5IBTH

Uca fab (unbound) from 6515 lineage
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
225
structure length
218
Chain Sequence
b'EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARVVADREGFGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UCA Heavy Chain
publication title Influenza immunization elicits antibodies specific for an egg-adapted vaccine strain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH01
4JCMA 4L1HA 3LY6A 5KSVA 2NY2B 5DT1H 5IR1B 2WUBH 1MVUA 4QRTA 4M4PA 4UIKH 4Y5YC 3RPIB 4UQ2B 1NLDL 2WQRA 3S35X 2ICWI 4UTAL 4A2LA 3AC0A 3TWCL 2IAMD 3KPNA 4EOWL 3P0GB 1F5WA 2J8UB 3NFNA 4K3EL 1HIMH 2A6DA 3O3AB 4JM2A 2P7TB 5L6YL 1IAIL 2NXZD 3LN5A 2B20A 2C3GA 4X8XA 1NFKA 1XEDA 2AVGA 4JY6A 4P2YA 1N59B 3IDIA 5CLTA 4L4JA 4WJ5A 4YEFA 1U8NB 2MNUA 3WKMH 3Q1SH 4OQTL 4P46C 3BVNA 2O93L 4UNVA 4JFOA 2XPGB 4ZAKD 2NW3B 2OR8A 1JGEA 4BH8B 4NM4L 2E8YA 1U6AL 5I75C 3TNMA 2D31B 1NGQL 3I02A 3NA9L 5A43C 3G5XA 1D6EA 3WJJA 2A77H 4U6YA 2BNRE 1A1MB 1U8PA 2DBLH 4L1DA 2UZXB 5BMFH 3GSNL 4JO2H 5ICXA 3RVTC 1AD0A 1X5AA 2OP4L 1ZEAL 1BD2A 5DJDA 4OF7A 4WO4B 3BUTA 3QIBC 4R3SB 4TRPH 1CFBA 1IC7L 1VENA 3AAZA 5F8RC 1KTKE 2BVQB 3TC9A 4WHYH 3MLYH 1MCJA 4LAJH 2B1HL 3KNBA 2ILLA 4UINL 1BJ1H 2BVEA 3ZDXE 5J9PB 5AYQA 1I9JH 3RUGA 4XNXL 4JO3L 3HFML 3D85A 1Z3GL 4PJ9D 4Q2ZB 3F7PC 5DVLA 1ODAA 1H0DB 2A6JA 2APXA 1AFVL 1Q94A 4XC3H 3BJ91 1K3IA 1OCWL 2WLYA 4KJWD 3TCLA 4OLXL 4QHNA 2DAVA 3NFPB 1I1AA 1YEHL 3QZWA 4ZUUB 3LS4L 4ZUVA 4W4OA 1N0XL 3VH8B 1X4ZA 4QRRB 5FGRA 1YN6A 5D1QA 2I9LB 1T21A 2PO6B 4GSDH 5FDYA 1VACB 4KAQH 5FA4B 3P9LA 4M6MH 2NY3D 1YUHA 1GGBL 2CIIB 3T3MF 4HFUL 3VGEA 3D39E 3OJVC 1BFTA 1XAUA 4PJGF 4F15B 4NCC1 4ZOAA 5D7LB 3TYFB 3ARBD 3AU1A 4I0PB 5GSRB 4KK5D 4HEME 3VA2C 4JZNA 3ZDZE 5GGSY 2EZ0C 4NBZB 4R4NC 3K4ZA 3EO1B 2ENSA 4ELKA 1NH6A 4UILH 4QOKD 3ZT7A 1MRCL 5EZJA 3FB5B 1CGSH 1ND0B 1GGIH 1NCBL 1PX3A 3ARXA 4JO1H 5DS8B 4L4VE 2EDTA 5CKGA 5T1DL 3DETC 4DN3H 4Y5YA 5HY9A 4NN7C 5HHXH 3BH8B 5SWZB 4ZS7L 4MMXC 3OPZL 4J8RA 3I3DA 4DCQB 3EJZD 5MEPB 4UV4L 4BH7B 1JIBA 4PRPE 5GRJL 4MWFA 4KMLB 1OVZA 2BSRA 1YECH 1BFSA 1NFDB 15C8L 3GRWH 1Y18B 2J88H 2MPAL 3G6AA 3RHWK 4X5LA 2IPUK 1EJOL 3C6LA 5H2BA 1PX4A 1PZ5A 2E7MA 4TSAH 1KCVL 2NY2D 3QJFB 3QDME 4OSUH 3RWJB 4Z8FL 2FGWH 4LSVH 1P9MA 1FVEB 5TDOA 1G1YA 5I8EA 3V79C 1LMKA 2ZSVB 5ANME 2A9NH 5IKCB 4LMQI 4Y5VC 1PY4A 32C2B 5GRZA 3C60C 3DUUB 2YPLB 2R0KL 4X9IA 1R3KA 1NDGA 4P57A 5LBSL 4PJXB 1OSPH 2NYYD 5TQ0H 2EO9A 3FONB 4TYUA 3QCTL 4L4TE 3DGCR 2YWYA 4FQPA 2GTZA 4YXKL 2VDLL 4HUWB 4IMKC 3C87A 1SBBA 2VXTL 2Y4SA 1L0QA 2H8PB 1HYRC 4UI2A 3BYYA 1RMFH 4U49A 5I8CB 5J6HA 5D7IA 3MJ9H 2XKSA 3BJLA 5EUOA 2O5XH 1GZQA 1RUPH 4ZPVB 3TH3T 1MHPH 5I1EH 5C0CA 1KACB 1VFBA 4YUEL 3JTSB 1AP2B 4YHLL 1A14L 4GAGH 1FL3A 1IEHA 1H9VA 4PBWD 1EPFA 1DBJL 2Q8AL 3T0VA 3KJ4C 3ZDYE 4N0YH 5BQ7B 4AEIL 2JB5H 4WO4D 3V4UH 4P4RA 5MP6L 3BN3B 4S10A 1EAPA 2W0KA 4OZGE 3SQOL 2NY5L 3ZDYF 3QXUA 4NJ9L 4GG6A 2QSQA 1N7MH 5L9DL 4OZGF 2PN5A 4O9HH 3MR9A 1SBSL 3D87B 2ADFL 2VISB 4OZFG 4NSKB 4PRHE 4KKNA 3WFDL 1GGTA 4HGKC 1G0DA 3FT4B 1DQML 5LXGL 4U1JB 4PG9B 1MFDL 3MPCA 4MD5A 3IJHB 3GK8H 5F88B 4M6NL 2DICA 4EDXA 4QRRD 4UT9L 1TQCC 5B38G 2PTVA 5C6TL 2BVUA 5BOPA 1T04A 5I1GL 4ERSH 3RGHA 2PO6D 5JPMB 3IVKB 2DJSA 3S5LG 2AV7B 4MQXC 1OW0C 4K7PH 3QO0B 1ZA3A 4LHQB 3S35L 3V5KB 1QRKA 4PJAA 5GS1C 1UACL 1CDHA 1CD1A 4XPAH 5D7LD 5BS0A 1N4XH 2FBOJ 4APQC 3P4OA 4I0PD 5C07A 4AENA 5H8DA 3PWNB 1U8OA 2BERA 5C0GB 2CR3A 2OI9B 3AXLB 2GYSA 1EUTA 4YHYC 1C12B 1CDYA 3UPRA 1ZT4B 2PW2B 5DJ0A 3UZQA 1YNTB 5DC4B 4GRWB 5DK2B 2F8XC 5GRWA 1XGTA 3D25B 3T0EC 2XRAH 1BBDH 3VFOA 3VWJB 3DO7B 2V2WB 2F5AH 4LKCA 3U46A 3VFRB 5SWZD 3BZFA 4UAOC 1JZ6A 4WI4A 1DP0A 1X4YA 2GSIA 2A74A 2IAMC 4KQ3L 3MV8A 2FIKB 1UWXK 3JBG7 2NXZC 4NGHL 1T1YB 3V52L 1F4XL 2HTKD 2VZUA 3O9WC 4FQ2H 4DTGH 4DQOH 3FOLB 4Z7VF 3LN4A 4LIQE 4OFKA 5E2VH 5LKNA 3CPLB 3H7BA 1Z9MA 4U1NB 4ZAKC 1CU4H 2ATKB 4O4YH 3HI5L 4D9RE 3RWHA 1RZIA 2IPTL 1FC2D 4MD0A 3GMNB 1NUGA 2JJSC 3VI3E 5F21B 1INEH 3GSOB 4KROB 2AV1B 2XQBL 4IHOB 2R2EB 2YPLD 4NPYB 2ZCHL 5DHVB 2PXYB 3TIDB 1KCRL 5E0QA 5L88L 1RSFA 2FLRT 1X5IA 2X4NA 4PJDB 3SY0B 1H3PL 2EDXA 1V7ML 1VERA 3ME0A 1P5UA 2NTSP 1IGMH 1OY3B 3SKOA 3D18B 5F1OB 2DD8H 3BZ4A 1BECA 3WN5B 1F58L 1HQRA 3CK0H 2X6MA 1OAQH 2HFFB 3MJ8A 1IGCL 2AJSL 2FB4L 4LSTH 4PJ9C 5DQDL 5IVNA 3JWDL 4JRXE 5IT2L 1U9KA 3B8YA 1KIQB 1NC4B 2VZOA 1D5XA 3S9DB 4XT1C 5E1AB 3VDAA 1G7JB 3QG7H 1H3WM 1OQXA 4OFDA 1JPGA 3ES6A 3EDFA 4KJWC 3CJJA 1M7DB 2YK1H 4XAWH 4JFEA 2KKQA 3AREA 3ULUE 4XBEL 2NLJB 5ITFA 1GZPA 7FABH 5IHLB 2E7LC 1RHHB 3FFDB 3UJIL 3MLVL 1L9MA 4EUPH 5EO9A 4HGMA 5TFSL 3DNKA 5EC1B 1AY1H 4BYHA 4POZD 3G6JA 1U91A 4N8CL 3HTLX 3D48R 1ORQA 1DBAH 5CBAB 1Z5LA 5CSBA 3N06B 4KUZL 4F37F 4X7EC 4OI9A 1MH5B 3ARBC 3SKNA 2DQGH 5HGAA 1TVBA 3F7YB 4KK5C 4MNQB 1B4RA 4LEXH 5EU4A 4HQQL 4BFIB 4ZFFB 3LV3A 2CRMA 3FO9A 4NQCB 2Y36H 2X4OA 5D72H 3T0EA 1T6WA 5DC0A 5FYJU 5ENWA 1BM3L 1A7OL 1VADA 1WBZA 4QRPB 3PGCB 4WHCA 4NOFA 1F6AB 3QEHA 1OP5H 2VAAA 2VZVA 2IAMA 2XA8L 2XZAL 4NKIL 1AHWC 2YD1A 4DZBA 2X4RA 3ZSTA 3P4LA 1GGBH 4UV7H 1DANT 