5IBTH

Uca fab (unbound) from 6515 lineage
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
225
structure length
218
Chain Sequence
EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDTRYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARVVADREGFGYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords UCA Heavy Chain
publication title Influenza immunization elicits antibodies specific for an egg-adapted vaccine strain.
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 218
sequence length 225
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ibtH01
2FZ3A 1KTRL 3FHAA 4RMWA 2FR4A 4ZSOE 3FT2A 3B2UD 4MAYD 5GGUB 2ZG2A 3SBWC 3WO3B 4HPYL 5J11B 3MCKA 1PX4A 5I8KL 3O8XD 3ZMRA 3Q3GA 5E6ID 2BRRH 1JNNH 3EIFA 1PEWA 4M5ZH 3L3DB 4MD0B 5KVEL 5JHDA 3PQYA 1XMWA 2R9HC 4M1GH 2UZXB 1S5HA 3HPJA 3F7VA 5F72S 2YRZA 1T2QL 1QRNA 3MLVH 3RRQA 5D2LF 1MJ8H 1U92B 4LSTH 3LQMA 2RQ8A 5E99L 4OZIF 3CCHA 3GSXA 2VAAA 3FTGB 1KB5A 2PXYB 1MEXH 4NJ9H 3U0TB 5L88L 3BD4A 3FN3A 5J7CC 1J88A 4ZXBB 2JCCA 2VOTA 1LDSA 5BV7C 1OSZB 4IOSD 2R0WH 5IVZA 5KVDH 3CX2A 3KVQA 5HGGS 1KG0B 4NQEB 2XY2A 3O3BA 3O8XA 4I1NB 1VGEH 1SMOA 2X4QB 2GJZB 3OWEA 4TUOA 3UTQA 1TJHL 4PBWD 4HGWB 5DD5H 4JHAH 4ZO9A 3WJLC 4RDQG 4H20H 4ZUVA 2Z4QA 5F71A 4X7TB 3OKNB 3QIWB 1QSZA 4LCUB 1FZOA 2V9RA 3P9LB 3CVHA 3VFVB 3TA3B 4E9LA 3FT4A 3V95A 1J0IA 2R0LL 3S88H 4KRPB 2P5EB 1EUTA 4FQ1H 4I18C 3AU1B 1ZT1B 3DSFH 1N5AB 1VADB 3TZVA 4Z95H 5HD8D 1U36A 3K2MC 1KJVA 2VLJD 4GKSB 4N0CC 1HHJB 3TO2A 4CGTA 5JQ6L 4PGEB 4NRXB 5CGTA 1HQRB 1QVOB 3O6ML 2P8MA 2G9HB 4OI8A 2NY6C 3EZJB 2DWEA 1S3KH 2WZPD 3UTPE 2J1KA 3SDCC 3QZWG 4HUUB 3UTTB 3FQNA 1R6VA 5IVXE 3MV8E 4I2XB 3AMLA 3LKPA 2I9LA 5DEZA 4ZD3L 