUYA 4OLZL 2BHZA 3O8XB 1I8KB 4TUJB 4TVPD 1MCNA 4OZHA 4BQ8A 4Q6YA 4R97C 5EZLB 4XHJC 3HC3H 4X5WB 1E28B 4JO4L 4YWGH 2YZ1A 1CLZH 4NM4L 5AAMA 1NFKA 1U8NB 1I1AC 1FZMB 2AXHA 5JUEH 2F54B 3MV01 1ZLWH 3BN9D 2ZG3A 5FF6A 4LARH 3PWNA 1CDYA 5F97E 5CCKL 1KIPB 3QT2A 3L5XL 5FM8A 4KUZL 4D0DB 1TJIL 5FYJH 3C87A 4KRMB 3RVXC 3W9EA 3QI9A 2D0HA 3Q48A 1XGYH 4Z7UE 2X10A 1LE9A 3ARRA 2VLJA 2BXZA 4LVHC 4DW2H 2L7JA 1JL8A 2ESVA 2Q6WB 5FYJU 5F9JB 1A7NH 1JTPA 4JFDB 4RFEB 5AG8A 4LRNH 1CGSH 1AP2B 5T5FL 1G0DA 1PKQB 1ZGLA 3ZKMD 1S3KL 1KLFA 5FUOH 4AENA 2FWOB 1TJHL 2IBGA 4NGHL 5C0CA 4HX1A 4JFPB 4JM2C 2IALA 3BP7A 1LVEA 1SYSB 5JQ6L 5GSVA 3DYPA 5F7FA 3P4LA 2AERT 4K71C 2MTPA 2WUBL 5C0BE 1BBDL 5KANG 4JY5H 1BWMA 4H8WH 5CINL 1XIWC 3O11B 1BX2A 1FBIL 1KJMB 4UMGA 4P57A 4W4OC 2QV2A 4UTAH 2X42A 4G7VL 3OQ3B 1HINH 2APWA 1M7DB 1VFMA 4UAOB 4XC1L 3DSNA 5HHNB 4BUGA 3MA7A 3FO1A 1DLHA 1GGYA 5LCVL 3OZ9H 4LCWE 4MNQB 2V6HA 1UH2A 3UJJL 4PFEA 3VGAB 2ICEB 2H26A 4M7JL 5AZ2L 1SYVB 3CCHB 3EOAB 4R4NC 2X5PA 4GAJH 1T22B 1WIPA 2CIIA 4LSQH 3DUUB 3QDMD 3LZFH 1M6OB 4XHQA 1NBZA 4EDWL 1YZZA 1J8HD 1HZHH 1PAMA 3ZDZF 1EPFA 4L4VE 2J4WL 3MJ9H 4R8WL 1WC7B 4FFVD 5C0JB 4MJ6A 5HHVL 2BHYA 4Z0BH 1R0AL 1LDSA 3HG1A 3DGGB 4FZ8H 3O2VH 3VDCA 3FB6A 3MJ9A 3HS0A 4X6CB 4BFEA 3ULVC 3BZ4B 1RZ7L 3X3FL 4NO3B 1RZJH 2LTQC 1CR9L 4QYOB 3ZSTA 3EDKA 1L7IH 4BFIB 2VLKD 5C8JB 4HUVB 4EDXB 3OR7B 1WBXB 4OTXH 4QXTB 4MNGE 1DUYB 1HILA 1K8DB 2QEJA 1NGYA 3OXRA 1JF1A 3V5DA 2AQ3A 1DN0B 3KLAB 3P3YA 1LHZA 1JWSB 4XNMB 4NJAL 3RVWC 3VI3E 5HY9A 3TPUA 1S9WA 4JHZA 1HHIB 5JO5B 4M03A 3FO9A 2XOTA 3MZTA 3CZFA 3V4VH 1WFNA 4WI2A 4S10A 4JKPL 4FQPA 4NOFA 2VLJE 4HEPG 3RKDC 5ICYA 1TTFA 1H9VA 1U8NA 1V5JA 3MC0A 1UKSA 4PRHA 5I8EA 3HPLB 2DMCA 5C09B 3S3PA 1G7IA 2JE8A 5BZWA 4PJ7E 4IRSA 4ENEC 1NUGA 4PRNB 3WNMA 2DQHL 1MCOL 4HV8B 1B6DA 3QDHA 2PO6B 2PYED 1RIUL 1W8NA 5BVPH 3ECBA 4YFLI 3O2DA 3RGVC 1TZIA 3BW9B 4CMHB 4LKCB 1YEGL 4CAGA 2W07A 3QNXB 4TULL 3BO8A 4F8QA 4P2RA 4X7FC 1OGAE 2XKSA 4LGSB 2GUOB 5MEOA 4NFDA 3ZE2F 1DP0A 1ETZB 2VXUH 4ZFGL 1UQSA 3EYQC 1ZV5A 1J1OL 4O58H 5IQ9B 4R3SA 4XP6H 4QHUB 1T1YB 1QFUH 5ENWA 1DN2A 4GW4A 3UTPD 1P7QB 3GHEL 4NKMB 3C9NB 1FZKA 5HHMD 1I1AD 1MRFL 1WGOA 1D9KC 2XZCH 3KJ4B 1N26A 3BWAA 4H0GA 3ROLB 3WFCL 5CEZH 3MLYH 3FZUC 4HPYH 3SGJA 4GMTH 4LCWB 4HBCL 4I3SH 4NZTH 3IJSA 2DKUA 2H9GB 4LCUA 3UZEA 2NY0C 1D5ZA 1ZVSB 5DJ0A 2PW1A 1TETH 4XRCB 5CZVH 3D3VA 5BS0E 3QEGL 1S7WB 1Z3GH 1HNFA 3ARFA 2A38A 1SJVA 4OCXL 4U1LA 4JJ5B 1QR1B 4XWOC 4EN3B 5HHOA 2NMSA 1EA9C 3CIQA 5F7DB 4Y5XB 4OF5A 5C71A 4JQXA 4EJ1C 3OKLA 4YFEA 1T7YA 4P23D 4QRRE 1ZHLB 2DI9A 2P5WE 2XWJB 1OW0C 4PS4L 3WIHH 1MLBA 2FBJH 4UDUA 4YK4B 1NAMH 4WIQA 3TF7C 1N6UA 2JCCE 1LO3L 2KH2B 5IMOB 4CRPA 4K3EL 5D2NB 4PJFA 4K7PX 3C5ZD 1AC0A 2HJFB 5L2KE 1G7JB 2K7PA 1DEEA 2Y07L 1UH4A 2VSDA 4TSAH 4LF3A 2NPLX 3GI9H 2IAMD 1OTUC 2OP4H 3C9NA 3MUZ1 2VERN 4UTBH 5FOJA 3DX9B 1CL7I 5LCVH 4HH9B 4JFDD 4Y5VC 2R69H 1MF2H 3I3BA 5JXEC 5EZJA 2FO1A 5EO1B 4LSPH 1RJZA 3GSOA 1X5LA 4IRSC 1JTTA 1KFAL 5C6TL 4L8CB 1E4JA 1NLBH 4LHQB 4HK0B 4LSQL 1NBYB 4JDVA 3S9DB 4FG6C 4LPWA 2WAHA 4U2ZA 1QBML 1P4IH 1WZ1H 4N5UA 1JZ3A 1T2QH 1MI5E 3K80A 1EUTA 4PJ8B 1A21A 1R3KB 1FDLH 5FYKU 2HTKD 5DS8B 2V2XB 3TZVA 2NY5C 1NCTA 3VE0B 1NGYB 3OKYA 3OXRB 3VXSA 4YHML 1N8ZA 1TQBB 4W6YB 2LAGB 1Q9KA 5CSGA 2DQTL 4PY8J 2X4QA 1LP9E 2C3HA 4ZPVA 3AROA 5DMIL 3SOBH 5IT2L 2IANE 1F11A 5IVZA 1CGTA 1MCWW 5F72S 1RZJL 4LL9A 3UDWC 1U8OA 4NRZA 4WO4B 5JO5A 4IOSD 3OMZA 4CMHC 2VE6B 5I18L 4NRXB 2OI9B 5C7XH 1WLHA 5I66A 4PJ8A 5A1AA 1C16A 3C6SA 3DXAB 4PJEB 4GKSA 4NQXA 4MSWB 4KK9C 3D5OF 4J3OC 3WFEL 4BH8B 3IB4A 1FL6A 1X6LA 3CVIH 2FGZA 1BQUA 1Q9WA 1OOAA 1XGUB 4Y2DD 5DJCA 1BWWA 3PWPE 5B3NA 2W9DL 5FAAA 5EZJB 2FX8L 3MCLH 4DOHE 1ND0B 5C08D 1N59A 1XGPA 5LVEA 4OI7A 4WJ5A 5I1CL 5GJTH 4MA8H 3MFFA 1JNHB 4L9DA 2ICWA 4QY8B 5FEBA 4KJQD 4NQEA 4IHOA 4MCZA 2DQHH 3DX7B 3F12A 2NY1D 2F74B 2NY1B 1PKOA 5F6HI 2PYEE 3VFGH 1YPZF 2H41A 2ZPKL 4N8VA 5SX4I 3NGBC 1WZKA 3DO3A 4OCSH 3QWOA 2FEDC 4DVRL 2DQIH 4KWUA 3DRTB 4LASH 4G43A 1NC2B 4X0KB 1I7RA 2AK4A 2VL5B 3NN8A 5C1MB 4HUMB 1A9EB 3P40A 1P7KB 2YPLB 4RX4A 2AJ3B 2GSGA 2B20A 4XAWH 1QD0A 2E8ZA 2BNQA 4UV4H 1BQHA 4ZSOB 3U4AA 2WSKA 1N5YL 1BQSA 1IC7H 1F42A 4EN3D 4XRCA 2DJSA 1QFWL 4QOKB 5IMMA 1EEYA 2VRAA 4RBPK 5LAXA 3B6SB 4KAQL 2V5TA 3SBWA 3BIAX 2V9QA 1T03L 1YEHH 3FO0H 1BFVH 1HHGB 1GXEA 1GGIL 1UJTA 1IGYB 5T1DH 1RI8A 4KQ3H 4O2CA 5IVXF 1LO2L 4XVSL 5DMYA 1T83C 4Y16D 4MAYD 3DX9A 4PGEA 4JPIB 4PRPE 3C2AH 5HHME 1AQKH 1YY9C 2VISB 3FFCD 4ZOBA 3FAXA 3ZT7A 5A3IC 4JY4B 4YDJA 2X70A 1P4BL 3EDJA 5LAXB 1AO7D 1AR1C 5JTWA 3GI8L 5DEGB 4PJ8C 1G7PB 3RWFA 5MEND 4UV7H 5MENE 4KC3B 4OJFL 4KMTL 5FECB 4U1MA 4YO0A 1B0GB 1NCBH 4EXKA 1TQBC 2XXCB 5JPNA 1ZHKB 1UH3A 4P48A 2GJJA 2GITA 1DJSA 5FYLL 5JXAL 4PRNA 4M4PA 3DRQB 4RGNB 4Z7WB 3IKCA 4PJXA 4WHYH 3EHBC 4N1EA 5C86A 