4HPYH 4BFBD 2R29L 5BJTB 3H8NA 4LLVB 3EJZC 3KPSB 3O9WA 3RVXD 3E6FA 3OKMA 5FUOL 3CSPA 1UM4H 1G7IA 1NGZB 1ZSDA 5FF6B 1WZKA 2YXFA 1DQQA 1S5HB 2G9HA 4WV1B 2HLAA 3DVFA 4PIRF 3ARRA 5J0BA 1BJ8A 4ODUA 4OBRA 1ZT1A 3VWJD 2NY2C 4RGOH 2J8UF 4ENEC 1I1FA 5K9JH 3NZHH 3FQWA 1KC5L 1U8HA 4K8RL 1GVIA 5HGBB 4HIJB 1S7UA 1YMMA 5IB3B 2DN7A 3NVQA 1HINH 4WUKH 4ZUWA 2ZUYA 1F3JA 3K8LA 2IH3B 2Z93A 4U1SA 5SV3A 2KQMA 1RIVL 4RMWA 4DOHB 2VXUH 4D0DB 2VXSH 4W68A 3TGXA 1ORSB 2EIZB 1P7HL 1KXVC 3BGMB 4N0FA 4XBGB 1T4KB 4PG2C 1UC6A 3MRJA 4E5XA 2K7PA 3VXSA 4Z7OE 3VWKA 2OTWA 5DD1H 1BZ9B 4NRXB 1KCLA 4C56E 1NKRA 5IHUH 1H5BA 4NDMB 1ZMYA 1XR8B 4HWBH 5L0QB 4TSBL 5FYLH 4F7PA 1F45A 1G0XA 1JRHH 3MOAH 5D2NB 3NN8B 3PABA 2R56H 4NM8L 4Z8FH 5AAWA 4M93B 4KROD 1PYWB 3O3BB 3F65A 1KJ2A 1U93A 4FQCH 4ZFOL 3B2VL 1CL7I 1KELH 2PXYD 3W2DL 3RGVB 1T1WA 5DD3L 4P3WA 3ULSB 2D7TH 5LGJB 2GJZA 3P9MB 1XH3A 3BI9X 2GHWB 3FT3B 3S36X 1CE6A 2E7LA 5DJXA 1CBVH 1C7TA 2EH8L 4PBVC 4KH2A 4EDWH 1BZ7B 3ZKND 1T0NB 2EO1A 3BE1H 5EULV 1JWMB 3MCLL 5EO0A 1HE7A 3L3IB 2VQTA 4I8DA 5EC2B 4YFLI 3L5XH 4ODHH 1TQBB 2LVEA 4U1LA 3IJYB 1CDUA 2XY2A 2XZQH 1NC4D 3WNMA 4ZPTB 2VDML 2CK2A 3MXVL 1P7QB 2EIDA 2NPLX 3VH8G 4JAMA 1FO0A 3SBWC 2EXWD 4DVRH 2NNAA 3QHFH 4OCSL 4U6TA 5H37G 2APTA 3SDDB 3VFWA 2PO6C 4M3JA 3FQNB 4QWWD 4MDJA 3MYZA 3OX8B 1L7IL 5KZCB 1D3CA 4MAYB 4X6FA 5GGTH 2VO5A 4NJ9H 2CLVA 3TVMA 1CI5A 3MOBH 3MYJB 4LCCA 1MRFL 1EO5A 5TF0A 4PJ5E 5F44A 6FABH 5JIPA 4I0PC 5I1DA 2X7LA 4PYGA 4MNQD 4DN4L 1DEEA 2X4UA 1HXMB 5FYKD 4F8QA 1S9VB 1FAIH 1IC5L 4NQCD 2UY7A 1MCOL 2QQLL 3HE7A 2OJZL 2R0WL 3F5WB 3DPBA 1U8JA 3SJVA 4EI6A 3FO1A 1WT5C 2A83A 1UJ3B 4X4ME 1LO2H 3X11A 4QRPD 4X5XB 3GUTB 1EAJA 1KJMB 2CJUH 1MCFA 5TJWK 1OLZA 1E0OB 3N1MC 1EMTH 4OZIB 4UU9B 4BZ2H 5IIEA 1SEBA 1UB6B 1NFDF 2EE2A 4OV5B 4HXBH 2FX9L 3OBAA 1YEFH 3TBSA 3KPSD 3OKKB 3TIEB 2YD6A 4LSRH 4ZNCD 3R8BB 1W72A 4MAUL 2FO4B 2HTKC 4FOMA 4XPTH 5E8NB 4LLUA 3L5HA 4TUOB 5INCA 3IFPA 4JANB 2J4WH 2BFVL 1RJZB 1K8IB 5K9QI 2XQYK 2YKLH 4Z7QE 3BDYH 2DI7A 2WP3T 5HJ3A 3KR3H 2F74A 2N7BA 2FO1A 2WV3A 2X4TA 1ZVHA 4F8TA 4PJXF 1GGYA 5FB8B 1J87A 1R3LB 2Y25A 4G7YL 4JG1L 4M8QA 1HWGB 2BXYA 3RRQA 3MRRB 2RGSA 4G9FE 1A5FH 1LNUB 3RVUD 3BEWA 4NZRH 3U9PH 2GQHA 1QFHA 3QPQD 4LQFL 3VGAB 5E2JA 4NIKB 1CTOA 2KDGA 2WUCL 25C8H 4YDVA 4I5BB 2BMKB 4HG4J 2H26A 3VG9B 2IH1B 1MF2L 2HJKB 3OG6B 4CDHA 4LEOB 2IFFL 1UWGH 1GGUA 2G60H 3A6BH 2PKDA 3T09A 1TTFA 4G8FA 5ALBH 3LS5H 5KS9B 4JHAH 3VFGH 4CL7A 2DB8A 4TVPD 1QLRB 1RZGA 3RGVD 1S3KL 1EHNA 3BZEA 3SBWA 4GJTB 1AQKH 1QBLL 9CGTA 2ZCHH 3NAAH 4QRRA 3CSYA 5T3XD 3CZFB 4XAKD 4KK9C 2QR0B 4QNPE 3KJ6H 4KMTH 4KTDL 1H3PH 4ZSOE 5F7HA 1V7MH 3HZMB 1HHHA 1NJ9A 5IVZA 3E8UH 4HS8L 4LASH 2YC1B 3PQYA 2XFXA 2V2XA 3RHWF 3REWA 1HKLH 2DL2A 2VKXA 3DBXB 1KN4L 1V3LA 4X99A 4POZC 4MNHB 5D6CA 3VCLB 4TOYL 3QCUL 4HKJA 3CCHA 3VU2A 2BHYA 2IPUG 1KNOA 3DXAB 2V7NB 3U0PB 4ONFL 3JWDH 2OJEB 4ORGA 4F7TA 3DRTA 4JRYE 1ZT7A 1P7QD 3BOVA 3VXQA 2HRLA 1B88A 3VDCA 1G7HB 4NC0B 2GY7B 2B4CC 4JVWA 1HHJA 3WFZA 1QR4A 2PTTB 2XZCL 3SDDD 4LF3B 4HKZB 4KK8D 1PLGL 3MRKB 5A2KH 5EFIB 2VABB 5KZCD 5GS0C 5DQ9A 2I60L 4YPJA 2GSGB 4MAYD 1AKJB 4JM4L 4GUPB 2ERJC 4MGXA 5IEHB 1S9YB 3ARGC 4LLQA 5HHPB 1IL1A 2XWBA 3L3HB 3CVIL 1IGIL 3WYRA 3U6RB 4X6DB 3RVXC 4F7MB 1LHZA 4U3CA 1MCWM 5JHLH 4PJHB 1ZS8A 5ESQB 3PGFL 2COQA 2I25N 3OKEB 3RDTA 1E27A 4L8CA 1E4KC 2XNAA 2AP2A 3QJFA 5CJBA 4W4NA 3TP4A 3D3VB 2YUVA 1G1CA 4DUVA 4OLUL 4ZTOL 3C6SA 3VWJC 2N1KA 5SWSE 3QEGH 4KZEL 5FCUH 4AT6B 1DLHB 1D5ZB 4FQ1L 3E2HC 4GKSA 2DM2A 4JFQB 3EOTL 2VLRB 3FO2A 1DQTA 4GKZB 1L7TL 5GRUL 3LVEA 4NKIH 3RWEB 4MD4A 3S36L 3INUH 3RVWD 1JGUL 1HHKA 4R90L 5ISZB 5EU5A 5J12B 1FVDA 4N5UA 2D0HA 2D0GA 2P42B 5C0AE 1KLUA 3P73B 4HWUA 1LP9F 3QUYC 4YHZH 1C5BL 4YBHA 4CNIA 2H8PA 1EO7A 4P23A 5B4MD 4IRJB 5C08B 1KJ3H 4NO2B 4CUCA 3TBWB 3HI6L 3TV3H 2OBGA 2CD0A 1CXKA 5IBLC 5J89A 3HUJB 4GMTH 4PB9H 1HOCB 2P5EE 4X7TB 1A47A 4PJDF 4S1RL 1FJ1A 3DURB 3U7WL 2FX7H 4XP4L 1GOGA 1KENL 4JPIB 2EDQA 2CRZA 3CFJA 2OS7A 1FCCA 4U1KA 2LQRA 5IESL 1P4IH 2R23B 4F2MA 4OFYD 3W11D 3WIFB 4OTXL 3GJFA 5FUCC 2IMNA 4PJEE 2BRRL 3N0PB 2FL5A 1Y0LB 5EB9A 1UA6L 1J0KA 5DI8A 3DIFB 1P7KA 4KKCD 5DJAA 5TDPB 1R5VB 3ZTJH 3LPWA 4NRYB 4U1JA 3W9DA 2FSEA 2PR4H 1N26A 4XCEB 2BNQE 1IGTB 2EDLA 3CDYA 3ILQD 4P5MB 1ZTXH 4PY8I 1QFWL 1NAMH 4LRNL 4QGYA 4ZQKB 3S88H 2OTUA 4HUMB 2EXWC 2VXVH 4U33A 1GH7A 1EA9C 5JW3L 1CIUA 1V3KA 4XP5H 4QWWC 2F19L 2VLKB 4J1UA 1GYAA 3KHQA 2X1XR 4NNPL 3ARGA 4OCXL 5HI4D 3QNZA 2FECI 3MLWH 4RMRA 3DXAD 3KPTA 3GSXB 5E6IC 1R5IB 3V6FA 3WFHA 4GKOA 4HMDA 3CU1A 4EIZC 4FA8A 1X5XA 3LMJH 4CDGC 2A1WH 4OF5A 3UDWA 1NMBH 1CDGA 4HS3A 1OAXH 2MQ0A 4XMKL 5AYUH 1SJXA 4HIXH 4Y4KA 1HN1A 1IVLA 1HCVA 5EBGA 3M17A 12E8L 2GAZB 2UZIL 5TE6L 3OQ3B 3ZE2E 3WO4B 4EBQL 3N1PC 1AKJD 1P84K 4U6HB 3C2SA 3D0LA 4LBEA 2YA1A 4YC2B 2UWEB 1TVHA 3IXAA 3TT3H 3T2PA 2BY0A 2Z91A 1BD2E 4IRZH 1FVCB 1T1YA 1FE8H 2AXGA 3C08L 3LRHA 5BRZB 1A6VH 3QUYA 4W6WB 5GISL 43CAA 4P9ML 5A16A 2HVJA 2P24A 3MROA 4YX2L 3RUGE 4FG6D 4WV1C 5DMIH 1FGVL 3D3VD 5I8KH 3SKUD 4GLRH 1CVSC 1DQLH 3GMNA 1NUFA 1T2QL 4CKVX 1KT2A 1TTGA 4GAYA 