4JN1L 3LRSA 1T1ZA 3KPLA 2X10A 3IT8D 4JFEE 3D0VA 4ZOAA 2CGRL 5CJOH 4R4FH 1FH5L 2YMXL 3PV6B 5JXAH 4FZEH 3VMOA 4OCRL 4MNQA 1KYOK 3MGTB 4LKXA 2A2QT 1U8PA 2M1KA 1CBVH 4PY8J 1ZHKA 4UTAH 4XMPH 1DVFD 1WBXA 2UZYB 3QHZH 4LARL 2VDML 4HKBA 1D5BB 4HXAL 4FQXB 4HLZH 3TYGH 4ZNEA 1TZHA 4M48L 2H1PH 1SEQL 1M1SA 4WFFD 4ZDHA 4RGMC 4RFEB 3IDJA 1ZWIB 5ELIA 3C5SB 1QZ1A 4GW4A 4ZS6C 3CSBA 4OLXH 4GS7C 3MRFA 1U2HA 1OY3B 4JGUA 1KFAH 3MJ6A 1RZKC 4KUCD 4ODHL 5FYJE 4CVZA 1PKQA 3L7EB 4F7CA 1TENA 1K9TA 1UXWA 5GJTL 2UVFA 5DZOA 4OLYH 3ZT7A 5GRUH 1VEOA 1DBBL 4PJ8C 4EN3B 4LLQB 1CFTA 1VHPA 4ETQB 4N1EA 1T2JA 2YSSA 1D5IL 5JXEC 3S98A 1NGQL 2YA0A 4CKVX 4LFHG 2AJSH 5J89A 3K74B 5HY9B 5JOPE 2QL1A 2EC8A 2I27N 1ZEAL 1AGFB 3RIAF 1NC2B 4JDTL 1AR1C 3PDGA 2XNAB 1CFNA 3FFDB 2Z8RA 3ZTNL 1B4RA 3QQ9D 2AJ3B 3T3ME 3CJJA 4MS8C 2FO1A 1AJ7L 1ZHBB 2NCMA 1WBYA 1A6AA 4QHNB 5CUSH 3B5TA 4FA8A 5BZDB 2APFA 1ZLVH 3CXHJ 2NY1D 1PG7X 5F1NA 4CW1B 3IFLH 3BPCA 1KELH 5FGBC 1J8HB 1LO0H 4NO2B 4XVUC 4IRZL 3SPVA 5I0DA 3CXDH 4OFKA 1FN4A 1TVHA 4Y4HB 5DRZA 2LU4A 4KI5F 2DIJA 2R1WA 1U8QB 1Z9LA 2V2XA 4YHNB 3SCMB 2KUTA 5HVHB 4NGHH 1BBDH 5F9OL 3DX9A 5E1AB 4JM2B 3V4UH 1Q9OA 3I6GA 4N5ED 1RJCA 3ARTA 1INDL 2FGZA 1CFSA 3KLHD 1MAKA 5DO2D 5H37H 5J4MA 1JYVA 4QRRB 3EDFA 4MQXC 1EK3A 3GJFA 3JBG7 1JGUH 4C56D 4QRQA 2EC9U 2AEWA 5IWLC 4ZNCD 3ZTJH 1FFRA 2MMXA 1VDGA 3CSYB 3V0WL 4PLJD 5ID0A 5DWUL 1I3VA 3X3FH 3HR6A 4ODBD 2YD9A 4I0PC 3OX8A 5MENA 2NY3C 4JPVH 5FYLL 5EC1A 3JSSA 2EH8H 4UT6L 3QZWB 1EBPA 3OAZH 3BE1H 4NO5A 4XVJL 5EBLB 3O3UN 3WNOA 5FK9A 4PTTB 5ILTL 2Z92B 4HEPG 4LIQE 5L2KE 2NX5B 1FO0A 3C9NA 3VWKC 3T2NH 2HKHH 5FGCB 1R0AL 1TJGH 4GFTB 5H94B 5B8CB 4OZIE 2LQRA 5KS9F 4KKNA 3RGVC 5BW7A 5AYQA 3RZCB 4HKZB 