3ARUA 4KFZC 5LGHL 2O5XH 5IBUG 4IEFB 3ZKSD 5CJOL 4KI5D 4MA1C 4OZGF 1PG7W 4M7LT 5DJ8A 3X12B 2J8UB 1CFQA 1Q9LA 5K9OB 1VDGA 25C8L 4U1JB 3K2UH 1NCCL 5DQ9B 2OI9C 1J1PH 5D2LB 1BVKB 5DC0A 1HEZB 2APVA 4D2NA 1NUDA 1DQLL 5EBGA 5H2BA 4AIZA 2J1KA 3E8UH 3QJHA 2R4SH 2I26N 3FT4B 3PL6C 4TSBL 3ZE0E 1UENA 1MIMH 1HKFA 3LN9A 5CUSH 4MWFA 2ATPA 5DJ6A 1XR8B 1F8TH 2YD4A 4NQVB 3SJVB 5DEFA 2AI0L 1EEUA 3QRGL 1BZQK 3ISWA 2BSRA 5DMJB 3IGAB 2CLZA 1I1CA 3FB8A 1MHEB 1A7RL 4ONGH 3MJ7B 2AK4E 3G5XB 1W72A 4JZJB 3DGGA 1FVEB 3BO8B 1GHFH 3O6LH 4ZYKB 3WHE0 3WDJA 1X5JA 1H3TA 1HYSD 2FRGP 5HYJB 3G5ZB 3WUWG 5GGRY 5ERWB 2BNQE 1QZ1A 2EZ0D 3H9HA 1G7MA 1RMFH 3PGFH 4XNUH 4NOBA 5IESL 1XF5A 1FG2A 3GKZA 3CC5A 3U4EB 1MHCA 3CX5K 3VG0H 3MLVH 2HG5B 1Q8MA 2DRUA 1KPVA 3STLA 4WRLA 1U93B 4LGPB 1S7VA 1T4KA 2CXKA 2H2SD 3JWOH 4N0YH 4BKLA 3BRGC 5F89B 3NA4A 1IM9A 1RZGB 1A4KB 4GXUM 3QO1A 2R2BA 4N5ED 4PY7B 4BZ1H 1Q72L 1TQCC 4RMSA 4YHYB 4M61A 4YE4H 1DE4B 2XWBB 2EEDA 2P8PA 4AJ0A 5D7IE 4JCLA 3TYFB 5FYJE 1RHHA 2AKRB 4OZHE 3NIFE 3T0XA 4DTGL 4FQXB 3OGCB 2IQAA 5D1QB 2VDKL 1TNMA 4X4YB 3KXFE 3BKMH 1TPXB 4KKBD 3L5HA 4PTUB 2ZSWA 4WEBL 5D1XB 5DEZA 3VFGL 4QOKE 4JZNB 5GS0L 2UY7A 3VXPA 3MRBB 5IK3A 3MGAA 3KLSA 3WO4B 2C4FT 5C08B 3D69B 5JHDD 2XNAB 3VXSB 4P3WA 1AGCA 2NW3A 2OR8A 3CK0H 3VWKA 5GZOD 4I18B 1I9IL 2HTLC 3JTTA 4KROD 1ZHNA 4F7CB 5FUZL 1FPTL 1MQ8A 1UXSA 1HWHB 4KRPC 1O7VA 2ZUQC 3MRNA 4UV4L 5IV2B 5E4EC 1N5YH 1ZVHA 3HZYB 1KPUA 4NO5A 4OD2B 2O61A 5ABDE 1FL3B 3GB7B 4FRWA 2EXYD 3TIDB 4FXKA 3GSUB 4KY1L 3MLTA 3ULVE 3DETC 4RIRB 4X8JA 1S7VB 2P5EE 3FQRA 2IPTL 4Y5XA 1NEZG 1AGBA 4Y4KB 1JF5A 3QEQB 5I74B 1IARB 4QRSA 5FF6B 3SE9H 3QUML 4YBQD 3ZKND 1K4DB 4C59B 5HI4D 5DMKA 1FNHA 3CFCH 4N8PA 2PW1B 2F53E 3BRFA 2OK0H 5I8KL 1OTSD 4PJIE 2YK1L 3WHXB 4CJ0A 3I2CH 5EZLA 5D7LB 2CRIA 2GI7A 1H3WM 3A6OA 3RTQB 1A7QL 5C0ND 1BLNB 5DHYA 2FECI 5ALCH 3QNZA 1RFDH 2WWMC 3PXHA 1LILA 3PL6B 1FORH 5FB8B 1WVZA 3S35H 4HJ0D 5DK2B 1I1YA 2Y6SC 3CGTA 1U8LA 2BSTB 4UV7L 4Q2ZB 4TOYH 1VADA 4MWFB 1NGZB 3I85A 4F57H 3FT4A 4KJYA 4KVNL 3SEPA 1IVLA 2N1KA 3IDIB 4Z7VE 2AK1H 1W8OA 4MJID 4L4VA 4XT1C 3RDTB 3AS2A 5GGSY 1INEH 4HW6A 4J1UA 4M6ML 5LGHH 5HDBF 3S5LA 2J8UA 1OQOA 3KHQA 3ARXA 5FGBC 2HFGL 1LWRA 3EYUH 5D93C 4Z7NF 5BOZG 1J05B 4U1GC 5EN2B 3FO2B 3H3PL 2ITCB 3ROOA 3TA3B 4D3CL 1BJ8A 4L1HA 1I7UA 3LQAL 5D7IA 2QSVA 3X12A 3IKKA 3EJZC 4TSBH 4NNPL 1MIML 4P23A 4I48A 1G6RA 2A6JA 2I60L 2JB5H 2OTWA 4M6NH 2FDBP 3DARA 3BPOB 4OFDA 4NHCH 1JZ4A 2B5IB 5E2JA 1J12A 1F8TL 5JHDE 1AD0B 1XAUA 3MBEA 4ERSH 1H0DA 3M17A 2GSIA 4JZOA 3IDGA 1EHXA 4MB5A 4O00A 4WU5A 3QRGH 2OL3L 5I2IB 5IM7A 3UBXI 4I0KA 2AJUH 3UYRH 5EU5A 1WCQA 3INUH 3FFCA 5GGTA 3SKNA 4KVCH 5KW9L 2NY5H 3RWFB 3ETBF 5T1KD 2EYRB 2FO4A 1IAMA 2HKFL 3HLAA 3N1GC 4EDXA 4JFEA 5DQJA 2EYSB 3IJYB 1I1AB 2YEZA 3TBWB 4QNPE 3UTTA 4HWBA 1VFBB 3GKWH 5FECA 4GRLD 2XQBL 5D7KD 1FGNH 3EKCA 3Q3GB 1JRHH 1MPAL 1XR9A 1JWSA 4MJ6B 5E8DL 3FQXB 2ZSWB 4KV5E 1T80A 3W81A 1G7LA 1A6ZB 4BZ1L 2BNQD 3MRJB 5GS1C 4Y5YC 3N50A 4JFXB 1A7OL 2BY2A 3UPAA 1FCCA 1I7ZA 1RZ8B 3QEQE 1RZFL 3EYVB 5FCSH 1QYGH 4P2RD 4HJGB 2NYYD 4UINH 4MD4A 4WCYH 4YDIL 3HAEA 3VFWA 4NPYA 4XAKE 3MPCA 1SEBB 1X4YA 1AE6H 5BW7C 4MNGB 1IKFH 2RCSH 2VQTA 3V5HA 1YEIL 4M3KB 4DKEH 4I2XE 2BNUB 4ISVB 1KLGB 1NGQL 4NQED 2E5EA 4UT9L 3ZKMC 1I9IH 1OP3K 1I4FB 1CFSA 2BERA 1G7MB 1XCTB 1C7SA 2X6MA 4M7ZB 3ARPA 3LPWA 5F88B 4C4KT 1T6VN 2JJUA 4R96B 4YAQA 4YEFA 1I3GL 3VGAC 4NYLB 1QRNB 2MOVA 1A7NL 1BVLA 1Q0XL 4G6AD 3JWDL 2F19L 4L8DB 3RZCB 1QLRA 3IGAA 3RTQD 4KZEL 1QEWB 4PJGB 4YXLH 4LLVB 4IRZL 2X9YA 3STZB 3HB3D 2WLZA 1OAYH 1OP9A 3SJVA 2P5WA 3DX6B 5C0GB 2GTZA 5CEYA 1BFTA 5GZNC 5DDHA 1CICC 1F3DJ 3JV6A 4UILH 5T3XL 3GBNH 3H9HB 2VDQL 5DK0A 4O5LH 4PGDB 1UWGH 2Y7QB 1CVRA 4PJAB 3BVNB 4Y5VA 3HG1D 2ZKHH 4NUJA 2HJLA 1A64A 2FIKA 5JW4M 3EJZD 1I1RA 2C26A 4K23L 5T1LB 4YC2C 4DGVL 3WEXA 2X4QB 1KCUH 3V5HB 3MRRB 1MFDL 2UZXB 2K7QA 1RZKC 3GIVA 4ZUWA 4LK4A 3WMSA 1NANH 5LQBL 1P9MA 4MSWA 3EJJX 3MRCB 1ZA6A 1OP5H 1CQYA 3TZVC 4F57L 5IKCA 5DTFB 5D7JB 4Z7QE 2RB8A 1QLEL 5KS9F 4U3XA 4Z7VF 5A2IH 2MHAA 1JGDA 1XCTA 3HFML 2H8PB 3MYJB 4AIZB 2VDNL 3VRLF 5I1DB 4JM2F 1QO3B 5T3ZL 2MPAL 4JN1L 1OD7A 4Y4FA 5EULV 4DGIL 1NDGA 5L0QC 4H88L 1MFAL 3EZ8A 3LQMA 1EHNA 1ZTXL 4FZ8L 4U1SA 5CJXC 5GIRB 1AD9B 4KJWD 1J5OH 4LKXA 4NKIH 2X9WA 3O2DL 4OZFA 3BE1L 4OCWH 3X3FH 3F7VA 2BRQA 4Z77B 4GFTB 3L7FB 4J3WA 3UROR 3TFKC 1N64L 2DWDA 5D5MB 1NAMB 2JB5L 4F8TA 1IBGH 4M6NL 5DD6B 3B9VA 3EYSH 5FM5M 3WNNA 4WWID 5IB4A 4MB3A 1RUML 1YEFL 2I07A 2AJVH 2XFXA 4M8QA 1O7SA 3HNTL 4KPHH 4OF3A 2Z91A 4I0PB 4IOFD 3M17B 1JK8B 3INUL 5J6GA 4FN0A 5EUOE 3L9RA 1TVBA 2V7NA 3OKOA 4K2UL 3CDGA 3TBVA 5CJ5A 4PY8I 4DQOH 3KGRA 4LFHD 3MV9B 4JKPH 5FDYA 4ZPTB 4Y19A 4R90L 4WHTB 1P2CA 3H2WA 3GMLB 4C57C 1VENA 5HHXL 1JPFB 4MZ3A 1G9NH 3BZFB 1G6RL 4KTDL 1MCOH 4OQTA 1K3ZA 5IM7B 3I84A 1T1WB 