3RUGF 3SOBL 1RFDH 2F54A 2VLRD 2AQ2A 1JF5A 5I71C 4F3FA 5DHVA 5C1MB 3DECA 3VD5A 4RQQA 1RUQH 3O6MH 3PNWB 5CWSB 3DVNA 3RVUC 4C83B 5ISZD 3IDXH 4PUBL 2Q86B 4Y19B 1EJ6A 1WEJL 4JFZL 2K1MA 4IRJD 5C08D 3LHPH 2V7HB 3O45A 2DQUL 1FDLL 4UQ3A 3LKPA 5GGSB 1QSFA 2FGZA 5EZOH 2ZUWA 5CJXA 4NP4H 1DSFH 4RWHA 5L0QC 5HVHB 3QT2A 2GKIA 2DQCH 2VQ1A 5D2NC 3LKSB 3MV01 1NEZB 4M93C 3JTTB 3WXWL 3B43A 1IAKA 4OLZH 4BKLA 3TCXA 1T1ZA 3GIVB 5HDOA 3EW3B 3RGVC 4YHOL 4G6JH 3DLQR 3Q0HA 4LCIH 1J05B 1IM9B 1RHHA 4JFPB 4JFXB 1WV7T 4HKBB 4ELMA 2V9TA 1B4JL 1S7XA 3F6IA 1KIPA 2ZJSL 5DK3A 4ODTL 4KY1L 1MRDH 2Q7YA 2XG5A 4P59H 5E6IA 1IE5A 1S7QA 4BSWA 1TQBC 1WIUA 5DJ2B 1FFRA 1SYSA 3FQTA 1IQDA 1EX0A 2IWGA 3SN6N 1CLOL 5IVXB 5IOPB 5D2LB 1XCQB 4LK4A 1DBKL 5KVGL 3LAFA 1UH3A 5E8PB 3ECBB 1KN2L 1IRAY 1FZOA 5HPMA 4HG4K 3GO1L 1F6AA 3DTXB 4PTUB 1LDSA 2BHUA 1AGDB 1B6DA 1TJGH 2VLKD 5IBTL 3VXUA 4HS8H 2I07B 5ITBH 5I66B 4MAYC 3FB6A 1G6RB 5EBLA 5FGCB 5BJTA 1T89C 5FGSA 5IB5A 2A0LD 4HZAA 5GRXG 1ZA6A 4JFHD 3BP5B 5I76B 3BP7A 4N90D 2DQTL 4MA1B 1OL0A 1DR9A 5BVPL 4QXTB 5JLZA 4YBLC 5C8JB 4XCNA 3OB8A 4JPVH 1HDMB 3SQBA 4K2UH 5D7IE 4HMEA 4LPWA 5F96H 5EUOE 4HUVA 1V7NH 1E4XL 5B8CA 2RR3A 4M43H 4OZIF 4XPBH 1UJ3C 5C0CE 4DGYL 4LCWB 5E9DE 3BUYB 1R3HA 5HGBA 1CF8L 1T6VN 4EI5A 1WWWX 4UTBH 4YAQA 1Q9KA 4KZDL 1PLGH 2QQKL 2VIRB 4NWUH 4Y16C 3HMXA 1R3IH 4AH2A 4Z0BH 4P2RA 4Y1AB 1QBML 2PCPA 4QHMB 1A7PH 4C59B 2I9TB 3U7AA 5IW1A 3WSQH 2HMIC 2GJ6B 4JKPL 4ZD3L 5BRZD 3VG0L 1T4KA 4JDZB 1KB5H 1A9BA 1CFNA 3EBAA 4LNRB 2HFTA 4KQ4L 1G7LB 5C3LD 5DUPH 4GG6E 4FNLL 3BAEL 4UT7L 2AJYL 5DYOA 5TPWL 2WWMD 1QO3A 1PSKL 3F58L 1Q0XH 5B4MC 4OF8A 4XWOD 2OLDA 5K9KA 1I7RB 4L9DA 5D2NA 3K2MC 4IDLA 3O3BA 2UUDH 4NOBA 2R1WA 4OLWH 5FV1L 3FQUA 2APBA 4PS4H 1SVZA 3EZJB 1SHMA 3I6LE 4XCCL 3A6CL 1C1EH 3WFEH 3JWOC 5LGJA 1XCTB 4PD4K 4J4PD 4HH9A 3QHTC 2DDQH 5ID0B 5ERWB 3VE0B 4OCMC 4PP2A 2UY6A 3VGAC 3OHXB 3QIUA 2YD5A 4Y19D 4JFDA 4D0CB 5I15L 4PJAE 3W11C 1JWMA 1MLBA 3Q6FB 2ICWJ 1QSEA 3BXNA 4P2QE 5BS0E 5KS9F 3U4EA 5EC2A 4PJFB 4U1MB 1AGCB 1K8DA 1JRHI 4FQHA 4U7MA 5C07E 2DKSA 1VHPA 4KKCC 3KYAA 1XR9B 1YPZA 4OZFH 3SGKA 1XGUA 3CFCH 1UM5L 3B2UD 2CIKA 3DOSA 4U6XA 3FCTB 3PHOB 3GJEB 1JI2A 5HGDB 4G8GA 3ILQC 4BM7A 3GB7A 3ETBF 4M9PA 2C4FU 1SEQL 3TBYA 1IM9D 5DC9B 3MLPA 1OAUH 2PW1B 5ESAB 4BZ1L 4I48B 4OM0L 4QRQB 4P9HH 5L2KA 3UX9B 4KJYB 3EO9H 5DRWA 1NC2B 5D1ZB 4YXLL 1F4HA 3TA3C 2ICWA 4M03A 3MV8E 2Z0BA 3RAJH 4JQXC 4P4KC 1JGLL 1OAYH 4G6KH 4YHNA 5C92A 5HI4C 3BESR 1HQ4A 4R7DB 5IVOA 1NGWA 3QQ4A 2FR4B 4RX4A 2MOVA 3WJLC 1JPTH 1BEYH 3KLDA 1PKOA 5DR5L 4YK4B 1ETZA 3NIFE 2V9RA 1CXEA 1YNKH 4OF0A 3L3OA 4YBQD 1DBBL 3RTQB 5EIQA 3EYVA 1ACYL 3BRDA 4JQIH 3SE3C 5I1CH 5F8QC 2AXHA 4K94H 1FH5H 2Q3AA 2VC2H 4EXPX 4R0LB 3I75B 2E6QA 3GUTA 1A64A 2MCG1 4Y16A 1H15A 2AKRB 4A6YA 3QULB 4DKFL 3W0WB 3ZYOA 4UOJA 1YYMH 1SJHB 4L8DB 5IHZB 1CQKA 2GFBB 3DUHA 2X1OA 4PJHF 4OBSA 5HHVH 4LRIA 3EYUL 4Z76B 4QT5B 4PGCA 3GMPA 1J0YA 4GW4A 3RU8L 1BFVH 5KVFH 5T1LA 4TNVK 2WLZA 4EZMA 3VXMB 4WTZG 1S7TA 2PUQT 1NDMB 1UB5B 2HT4C 1OPGL 4FG6C 1YNLL 1BQSA 2J1KA 4LCWD 3TN0A 1OP9A 1ZHBB 2UZIH 4N8VA 3WE6A 1ZLVK 5TDNB 4Y1AD 2HKFH 1WBYB 1MI5B 5IROC 2VMFA 2ZOLA 2GJ6D 3EAKA 3BHBA 3UTPE 1IFHH 2VDRL 3CX5J 5CFHA 5J12C 3C08H 4XH2A 4ODSH 1DE4B 4NUGL 3UTSB 1MHHB 2P48B 1HHIB 2OK0H 2AJUL 3PIQA 3IGAB 1BIHA 2R4SL 3G6JE 4XVJH 3OKOA 5JXAL 2CLRB 5JTWA 2Y1VA 3K8MA 1NBZA 2DQIL 1AC6A 4QTIL 1U8LA 2P8MB 1JZ2A 1C5DB 3GNML 2X1QA 1OQOA 1DN0B 1XF2A 2AJ3B 4GRMA 2OCFD 3K46A 3DHJA 4LSSH 1OGTA 4NZUH 4Z7UF 3T0EE 1C16B 3LEXB 5ACLA 2B4CL 5F3HA 1A1OB 1MIEL 5JOFB 5FKAA 3K3QA 2O5ZL 5J1SC 1DTUA 3EJYC 3UO1H 4TQEH 3MRFA 1FFNA 4QTHA 1FBIL 3MRCA 2R69L 4O2CA 2ZG3A 3GBNL 5GS0L 1LO0H 1FLRL 3U83A 3TA3A 4MVBC 4MXWH 2RCSL 4JQXA 4P4KA 3N85L 1FDLH 2FJHB 1F3DJ 1QP1A 3U0PA 3VI4E 4DVBA 4LSPH 1YEIL 4X4XA 2JJVA 1VGEH 3UZVB 1AO7A 3B83A 1B2WH 3W9EA 3T4YA 5DZNA 3VI4F 3LQAC 3BIKA 5DO2C 5JR1H 4UB0H 3B9KB 1XGYL 3WL9B 2YD7A 3MRKA 3NCEB 4X6BB 5BZDB 3FOMA 1YMME 1NC2D 2VUYA 3PWPB 5D1ZD 5DMKA 3RY6C 2ID5A 3B6SB 5I1HL 3RBGA 1I9IH 3KPPA 1LO3H 1LDPL 4OLYL 4WVRA 4RAVA 2I24N 1CFQA 2V2TA 1S9YA 3VA6A 4JLRB 2A0LC 4NHCH 4X7CC 1AJ7L 1JV5A 4YDIH 4DZ8B 4M9OA 2RFXA 3OSKA 5CZVH 3HHRB 1SJEA 2NY1B 4PJBB 4Q9RL 2UZYB 4KUCD 3RTQD 3KPMB 1EFQA 3KXFB 3H0TA 4QYOA 3N9GH 1MJUL 2Q76B 4R6UA 5FFLA 2P5WB 5I2IB 1G84A 5IJVA 5J4MA 4GBXA 5C0DA 2BJMH 2UWEF 4RWYH 4XCFH 4CADB 4EN3C 4Y5XA 3MRDA 4E0RB 3QFDB 1D5ZA 1F90L 1I1CA 3HC3L 3UBXI 4IOIA 3WO4C 4JFQA 3W0WD 2VLRA 1AIFA 1WJ3A 5IROA 4GKZA 4YC2C 4QRSA 1QKZH 1KG0A 3CDGB 5C7XH 4YDKH 5LWYL 1JJUA 4CVWA 5FAAA 2VXQH 1GIGL 2DF3A 5D7JB 5DMJB 4C57C 4M7KH 2VDOL 3BDXA 3VXPA 5ADPL 5B39B 5IB2B 4FZEH 1K85A 3I84A 1RU9L 3LH2H 1RY7B 5DEZA 3C8HA 5IJKC 3EYOA 2QKIA 4AIOA 3LKOA 2DYPA 3DUSA 2NQCA 1A6ZA 3VXMD 3EDJA 3HCVA 1J8HA 1I9RH 3TBWA 2HH0H 4JGJA 3SGEH 3BEVB 3V0VA 5C9JA 2FLBT 2WWMC 1KLGB 1MFBH 2PF6A 3QI9A 4XWOC 3HUJA 4U1GC 2ITCA 1JHTA 4DAGH 2QHRH 1QFUH 3EO0A 1J5OH 1RZ8A 1AD9A 2APVA 1MI5D 5DA4A 4TUKH 3GHBL 5AZEL 3CFEB 5HYSB 1KPUA 2WZPD 1RIHH 2NW2B 4J4PC 2R23A 4MYWB 3MRGA 5T5FH 1EZVY 3UTSD 4OUUB 1MY5A 5ICZB 4GXVH 