2AK4E 2W9EL 3MLUL 3VXME 4P2QA 4YWGL 4AG4L 1A7QL 4LK4A 3ULUF 2EO9A 5I1IH 3OR7A 2X70A 4F57L 1G6RL 1LEKB 1U6AL 4PG9B 3JTTA 1CFQA 3MSPA 1GPOL 4PRHA 3GSUB 3I3BA 4XCNA 1N64H 2V9QA 4NOBA 1K8DB 4PUBH 4D94A 4FQJL 4JZJC 4FTVD 3C2AH 5E4IA 1YPZA 1QFWL 3V6BR 3V6FA 3NABL 1UM6H 4ORGA 5D1XD 3DMMA 5EO1B 2IJ0C 3WUWG 3P73A 3UBXA 3KYMA 3AB0C 1BIIA 5EO9A 4GXUM 2EE3A 2X4NB 4AENA 1PY9A 3U30B 5DD6B 5E9DA 4ENEC 4LRNL 1LDPL 1UFUA 2IAND 3VI4F 1QSED 1GZPB 2PW2B 1JCKA 5GRVK 3O4OC 4YDKL 4JKLA 3GMPB 3BGMB 5C0DB 5T1LB 4H8WC 4HDIB 2DLFH 2JELH 1U3HD 3QWOA 5GS0C 4KKLC 3GMOA 5LGKA 3N1QC 4TNVF 1QR4A 4IHOB 4F9PA 5ACLA 2VSDA 3QUZA 3REWA 4HPYH 2LTQB 1JF5A 4RAUB 4WHTB 3QUML 5KVEH 3WDJA 1Y18A 2I25N 1QYGL 4F58L 2ERJC 3ARGB 3IJYA 2HTKD 1HHKA 2R0KH 3BGAA 1GGBL 1FNSH 4NHUB 2ZOKA 5EU6D 4ZUWA 4PJAF 4DUVA 1AGDA 1RI8A 5E99H 3O3EB 5DSCA 1QNZL 1GZQB 2GKIA 3G5XA 3WFHA 1NCBL 4OIIH 4JPWL 5ICYB 4JFQB 2BVTA 1VEMA 1FNFA 5L88H 4M4PA 1OPGH 1U8OA 4XRCB 3UJJH 1BVLB 3CDGA 4QNPF 3RWIA 3GSRA 5TQ2L 4ZTPH 2PO6D 3LZFL 1SBSL 4XPFL 1N5YL 4HK0A 4H26B 4YAQA 4Q9CA 3MV11 1TJHH 2QQLL 5HYJE 2RHEA 5IT2H 3G6DL 3VMNA 1ZGLP 15C8L 3FB6A 3E2HC 4XPAH 1D5ZA 1BD2A 3C8HA 3S4SG 4IOFD 3BXNB 3TBYB 1SY6L 1D9KB 3OJDA 3WIHH 1JHTB 5I16B 5DHYB 4JHWL 5B21A 5CD3A 3QIUD 3X13A 3JV5A 1FFPA 5C0JA 1MCCA 2AS5M 1XGRA 4HH9B 4JZOA 1T3FA 5C0BE 5DMGC 2BK8A 1CU4H 1QHOA 4HCRH 3H0TA 3CD4A 5ETUA 3ARDB 2W0LA 5K9JL 4M7JH 2DAVA 5E2VL 1S7XA 3RDTD 2PO6A 5FDYA 3O6MH 2IQ9L 3S3SA 5FB8B 1F13A 2YK1L 2VITB 3CDYA 2R69L 5E70A 2VZOA 3WJJC 3RWFA 4KVCL 1G0DA 5KSUA 3BP5B 4C59B 4WEMB 1S7TB 3PHSA 3O0RH 4P2OC 3VFGH 4ZD3H 3FB5A 2AXJA 3NIGF 3CFKB 1R5VB 4QHMB 3MJ9L 2X9XA 3E6HA 4U6VH 3D85A 2ILLA 3BN9C 3ZKXB 1AGEA 2CGRH 1LNUA 4O4YL 