4J6RH 4GAGH 1JFQH 2OM5A 4CVXA 1EHLL 3IXAB 4B5EA 2Q8BH 2OZ4A 5E70A 2W59A 1IFHL 1HOCA 1F6LL 2FZ3A 3SDDA 5EU3A 4OKVB 2QTEA 5JQHC 3LRSA 2A6JB 4KJYB 4ZS7L 1HXMB 5HYFA 1AHWC 5C92A 4HXAH 5ACMA 2VB5A 3ZDYE 5BVJA 3NCJH 1R3LB 2XI9A 5KG9B 4MJ2A 4OD3H 5BZDB 1JGUL 4IOIB 1OL0A 3SGEI 1CICB 4OFPA 3L3JB 1QRNE 4AEIH 4XBGA 4OCMC 3DSFL 5GQBA 1KOAA 3DXAE 4PJEE 1FH5L 3QUZD 1EAPA 3TNMA 4DN4L 5TDPA 5FA3A 3UTZB 3P4OB 3VI3F 1BLNA 1R3JA 5CBEB 2D31A 2UYLA 3QDGE 5I76B 3QUYB 2YD1A 3SE4C 5E6ZA 3WFCH 4Z76B 5IF0A 6FABL 2ZG2A 4GW4B 3B9KB 3NCEB 4FQJL 2GJZA 1IQDA 1AGCB 3GJFK 5EU6A 3RY6A 4ETQB 2Y4SA 3UZQA 1Q0XH 1R5IB 4QF1A 3KYNB 2WIIB 1BZ7B 5I30H 5KSAC 4RIRA 1SEQH 4X8JB 4XP5L 3VXME 2VC2L 4RMUA 4X7CC 1PZUB 4HS6B 2ZCHL 3QQ4A 3I50L 5GSRB 5C07E 3MA9L 4WTZA 4PJBF 4XP4H 5C0GA 2DN7A 1YYMH 5TQ2H 2EH8L 4DAGH 1U8OB 4JVUA 1NBYA 3DURA 1NKOA 3TBTA 3ZYJA 3JVGC 4P3DB 2EDJA 4WI7A 3LV3A 1ORQA 4PRAB 3FRUA 2IG2H 2R0KH 5EUOA 1CLOH 4OLYH 4PJAA 4G8IB 4JHWH 5ACZA 2AJYH 3OJMB 5E0QA 5C0AE 3P4OA 3OB0K 3S3SA 5DS8A 1KCSL 3G5ZA 1Z5LA 2V5YA 1QNZL 3S37H 2JELH 5KSUB 1KG0A 2OMNA 3C5JA 3WE6B 3JUYA 5EG6C 1BFSA 4HWZA 3HCVA 3VWJD 5EC1A 3CSGA 4IMLB 4I0PC 1FE8L 3L3KB 3N9GH 4L8CA 1J0IA 4NNXB 3WD5L 3TM6A 1EJOL 3BP4B 2Y5EA 1H3VA 4GSDL 2KQNA 4NQCD 5B21A 1UZ6E 3GHBL 1KN4L 3BZEA 4P49A 4G8GB 3VRIA 2P7TA 4UQ3B 2IJ0C 2MCPH 1VCAA 3HNVH 1S9XB 5DMIH 5ECJE 3V6ZA 1J5OL 5CGYC 5JNYA 3ARQA 3BJ91 4K9EL 4WDIA 5E7BA 1A6ZA 1JTOA 4YDKH 1Y6NR 5ICZA 2A9MH 3N1QC 3F6IA 1OF2A 4MA7H 1NGXA 4YPGB 3UPCA 3ZKQD 2VDOL 4CUCA 2COQA 4F7EA 1AY1H 2GEEA 4X7SH 3VFUB 5ELIA 4O9HH 5DD1H 1G1CA 3W11C 4ELKB 3SE3A 3CH8A 2AXFB 4PJXB 3WFEH 3Q1SL 2VDML 1KCRH 3GRWL 1I7TA 4NZRH 1P84J 3QA3A 5GGUA 5T33L 1F13A 4PRPD 4PREA 5B38A 3ILQD 3QXUA 3EFFB 1NEZB 4M43H 2PTTB 3OKOB 4FQ2L 3HKFA 3M8OH 2CRYA 3S96B 1UM4L 4WV1B 4HGKC 1CFVL 1A6AA 2NXYB 4MVBD 3LDBC 1CFNA 4KRNA 4RRPG 3MJGX 1O0VA 3S6CA 3RX5A 4WHTA 2RQ8A 4ONHB 2NCMA 1PZ5B 3O0RL 3HR5A 1CLCA 4IRJA 1ES0A 5J11B 3BSZL 1SBSL 4K71B 4ZFZB 3RL1B 1QBAA 5C0CB 1AD9A 4Q74A 2LFGA 5E8OB 1WWCA 4U1SB 5GZND 4F7MB 1FC2D 4PB0H 5D2LF 5HDOA 4JDZB 1QUNA 5EB9A 1FVDA 4PTTA 1P4LA 4OF7A 4XMKL 2MKLC 1AO7E 3O8XA 5HYSG 3EO0A 3HE6C 1HHGA 4G9FB 4WY7H 4UOW1 3TVMB 3VD9A 3C8DA 4YO0B 4JO1L 3IXTA 4HIIB 1P7HL 1H5BB 1RJYB 2WNGA 4F15C 4HGWB 5J57B 1CGSL 5C0RH 1ZK9A 3DMMC 4LLQB 4EIZC 4G5ZL 3TT3H 5DD3H 1BD2A 1UM5H 5C70A 2VLME 1TJHH 4NGHH 5DA4A 2HFTA 4XXCC 1E0OB 3LCYA 4ZFFA 5GIRA 1AI1H 5TE6H 3VFTB 2IADB 1FL5A 3HI5L 4JR9H 3KLHD 1YC7A 4LCCA 3QCUH 4OGXH 4JY5L 3CFDB 1IGIH 3O3BB 4H8WL 4HUKB 1HH9A 4KHXH 4O2CB 3RWGB 4UTAL 5E8NB 1MUJB 4U1MB 1YEDB 1HINL 2D7PA 1JE6A 3S96A 1P6FA 4U0RB 4NHUA 2ZWLT 32C2A 4XCCL 2CIKB 4YUEH 5FFLA 2DJ4A 2ATKB 5CP3A 2LTQB 4PJXF 4GOSA 5I30L 1DBJL 4FQIL 1XT5A 2VLRA 4XMPL 3HR6A 3ARGC 4FFZL 5AD0B 5IFJB 1ZHBA 3QDMB 4P99A 1HHJB 1NBVH 4GAJL 3NA9L 2DBJA 2JIXD 1CGWA 3B9AA 1N59B 1XGPB 3KJ6H 1A22B 4PGBA 4MJ5B 5J1SC 3AS1A 4Y88A 5CEYB 3IS1X 2ZOLA 5ANME 5C0IA 4HUXA 1JN6A 3QQ3B 3OKEA 3GSQB 3D3VE 3BVNA 4EI5B 4YLQT 5CFHA 4Z8FL 2Z4QA 4BFBD 5H94B 2HFFB 2R23B 1UYWH 2QKIA 2Y9RT 5HHOE 3ME0A 1YJDL 4ODTL 3FQTB 3BGMB 2F9BT 3TN0D 4I4WB 2XZQL 3IFPA 3C60C 2AJYL 5A2KH 3IDXH 3C5SA 3S8WA 1XF1A 4N90E 2RAMA 3RVVD 3NFPA 3IU4H 3BEVA 2R9HC 5EZIH 1QFWM 5DRZB 2MNUA 2KZWA 5EORL 4YFDB 3V7AG 2VN7A 3NCYS 1T21A 1DQTA 2AJZB 3AGVA 3WNLA 2X4NA 1AXTL 2HVKA 2WINB 3MNVA 4OLWL 3BMWA 4R4BB 1YEKH 4HKZB 4KK6C 1PX3A 1QRKA 4WFGE 4MQXD 2C3VA 1JHLH 4KI5F 1AP2A 4OAWA 3MA7B 2P8PB 2C3XA 1F97A 2DQUH 4ONGL 4BZ2L 3FQNB 1LE5A 1CWVA 3UAJD 1HIMH 3KLDA 2QHRH 1XF3B 3OV6A 4IIQA 1VHPA 4KROB 2A6DB 3HRZA 2YD8A 3HAEB 3VFWB 1UA6L 5IGXL 4X7SL 4NM8L 2WBJC 3U7WH 5IESH 5CD5C 1E6JH 2ICCA 3ZYOA 3K3QA 4FQ1L 5I71C 4IMKC 5D8JL 4Y1AD 4HD9A 1ULVA 4TQEH 1DQJA 4AM0B 1NGWA 3IRPX 4ONFH 4WFFD 1AGFA 4H25B 3ILPB 1BZ7A 1QLFA 5GSRA 4R26H 1CDUA 1Q72H 1P69B 4EEEA 2QQKH 1BAFH 4LLQA 4APQD 2DL2A 3ARGA 1T89C 1SY6A 3T4YB 1CDBA 1BJ1H 4LPTA 2Z31A 1XGQB 3B9EA 1QFUL 4LEXL 3WL9B 4ODUA 4I5BB 2YN5A 1DBML 1KC5H 3BP5B 3GHEH 1OWWA 3C6LC 2R4RH 3OKNB 5I74C 3I3DA 2DJUA 2NY2C 5TE4L 4FS0A 2J6EA 5CD3B 3QH3A 1U8HA 3FKUS 4GRLA 4WW2C 2GK2A 5FM4A 4JREB 3HC4L 5FCUL 3UTZA 5IB3A 2EC8A 5E7FA 4LARL 3UTTD 4HIJB 4AT6A 1FLRH 2NY6C 4HKXA 1X7QA 5DHXB 5D4QA 2OYPA 1CZ8H 2Q76A 4YBLC 3V7MA 2GSIB 1MEXH 4JFZL 1YMMB 4WY7L 1Z3GL 4UB0H 3V6OE 1XGYL 5BCAA 5BVJB 1P5UA 4HDIB 5ANMB 1G6RB 4WFHD 1LD9B 4LBEA 2GTWA 5IEHA 1CICA 4TTDC 1YA5A 2DQGH 3RPKA 1KXTB 5F9WB 5DSCB 3VRLE 3KXFD 1MJ8L 1ACYL 4RAHA 4BH7B 5T5NG 4FMKA 4WI4A 3WIHL 3KPNA 3MRHB 4Q58C 2VLKE 1AGDB 1LO3H 1AKJA 1V7NH 3VFOA 4ETYA 4XPHL 1J1XL 2VMFA 4Q2ZA 5DJ0B 3V4PL 1BF2A 2R56H 1ZMYA 1A6AB 5IVNA 1MY5A 1FIGL 3NABH 4QRPD 2IPUG 3O4LE 4A6YA 5DGQA 1EO5A 4J3VA 2C9AA 4AIXA 3CSPA 2ADFH 5F96H 4TN9A 5FO8A 2CSPA 4LSPL 4ZDHA 1OCWH 3MLZH 3FRPA 3OF6A 5KAQF 5D71H 2V2TA 4L4VD 4Q7DA 1NBVL 