3WLWD 3BP4B 5IFAL 3TYGH 1R5VA 5I1KH 3IXTA 4KTEH 3KVQA 1W2KT 2W9DL 4JFFA 4UMGA 5HVHC 1NEZG 3EYQD 5HVGB 1U58A 2NX5A 4ZDHB 1CK0L 1E4JA 1UZ6E 5HHQA 5I73B 4Z7NF 1ZKAA 3SJVE 1KFAL 4HKXA 2H32A 1K2DA 1I8KA 4WI2A 3H3KA 3HI1B 4NFDA 2E9WA 5H37H 3S4SA 3UYPA 4OAWA 2CKNA 1ADQH 3MLTB 3ZL4L 4P49A 1MCLA 4JJ5B 2V5TA 3RWCB 2WBJB 4NQEB 1W0WA 3NCMA 1TZIB 1HNGA 5D2LF 4NUJB 5EOCH 4HWEL 3VXNB 1VKXA 1JZ3A 4FQJL 1G9NC 4YDLC 2W9LA 5FUZL 5KG9A 3T2OA 3CFKB 1J10A 4OUOA 1HZHH 4J3OC 3REVA 4PGEA 4H0HB 1OAKH 2XTJB 3HMWH 4YBQC 3B9KD 4EN3A 5C9KA 3PWPD 3OMZA 3F7VB 5F9AC 5E2WH 1JWUB 1HSBB 4D9QE 4N1CA 4NO3B 1LE5B 4HDIB 5A2FA 3SHSA 4NZDA 1PQZA 1RAMA 3B9AA 1MFCH 4WFFD 5I9QB 5DJ8B 4AM0A 2CLZA 4H0IA 5GGRB 5IJKA 5LQBL 4PRNA 4JB9L 2NY1D 4IOSD 3GI8H 5ACMA 3HE6B 4U4BA 3RX8A 3KXFD 4FTVB 1D5IL 4I77H 3AVEA 2P5WD 4J3XA 35C8L 4JCLA 1T3FB 3QUMA 3KYOA 2DQHH 3VXRA 5HHOA 3BKML 1QRNA 1YQ2A 4FQIH 1EHLL 3O4OB 5I1AB 1DBMH 1MHCA 3MXWL 4F58H 1BGXH 1TETH 2C1PA 3CLEL 5CEZD 1MCDA 4C4KO 5L7XH 2VSDA 4R8WL 4DFHA 1BREA 3PNWA 3G04B 5D7JD 4C83A 3BYTA 4QRRE 4MA8H 1AXSA 1JP5A 4YZFF 2Y07L 5T3XL 3M1BB 1WUNT 1ITBB 5GIRB 3P3YA 4OGXL 4PTTA 3EUUA 1V8HA 5C0BA 3PQYE 1KCUL 1CN4A 2CDGB 3FO0H 1I8IB 3U1SL 3CXDL 1RVFL 1VDGA 5GGSA 4GLRI 1XF5A 1F97A 3EYSL 5ELIA 2HVKA 3DYMA 3QHZH 5FM5O 4I0KA 1OGAB 5TE4L 3Q3GB 4K3JL 4WHTB 1NCCL 4LLWB 1KIRA 4DJMA 3Q6GH 3MLXH 1QA9A 4R4FL 2NCMA 1A9EB 4YHKL 4IMLB 1TNMA 1YY8A 1IM9A 1BIIA 1R0AL 3WFBL 3IDUA 4HKBA 4QLRA 4PJFF 4LSQL 5TQ2H 3G6DL 2XWJA 3MREA 4WCYH 2MFNA 4EUPB 5GRYA 3H42L 3DV6B 3VXTA 2BHZA 1I3RA 4FRWA 2OL3B 4MXVF 5HVWA 2EDDA 1JK8B 1FAKT 1ZGLM 2G2RA 2CXKA 5EO1A 4M7ZB 1QNZL 3KYMA 1B3JA 1PG7X 2R9HD 3O4LB 3EGSA 2JIXA 2PYFB 3SDXB 1A3RL 4Y2OA 4N9GA 3WFCH 1MWAA 1BFOB 3RWFA 1N5YH 5EWIL 3IAPA 4K9EH 5DVKA 4ZUSB 4ZFZB 1NEUA 1G7PA 1T0MA 4ZOCA 4LSDA 3ROLB 3HR5B 5FA3A 1NCTA 3GIZL 3O8XC 4I3SL 4XGZA 3WHXB 3T65B 4P5TB 2OMNA 3GBNH 1RD6A 4A6YL 1FFQA 1MREL 5D1ZC 3LDBB 2WBJD 2R0ZH 3MGTB 1CFTA 3DYPA 4GRLB 4NQED 5IHBA 4Q9QL 4KV5E 5KSUB 2QEJA 5GJTL 3BP5A 2CKBA 4KUCF 2M1KA 3IDMA 4JQVC 4S1DD 1IEAA 2B5IB 1JF1B 4PREA 3EOBA 2Q6WA 5KVEL 4OM1H 2DMKA 1R5WB 2XTJD 3P4NA 4UBDD 2DKMA 2JE8A 4I9WD 4XI5C 4ZYKB 3RTQC 4PGDA 3VXOA 3IAGC 1U95A 5K9QG 3DI2B 4U7KA 3CH1A 3L3JB 1O7VA 3MNWA 3WXVL 1W0VB 2X5PA 4WDIA 3GHEL 1M71A 4M7JL 5D7KD 1NGYB 3T1FB 1TJIH 1AE6H 1Q9OA 3JWOL 4JZOB 5IWLC 4F57H 3EDEA 2I9TA 1U8MB 4HMCA 3IFLL 4PBXA 3H3PL 5DMYA 5EIVA 1A7RL 1A4KB 5DQJB 4QF1A 5JDJA 3HE6D 1NCDL 3GM8A 1G7LA 4FTVD 2R8SL 3MNVB 5IM7A 1FN4B 3SGJC 2AEPH 5JDSA 4NT6B 4C54A 3V9FA 5D93B 1QD0A 2BOCB 3BKJH 4HWZB 4OZ4B 1T5WB 2HFGL 1I1YB 1N8ZA 3OGCB 2AXJA 1UQSB 2VLJA 2YHGA 4KTYA 3QJHB 1FYTB 3QUZB 4KDWA 2MWCA 4NC2B 4XRCB 3X13A 2FNBA 5ID0A 3VFVB 4L3EA 1WAAA 3I9GH 4L3CA 3TBVB 5IUSA 5DLMH 4JZJB 3TNNB 4WHYG 5JHDA 5JOPD 1IGFH 5GSVA 4QHUA 1J86A 3TBTB 4FFYL 3MBXL 3WLWC 1HYSD 5ETUB 3ZZ1A 4ALAL 1OGAD 3KYNB 3GDBA 2ESVB 1ZLUH 2FATH 5H35A 4G7VL 2AGJH 1ED3A 2UYLB 2X9WA 1NLBH 4HZLB 1IAIM 5HPOA 4I2XA 3NCCB 4GRWE 1DCLA 1Q72H 3GM0A 2XN9A 5FEBA 4NNYA 2IANA 4V1DA 1HHGB 1N5AB 4ETQA 1KPRA 2DLIA 2YRPA 5CD5D 3O8XA 2GUOB 4NWTL 4YE4H 3JV4B 4IS6B 4LCUB 5HDQL 4ZO7A 3UYRL 4YXHH 5F9JA 1UWXH 3OJMB 1TNNA 3LB6D 3BKYH 1FNSH 1GAFL 3MRMA 1VESA 3OJDA 1T7ZA 1WLHA 4R7DA 3WEXB 4NZTL 5BOZG 4G43A 2HRPL 3O4LD 2EECA 2FCBA 4AK1A 4M7LH 3FN0L 2H3NA 1KEGL 3QXAA 2Q3ZA 3LCYA 4YIQB 5FYKH 3RTQA 1Q9WA 1CK0H 4GQ9H 2ZKHH 4WW1A 1N6QL 3WD5L 4DK6A 1RULH 3ARDB 5GHWH 3IRZA 5A40E 3FTGB 2A6IB 4P5TD 2VITA 1HILA 2CQVA 1T7YA 2F54E 5BW7C 2W0PA 4X80L 1T80A 5IV2A 4GRLD 3O2DA 5E94A 2DQDH 5C0JB 1KLFA 4XNUL 3IRPX 4B53A 4HCRA 1M6OA 4PJBF 2VN7A 1JMXA 1UZ8A 4X4ZA 3VFTA 5CJ8A 5FUCE 3O3DB 4FFVD 4OD2B 4JREB 2NY1C 1NFIB 4EVNA 5EUKB 4U3XA 1QSFE 2Z92B 1MNUH 2ICEB 1QVOA 4ISVB 4IEFB 4GOSA 4TTGA 4F9PC 3TO4B 3K1DA 4WEBH 2GIYA 4HC1H 3QWOB 4XVTH 5HD8D 3NIGF 3K4DA 1KJVA 1Q9LA 1JPST 3MLSH 5EU3B 1WBYA 3L6FA 3KPQA 1NBVL 2DTSA 1S78C 5F89A 3IAQA 1WZ1H 3GSUA 4M5ZL 5D1XB 1JNLL 1KGCD 5D7JC 3V6ZA 3QWRA 1YQVH 5B39G 1NGXB 2WNGA 4NFBA 5IF0A 4ELME 5T3ZD 1FZKA 2CO6B 3PF2A 3MRLA 4M7LT 2EIBA 3FB7A 2GT9B 3FRPG 1EVTC 3GMLA 2ADGA 2V5RA 35C8H 5FYLD 1FZJB 5IB1B 3WNNA 1A4JB 4HJJL 2OSLA 4JHWH 1X5ZA 2E27L 4MNQE 4PJ7A 2DOCA 1PG7L 1J18A 5ADOH 4LP4A 1MJ8H 2FJGA 4MJIA 5DD0H 3LD8B 3MXWH 1YEDB 4HJGB 1FYTD 1GGCL 2EDKA 3QUZD 4TVPH 5HYSG 3BD5A 4AEEA 3QBTB 1UG9A 3LQAL 2P47B 5SV4A 4L9LA 2AQ1A 1T1XB 3ARZA 4M6AA 3A67H 3MV11 4WTXA 4RZCB 3QFJB 1GCFA 4PRIA 2HT2D 5LCVL 4PJCA 5K59E 1GC1H 2X70B 1U0QA 3VXUE 4JDTL 5CBEA 3L3KB 1RUML 3H2WA 4UDTA 4XZUA 4CN1A 3O0RH 2ESVD 5T1KA 1CIDA 5DZOA 1DEDA 2IBZY 4LGSB 5GZOC 5KSBB 2YD4A 3BWUC 4GKNB 3FRUB 3CVHB 5MI0C 4Y2DB 1J0ZA 1XZ0A 5HHMB 4HS6A 4KRLB 5I73C 3I6GB 4TPRH 5HYFA 4L8BB 1KCSL 1Q38A 1UENA 2FZ3B 4ODVL 3S96A 3KPOB 3B6SA 1QZ1A 1SY6A 2V5YA 4RCAA 4LGPB 1P1ZA 4P2RE 4RRPA 3RZCB 2B2XH 1NSNH 3C8KB 2WBJC 5EZLA 1JFQH 5E7FA 1P2CA 3QXDB 2P43B 5TF1L 4WU7B 3LEYL 4OZHA 1DQJB 1CG9B 3GMRB 3KPMA 4BSVB 4MSWA 3I3EA 4H5SB 2XTJC 1F02I 4UBDC 3ARDD 4LAQH 4F9PA 4DGVL 5D2NE 5JNYB 3T4AB 1CZ8H 4AEHH 2FWOB 2X89A 7CGTA 4MQSB 1KOAA 5DD6B 4FP8H 1YDPA 