1K5NA 4QY8A 4Q0XL 1NCAH 3FRUA 1FH5H 5INDB 3GSOA 2BXYA 2X41A 5DQDL 3LSOB 1FYTD 1DFBH 5EUKA 3S37L 3TJHD 2VC2H 2G75B 4KI5E 4NQCA 3NCEB 3BW9B 3JV0A 3KPMA 5FIEA 1JK8B 1AE6H 3SY0A 2OZ4L 1NC4B 1MCEA 3P4MA 1P53A 4H1LH 3RL2B 3CFJA 3I02A 3SBWA 4M1DL 4D0BA 2QADC 3HG1D 4BSVA 2HTLD 3VRIA 1JNHB 1JTOA 4LARH 4F8TA 1CLZL 1FRGH 2W1NA 1DBKL 1FYHB 2P44B 4HWBL 3WUWB 3L1OH 5F96H 3M45A 4O00A 3IXAB 2N7BA 2EZ0C 4PY8I 3KYKL 5TDPA 1AD0B 2YBRB 3H42L 4HWUA 4L4VA 2J5LB 5FFLA 3LQZA 3CLEH 3QQ4B 4ONGL 4PJEB 1A7OL 4UTBH 3NH7L 1K4CA 4DFIA 4J4PC 4L8CA 5F8RC 5GS0H 1FDLL 1WAAA 3PV7A 4HHAA 1I75A 1WIOA 1MJ7L 4TNWK 5D9SA 2VH5L 3TBVA 5DS8A 5GJTH 2BVOB 3W0WB 3BZEA 2P24A 3D3VE 5DQJA 4BM7A 3MRKA 1WC7A 4WW2C 4BH7B 3D48R 3A6CL 4M9PA 1OP3H 3QULB 4KJQC 3PHQA 1MI5E 1MF2H 3EHBD 2GITB 5KS9E 4NDMB 3W9DB 1T1XA 4KK5C 4DZBB 4LF3B 1RZ7L 5JIIA 3KPSD 3C6SB 5EZLA 3PP3K 1BBJA 1ZEAH 3K4AA 3RBGA 3JV6A 3DUUB 1HK6A 3BPNC 3IXTB 4U1NB 1IZKA 1EV2E 3IDMA 4JDTH 3VG0H 3ULUE 5CHNA 2RFXA 1J9CT 1FLRL 3ZTNH 4YHLL 4I18A 2LFGA 1NGPL 3STBA 4M62H 2AJVL 2R2BB 3OKKB 4CMMB 3REVB 5DK0A 1FCGA 5ID1A 5IEKB 3RJDA 1C5BL 4JVWA 4AEEA 2I60L 5SWQB 2F53E 3NAAH 2VUOA 2IMMA 3LS4H 5C09A 4DN3L 1FFNA 1MUJB 3KS0J 1D5MB 4ONOA 5FGSA 4IRZH 2X1WL 2X5PA 1NKRA 3K4DA 4M7ZC 1QO3A 4FQQB 3KS0H 2QKIB 4ZUSA 1G7MB 1R3LB 3EYFB 5IHUL 3U9PL 3S4SB 1TETL 1LGVA 4FOMA 4CN6A 1KOAA 5IB5A 3BZDA 4OFPA 2V2TB 4HIHB 5DJ0B 3MRGB 3W9EA 1INDH 3MYZA 2F58H 1IL1A 2FHFA 1MIEH 3MROA 2CJUH 3N1GC 5JUEL 1UJ3B 3WFDL 4OV5B 3NPSB 3FOLA 4GBXC 5HHPA 35C8H 4B7LA 1BFTA 1SEBA 4M02A 1LP9A 1CDIA 2BVQA 2ORBL 5D7JC 4LVOC 5C6PB 3BP4B 4WNQB 2ED9A 4JRXE 4ONHB 4HWEL 1FFQA 3CK0H 4M4RA 5C0FA 5FYLH 3DRQA 4UNVA 2XWJB 3DYPA 2HT4C 4XHQA 1KACB 3C08L 4K8RL 3QUYB 