3QDAA 2AVGA 5DLMH 2APTA 1GGCL 4ZTPH 5LGJA 3VRJA 5EFIA 3TO4D 4N1CA 1FV1B 5DHYB 1KLUB 3D3VB 1TVBB 4Y4FC 1YNTB 3BPNB 4J2XA 5CEZD 3R06A 2AK1L 2EO1A 3G6JA 3NTCH 5ID0B 3PNWB 2C1PA 2BSSA 4X4XA 5E00A 3ZKXB 3U4BL 1YN6A 1ODAA 5D1ZB 3F7YB 3RZCD 4WNQB 5AYQA 3ARBC 4JKKA 2F58L 1R0AH 3QUKB 4G8IA 2LU4A 3T3MF 4OLVL 2ZSVA 4N8VG 5AWNL 4RGND 5I6XB 3MGTB 5JMOC 5BRZE 1ZA6B 3EJYC 3IU4L 2Z8VC 4I3RH 1JZ7A 3RVTD 3T0EA 1GPOL 4M1DL 5J1AB 3U48A 1PVHA 5GXBB 1U91B 1TZGL 3NGBB 4HEME 2GJ6D 1FO0B 4LVOC 2AABL 5MERA 1KULA 4MGXA 1IEBB 5GS2H 5IQ7L 2F74A 1KPRB 1IAOA 3D18A 4HWBL 4KK5C 2BVOA 4KXZH 4NQEB 4PJGF 4ZNEA 3EFDH 3VCLB 12E8L 3MFFB 2GQHA 4GXVL 5KVGH 3VGBA 2FX8H 5J13B 3CU1A 4ZXBA 3WNKA 3ESUF 3T65A 3SE8H 4ODHH 4N9GA 4HLJA 1F6AB 1DZBA 5T1LA 3QIWA 4GQ9L 2R2EA 4N8CH 1T0NB 1PLGL 4NN6C 3QFJB 4MJIE 4QT5B 3THMH 3EHBD 4HC1L 3U83A 4ZUVB 2DTML 1IL1B 5J89A 3RX8A 4PP1C 3VFRA 1IGCL 2XQBH 1EZVX 4NC1E 5B39B 2YPVH 5C0EA 1UZ8B 2NY6B 4R96A 4TQEL 2GAZB 1NPUA 2FATL 1RIUH 2VE6A 3D39D 4WUUE 2E8YA 1MFCH 2ICWJ 4MQSB 4NP4H 1HKLL 4MQ7A 2YA2A 2HFFA 2V9RA 3NCMA 2GW5A 4DVRH 3QUMB 4DKFL 4WJ5B 2QADD 3VXQB 3ARWA 1KLGA 2QQNL 2ZOLB 5CP7B 5DT1H 4EQ2A 3O4OB 1G0XA 2YXMA 1QYGL 3VGEA 3WFZA 2FD6L 4NZUL 3N85L 4TNVF 5EOCH 2QBWA 4C56A 1QRNA 2W9LA 2BVEA 3IDUA 3BESR 5H35B 1HOCB 2CK2A 3TJEL 1YEIH 3JZ7A 3NACL 2KKQA 3FO0L 2OBGA 3V2AR 2HA1A 3V79C 1GGIH 5GGVY 1H8OA 1JNLH 5ALBH 1XH3B 4UT9H 4K7PL 1NMCC 3KYAA 4OIBA 3UPRA 2HFEA 3PQYD 3QHFH 5IB2A 1GZPB 4JCMA 1FQ9C 3F5WB 1DQQA 2EH7H 4M62H 5JPNB 5E2TH 2EKJA 3BKJH 5TQ0L 1S9KC 1N3NB 5I1AA 3T0EC 3WFDL 3KDMA 3JBG7 1J0HA 1E28A 3MROB 1ACYH 4GBXC 1A2YA 2QHLA 3QZWG 3RX7A 4F3FA 3KPTA 4S0TD 4POZC 1NCNA 4Y7MA 3MCKB 3GBLA 5IW3A 3JVGA 3T0EE 2ESVB 5DJ8B 3QAZB 5IJKC 4P2OA 5HGDB 2JF1A 5D1ZC 4ALAH 3QO0B 1CGXA 5DEGA 1AFVL 1JPST 3KPSE 4U1IA 4FQCH 4DKDC 3T8XB 3RUGA 3CFDA 4LIQE 1KIQB 5JOFB 1MRCH 4J4PC 3JWDC 2Q86A 2G9HA 4LNRB 4Y8DC 4IS6B 4YBHA 3F7YA 1UB5B 3H3KA 4TSCH 1PKQA 2FSEB 3X13A 3PP4L 2X7LB 4LVOB 4I0PA 3IVKB 5JMRA 2HT4D 5IHZA 4AEHH 5I1EH 2W0FA 1R3HA 2Y72A 4YDJB 5B8CC 2CUMA 3LKRA 4MJIA 5EIIB 1WF5A 3PV7A 1OGAA 3VMPA 1C12A 4Y4HC 2Q20A 3QDJE 4HF5L 2XKNA 3QXVA 1QSZA 3GSRA 3MREA 4RQQA 1UXWA 3BGFB 3MLSH 5TFSH 4UT7L 3WJJA 4PGEB 5JOPE 1FDLL 4L4TD 3F7VB 5D96C 3HZMA 4L4VB 4ZDHB 5DSCA 1T1YA 2R1XA 1IGYA 3BIKB 4QGTA 4NN6B 5SV3A 3UTOA 4L3CB 3K8KA 2OXHA 2NTFA 3GMPB 2DQEL 2A1WL 3T4AB 1XF4B 4F58H 5CEZE 5H37G 2B0SH 1FYTA 3FMGH 3WE6A 5EN2A 3PWLB 4P5TC 3PQYA 3AM8C 4HIJA 3U6RA 4D8PB 1I85C 4XCEA 1MLCB 4C56E 1CYGA 3DTXA 1TLKA 2APXA 2FH8A 3DROA 4LGRB 5GRYA 4HWNA 5FO7B 1SJXA 2GAZA 5D1XD 4JFDE 5B4MC 4IHOB 2VR5A 2PF6A 2ZUQB 4P9HH 5I17B 5FB8A 1QRND 4LSDA 4MLSA 4QNPF 5FHAL 2B1AL 4YE4L 3GSNH 2BNRA 4PV8B 3EO9L 1OTTC 3OXSB 3FO9B 1T0NA 2BRRL 3VG9B 5CP7A 2AK4D 2Q3AA 1MWAH 4N9GB 2JJVA 5HHPA 1UADC 4KKLD 4ZXBB 2CGRL 4F9LC 4X99B 4HUUA 4KH2A 4JO4H 3ARDD 1JWUA 3VWKD 4FQLL 3IJHB 5HGBA 5K9KB 1IJ9A 4HV8A 4Z78A 5JHDA 4R0LA 4M93C 4OGYL 1L9NA 2VZVA 3QFJA 4ZODA 3RNKB 5KN5B 5IMLA 3HE6A 1UZ8A 1AGBB 4Y4KA 1MAJA 2G5BB 3MRKB 4MD5B 5FA4A 4P59H 2IPUK 5JPMB 3L5XH 3AY4A 4OGAC 3VXMB 4YX2H 3IU3A 5SWZB 5CZKA 1PEWA 3KPMB 3T0EB 4U6YA 2ZJSL 1Y18A 5C08A 4RFOL 5FKPB 4HXAL 1CDJA 4WTWA 1C1EH 4NZUH 4RZCB 4E41B 1ZEAL 3HCVB 4U0QB 4XAWL 1MCHA 1KJ3L 4LLYB 3FQWB 5IB1B 2HVJB 3S37X 4KY1H 1DSFH 2PYFA 2BNRD 4R9HA 5LBSH 1FHGA 1RHHB 3LKSB 4XBGB 4JFOB 2E7MA 3NACH 1YYLL 5ADPL 3BQUB 1KPRA 3RDTC 2WV3A 3D39B 2IBZY 1NCAH 2EYTB 4JB9H 5D1XA 1S7XA 4K7PH 4Z0XB 3F65A 1MHHA 2OK0L 3KG5A 1LO4L 2A83A 3VRJB 1IM3A 1IAII 5JOEA 3B9KA 2NNAA 2XQYG 5ISZE 3RVUD 5BV7L 4G7VH 4HIEA 5DI8B 5M7QA 5IF0B 4WGWB 3B8SA 1FYTD 3FT3B 3FQTA 1BZ9B 1HH6A 3MGOB 4R0LB 1PSKL 2HP4A 2IQAB 4G6MH 4X6FA 2PYFB 3AM8A 5IBTL 5CAYB 3BD4A 1YN6B 4XTRD 3U0WL 3UJJH 3ZHDA 1P4BH 2VC2H 3GMRB 4OF6A 5KTEL 1I3VA 3MV11 4OZIB 2NX5A 4PJDB 4PJBA 3RGVD 1Y18B 2Z8SA 3MRPB 5IK3B 5JIPA 1AFVH 3BMVA 4H0IA 4NO0A 3RRQA 1LK2A 1AGDA 3DETD 1INEL 4P46B 1WCBA 4ODSL 1CD0A 4TPRL 3P30L 3T77B 3SDDB 3SPVB 1P6AB 2HLFD 5DO2D 4JFDA 3LH2L 43C9B 2UVFA 2H9GA 4Z18A 2PO6D 5CHNB 2IAMA 3HC0A 3BPCB 4RGOL 1LE9B 3LPFA 1ZT4B 3BWAB 1LEGB 4XMLL 1MSPA 4W6WB 1J1PL 4NN5B 4NNPH 1F4YH 1Q94B 1OPGL 4JM4H 4PGBB 1DBBL 5KG9A 4OIIH 1FNAA 1ONQA 2XTJE 2EKSA 5IG7B 5HYQB 1KCKA 3SKMA 5HVGB 3X14B 3RY5A 3H3BC 2GK0B 4P2OD 3PHQB 1EJOH 3QIBD 4PP2B 1BD2B 5CGMA 1VEMA 4KGJA 5DK2A 3EZJB 4RQQB 3VXTB 3ESVF 4ZO9A 5KSVA 1EBAA 1UWXK 4PJ5B 2NXYC 3HNVL 5CGTA 5C3TA 3MRFB 1C12B 3P11H 3T4YA 4XCYB 1II4E 2CK0H 4QRTA 4GLRH 4QO1A 4Z7NE 1YY8A 5KVFH 1R5VA 4PBVC 3U0PA 4Y16A 2PR4L 4D9LH 4MA7L 3RDTA 2DWEB 3DV6B 4KDWA 3T4AA 3V95A 5B4MD 5BJTB 3EBAA 3KYOB 1EJ6A 1B0GA 4D0CA 3OBAA 3BIKA 2Q86B 4GT7A 1YQ2A 3PIQB 3S5LG 4P9HL 4ONHA 1D9KB 1KIQA 3EOBA 1CI5A 4NZRL 2VDLH 3QWRD 1KXVC 4G9DB 1H5BC 1L4IA 5E5UB 2B1HL 4OUUB 2BY0A 3LQZA 1K4CA 3OKMA 4C56D 2VXUL 