4WGVB 1KPVA 4LKXA 1PZUB 1KULA 2HJLA 1A2YA 1TIUA 1RJYA 2VE6A 4FQLL 5F7DA 3L3DB 4LGRB 4PY8J 4Q0XH 1GHFH 5T3XE 1AI1L 1TCMA 5I9QC 3WNPA 4OB5H 4XNQA 1D6VH 3OR6B 4JFDE 1T22B 3NCFB 2NY0C 1U8KB 2WIIA 5CSZA 3HE6C 1QSEE 3SKMB 3STBA 3MJ9A 3D2UB 2BDNL 3E0GA 3NCYP 1KLGA 4U1IA 2Y06L 3TO4D 5IW6A 3IETB 1YPZE 2YD8A 3CXHK 3P4MB 3O4OC 4Z6AT 5FO7B 1HEZB 5FDWA 1A6TA 3QNXA 4NNXA 4G8GE 1WCBB 1I7TB 4OJFH 3FMGL 4ZXBB 4LCYB 1EFXB 3DJ9A 4HFWB 4KPHL 3IDJB 2VR5A 5E5RB 4O00A 1AGEA 5D1XD 2O5YL 4MDIA 1AXIB 1O7SA 4G9DB 3B4NA 3QDHA 5DEFB 5L2KE 4IJ3B 4LARL 1YN7B 5C0IA 3VD3A 2AK4A 5JIKA 3VJ6B 1MCBA 3SGEI 2C3VB 5F9OH 3H9SB 1S9XA 3NFSH 1MQ8A 3QIWA 4ZUTA 1U92B 2QQNL 4ACPA 1NMAL 4L8SA 1HYSC 5CILL 1G9NL 5FOJA 4J3TA 3X12B 1XGRB 3MNZA 4WFEE 4ODXB 2FYYA 2R2HB 1QQDB 2DM4A 4R7NB 5KW9L 5F6HJ 2B1AL 4WW2A 1FPTL 2QBWA 4CVZB 4YHML 1NAMB 1O0VA 5FK9B 5JXEA 3QFJD 3PWUA 1UXWB 1NQBA 1IBGH 4ONGL 5F3BB 1NGPH 5F7KC 3HI1A 4LNVA 5D5MB 4X5WA 5CD5C 5IQ9B 1G9EA 3MLTA 4X8JA 2DQFB 4EUPG 2VDKL 5JPNB 1TCRB 3NCYS 2CMRH 1AQDA 2GY5A 5A2IH 1G6RL 2Y5TA 2QADB 3RWDA 3LB6C 2IQ9H 3SDXF 3MZTA 4UUJA 2CKBL 4M7ZC 3BT2L 4MA7H 5DJYA 2F9BT 3BO8B 5E4EB 1SYVA 4Y2DD 4OQ1A 5HHMD 5FOBA 4W70A 4F7EB 2Z31B 4HUUA 2EDFA 4ZO6A 3SKJL 1LE9B 1VGKB 5ALCL 1J1OH 3HC0A 3C5JA 3RKPA 3AY4C 1UVQA 3P40A 4P5TC 3LEVL 3RZCD 5GJSL 1P6AB 3HNTL 3LDBC 1RJLB 4GRLC 1CL7L 1M7IB 3MOQA 5ICYA 4O58H 3I50H 2O61A 2LAAA 2CUHA 5TH2A 3IFNH 4QKXB 5B22A 3UTQA 3ARYA 1F13A 5F7LB 1GSMA 1LEIB 5DVNA 1DL7H 2BY1A 2B5IC 4FFVC 4LHJB 3GBMH 1T3FA 2EIEA 2A73B 4Y4HC 4H88H 4KJPD 5C0RL 4M1CD 3TJHD 5DMGD 1I3VA 1W0YT 5TE7L 5KTEH 5HD8C 3V0WH 2X4SB 4M1DL 4HK0B 3U0TA 1VSCA 4G80A 1YEGL 3T8XA 3IS1X 4GS7B 4K3GA 4PY7B 4M62H 4LHUB 3S3PA 2VDQH 3OXRA 1DLFH 1CDCA 2NTFB 2VN4A 3HB3C 43C9A 1IQWL 5CSGA 4G6AD 4AY0A 2EC8A 3CDCA 4R9HA 2CDGA 4MCYB 4OQTA 1I8IA 2ZSWA 3D2UD 5CUSL 4J12A 2XWTA 4XMLH 1JYNA 2HFEB 3VFMA 2BNRB 5D93C 1BVZA 1S7WA 5LGHH 2X05A 3VFPB 4RSVA 2J12B 3PWVB 4O2EB 3QNYB 3ZMRA 1DDHB 1AO7E 1KV3A 1C08B 3VD9A 4ZXBD 1EFXD 3BSZL 3LQZA 1CS6A 1FG2B 1EEZB 1FFOA 3QUZC 5HI5C 2WWKO 1IAOA 4G8EB 5KN5A 4WUUA 5EOQL 5FYJL 1A8JH 1IEBB 4DWHA 4HIEA 4H20H 1UKTA 5IMLB 4JZJC 3KPRA 3IT8D 3SDCB 3PWLA 2AJXL 4Z78A 4H1LB 5HSFA 5CMAA 5IBUB 3H9SD 5KANI 4GAJL 4LMQE 1S7VB 3FQRB 4OGYH 8FABA 2BOBB 2BCKA 4U0RB 4YGVA 4XP6L 1E6JH 2JF1A 5DHXB 1K6QL 4QCIA 3LPGA 2OR9H 1J1XH 5CD3B 1QSZA 1Q1JH 3X14B 4AIZB 1MJJB 5DT1L 2WUBL 5A3IC 2C3HA 1G7MA 4UIKL 5DUBA 4P5TA 4K55A 4K7PX 5GGQH 2VLRE 1HI6A 3IDGA 3BW9A 2QADD 3ROOB 1HIML 4U31A 2Z4QB 4NKMB 5FO9A 1R24A 1UWEH 5DHYB 4L4VB 4NO0A 4P2CG 2WK2A 3WKML 3Q1SL 4OV6F 5FYKU 3IU3B 3VFNB 5H94B 2Z31D 1R5WA 3H9HB 1IGYA 4Y4HA 1MVFA 4ZYKA 1MCIA 1J8HE 3QDJA 2QLVB 3ULVE 3FHQA 2WINB 4LVHC 5D96B 1NMCB 3HUJE 3RL1B 4RDQF 3AROA 5BXFA 4PRPB 2A77L 5JO5B 4ZNEA 2HG5B 4MHHG 4LLYB 4N0UA 2DBLL 2Z35B 1Z0NA 2LE9A 5BMFL 4Z5RA 4JO2L 3NOIA 4YPGB 3MZGB 4RDQG 5IMKA 4POUB 1HH6B 3I6KB 3MACH 4TRPL 1G7QB 3QDMB 3R06B 3VRJB 4MMZC 3MLYL 4Y4FB 4S1SH 4Z9KB 4JREC 1KJ2H 5ANMB 4NT6A 1I9JL 1YC8A 3ZE1F 4XMPH 3MV9A 2NZIA 5BZWA 3UTTA 2CK0H 1I1YA 3MA7A 4DGVH 3TO4C 5FHBH 4RFEA 4XC3L 1UQSA 1OAZH 2NX5E 4FQQA 3GMOA 4L4TB 1BBJA 3QCVH 1FYTA 5E2UH 1PJ9A 2H2SC 4LVEA 4LHUD 1B0RB 2RB8A 5D1XC 1KYOK 1BVLA 4JZJA 2VZSA 4NQVB 3EFDH 1KTLB 3IF1A 4FXKB 4KAQL 4BUHA 5C2BH 4M6ML 3SCMB 1OWWA 1BVKB 3MMEA 4M48H 1JUFB 2BNRD 3MGOB 5MENA 4BFEA 2W9EH 2A9MH 2CSPA 4OT1H 4YDJB 3EOAB 1CTNA 2ESVA 5I19H 4OZFB 5JW5A 1NCAH 2IALA 4I3RH 3I3BA 4H8WH 5D6DC 2W0FA 1QPPA 3PDDA 4HZLA 4OZGB 4UILL 3LD8C 2IBGA 4NO5B 5IMOA 4RBPH 1GGIL 1RZ7H 4JO1L 2OXGA 3AS1A 4Q6YA 2YBRB 4DN3L 4WU5A 5B38B 2VLLB 1CXLA 4PRHB 4M3KB 1G9MH 3SDCD 3S5LB 5HHXL 3T1WA 4K71B 1MPAH 1LO4H 2WMPA 4TULH 5GGTA 1Y6NR 3SDYH 5KSBF 1I8MB 2G5BA 1EIBA 2YPKA 1NMAH 1R3JA 1YECL 4QRUA 1LEKB 1MLCB 1G9NH 3GRWL 2J88L 2EC9U 1PG7W 5FECB 4YIQA 3FN3A 2DQJH 3STLA 3VRLF 2FJFB 1MQKH 3D69B 3V95A 3VXRE 5HHOE 4TSAL 1F00I 3VGBA 3F12A 1JZ8A 1QRNE 1P4BH 4PLKD 4OSUL 1T20B 2FGWL 4LSVL 2GI7A 3Q5TA 3U79A 5HGHB 3RNKB 1BZQK 1PEZA 3CSGA 1FL6B 4XNYH 4ZTPL 5K33A 3E6HB 2R39A 3SE4C 2A9NL 5C0FA 1BX2B 4XCYA 2P8LB 1DQDH 3RZCC 3PJSA 5CINH 4Z7WA 5MERB 3MRQB 1OSPL 2E7BA 1EERB 1UEMA 5TQ0L 4L4VD 4UIMA 3O3DA 2DWDA 2QHLA 4M1GH 5C0BE 4G42A 5F9DC 2WBKA 4JPWH 3BP6A 1ZGLB 5ESVB 4P2OB 1RMFL 1ZWIB 2ARJA 2OM5A 1XF3B 3MJ9L 5CP3H 2O5XL 4HX1B 1RUPL 3QEUB 4KJPC 3HS0A 4M1CC 1MHPL 5I1EL 3AB0B 3TJHC 1J1PH 2IPKB 4Z7VB 4F37K 4PRPD 4QY8A 3VMOA 3MRIA 2DWEA 3BPLB 4GAGL 4D9LH 5DRZB 1WBXA 4RAUB 4N8PA 3L7EB 4X0KA 1EK3A 2AI0H 1N2RA 3MBEB 5DSCA 4N0YL 4DFIA 2JB5L 5D1XA 4CMMB 1JNHA 3V4UL 4QHKJ 3P77A 3C2AH 3QDMD 4Y4FD 4I18A 3U7YH 4XX1E 1VPOL 5JOEA 3HPJB 1IKFH 3QA3B 4G6AC 3DX9B 2IFGA 5DJZB 1N7ML 1E6OH 4YHPA 4O9HL 4PRBB 5LGKA 3SEPA 3ARUA 3O6LH 2H6PB 2K3TA 5D6DA 3EIFA 3ESUF 5DUMH 5EOTB 5IGXH 2FECL 2JCCA 3D6GA 4L4TD 3VD7A 5DJ6A 4UDUB 2R1YB 3GK8L 2AS5M 4YJZL 1GOHA 3FT2A 1BHGA 1DUZA 1FORH 1J12A 4L29B 1FFPB 3MA9H 5EBMA 4ZXBC 1MCQA 3HZYB 1K9TA 3U30B 1FV1B 4ERSL 1RPQA 2X9YA 3FB8A 4PJIA 4WY7H 4K7PL 2P46B 2D9QB 3SCMD 4IJ3C 4JRXB 4CVXA 2ITDB 4XPAL 1LD9B 1N4XL 3SDAA 3ALWA 1JF6A 