4P5TC 3EFFA 4CMHC 2BNQB 1S9YB 3MX0A 3P0VH 3RVTC 2VRAA 4Y2DB 4KK9C 5IIEB 4N0UE 4P23C 2DRUA 4YR6A 1YMMB 5CKGA 1TIUA 1A2YB 5F70A 2UZIL 2WIMA 2JJVA 2DD8L 4X9BA 4U3HA 3OB0K 2W9EH 4KKBC 1ZGLA 4QCIB 1JPFA 3WLWD 3QIBB 3GBMH 4YWGH 3S96A 3O2VH 3OG6B 3IAPA 4J3VA 1CD1A 1H15B 1BOYA 2VXQL 4FXKB 1U93B 1OM3L 3RHWK 3WS3A 4AG4H 3B9VA 3QEUA 3RZWA 2GUOB 5MP6L 1QR1A 1IKFL 2LU3A 5LJYH 1QACA 3NCFB 1DBML 4JFDA 4PJ8A 4AT6B 4Q97A 3O4LB 3VXNA 5BMFH 2P8LB 1VA9A 2XACC 2BOBA 4ZUUB 5JXEA 1J8HE 4R90L 4FQJH 2FL5A 3CU7A 5D2NA 4EVNA 3O9WB 4QRSA 3TBWA 5CINH 1DTUA 1MH5B 5HGBA 4LP4A 1JF1B 2IH3B 2GAZB 3P4LA 3MACL 1CFBA 5JW4N 2F5AH 1T89C 2EDEA 4U1IA 1FFOA 1L0XA 1IQWL 5KAQG 2X1XR 4JKPL 1KPVB 3QDJE 4PRAB 5J3HC 5C07E 3T2QA 2Y07L 2AXFA 4LRNH 1C5DB 3TESA 4PJGF 3PXHA 4XB8A 2AJZB 2X2YA 1MSPA 4QRRE 4Z7UF 5TPWL 2W92A 4P48A 3K7UA 1H5BB 4RWYL 4JHBA 4YDKH 1XGQB 5AD0A 1RZ8A 1JPTH 3GRWL 3WS6C 1SVCP 2ITDB 5EB9A 2LABA 5HXMA 1Z0NA 5I6XB 2VWEE 1L9MA 2NY0C 4QHLA 4L8DA 4KU1A 4M8QA 3K2UH 4NFCA 4PRBA 2HKFL 3HMXA 4RFNB 4EI5D 2VXSH 4J2XA 3QUMH 5TFSH 4JFFE 5ESQB 4YNYA 1QYGH 1RUAL 1NGWA 3KPRB 4KTDH 1FVCB 2C1OA 4YIQB 3NACL 4GAYB 2XV6B 4QWWC 2D31B 3C6LB 4JY5L 5EU4A 2HT2C 2FIRT 3O3AB 4G5ZL 4PGBB 5B39G 4G8EB 1AXSA 4XXCC 3T77A 5AYUH 2AW2A 5CEXA 2OTPA 3FOMA 2Y5EA 2ZSVA 1UZ8A 4JJ5A 1P7KB 2IAMD 5FUOH 3WIHA 2BERA 4WU5B 3SDDB 3W5MA 4I0PA 4LDLB 2Q87A 2A6KA 3UPAA 4L4TB 2A9MH 1IEAB 3DROA 5TQ2H 5KVMC 1XEDA 5LGJB 2Q86A 3LZFH 3VMPA 3PDOB 4HCRA 1I8MA 3QFJA 1AHWC 1UM4H 4EI5A 2NW3B 3OKLB 3VWKA 1HXYB 1QFPA 3FFCD 4HS6B 2QQLH 2HH0H 1A3LL 1UC6A 2J6EL 3I3DA 4RIRB 4XXDA 3IF1B 3RGVA 1A9BA 4AM0B 5DMJB 2QBWA 2O5YL 2HA1A 1N4XH 4L8SB 3FAXA 4JHWH 4WV1C 5DHVH 1T66C 4QOKA 3DUHA 3MRJB 4OGZA 5BCAA 