4ZFGH 3C6LA 5I1LA 1PDKA 1RURH 3V5KA 3EFFA 4XNXH 2X4SA 1P4LB 4PREB 2B4CC 5CJQL 3M07A 5DDHB 4OD1L 1MOEA 1K3IA 1DL7L 1RUPL 2FJGA 4AQ1B 2AQ2A 2VDKH 4Q6IB 5ICYB 4OGYH 4PJGA 4R7NB 2BOCB 3NCBB 4FQHB 5A43C 4ODXB 5A16A 3CDYA 1HSAA 5CWSB 4XWGH 5F7UA 4IDLA 2A6IB 3P77A 2VKXA 4ORGA 5SWZE 4OT1H 4PB0L 3D39A 3NZ8B 4UQ2A 1D7FA 4CW1A 4OAWB 1MCEA 4YK4C 2ZJSH 2V7HA 2J8OA 4RFOH 1MCDA 4MNHB 4KUZH 3NFPB 4QCIA 4JO1H 5IVOA 4GS7C 4OBSA 4KJPD 2F19H 4U1NA 3V7AE 1LDPL 3ET9F 3O3AB 2XYCA 4YXKH 3L3DB 1MCPH 2QKIB 4WGVB 1VGEL 1N3NA 4HKZA 5I1AB 4M5YL 4ELMB 1RZIA 2FYYA 1BMGA 3I02A 2VLKA 2O26U 5T3XH 1S9YA 4J23A 1J0ZA 3BN9C 4G80B 2FR4B 1A6UH 3G5YB 5J4MA 2F5BL 2VDQH 5DJCB 2MWCA 4HZLB 4MJ5A 5ICZB 1MJ7L 5JQ6H 4JPKH 3BEVB 2BDNL 3K8LA 5DJ2B 3CFCL 1PG7L 5A3ID 3SN6N 4WI3A 4JFHD 4F7PA 1Z9MA 1EXUA 4CKVX 1C16B 3P0VH 3GSNA 4HUXB 3VXRB 4YUEL 4JRXA 4U7MA 3PDGA 3GNML 1HQRA 2RHEA 5LQBH 2X44D 2FB4L 2ID5A 2R23A 4NHUB 3STZA 2MSPA 1GJIA 3S35L 3TZVD 2A0LC 4WFGD 1T4KB 3RZCA 2EDRA 3QDMA 4YGAB 1DVFB 1HDMA 3KJ6L 4H1LH 3UTSE 4Y1AE 1FFOA 1T2QL 3HLAB 1RZ8A 1MREL 3OTTA 5J0BA 1MHPL 1HHJA 1JVKA 1GC1C 5ITBH 1OAUH 3QI9B 4NC0B 4M6MH 1B4RA 4WFED 4GRWB 2DD8H 4JFFA 4CDHA 2VLRD 4NRXA 4APQC 2ARJQ 3QEQD 1O5DT 4ZOEA 1QPXA 1EBPA 1JI2A 2HFGH 1S7TA 2GY7B 4KQ4L 5IT2H 3BE1H 4OCWL 2EECA 2J8UF 3C8KB 4LP5A 1U95B 1F4YL 3GGWB 2G5BA 3MRKA 4MD5A 4NN7C 5EZIL 1Z0NA 1I7UB 1MAML 1U41A 3UX9B 1JPSL 2PXYA 4E5XB 3GSWA 4PD4K 4XGZB 1OSPL 1RPQA 4QRPB 3SDAA 2F54A 1FNSL 1RUQH 3NIGF 35C8H 2GHWB 3PJSB 2BSSB 4X4XB 3QXDA 2AXJA 4JZOB 4NQDE 4ODWA 3Q3GA 2ESVD 4L9LC 3ZLQC 5F8QC 3ULVF 4WEMB 1SBBA 4KTEH 3LHPH 2GK0A 4MXWH 2KDGA 1U58A 2CK0L 3L3GB 2VL4A 3BP6B 1VFUA 1I8MA 2CKNA 5I1CH 3QI9D 6CGTA 1K5NB 4JKMA 1RJZB 3GSOB 2NY2B 3D3VD 3V4VL 1EZVY 2MCG1 4HIHB 4JAMA 4JPVH 1D6VH 4AIOA 4WEUD 1YY8B 4NM8H 5ADOL 2CJUL 1ZKAA 4H5SB 4OQ1A 4S1SL 4JLRA 5T3ZE 5CS7A 4ZFOA 4X9FA 1RQ5A 3TIEB 3CVHA 3MLUL 5T3XE 2C1PB 5HJ3A 4IRJD 5DUML 4J1UB 4N0UA 3BT2L 1RIHL 3MV7E 3R06B 3G5VB 2FLBT 2VLMD 1EEYB 3GJFB 2PYEB 4R26L 3C08L 1BJ1J 3S97C 2EC9T 4GLRI 3TNNA 1AKJB 4WDIB 3LKOB 4P46A 4XPFH 5CJQH 1RZFH 3CLFH 1BOGB 3D0LB 3SDXB 2W0PA 2EIZA 3QFDB 4HG4K 4UINL 2C4FU 2CQVA 5GGTH 1IC7L 1GVIA 1KC5L 5E6IC 2YD2A 3L95B 3B5GA 4WU7B 1IKFL 2RCSL 3O81A 5K9QI 2DS4A 4OT1L 1KEMH 1YEHL 2J8UE 2BX5A 5CHNA 4I77L 1FFNA 4E0RA 3U7AA 4MAYB 3W9DA 5CEZL 4Y1AA 5T1DL 4IRSD 4GMTL 4FZEH 2IH1B 5DRNB 4JFZH 2HT3C 4QHNA 4LKXB 5EC2A 4FXLA 3A0OA 1KJVB 1BBJB 3Q5TA 3VFPB 3TA3D 3RL2B 1ND0A 1A6TB 5EC1B 4ELME 1VGEH 2RR3A 5I8EB 3E6HA 5IJVB 3RGHA 5HJ3B 4LBEB 1A9BB 3TIDA 4IRZH 5JW3H 5LWYH 1KGCE 3QUMA 3I50H 1P84K 3FFCE 3U7YH 3HUJA 2CR6A 3VWJA 1JYVA 1ZGLP 4OZFB 1ZHNB 2PNDA 3IFLL 2VAAB 3V4PH 1F3DH 2F54E 4V1DB 4Z7UB 1V3KA 1Y6KR 4YR6A 1JF1B 1FIGH 3NABL 4LLMB 1FSKB 2YD3A 4GKOA 2GJ6B 4PRBA 1DQQB 3KPLB 5EWIH 4OUOA 2A77L 4J4PD 2AEWA 4FABH 5IFAH 3GI9L 4MNQD 1X5HA 2YUZA 3TN0A 1U95A 3D2UB 2YC1A 3QEHB 1DN0A 3KLAA 3WLBA 1DQLH 4JZJC 4WHCA 1WAAA 2R2HA 5CSBA 5DJZB 3SDAB 3ALWA 3AREC 2O61B 1ZT7B 4J12A 3TYGH 2EDKA 4LQ1A 3TPUB 2G60L 4H1LB 5FV2A 1L0XA 1W72B 2WZPD 4MYWB 4EUPH 5C2BL 1EEQA 3FJTA 3BHBA 2L0DA 1QBMH 1WZ1L 3MRMA 2UYLB 5I76A 4JGUA 3HAEH 4GSDH 4I8DA 4NO3A 4U6HB 2D4FA 3CFEB 3HNSL 5CJ8A 4G42A 2B2XH 1LNUA 1YQVH 1CE6B 5F7MC 5TPWH 4HUVA 2XG4A 3FB7B 4U3CA 1MFAH 4KQ4H 1OT1A 4UOW0 1GOHA 4LIQL 4FQXC 4K9EH 5E6IA 3HPJB 3O6LL 4P4KC 2MQ3A 4YHZH 2VJXA 5EA0H 2VITB 3ULUD 2FLRT 2NY3C 2D0FA 1KELL 3F62A 2VDOH 1HQ4B 4M00A 1JPSH 3PWPA 3OJDB 3GIZH 1KYOJ 3VWJB 5D2LA 1E6OH 3GMNB 1D5IL 4KMLB 5I75C 3VFRB 1UVQB 1TPXC 4HWBH 4E42A 1KNOA 4L29A 2ADIA 1ADQH 3P4NB 1U8MA 2ICEA 1DUZA 3EFDL 3BZFA 1ZWIA 2YWYA 5J3HC 4GW5B 2AJXH 3DRQA 2RGSA 4BQ9A 4W81A 4HS8L 1QSFA 3STLB 3UDWA 3MJ8A 4NZDA 4K2UH 1J11A 1FNEA 4M9OA 4LVNC 2FX9H 5F70A 3QJHB 2XT1B 4MDIA 1ZA3A 3GK8H 5DJ2A 4JJ5A 1OGTA 5ICXA 4OKVA 1D6VL 1WEJL 1YMHB 4P46D 4EUPG 4Y4KC 1OGAB 3KPRA 4HZLA 4LVHB 3SDDD 2DTMH 5E4EB 5I8CB 3MJ6A 4U49A 4YWGL 1FFNB 1FZJB 4JKWA 1IMHC 1G6RH 3QFJE 4P2QD 5E5RB 3QSKB 1KJMA 2EDWA 5DJXB 2XWJA 5DUMH 3DLQR 5HPMA 4FQHA 3W2DL 1RIHH 3I9GL 3CUPA 3DUSA 2VH5L 1CK0L 2WWKO 4WU7A 1RY7B 2K1MA 1NCUA 4M9PA 2QJDA 5B22A 3NFNB 1OP3H 1CT8A 1B0RB 1OTTD 3SDXA 3REVA 2AV7B 4TUKL 5DJAA 4PJEF 4MMZC 5EOCJ 4DZBB 4ACPA 4DW2L 5C0RL 3KNBA 4JHAL 3NCJL 1XF2B 1F4WL 2F15A 1UM5L 3MNWB 3NIFF 2RBLA 1NC2D 1NCDH 2FJGB 2NXYD 3D85D 1G9ML 1V3MA 1JGUH 4HXBL 4MJ4A 3VFMB 3KPSD 3V4UH 4PRPA 4AEIL 4UAOC 1AI1L 1H0DB 4DJMA 4PV9A 2NZ9D 4PJ9C 1KEML 1YDPB 1TZHB 5SWSD 1AJ7H 2BOCA 3QCUL 5AYUH 2X09A 1EH9A 4NT6A 5D6DA 3SE9L 1JNLL 4XPBH 1MNUL 4GRLB 4FZEL 3WIIH 3L3OB 1NGPL 4NKMA 4ZAKD 5KSAD 2PXYD 4PLJD 5DXWA 2ITCA 4HIHA 1QFPA 5HPOA 3QDGB 3BD3A 3UPRB 1I8LC 1K8IB 2OX5A 2UVEA 2P8MA 5D93B 1NQBA 4JO3L 1H3PH 4GXUN 1LO0L 3RJDA 4PG9B 4ODUB 1MFEL 2W92A 2BXYA 2H1PH 4P4KA 3TA3C 1WBZA 3HE7D 3CFIC 3O3EB 5TQ0H 3RL1A 