3OKDB 1I7ZB 1UXSB 5JORA 3K2UH 3HAEB 3ZTJG 2VDPH 5C6WH 2F53A 3L9RB 2J2ZA 4HIIA 2BVPB 4LPUA 1X5LA 2EDEA 2V9QA 4MX7B 5D5MF 3OV6A 2HKHH 2GTWB 4AG4H 2P44B 3I6GA 4E41A 4K7FA 2XRAL 1FNGA 4PRHD 1BBDL 2ICCA 2F5AL 3SE4A 4X6EA 4MA3A 5C0ND 3WS3A 1OSZB 1S8DB 1JZ4A 2JK5B 4HGWB 3UBXA 2IQAB 1CFSA 2D7MA 2HN7B 1MEXH 1OB1A 4N68A 2D4DA 3EFFA 3O3UN 5EIIA 2NZ9D 1A6UH 1LK2B 3QUKB 1DQJA 2CPCA 2J5LB 3AMKA 3WLBA 4FQ2L 2Z9TA 3V6OA 3C5ZA 4DQOL 4DTGL 4CW1A 5E4EC 3DX7A 3LKQB 3UTZA 1F2XK 3X3FL 5GGUA 4NBXB 5E2VL 4OCNC 1SMAA 5D71H 3DGGA 2Z31C 2EYSB 4XNMA 1F4YH 3HZKA 4P99A 4YNYA 2IJ0C 1CU4L 3HLAA 4O4YL 1CLZH 1S7SB 5D9SA 3RWIB 5CGTA 1E28A 4K23H 5E8EB 1IGJB 5ID1B 2B8OT 1INEL 3OKLA 5TGBB 3LKRB 4JY4A 1ACZA 2VLJE 5J1AB 3HRZA 3MUJA 2XKNB 3MTRA 3KPLB 1IKNA 4L3EE 1WFUA 1WAAE 1FL5B 5FO8A 2AXFA 1BJMA 2YSSB 1CFVH 4M61A 4KVNH 3ZSSA 1IGML 2YD9A 1QHPA 5JHDE 1BQHB 1QFWM 4RGMB 2DD8L 2ADJA 4P2OD 1RIUH 1JNNH 3MJ7A 3IDNA 3CK0L 1OAQL 3GSNB 3T0XA 1X5JA 3DMMB 3E3QE 3P11H 3MC0A 4LSTL 4Q9BA 4CJ1A 1U3YA 4PRAA 3W39A 5DFTA 3I2CL 3GSRA 4KC3B 3QG7L 4F7CA 2EXYD 3OXSB 3L7FB 4I2XE 1KUMA 3MBED 4WFHE 2XN9E 4DKDC 3GJFH 2IANE 4V1DE 3GMQB 2YK1L 4MQTB 4PGBB 4GS7C 4XAWL 4N1HB 5FYJE 4LHUG 3TO2B 4FXGA 4YEEA 5B3NA 4NKOB 1OT2A 1CGVA 1ZVSB 2FX8H 4XTRD 1WTGT 1T5XA 4WI6A 5FCSH 4D3CH 7FABL 4D9RD 5E08H 2YOCA 4GG8B 5HHNB 2FIRT 1T03H 1AY1L 3H9SA 2GK0A 4XP1H 3QP3A 1BLNB 1S5IH 3U2SB 1DBAL 1N0LA 5CIPA 1WFNA 2ZOKA 2DQGL 1MJ7H 2CDFB 1X5HA 2RAMA 1MCKA 4CBPA 3ZDXF 2R2HA 4LEXL 3RFZC 2Y36L 1S7RA 4ZFOA 5D72L 4V2CB 3WIIH 5E4IA 3RL2A 2VZTA 5C09A 5I74B 1KEMH 1YEJH 3BQUA 4LDLB 3WHE1 1KXQE 1YMHB 3RX7A 3LKNA 2E6JA 4Q7DA 2ZUSA 4JHBA 2KH2B 1J7VR 1DFBH 4LDOB 5HYJB 1RZFH 4JRXD 3H9ZA 2Q87A 1WWBX 4H1LG 3SDCC 2BSED 2YEZB 5IBUG 1QLFB 4Q97A 3THMH 4UV7L 5CS7A 4HPYL 2LU7A 5D8JH 3ZKXB 4U0RC 1MCNA 1LO5B 3ULUD 4RA3A 3IKCB 1UM4L 1ZE3C 1B6UA 4X6CA 4AMKH 3P0VH 5KOVC 5LJYH 1U2CA 4LOUC 5I6XC 4OFPA 3U9UA 1JGDA 1T2JA 5IMMB 3V5DA 5HYEA 4M5YH 4NKDB 3ZDZF 3DVIA 1BOGB 1NKOA 3JVGC 4RGOL 1ZLVH 4XWGH 1JYVA 1EEYB 4PLKC 4QXUH 5K9JL 3NZHL 4PJ5B 1ZAGA 5K9OB 4PV9A 2ZCKH 1HINL 3QXTA 4WUKL 2JJTC 5DRXA 2DKUA 1JHLH 3AS0A 1NAKH 2VXUL 2VXSL 4GW5B 5CJOH 2KL6A 3MODH 3G08B 3C09B 4RNRB 3GMMB 5JUEH 4NQXB 2R4RH 1BWMA 4P46A 4FZ8H 3OL2A 5DD1L 5EBWA 1UEYA 4JEGB 1H3TA 2BC4B 5IHUL 3KHOA 1NPUA 4HWBL 2AK1H 3W81A 1VFAA 5FYLL 3CFBB 5E1HB 1JRHL 5D96C 3MOAL 1NMCC 2Q1EA 4PJ7E 5E8DH 2R56L 3BH9A 2JB6A 4WWKB 4PLOB 2V17H 4MJIE 1NCNA 4X9BA 1RHFA 3DX8B 4FQCL 4ZTPH 1H8NA 4HULB 3T3PE 1KELL 4R2GC 2D7TL 5CEZH 2C5DC 4YR6A 1ES0B 4IRSB 3UMTA 3O11B 3CH8A 3KWWA 4O5LH 3QIBA 2C7UB 3IDYB 1MCCA 4PRIE 1CBVL 5MEQB 4PJCE 3QUXB 4EDWL 4Y4FC 1PY9A 2FRGP 3G5ZB 2KPNA 3BE1L 1K4DB 1D5MB 1TJHH 1MFAH 3DMMD 2VLME 3L5XL 4ODHL 4G9FB 4WI9A 1ONQA 2XZQL 1QFPA 1K4CB 4V2BA 1R6VA 2MCPL 1HSAB 1BQLH 5E9DA 3MRBA 4OKDA 3T2QA 4NQDA 1F3RB 4NQSA 2EYRB 3STZB 3GKWH 3P9WB 1QEWB 1CD8A 3FFCA 4GH7B 2CR6A 2Z8WC 5AWNH 3CC5A 4HW6A 2IGFH 4DVRL 4Z0XB 3PL6B 3BWAB 3HNVH 3QHFL 3DVGA 4OLVH 1AGFA 1L9NA 4JO4H 3WNKA 2P45B 3RKDD 1EXUA 5IB4A 3SCMC 1VPOH 2OXHA 3MFFB 3C5SB 3FQRA 5GGTL 1I9EA 3K8KA 3HZVB 1NBYA 3MOBL 6FABL 4XVSH 1HXYA 4KRPB 1WITA 1X6LA 1QG3A 3PP4H 4OZHE 1DUYA 4XNZC 2BNUB 5DK0B 4PJGA 4HUXA 1FAIL 1DVFB 4H0GA 3S3SA 5HGGS 4ZSOB 4OKVA 3JV5A 2P5WE 3M45A 2ATPA 4NRZB 4NYLA 4PV8B 4CN6A 3OR7A 1WSST 3O3EB 5E5MA 5HYJD 1WC7B 3V4PH 4U6VH 1P53A 1LO2L 2EICA 4CU8A 1UYWH 2CJUL 2G75B 4GXUN 4P9HC 3PGDA 4F33B 5T1MB 4FABH 4P5KB 5ACZB 4K71C 1EMTL 4R4BA 4BZ2L 4JRYB 2NMSA 4I1NB 4HXBL 4NKMA 1YEFL 2DJ4A 4P2QA 1CT8A 2AAVA 4LVOB 4WI8A 4LSRL 4F80A 4J3WA 1A1NA 2NZ9C 3VFNA 4XPTL 4FQXB 5EA0H 5KSAB 2CXGA 1REIA 3FQXA 2X10A 1ZLUK 2A6KA 5F1IB 2J4WL 3JUYA 4LLMB 2YKLL 5IQ7H 3BDYL 5MEOB 1ZGLP 1J0JA 3G5YA 3KR3L 3MRHA 4MJ6B 4K94C 4PJ5D 4P3DB 2OZ4H 4HF5H 3KLAA 1G6VK 3CFDB 3GSVB 3QDGA 5DEGB 3GGWA 4Y5VA 4MCZA 3C60A 1A5FL 1I7UB 3VW3H 1MUJB 2X42A 4NZRL 3U9PL 3S8WA 1TZHB 3I6KA 4NHUB 4Z95H 1KB5A 1EO8H 2K9UA 3O6KH 3BPNB 3PDOB 1FGNH 3ILPA 4AQ1B 1OF2B 2AK4E 3FAWA 5HDBE 4IMKA 25C8L 3DV4A 5SWSB 1QR1A 3X3FH 4P2OC 4S1QH 5BVJA 5I1JH 3KDMA 1UWGL 4RMVA 2G60L 5I1IH 2WM0A 1ZLSH 1C7SA 3A6BL 4WWKD 3RVVD 1LP9B 3AB0C 3BPCB 1D9KB 5ALBL 3LS5L 4B41A 4JHAL 3VFGL 5IFHH 2V6HA 2PTUA 2W65B 3UC0L 3D5OF 2DTMH 3BPLC 5C0AB 4NQUA 5I17A 1AQKL 3MBEC 4IRSD 1XGQA 3NAAL 1QLEH 2OMBA 4RGNE 3VI3F 4LPVA 4PRDB 3VFUA 3UJJH 1H3GA 3KJ6L 4KMTL 4WW2F 2Y7QB 3QUXD 2IADB 4HH8A 3VRIA 4XTRC 4ORZC 1HH9B 3E8UL 1BVKA 1B0GA 1VEOA 3QG6A 4LASL 3SPVA 5AD0B 2CDEB 4BQ6A 1HKLL 1LEGA 4OCLC 3JV0A 4KI5E 4XXCC 4G9FD 5HYQA 5CEXA 4OZFA 4GFTB 4TN9A 2XI9A 3MO1A 5GGVH 1OARH 1U3HB 2BVOB 1VFMA 2W60B 3MGAA 3KLSA 2E3VA 5L2JB 2B0SH 3QEQA 1PDKA 3I2CH 4X7SH 5FKPA 3MRNA 3ELAT 1YJDH 4PJEB 5E00B 3LSOA 3BD4A 3PL6D 1MHEA 3HPLA 2FEEI 5E6ZA 1J88A 3WUWB 3U30C 3CAFA 5DDHB 3MRPB 1D5BB 3HRPA 2GK2A 1OW0A 3B9EA 1CLCA 1CICB 3S5LA 3HNSH 1HNFA 2J6EH 3C9NB 4FFWD 5GS1A 5AG8A 3FHAA 1KTDB 2BNQB 2OR7A 5E2TH 3ULUF 2VL5B 5F1NB 4U2ZA 4HIHB 4APQA 2NY3C 5IEKA 3U36B 4MQ7A 1KB9J 2OL3H 3HAEG 4KRPD 3IU4H 1CE1H 3OF6D 5KSVB 4WNQA 3RA7H 1MVUB 1DVFD 4QRTB 5JHLL 3D69A 5F93C 