4XNYH 3K4AA 5E2UH 1FN4A 4WU5B 5CZXC 3MV8A 4HAGA 3LKNA 4S2SB 1WTGT 4TOYL 5HBBA 3K7UA 3QQNA 1RIVL 1A1NA 1Z9SA 5SX5K 4JM2D 5E1AB 2AV7A 5CBAA 3MA9H 2CRZA 1A1MA 2H6PA 1CT8B 4LLUA 4QXGH 2ARJA 1JNNL 1HZHL 1MVFA 4XXDB 1CD9B 2LAAA 4BSWB 1MVUB 5BS0B 5JDJA 1JGEA 4W4OA 3BPLB 1C7TA 1FL6B 1KB5A 1ZANH 5FDWB 2NQCA 4G6JH 1D5BB 4GJTB 4P5TB 3MRQA 4WTXA 4JFFB 3RVXD 4JRXB 4GAYA 4L5FH 4JRXD 5I75B 5IB3B 3B3IB 3CFJB 3U2SA 3LEYH 3PXJA 4PJ7B 1AR1D 5CJBA 3V6ZB 3N1FC 15C8L 4PJ9D 5E94B 2XTJD 3RA7H 2IF7A 3EYOB 4F7TA 2LU7A 1A9EA 2J6EL 4LSRH 4ERSL 3T3ME 5C0FA 5FGCE 3QNZB 1XGQA 4ELKA 3DVIA 3MLWL 2BP3A 3MOQA 1DQDL 2APFA 3DXAA 4PJEA 1OT2A 4XCNA 3U46A 3ZTJG 4OZIA 2IFFL 4OLUH 4C58B 2MCPL 3DGCR 4YHZL 5GS1B 5I8CA 5F1NA 1QSEA 1TCRA 1YMHA 1MRDL 5DJYA 2X1WL 1U8KB 5EU6D 2AQ1A 5IGXH 3PHOA 1LK2B 1P53A 4JFHE 2CR3A 2NW2A 1E4KA 2A2QT 1E6JL 1V3JA 4LP4A 5F7NC 3OPZL 4FP8L 2HJKB 4GRMA 5C0IB 1NAKL 3CVHL 4O9HL 3FRPG 1JMZA 3WO3B 5KJRH 1FZOB 2AJXL 1YEGH 2DLGA 3PP3K 3IAQA 1AHWA 1A8JH 3C8HA 3L3HA 3TCLA 5CP3H 1E4XH 4X9IA 3QUZA 3VWKC 5FHAH 2CMRL 1BAFL 3BH8A 2R15A 2NLJA 2APBA 4M61B 3BYYA 3PWPB 1HXYA 1NFIA 3M8OL 1MLBB 2A83B 1UM4H 1CGYA 4YDIH 2CGRH 4R4BA 3IU3B 2EIDA 1MUJA 4XCFH 3VXNA 3V0VA 2ICWI 4H1LG 2XRAL 3MLRL 4OFYA 2VQ1A 2C1OB 4XI5D 1T0MB 4Y5XC 1KB9J 3RNKA 3ZE1E 4WEBH 5FM5O 3QPXH 3MUGA 3WXWL 2OTWB 4MAUH 1CLYL 1G9NC 2BHUA 3ULUC 4PJAE 4PRIB 3BDBA 5E2VH 1SVCP 4PJ7F 1CG9B 5TH2B 3FOMA 3W9DB 4M5ZH 5E56A 4G8EA 4POYA 2A9NH 4X9GA 5ID1B 3HUJB 5BQ7B 4JQIH 3JWOC 1FJ1B 1ZEAH 5HGHB 3RIAF 1T20B 4JRWA 1RV6X 4PJ5A 3H42H 1EAPB 3MTRA 3O9WC 3TNMB 4K7FB 4YC2B 3UXFA 3O6FB 4D0BA 4WUKH 2EE6A 2BVQA 1IZKA 4TUOA 1D9KA 5ADPH 2O93L 2LE9A 2R0ZH 5DWUL 1RK1B 4D9RD 5TE6L 3QIBA 5DUPH 2DMKA 4JB9L 3WIIL 2ARWA 2DIBA 2FBJL 4XVJH 5KS9A 4LHUA 3VXUA 3ZE0F 5I17A 4HDIA 3VGGA 3OAZK 4OV5A 5D7JC 4YDLC 3SO3B 3U0PB 3C2SA 1H3PL 5HYSA 5I6XC 1I8KA 4TUJA 3MJ7A 4U4BA 5EU7E 1VEPA 1S9VB 4U6TA 4LAJH 3MLXH 3PGCA 3E2HC 1L0YA 2VXQH 4PG9A 1PSKH 3KPNB 2CO6B 1MVUA 5BS0A 1A7QH 1K8IA 5IJVA 4LU5L 4NQCB 3IKCB 3GMMA 5ALCL 3ZL4H 5ITFA 4FFZH 2VXTH 5K93A 3HMXH 3RU8L 1RVFL 4NBYB 2CLRB 4Y4FD 1JI1A 3DIFB 1I7TB 3KWWA 4J3SA 5F7HA 2DQDH 2M26A 1PQZA 2C4XA 5D1ZD 3UYPA 3GMOA 4X7TB 4NO0D 1JNNH 1JGLH 4MLIA 1DLFH 4PJBB 1YMMA 1D5ZB 1UACL 1ZVSA 4PRPB 3RGVA 3LEXB 1W0VB 4OZFH 2VKWA 4JFFE 1CD1A 4G6JL 4PJFE 1QACA 3CXDH 2G9HB 4AM0A 4X4ZA 5IHZB 4ZAKC 43C9A 3L3OA 2YD6A 4QTIH 4UDTB 2P5ED 1U9KA 2YXFA 3EYFB 4XC3H 15C8H 4XP1H 5GGRA 4YGVB 1KBGL 4IIQB 2NXZC 3CDGB 3EOTL 3EYSL 4XNQA 5DC9B 1PY9A 4QRSB 5GS0D 2J6EH 4HCRA 1WIUA 3FB5A 2OQJB 1S9WB 3RUGE 3VXPB 4IMLA 5JA9A 3TT1L 2K9UA 3UC0H 3UTTE 4XI5C 5MENB 4XPAL 5F6HJ 4KPHL 3MNWA 4W68A 1EVTC 3E3QE 1DQDH 5I8OL 3MROA 3HMWL 3SJVD 1MI5A 3DX8A 5DHVH 4DK6A 4M48L 3HZYA 2JJTC 1GZQB 1BZ9A 1HH6B 5D7KE 1SY6L 4M3JA 2VSCA 5C8JA 1C08B 4P9HC 5KW9H 3P11L 4HWUA 4BM7A 3MRBA 1F5WA 2R1WA 1N0LA 2C3GA 2R2BB 2AP2A 3CZJA 4PJ5E 1CFTB 3FQUB 3WXVL 1FFQA 2YPVL 3QIBC 4X5XB 5SV4A 2ERJB 2P48B 1HXYB 1ED3B 4JFYA 4K94C 2ZUXA 1RUAH 3CC5B 4Y4KD 3U4EA 4NKOA 1YEEH 1B6UA 1OHQA 4DKFH 3L3HB 1X9QA 4X4YA 1IFHH 4PY7A 1BX2B 4GS7B 4OCSL 3VFNB 2VXVH 1DTUA 1KJ2A 4WWKA 3ARDA 5JHLH 4J8RA 4LRIA 2DF3A 5E2WH 2CKBH 1HHKA 4FHBD 3B4NA 3MSPA 2EDNA 2UZIH 2DKMA 1HCFX 3QO1B 1MHEA 3RP1A 4IJ3C 4WCYL 2BSRB 1DBMH 3L3KA 3R4DA 3P9MA 3SY0A 1FH5H 3FCTA 4LCYA 1P1ZB 1R5WA 2UUDK 4U1NB 3ULSA 2P47B 1AE6L 4F7TB 1HQRB 1PEZA 5EUKA 4LPCA 2X2YA 1GL4B 5FHBL 5B38G 4XBPB 1BFVL 5CGYD 2IGFL 5DMGC 4M1GH 2K3TA 3E2HB 3GEWB 2BNRE 3WBDA 4KQ3L 3D2UA 2MQ0A 1C5DB 1HEZA 4UIKH 4ORGB 4OSUH 2VXSL 1SYSA 3BKJL 1H15A 1PW3A 4RGNC 3HZVA 2V17H 4WUKL 2O5ZL 1SEQL 5T1KA 3ZTNL 3L3DA 3ABZA 5DD5L 5DJ6B 4NQCE 1CE1L 4QWWD 3SBWC 3U9PL 5A2JH 4RFNB 1ZT7A 5D96B 5C2UB 3MBED 2AV1A 3DVNB 1K4CB 1UKQA 1WFOA 3OKMB 3R1GL 5D1QD 3GSVA 5JIHA 2DLFL 1CXHA 3REWB 1T7ZA 2Q8AH 4L1DA 1H8NA 1OGAD 4HKJB 4BK4A 2J8HA 2W0FB 4LLUB 4U6VL 3W39B 1S9YB 4ZAKB 4G6KH 1NANI 3P0VL 5GSVB 1WBZB 2R0KL 3O3EA 4MD0B 1L7TH 3HI1A 5GGQH 3RIAK 5DR5H 2ADFL 5F96L 4X4MA 4NN7B 4PBWD 4JQVA 25C8H 4ZO6A 3MLZL 2WK2A 1EUUA 5C09E 1ZAGA 2XPGA 1A5FH 4GMSL 2EYSA 1WAAE 2JELL 4Y1AB 1KIRB 5F1IB 3QWQB 2X4UA 2W60A 3P2TA 3I6LD 3P4MB 1TDQA 2XKUA 1EV2E 5FA3B 3LS4L 3BXNA 1MJUL 4EVNB 4HLZG 1FP5A 1S78D 3Q6GH 3TVMA 1QLEH 2PUQT 3ZDZE 4B7LA 1T2JA 5MENA 2KQMA 2HH0L 1ZLVK 2Y5TB 4QLRA 1ZLUK 1S7RB 2AI0H 3VFVA 1ZT1B 5L9DL 1A2YB 3GHBH 1ITBB 1XIWD 2FJFA 2MPAH 4JN1H 2BVUA 3KDMB 4WNQA 5L8KB 2E9WA 2BFVL 2E7BA 4OM1H 5HVWA 1M71A 5DJXA 5I1JH 1LP9F 4GRWE 5FYKH 5KOVC 1KT2A 4M93B 3GJFA 4MAYA 4X5WA 5J9PA 4ESKA 1KBGH 2LVCA 4UDUB 2XA8H 3PGFL 5C0CE 1TZGH 2ILLA 3ROLA 4TVPH 1GC1L 5JNYB 2AABH 4ZQKA 2PETA 1D6EB 5K9JL 5D1QC 2EDOA 4XPAH 1K6QH 5LGKA 3Q1SH 5JZ7C 5HYSB 1QOKA 3RKPA 1AD0A 2AJVL 2G75B 4PP2A 4QTHA 5BV7B 2VIRA 4GKNA 4JDTL 1MFBL 1QVOB 3IDIA 1YEJH 4K3DH 4F15B 4U1LB 1PQZB 5KS9B 