5FGBC 3T04D 1VCAA 2P1YA 2YR3A 4K3DH 4IOFD 3NFNB 5AZ2H 2A6DB 4JM2B 3LN9A 3LN5B 3QEGL 4U1HA 5FCUL 4JY6B 3TFKD 1BX2A 3IDIB 1EUUA 4WJ5B 3S6CA 5JIHA 4D8PA 4JRYD 1NL0H 3BVNB 1P4LA 4O51B 5I30H 4JFOB 4GW1A 3UYOD 3ZT5A 3INUL 3NCBB 2IC2A 3MJ6A 1JGEB 4YHIA 4FQXD 2MHAA 3TNMB 3TZVB 5KSAD 4AYFA 3HN3A 2J5LC 3O2WH 3R0MA 4YHZL 5JOPE 3G5XB 1KIUA 3S37H 5ILTH 3LIZH 1D6EB 3IJSA 3OAUH 4F9LC 2WP3O 4U6YB 1KJ3L 1TXKA 1U8PB 3TV3L 4ZAKA 5ICXB 1AD0B 3S34H 1JBJA 2IPKA 1RK1B 4GMTL 1BD2B 4PB9L 5DJDB 4PLNC 3MLRH 2JJSA 4G3YH 4YO0A 4Y88A 2RIKA 4QHLA 5F7EH 2DLFH 4R26H 5F7YC 1AGBB 2FX7L 4JDVA 3G9VA 2XTLA 3OKNA 5FM8A 3MBEA 3KNBB 4KDTC 1FNHA 4RFOH 1QSVA 1EZVX 4WUUE 2D7OA 3RUGB 1TMCB 1P4IL 3D85B 1AC0A 4RMQA 4LPXA 1F11A 5IFJA 1ITCA 3DROB 2NYYC 1BQHG 2XYCA 3KPRE 5SWSD 1Q94B 1FNEA 4XXCA 5T3ZH 3TCLB 4KHTL 2XACC 4QHNB 5FM5M 3RNQA 5IK3A 1Q0YH 4AL8H 3QZWB 3DMMC 4ZUVB 2AQ3A 1D9KD 4MNGA 4PJ9A 4Z7OF 2PR4L 5DTFA 4TUJA 3DX6A 4PGJA 4DEPB 4AEFA 1YN6B 2H2PD 4PR5A 4S0SD 5D1QB 1ZHNA 1RK0B 5C0AD 1T21B 1MFEH 3MCKA 3P9LB 4LLDA 1TTUA 1JPFA 1ZTXL 1YUHB 1NAML 3V5HA 2DLGA 3V2AR 1PAMA 3S88L 4O2FA 3L3GA 3QQ3A 5CP7A 2VXVL 4WO4C 1GXEA 1I3GH 4JZNB 4HPOH 5E7BA 4XP5L 4ELKB 1P5VA 1IM3A 1URLA 3RKDC 5EZJB 4NJAH 4KVCH 4BQ8A 3MLWL 4NCDA 4XBPA 5J3HD 1ZHKA 5SWQA 2YWZA 1U3HD 3ARBA 2AEQH 3I85A 3K7UA 3V4VH 5I8OH 2MCPH 3LMJL 2X4QA 1K5NA 2YS4A 4Y5YB 3QAZB 2A1WL 2C1OA 3P30H 4WGWB 1NMBL 2HJFA 1OAXL 5HY9B 3QDJE 5AYUL 4QOKA 1N64H 1YYLH 4HIXL 4JN2A 1AR1D 4P3CH 5INDA 2H9GA 4ODWA 5I74C 4J8RB 3MUHL 3NH7H 3L95A 1CICD 1PD6A 1F3DH 4K07A 3PV6B 1A6AA 4MWFB 4ZNEE 2BSRB 4GMSH 4N0UE 2BNQD 4DGIH 4EKXA 3L5IA 5E8OA 1AHWA 3TT3L 2W59A 3G6AB 3C6LB 3MUGA 5AUMA 3RWGA 2Y6SD 4IRZL 5H2BB 3ZKXC 1FE8L 1PZ5B 4F15C 2H41A 4BJLA 2X4PA 1S9WA 4L3AA 4TSCH 1A6VL 2ZG1A 4HV8A 1X4XA 5TDOB 3ZT6A 5I8EB 1EDQA 2X09A 4F9LA 2JELH 4X83A 5DMIL 3MV9E 5FYLE 3UTTE 4JM2D 5I8KL 1CXIA 1DQLL 5IR1A 1NDGB 4P57B 5HI3D 1IGJA 1H8OA 1RFDL 4JR9H 4J6RH 3RPIA 2APFA 4UQ2A 1UCBH 3HR6A 1FYTE 4MLIA 2GTZB 2XKNA 1RZKH 3GZKA 2J8OA 1BQUA 2J8UA 1RUQL 4K7PY 3O6ML 3O3AA 1FL5A 2P7TA 1CR9H 5J6HB 5D7IB 3ULVH 5EUOB 4URTB 3TZVD 3IDXL 1GZQB 1N59A 4PG2A 3QQ9D 4B50A 5CKAA 1U8NA 5C0CB 3NZ8B 4OF6A 1FIEA 3LHPL 3P0YH 5D7SH 2XPGA 3QB7C 5MENE 4B5EA 4WTWA 1FL3B 2NW3A 5EZOL 4NP4L 4NQTA 2VYRE 1DSFL 4BH8A 2ESVE 1OTUD 3OKYA 1BD2D 2D03H 2D31A 3T0BA 2DQCL 2I5YH 2YRLA 3RVVC 1EAPB 4OLZL 1A1MA 2BVTA 4Z7QF 4G6JL 5B3JE 1J0HA 4GG6B 4LCIL 3D85D 4WO4A 3MR9B 3IDYC 4R3SA 2BVQA 5A2LH 1RUAH 3CUPB 5B3JF 3QUXC 1VA9A 3SGDH 1YEKH 1B0WA 4MD5B 5KVDH 5GGRY 3U2SA 4BK5A 5J9PA 1MRDL 3V7AE 5KANG 4P59L 4EDXB 4Q2ZA 2PNDA 1FC1A 1H0DA 5D1QD 1T04B 4BQ9A 3NIDE 2CUIA 3UC0H 4XPHH 1ZA3B 2VZ3A 3NFPA 2FD6H 1AXTH 1KTRL 4DUWA 4ZUUA 3OAYH 3VH8A 1CD1B 5DRNB 1JMZA 5HYJA 1JCKA 3P4OB 3PL6C 4CAGA 4JN1H 2Q8BH 5C07B 4AENB 5CCKH 1U8OB 2I9LA 2PO6A 1JHKH 1VACA 1ADQA 5FA4A 1TJGL 4U3HA 3UPRB 3T77B 5ITBL 2CIIA 4FFWC 5DJ0B 4Z7WE 1I8LC 4QNPF 5D7LA 3TYFA 4I0PA 1XGTB 5GSRA 3U48A 2ZCLH 1X5YA 4KRPC 4MB5A 1A7NH 1J11A 3DRQB 3EO1A 2IG2H 3VFOB 4LKCB 1NCWH 5GGVY 1DVFC 3M07A 4JPVL 4B7LA 3CVHH 2G5RA 3BZFB 3FB5A 4K2UL 1ND0A 1YA5A 3VGHA 5DS8A 5F96L 5BCAA 4K9EC 2XV6B 3WV0A 2GSIB 1V7NL 1WT5A 2A74B 4M43L 3MV8B 4AIXA 4XPBL 4OCYH 4RMTA 4S0TD 4G5ZH 4XPFH 5JQ6H 4UTBL 2C26A 2BK8A 5A1AA 4NWUL 1R3IL 1T7WA 2D7NA 4Z0BL 3BH8A 3TFKC 5SWZA 2QSCH 4GXUM 5GZND 4GW5A 1A7PL 3LN4B 3C6LD 1AH1A 4DCQA 4XP9H 3H7BB 3WSQL 5MEPA 1ZANH 3QUMH 4OIIH 2CGRH 4BH7A 4LVOC 5JIIA 1KB5L 2ZNXA 2IF7A 1E4WH 3RWHB 1NFDA 1RZIB 2OI9C 4MD0B 4FQXC 1Y18A 3L1OH 5DUPL 4W81A 5KSAC 2DIBA 4UT6H 4KHXH 4FS0A 3F62A 3RVTD 1FRGH 1Q0XL 5HTSA 1T2XA 1RURH 3RWJA 1FVEA 2X4NB 2JCCE 4OLWL 2ZSVA 4PS4L 1EEUA 2X1WL 5IKCA 3CFIC 1C1EL 2K7QA 3SKOB 1IZKA 3WFEL 32C2A 3BZ4B 3DUUA 2YPLA 2JCCF 2DDQL 2B39A 1HQRB 4PJXA 2BY2A 3FONA 4PJIE 3MJ8B 5C0CD 1UADC 3BPNC 4NCC2 1FQ9C 2XKUA 3QRGH 4HUWA 1X44A 1D5XB 4HT1H 1JZ7A 1IARB 1JPGB 1Z9LA 5I8CA 4KRMB 1TQCB 4ZPVA 2F53E 2HA1A 5EU6B 4JFEB 3CFCL 3AREB 1D9KC 1LQSR 1A3LH 3JTSA 3NTCH 1AP2A 5ITFB 3WS6C 3DSFH 3WNOA 1GZPB 3NABH 3T08A 1CLYH 2H2PC 4KROC 1ZXQA 1UJTA 4JKLA 5EO9B 1KXTB 4E41E 5BQ7A 2ENYA 3BWAA 1OAUL 2PXYC 1T83C 3G6JB 1U91B 3SE8H 2EZ0D 1ORQB 4P9HL 1Z5LB 3OZ9H 4Z7UB 3EO9L 3SKNB 5HGAB 4YHYB 5JW4Q 1DANU 3U0WH 1I8LA 5EU4B 3WN5C 3LV3B 3ZKNC 3RAJL 3FO9B 2X4OB 4KHTH 3KLHD 1OAYL 4G6KL 2VISA 5IG7B 4NSKA 1JGVH 3FT4A 4HBCH 3JXAA 4PJEF 1JPTL 1BEYL 4PG9A 5J3HC 4YWGH 3V6OE 5ENWB 1MIMH 3IJHA 1YNKL 1VADB 1WBZB 5F88A 3V6BR 3QEHB 2VAAB 4JQIL 4DZBB 2ZP0T 2X4RB 5I1CL 3WUWG 4K94L 1FH5L 1AR1C 2VC2L 2AJZB 5C07D 3QDAA 1OD7A 4KGLA 3FJTA 3SE9H 1D7FA 3IVKA 5JPMA 2OQJB 2AV7A 4WHDA 3QO0A 3O9WB 5DGRA 3E6FB 3OKMB 4JPKH 3V5KA 1G7IB 3JUZA 2HWZH 1YYML 4RA0C 2G9HB 3PP3H 2HLAB 5HHVL 3PWNA 3VGGA 4I3GA 5C0GA 1FNLA 4ODUB 1ZT1B 2E9IA 4GAFB 3AXLA 4FQXA 4D0BB 1IJ9A 1EGJH 1C12A 1I1FB 4JM2F 4KI1A 1BFVL 3FQWB 5F1IA 5KVFL 1ZT4A 3KG5A 2PW2A 1S7UB 1YMMB 3NPSB 4OIAA 5C0EB 1YNTA 1E4KA 5DK2A 4ZUWB 1F3JB 3MV8D 3TH2T 3D25A 2Z93B 4U1SB 4RBPK 1HK6A 1INDH 4HSQA 3VWJA 3DO7A 2V2WA 5MHSE 1C5CH 3VFRA 3GSVA 4C55A 4JG0H 3MRJB 2HKFL 4E5XB 3VXSB 1MCPH 3VWKB 2OTWB 3HA0A 1TDQA 3IFOB 4JKWA 2FIKA 1IFHL 3L5JA 3ZE2F 1H5BB 2EKSB 1A6WH 4F7PB 4ODSL 3TZVC 2FEDD 3QQ9C 3FOLA 2OK0L 1KJ2B 1U93B 3WJJC 3H9SE 3CPLA 4XVJL 2Z8VC 4FFZH 4U1NA 5FXCH 1T1WB 1LP9A 2ATKA 2GJZB 2AEIT 2FBJH 1SVCP 4M6OH 5DJXB 3GSOA 3NCJH 1XMWA 2AV1A 3FL7A 4LSSL 4NZUL 4IHOA 2R2EA 3EDDA 3A6OA 4NPYA 1I1RA 5C09E 2PXYA 3TIDA 5EO0B 3SY0A 4PJDA 2F8VA 3UO1L 2R0LH 4KWUA 4TQEL 3BDBA 3QPQC 4U1LB 5C86A 1LO0L 2DI8A 3D18A 3HC4H 4HXAH 1CD0A 4MXWL 2ZZUT 3WN5A 4E42B 2IBZX 3UJTH 3QZWG 2HFFA 1FNFA 5EU6D 2J7LA 4JFED 3UTPD 3ARED 4JAMB 5DFWH 1FO0B 4W4OC 1ZK9A 4MQXD 4LSPL 4X6CE 3ARQA 2NNAB 1KIQA 4DEPC 1EEQA 1OM3H 1NC4A 5D1QC 5E1AA 1VGEL 1G7JA 3VFWB 1B2WL 2VUOA 1MCEA 1U3ZA 4MDJB 1WICA 1M7DA 5L8JB 1LK3L 1VFOA 4X6FB 2CLVB 1DJSA 3TVMB 1G0YR 1VEPA 2UVFA 1WTLA 5JR1L 4UB0L 2NLJA 4LCCB 1MAMH 4J2XA 1TZGH 3FFDA 5I1DB 2X7LB 4QXGH 3U4BH 5GRVK 1DEEB 2X4UB 1GC1C 1I9IL 1LO3L 4H1LH 5EC1A 2WSKA 3UPCA 3QO1B 3RX5A 4ONOA 3HE7B 3WDHA 1U8JB 3SJVB 5CBAA 4NHCL 4EI6B 5FIEA 3FO1B 1MH5A 2A83B 4O02H 3F7YA 4YDIL 4MNQA 3X11B 5CZVL 1FIGH 3QAZC 4XVUD 4BFIA 4ZFFA 5DD5H 4NQCA 3N9GL 4ZFGH 1MY7A 3O2DH 4WI5A 1SEBB 5EORH 5IIEB 2BJML 5J8OA 4RWYL 3L5WB 4XCFL 4HCRH 3TBSB 3O9WD 4KXZH 3PGCA 4QRPA 3SDDC 4KK8C 1W72B 3EYFB 1QKZL 3DARA 4O51A 2X44D 5C7XL 4LLUB 4YDKL 5INCB 3IFPB 2VXQL 5GZNC 3C6LC 4M7KL 4LLVA 3KPSA 3BFOA 3QR2A 4FZEL 3TZVA 1QYGH 1X5GA 3LH2L 3CMOH 5HJ3B 3WDIA 2F74B 1NGZA 1P9MC 5M7QA 3EDKA 5FF6A 1YMMD 2X4TB 1S5HA 4OCWH 1I9RL 4WV1A 2HH0L 4M8QB 4JY5H 3WIHH 5BO1H 3DWTA 3BEWB 1MFBL 1RK1A 2KBGA 4HC1A 1WISA 4DAGL 2QHRL 1QFUL 4NQDE 1J5OL 2NY7H 4HIJA 1AGBA 5IB3A 5D7IF 4BQBA 1BAFH 3VXSD 3VWKD 5EUOF 4TUKL 1CGWA 1BMGA 3FFCE 2IH3A 4YDVB 2IEPA 5I18H 1RIHL 2H26B 4D0DA 5CEYB 5EDXA 1ORSA 2EIZA 5T5FL 3ZTNH 3DROA 3BGMA 4XBGA 3RVWC 3X3GH 4G6MH 4G8FB 4GXVL 4JRWA 1BZ9A 2X9XA 4NRXA 3TYGL 1RZGB 4NDMA 5I1KL 2F15A 4KTEL 1XR8A 2ORBH 4KU1A 3BZEB 5DWUH 2XT1B 2NXYB 3MLZH 2H1PH 2OX5A 3CSYB 3NN8A 3T3ME 4GG6F 3TJEH 4PJGE 3RIFF 1PYWA 1RK0A 3T2NH 2QJDA 3B5TA 1HHHB 1NJ9B 5IVZB 3RGVA 3PQYB 5FHAL 2XFXB 1RZJH 1CDIA 1OLLA 2V2XB 3ULSA 3REWB 3P9MA 3FT3A 4X99B 2C3WA 5D6CB 4HKJB 3CCHB 1ADQL 1KNOB 1BZ7A 1Q8MA 1T0NA 2DQEL 4ORGB 4F7TB 3DRTB 1ZT7B 2YN3A 3VXQB 3PHSA 1A0QH 3L3IA 2BRQA 3CZJA 3VG9C 4HHAB 5EOCL 2QSTA 3IJYA 3KLHC 1HHJB 2EDYA 4PJAF 3UTOA 4ZPTA 2ADIB 4N1EA 1HZHL 1P7QA 5DQ9B 1OAKL 1SY6H 3HMWL 1OD9A 2EH7H 3TVMD 4WRLA 5F7MC 3GJFK 4LLQB 3O2VH 2ZPKH 3PV6A 2LTQB 3AGVA 5E2WL 1IL1B 2XWBB 3SDDA 3EKCA 3FQNA 3QDGE 1F4WH 2VH5H 4N9OB 3OX8A 4MAYA 4LFHG 3HE7D 1T89A 1WF5A 1ZS8B 1MFCL 3RDTB 3SJVD 3MYJA 4N5ED 1GPOH 1E27B 4L8CB 2XNAB 1J9CT 4ENED 1HXMA 3GI8L 5CZKA 2A2QT 3C6SB 5J1TC 1S9VA 4I77L 4GKSB 1BF8A 3AMLA 5D70H 1U8IB 3F5WA 2DQHL 3FO2B 4FQIL 4OFIA 5HDLA 1UJ3A 1DBML 1F8TH 1K3ZA 3NACH 4MD4B 3NIFF 2AJVH 4X5XA 1HHKB 1KJMA 4F58L 1BGXL 1TETL 5EU5B 1FVDB 3QPXH 1KLUB 4OZIA 5L7XL 1IC4H 4UU9A 1UB6A 4CNIB 4OV5A 4WENB 3BKCH 4P23B 4MA8L 3OKKA 2LFGA 3TIEA 3JWNC 1KF9B 3NZ8A 2Q20A 4U05A 4XC1L 2VZ1A 1ZLWH 1XGPB 2FO4A 5E8NA 5KJRH 3FO0L 5DVOA 4XB8A 3H9YA 4TUOA 2FEDC 4D9QD 4JANA 4L5FH 1FJ1B 1RJZA 1K8IA 1A7QH 2DM7A 2WBWB 3WUZA 3QHZL 3CFJB 2JJUA 5L8KB 4U1KB 4LPTA 4X4YB 4I4WB 2Y9RT 4MHHI 4F2MB 3QEQE 5FB8A 3Q6GL 3MLXL 1R3LA 4IDJH 3GJFB 3MRRA 4PJ8B 1SM3H 1LNUA 4PB0H 4WFGE 2FL5B 4OD1H 5DI8B 5E99H 3ZLQC 3BN9D 1P7KB 2E7CA 4LIQH 5DJAB 1IT9H 4OD3H 1WWAX 5TQ2L 3CUPA 3W9DB 2FSEB 4WCYL 4OFYA 2YPVL 1NANH 4KKBD 5DF0A 4I5BA 2F5BH 3CLFH 2BMKA 2IH1A 2HJKA 4IRJC 3DO3A 3TM6A 2YMXH 1AR2A 2NXYD 4LEOA 5CJQH 2OTUB 1OHQA 1TVDA 1UGNA 3AREC 5KS9A 3G6JF 1QLRA 4EQ3A 3WFCL 3PQYD 4KKAD 2V5MA 1N5YL 4K9EL 4OCRH 5FV2A 5DRNA 4J1UB 3TT1H 2ERJB 3RJQB 3ARGB 3CZFA 3QNZB 1RUKH 2QR0A 3SGDI 3V6FB 3WFHB 3HZMA 5GQBA 3T77A 4EJ1C 1XFPA 2YC1A 5C2UB 2R0ZL 1NUDA 3DBXA 4HS3B 2XICA 4Y4KB 4MNHA 1HKFA 3HAEH 3VCLA 3DRQA 3VGFA 2D0FA 1L6XA 2F58H 3WJLA 4POYA 3DXAA 2V7NA 2AABH 3M17B 3ULUH 2OJEA 1OTSD 3TPUB 3E2HB 5C70A 4OM1L 3D0LB 4XVUC 4LU5H 2EDHA 4LBEB 1G7HA 2OYPA 1TVHB 3IXAB 3SE3A 3M8OH 4YQXH 1LK3H 3D9AH 4Z7VE 4HWNA 2Z91B 1KBGH 2PTTA 5BV7H 4LF3A 4HKZA 4Z77B 3IKKA 1Z2KA 2AXGB 3UCRA 4MXQD 1CVRA 5EFIA 2VABA 1TJIL 1AE6L 2GSGA 3QUYB 1AKJA 43CAB 4GUPA 3ZHLA 4F57L 1CCZA 5A16B 2HVJB 3RDTD 3TLRA 2P24B 3MLUH 3MROB 1YEEH 3AM8C 5IEHA 4XPGH 4NKQB 1YZZA 5HHPA 2E7HA 3L3HA 5F97E 3H7LA 4KGJA 3U6RA 2MQ3A 4X6DA 3V8CA 4F7MA 5EU7C 1KT2B 4GAYB 2L7UA 4PJHA 2AEPL 2F54B 2XXCB 4H26B 1NLDH 5ESQA 3OKEA 3NPSC 4UTAH 4F3FB 3TWCH 4EOWH 4WTZA 2GCYB 3BKJL 4RQQB 5C71A 4MNGE 4K3EH 3D3VA 4MB3A 5L6YH 2C9AA 1IAIH 3DVNB 3MV7B 4AT6A 1DLHA 3WKNA 2N56A 4OQTH 2XY1A 2YRZA 3VWKC 4P23D 3BGFB 3RWEA 3O45B 3ZYIA 3I9GL 4UQ3B 3LKPB 1QSFB 1H5BC 2P4AB 5ISZA 4NM4H 5DLML 1U6AH 4G8IB 1NGQH 3NA9H 3P73A 2VQ1B 1IGFL 3HKFA 3RI5F 2CRIA 3MUZ1 4IRJA 5C08A 2N4IA 1IAKB 4HAFA 4BKLB 1I3UA 4NO2A 1T1ZB 2YD2A 1BWWA 5EU6A 2QQQA 3GSNH 1I75A 4KK9D 2FATL 2OP4H 1ZEAH 1HOCA 2AGJL 3OG4B 4X7TA 1NLBL 1IC7H 2ZUVA 5EZIL 3DURA 4ELMB 1CGTA 1RI8A 1S7XB 4PJ8D 1Q72L 2DLEA 4QOKE 5D4QA 4HLZG 4JPIA 4HUKB 2B1HH 4UINH 1KIPB 2BVYA 2W92A 1N6UA 4XNXH 1ROWA 4JO3H 2Q7YB 3HFMH 4YE4L