4GG6F 2VR4A 4M43L 3KWWB 3CNKA 1MWAL 1R6VA 3N0PB 3RWIB 4XP9H 5A2LH 1ERNA 1MWAB 1D5MB 3F58L 4N0FA 2R2CA 5C0BD 5JR1H 2NY4C 1AIFA 2R8SL 4L29B 1IGCH 3U36A 5F9OL 4NM4H 3T2QA 5C0DB 2IAMB 3HC0B 1QSFB 4HIEB 5HXMA 1NCWL 4MVBC 1T7XA 4XNZB 2HMIC 2W1NA 5E95B 3NZHL 1F2XK 1P1ZA 1JNHA 5JHLL 4MQTB 2D03H 4O2FB 3S98A 3QRFM 3SDXE 3WKMH 5HYIA 2BJML 3B2UC 3ARGB 1H15B 4OCRL 2KL6A 4UOJA 7FABH 3KYKH 4P2RB 2LU3A 1KJ2L 1WISA 4F80A 4G5ZH 4Y2DA 3S35X 3RWEB 5D6DC 4H25A 3MOBL 3FN0H 3F7QA 4X4ME 1NFDB 4ZXBD 1YYLH 5CEXA 1U8PB 1Y0LB 1IM9D 4JFQB 1I1FA 3QH3B 4NQXB 5FUOL 3SDDC 1PGRB 4IRSB 1S7SB 4J3XA 3TFKD 2UWEE 4X7DC 2E7LC 4M1GL 4OGXL 1IC5H 3HI6L 3GGWA 4JPWL 4LCYB 4I2XB 1IILE 2DB8A 3V8OA 2GJ6A 5I1IH 3OGOE 2WUBH 5F6IB 4GG8B 1IGJA 4HMDA 5DF0A 4F37F 3C60B 2YK1H 3SCMC 3GJEB 3T0ED 4R97B 5MI0C 5T1MB 1AR2A 3KPLA 4AYFA 1BFOB 3U0WH 2YZ8A 4X6DF 1RFDL 1JWUB 4R4FH 1G84A 2H45A 3VXSD 4Y89A 3NFSH 2VZSA 2ZUTA 3ULUL 1BQHG 3G9AB 4LDLB 1A9BA 5HHPB 5I19H 3JV6B 2DM4A 3E6HB 3NH7H 3GO1H 5FOBB 1N7ML 2NNAB 2VLKB 4BSVA 2ZCKH 2NXZD 4WW1B 2P4AB 2DLIA 4WO4C 2WBWB 4I18A 4JGJA 4YIQB 5TDOB 5IFHL 4EDWH 5GGRB 1XMWA 4ODVL 1OP5K 2FNBA 4DZ8A 1MCIA 5HYJE 3IDNA 1IGFL 4L3AA 1UM6H 5DR5L 1L0QA 4R8WH 2V2TB 4HULB 4ZOCA 3FFDA 3OF6D 3QHZL 3BYTA 1E27B 1CDIA 4PRID 5IVXB 1QSEB 2WBJB 2Z9TA 4AEHL 4NKDB 1MQKL 2HT3D 5J9PB 1IAKA 4CADA 2EC9U 1YNTA 1CR9H 4U6YB 4HWEH 3M1BA 1RU9L 2IALB 4HCRH 5DFVC 3SO5A 4YHKH 3WIHA 4YGVA 5K59E 4OTXL 1AKJD 4PLKC 1ZLSL 3O4LB 4G8FA 1FE8H 3MRHA 1VB9A 2G75A 3O3AA 1LK3L 1F6FB 1DR9A 2EE9A 1A6WL 1CVSC 2B2XL 2BVTA 1XR8A 2NTSP 5IEKB 2Y5TA 1W0WA 5HHOD 2D7TL 3DO7A 5IQ9A 4ZSOE 5DRXA 1UEMA 3FQXA 1KACB 3CMOL 1RUKH 3RUGF 5IIEA 5GRVL 4NQDD 4PBXA 1FYTB 4F9PC 1KT2B 1KCVH 3QCTH 3WHE1 3X3GL 5CBAB 4QRRA 3RWJA 4YHNA 4R7NA 4QHKI 2FH6A 3MBEC 5HDQL 2DLHA 3SQBA 4MXQD 4ONFL 3S34L 2VIRB 4FMFA 4GKNB 5BVPL 5JORA 1JRHL 2H32H 3HE7C 3T3PE 4JREC 4KDTC 4EXPX 3SDYL 2ADJA 4D9QD 1QBLL 3BP6A 5J56B 4PRDA 4PGZA 1FNLA 1J18A 2LABA 5KSVB 1PBYA 2Z31D 1DL7H 3CDCA 4EI6A 4FQ2H 4RX4D 4PJ9B 1ZGLM 5I15L 4RGMB 4NC2B 3FOLB 3MRIA 3VFSB 4DWHA 1FFRA 2VABA 5I1GL 4PRHE 1CF8H 4XWGL 3E6FB 4EZMA 4M6OH 1FVCA 5F6IC 3QG7H 5EOTA 3W2DH 4DKEL 3OR7A 3WEXB 3P9LB 2VH5H 4PV9B 3QIUD 3QUXB 4P59L 4LCCC 5D5ME 1PKQE 2FL5B 2UV3A 4O02H 2AAVA 3T1FB 2MMXA 4HQQH 1ZSDA 4JO2H 3DUSB 3KR3L 2D2OA 1OVZA 1E4XI 2QR0A 2Y25A 4DZBA 4JHAH 4B0MM 2P8LA 1DVFC 1I3GH 1SJHB 4JE4B 2QADC 4U33A 1N6QL 3MRLA 5BW7A 1MJ8H 1DSFL 3TT3L 1DANT 5LBSL 3BDYH 4P2OC 1KYOK 4QRRD 3ZYIA 3ZZ1A 1OAXL 5E1HB 1FZOA 4KKAD 1AGEB 3ARTA 1S5HA 1VKXA 4PJCE 4BFIA 4DVBB 4UILL 1GZPA 3PWVB 4MNQE 5FYLD 4PJ8D 2R56L 1NDMA 4WV1A 1SYVA 4PD4J 2QQLL 3FTGB 2ZKHL 5TDNA 2A0LD 5BV7H 3SHSA 2H1PL 2Y07H 3TYFA 1T3FA 4DGVH 1LEIA 2OMBA 5C6WH 2HLFC 4TSAL 5DO2C 3PV6A 5E2UL 5JA8B 4UTBL 3VH8G 3B2VH 3W11D 3MUY1 1EVUA 5GJSH 5HVHB 1K4DA 2PKDA 5L0QB 4ZSOA 4XMPH 4Y4HA 1NMAL 4NIKB 5E24E 2IFGA 3FZUD 4JEGB 3RY4A 4KK5D 2ED9A 1FNEB 2X89A 4NWTH 1LGVA 1NLBL 4WW1A 2Y6SD 3MO1B 4L8SB 3NPSB 1MHPH 3C5ZB 3T2NH 1FO0H 2WWMD 4E41D 1M7DA 4OLXH 1ORSA 1OAUL 5MEPA 4ODSH 5FYJD 4YNYA 1JHKL 2EE3A 1XH3A 1OAKH 5TDNB 3U4BH 1ZE3C 3CMGA 4LSVL 4KXZI 1INDH 4KTYA 3S4SA 3QZWA 5DRWA 2QLVB 5GS1A 2XZZA 3PV6B 3QHZH 2FEEL 3IDNB 5F9JA 1ZTXH 5EDXA 2R29L 5AWNH 3FRUB 1VFAB 4P5TA 4XB7A 1VACB 5GGSA 2I25N 3JV5A 1DBAL 2VDRL 4F2MA 1GSMA 4HFWB 1BM3L 3G6JF 5FUCC 1SM3H 5EBMB 3QJFA 3SDCA 1A3LL 3FT2A 4D0DA 4HT1L 1OSPH 4C83A 1F58H 4JM4L 4HWEL 1IBGL 1KG0B 3C5JB 5C08E 4PTUA 1FNSH 5J06A 3QPQC 5DUBB 4LSRL 1Z5LB 4HS6A 4IBLT 1BGXL 1C5CL 1LK3H 4RWYL 1YEFH 2KUTA 4OLWH 3FQWA 5IB1A 4GXVH 3RKDD 1W0VA 4DGYH 4G6FB 1H3GA 3LKNB 4MXWL 4UZGA 1GGBH 3WNPA 1N4XL 4LSTH 4RGMC 2E6PA 5JDSB 4KHTH 1GCFA 2IFFH 4OLUL 4DKAA 3LV3B 2VLJB 2W9DH 4BELD 2H2PD 3MCLL 4OUUA 2VLJD 2YSSB 4G7YH 4RGNE 5IHUH 1WWBX 1DDHA 1G7QA 4JANA 2DDQL 5GJTL 1CXEA 4HC1H 3FOLA 3MRIB 2I5YH 3WN5B 5DVMA 1FVDB 3O8XD 4PTTB 5HHXH 1IGTB 2R0WL 1S78C 2OZ4H 4XB8A 4LCCB 2X4SB 5F44A 3FO2A 1NMCB 4FTVA 1U3HC 4PP1D 4D0CB 1GZQA 1MCFA 2DM3A 1IQDB 1T5WB 4MXQC 1EHLH 5DVNA 5IWLC 1EAJA 1DVFD 3UYOD 4PJCA 3HR5B 3QYCA 3D18B 3PNWA 4LCIH 5D2NA 4TTDD 1T5XB 3NIDF 2DQJL 4ETQA 2EDTA 2ESVE 4L4TB 4LASL 5ILTL 1HNGA 3VW3H 1RURL 2QQKL 5B3JF 2YD9A 1CXFA 4K3JH 4QEGA 4YHNB 1MCWM 5EOQL 3RAJH 3A6BL 1RUPH 4MX7B 4MS8D 3V6OA 4HK3N 5IR1A 3DROB 2EIZB 3QFDA 1QFWH 1JV5A 4U1HA 5TE4H 1KJVA 3JTSB 2MFNA 4ZFZA 3U30C 3CX2A 5C0BA 4MAUL 3DO7B 2ZUWA 4NUGH 5JW5B 3ZHLA 2PYEA 5FYJL 4JO2L 3O3DB 2VUOA 4HKXB 3MV7D 3IVKA 2FHCA 4NRYB 5TGBA 1LO2H 3RZWA 5FK9A 5DRXB 4PRHD 2EH7L 4M62L 2YOCA 2MQCA 4KJWC 1J10A 2H2PC 3R0MA 2V7NB 1D5XA 2CLRA 4WW2F 4ZTOH 3NPSC 4I13B 3T8XA 4C54A 2DQGL 5JW3L 4QHMA 3ZMRA 4NQCA 5ITFB 2IH3A 5DWUH 3BP4A 4D9QE 3GI8H 9CGTA 2W9EL 4QRUB 5ESAA 3ZDXF 1S7QA 2A74A 1A6UL 2I9LB 2YA1A 3D48R 3BAEH 4NKDA 4JPKL 2FSEA 3X13B 3S88H 5FYLH 3FONB 3LEVL 4NQSB 4UT6L 3UMTA 5GRVK 1TZIB 3BW9A 3RY6C 1FNGB 1XIWA 4FQXD 2XY2A 4XWOD 4M7KH 4KDVA 4KI5E 1N5AA 1JCKA 1CCZA 2X4PA 2X41A 3TP4A 5CD3A 4NQUA 4NKQB 4OCLC 5T1MA 2NX5B 1M05B 1X5KA 1NMAH 4P2CG 5C09A 1HN1A 5EBLB 5HHQA 4YEEA 3HMXL 5D71L 2CO7B 3RVUC 1T6WA 1QG3A 1KCSH 3L3IA 5M95B 1QNZH 3GSVB 4Z0XA 4ZTPL 1NFIB 4BSVB 3WFHB 3UBXG 1GRWA 2GCYB 5ID1A 2F8VA 1J0YA 2KPNA 1WUNT 2AEIT 1UACH 1X7QB 2J4WH 1HQ4A 5GRJL 4K94H 4PUBH 1TITA 4PGCB 2PO6C 3ARED 1RZGA 2GSGB 3O9WD 2YC1B 3VD7A 5IVZB 4DEPC 1KN4H 3D87B 1Q1JH 4ZXBC 2P24B 2IANB 2F58H 3JV4B 3BQUA 1CGUA 5IMLB 1XEDA 5C9JA 4OLVH 2HJLB 5FYLE 3FMGL 5JIKA 5SWZA 4JRYE 1EEZA 5D1QA 1SM3L 4PJ7A 2L7UA 2P43B 4FOMA 2A9ML 1A3QA 5DK0B 3LB6C 4YR6B 3BKYH 4U31A 1VACA 4NUJB 4XTRC 5MP6L 1WT5C 4RWYH 4P5MB 5D72L 3QZWB 3SE4A 2SEBB 4PB9H 1WV7T 2ICWB 5IQ7H 3SY0B 1Z9OA 4NJAH 3P0YL 1PFCA 4HK0A 1UCBL 5C0FB 2CLVB 3GRWH 4IDJL 1KTRL 3MCG1 2Z93B 2I9TA 3L6FB 4YAQB 4KTEL 2FX9L 5KN5A 1K85A 4CN4A 3CXHK 2DQFB 3QJFB 3SDCB 3MO1A 5IHUL 4M7ZC 2PTVA 3AAZB 4WWKB 2E9BA 3EO1B 4K3GA 2AXGA 1AXSA 1CFVH 2OJEB 2VLLA 3HS0B 4X6CA 3VFNA 1JNJA 1U8KA 2F53D 4R7DB 3WUWA 3GRWA 5ISZD 4OZFG 2FJHA 1BPVA 2NY7L 5DA0B 5B39A 1HWGB 1SBSH 5C0EB 4AZ8A 3VD4A 5E5MA 1IE5A 1XCQB 4G6AC 4S11A 1RUAL 3P9MB 4XCEB 2ENYA 5IP4A 3I6GB 1CFBA 1MFCL 4KUCD 1T1XA 5HI5C 3K4DA 1QVOA 2WWKT 1LQSR 4OZIE 4V2BA 3LKQA 4N1HB 3C08H 1K2DB 4DVBA 5LXGH 3QXWA 4OGAD 3DI3B 2QQNH 2UZIL 1N8ZB 2OSLB 2NTFB 4K3JL 3CLFL 1HXMA 1JGVL 2YD5A 2MKWA 5BMFH 2E7LA 1A3RH 1EHAA 3LOWA 4MD4B 3I75B 3MV8B 1MRFH 4GKZB 4IRJC 1XGTB 4PJDE 4M8QB 5MERB 5E9DB 3S36X 4BZYA 3MLYL 2A6IA 3P77B 3AB0C 3W82A 5FHBH 4MNGA 1MIEH 2YRZA 3AS3A 5A16B 4YXHL 4NZTL 4I77H 5IB4B 3BISA 4YDVB 2XWTB 2YRPA 43CAA 4YHYC 4TTGA 2YPKB 1IGIL 5F1IA 3MGTA 4CU6A 4Y19B 2X4PB 4Z77A 3QUKA 3MMEA 5L8JB 3H7LA 4ZMAT 1K5NA 3ILQC 1GGTA 3DMMA 3EW3B 3KYOA 2JJSC 4NN5C 1ETZA 3MRLB 4FQIH 1A7BA 1S7RA 5FIEA 5IW6A 4HMEA 1P7QD 4M7LL 5DD5H 3WO4C 4O2EA 2W9EH 3K1DA 3KXFB 4PS4H 4JRYA 4GG6B 4OKDA 4GW1A 5LWYL 3CVHB 4YFLF 4A2LA 2P5EA 1BIIA 5DJAB 5KZCB 3TO4C 1NKRA 3P30H 3IDGB 2Q8AL 4YHLH 4DEPB 3IFLH 3BJLA 5LJYH 1TTUA 1I9JH 5E9DD 1I7RB 2AK4B 4N0CD 4U1IB 1UEYA 3ZHKA 3LH2H 5DYOA 1ZANL 2DYPA 2E9IA 2FO4B 2P1YA 4JG1H 4G6KL 4UIMA 1OTUD 1MJJA 3SKNB 4LNVA 1X5YA 2EKSB 3RWJB 5E9DA 5FKAB 4A6YL 5I1KL 1XGTA 2GT9A 4TSCL 3VA2C 5JW5A 2FIKB 2CXGA 1JHTB 4FFYH 1HE7A 3QXAA 3LQAH 2BOBB 2VLRE 5KS9E 1TJGL 5FO9A 1HILB 3LS4H 5KVDL 3O6KH 4L3ED 3AXLB 3O6MH 2ITDA 4WO4D 5I16A 5I0ZA 1P7KA 2CDFB 4S1RL 4HFUL 4K94L 1IKNA 1SHMA 3BEWA 3DRTA 4YHIA 1YEKL 2DTSA 3DMMD 2ZUUA 3NAAL 1Y6MR 4GUPB 4BFGA 5I71B 2CD0A 3P4NA 4LOUC 3EIFA 4PGJA 1Q1JL 2JIXB 2OL3H 3RNQB 5JW4N 3RTQA 2CDEA 1INQB 3SOBL 2NY5L 3OB8A 1F4XH 5GHWH 4Q6IC 2NY6D 4NQEE 1CS6A 4U3HA 4XBEH 1EXUB 3ZYZA 1UB6B 1KELH 3P9WB 2AXGB 3OPZH 3VMOA 5INCB 3GIZL 2ZOKA 3RPIA 3GUTB 4XXCA 5DHVB 1J0KA 1G9MC 5AUMA 1VADB 4G8GA 1YNKH 3VRIB 2XG5A 2BNUA 4PJDA 5D8JH 3TO2B 2VQ1B 3WN5A 1ORQB 4PRAA 3UZVB 5F1OB 3MACH 4RNRA 2P49B 1FGNL 3MZGB 1ADQL 4ZFOL 1X5GA 5KSBE 4ELMA 4OF8A 2X1QA 4Y5YA 2DI8A 3UTPE 5TDOA 3CH1A 3JSSA 2B1HH 1QKZH 1LEKB 4U1GB 3RWDA 3QIWB 4PG2C 1N0XL 1GYAA 4KJPC 1MCQA 3NCFB 3FQRB 1U0QA 4XNXL 1X44A 3T65B 5IMKA 4OM0H 3QUZB 1IL1A 4AMKH 1V05A 4XCFL 3IT8D 5JR1L 4UU9A 3T0DA 3MLRH 3BPOC 4MNHA 1S9XA 4HS3B 3D69A 3MRNB 3VXRD 5BRZB 4FQLH 2X4NB 3QIUC 4XVUD 1M7XA 5IB5B 1ED3A 5HGGS 1CLYH 3QCVL 2HJKA 4O51A 1QQDA 2JTDA 1QFWI 4N0RA 1JPGA 1FL3A 3GB7A 2LQRA 2EDDA 4M5ZL 1DEEB 3VXSE 1KPUB 2AKRA 2WW8A 3UEZA 2ICES 1B0WA 2NY4D 4HUWB 1IAOB 3VA6A 4M4RA 2CDGB 1LP9A 4Z76A 4TUKH 7FABL 2I9LA 3MUHL 2Z92B 4JFED 4YZFF 3R8QA 3MRDB 2R0LL 1LDPH 1KJ2H 3AU1A 2OL3A 4NDMA 1XGRA 2YMXL 1SJEA 1IM9B 3HZKA 3ARBD 1WQVT 5E9DE 3U79A 2FECL 4HXBH 3G08A 1DFBH 4KAQH 3TGXA 5FUCE 4O4YH 3RGVB 4RNRB 3QUXA 4L3EE 3RWDB 4X6BA 4K3HA 4Y5YB 5SWZD 4Z6AT 5EC2B 4Q0XH 1QSED 1XZ0B 4XPHH 2BDNH 4LPXA 2YR3A 5E8PB 4X6CF 4I2XA 4CBPA 3ARZA 1FAIH 4NRYA 3ES6A 3OB0H 1A14L 4PJAF 2DMBA 3IFNL 4U6XA 3DXAD 3PHSA 1T83A 2BK8A 2VXQL 5GRWA 3IAPA 4U2YA 4HKBA 3CXHJ 4EI6B 2WIMA 4P2QB 3FB8B 5MHSE 4LU5H 1NLDL 1MLCA 2XN9A 3TBYA 1H3XA 1AIFB 4QHMB 5H37H 2VZ3A 1U93A 4JHBA 4QF1B 1VKXB 4HBQA 1GGCH 1A7PH 1FG2B 4W4NA 1QA9B 1RIVH 3IETB 1KIUA 3NH7L 2D0GA 3PWJA 4Z7VB 2NY0B 1B4JH 4GUPA 3L3GA 2X4RB 3DIFA 3LMJH 4OCNC 1JK8A 3GSXA 3OR6B 5IFHH 3NTCL 4QXGL 5DFVD 3BKCL 4AL8H 1JUFA 2AW2A 4M02A 4PG2A 8CGTA 3G04B 5T3ZH 2QR0B 3QNXA 5DVKA 4UNVA 4X6DE 1NJ9A 4GBXD 3K2UL 4RGOH 1PJ9A 4LLAA 1T89A 2DAVA 4MMXC 3TWCH 1JPFA 3DYMA 2R1XB 3OKKB 4DFIA 3O2DH 1MQKH 4JM2A 2X7LA 1TJGH 3J7HA 3TCXA 4QHUA 2R4SL 1JPTL 4Y16C 3AXLA 4XX1G 1IQWH 4D0BB 3MREB 5H8DA 1L9MA 1XZ0A 3H9ZA 4V2CB 5EZOH 1UGNA 3I3EA 3LKOA 1KTLA 1RK1A 3HZMB 3MV8D 2KBGA 5EIIA 5I8OH 4NNYA 1R3HB 3LB6D 1A6WH 3V0VB 3B43A 12E8H 4P4KD 4YQXL 3MLWH 3EOYG 3GSUA 1H5BA 3MXWL 5I73B 4H0HB 2VDPH 5D7LA 3ALPA 4NQD