2ZCKH 3WSQH 1U9KA 3IDYB 5JNYB 4G9FB 5BRZE 3SJVB 5CJXC 5K9JH 1QSFA 2D7TL 4RA3A 5IESL 5IFAH 1KGCD 3EDEA 4IRSC 3UTSA 1WZLA 2B5IB 3QDGB 3SGDH 1N6QL 4KRLB 2X4RB 4DCQA 1FG9C 3HE6D 1II4E 2AQ3A 3GIZH 3QDAA 3RY6C 2JK5B 5J11C 3MMEB 2R69H 3FFCA 5CEYB 1XZ0A 4LGPB 1QD0A 2DM3A 4PRNA 1P9MC 3OKYA 4NM8H 4JG0L 4WDIB 1VKXA 1FCCA 4H1LA 4JFXB 1NAKH 3A6BH 2YHGA 4NC1E 4PJBA 5HVFB 2XQYG 2XYCA 1IGCL 1HYSD 2X9YA 1I7ZA 1CFVH 2HN7B 3MJ9H 1QUNA 4R2GB 1C08B 5IW3A 3PUCA 1MY5A 5C86A 3MZGB 1BFVL 3MA7A 4NQDB 1P2CB 3LY6A 3VFOB 5E94A 3EJZC 3DBXB 2PXYC 4H5SB 4LLWB 1BVKA 4OD3L 3CSGA 1P7QA 2C1PA 3MLWL 5F9WB 2Z9TA 2EEAA 4RNRB 4ZXBC 1IGJB 4OSUH 3HZYB 3VH8G 3BEVB 4UNTA 2OZ4H 1F8TL 5BV7L 2R1YB 3AREB 1TZGL 2Z31D 4TUJB 5FUZL 1YEHH 2H2PD 3BEWA 2Z35B 1IBGH 5ESVA 1G7QB 4YPGA 4WO4B 4HWBH 4PRDA 1IILE 3GKZA 3N50A 4MJ6A 1YN6A 3SDXA 1MQKL 3CFBB 2ZUQB 3GSQA 3KYKH 3TA3C 43C9B 2V5TA 2MKWA 2FEDD 4ZAKD 3HNTL 4KRPC 5IMOB 2KZWA 1OW0C 4HZLA 1A7OH 4OIAA 4OB5H 2EDNA 1FDLH 3D39B 1WFTA 1X5HA 3S36H 4LGSB 4LLDB 1MJ7H 1N2RB 2NMSA 5SWZB 4LLUB 3V5HA 3MCLL 4RAVA 5EBWA 1WGOA 3BVNB 3KPOB 3CU1A 1NQBA 5BZWA 4X98A 3B9DA 2AQ2A 4XZUB 5EIVA 2VZVA 4IMLB 3A6CH 3I6KB 5C0RH 1D6VL 4XCYA 3VWJD 5I1AB 1RJLA 3PWPA 3FAWA 1TZIA 5E00A 4HJ0D 2ZNWA 4FFZH 2HFFA 4N8VB 1TITA 2Y23A 1YN7B 2J4WH 2IADA 1WCBA 5FYLD 3MRHA 4RMUA 4X4YB 5LGHH 5C0EA 4XWGL 4ZAKA 5B39B 5JO5A 1MFAH 3SGEH 3LPWA 1FZKA 5DA0B 1BPVA 3MFGB 5EWIL 2BSSA 3RIAK 1G9EA 1T1WB 5CCKH 1OAXL 3VXOA 5E8OB 1T1YA 5DURB 5EUOB 5HDQL 3RVUD 4U05A 1HXMB 3EYQD 2HLAA 2BY0A 4PJ5E 1IM9D 3L7FA 1OARL 5ITFA 4V1DD 3VXUE 1L7TL 4NQXA 1NCWL 4HMEA 4WI3A 3T2OA 5FUCC 3ZHDA 1EGJH 2VLKE 3WJJA 1N8ZB 3O2DL 2HT3D 2FJFA 4Z7VB 1EO8L 4FQXC 3ZKQD 3C60D 1Q9KB 1N3NA 4P2OA 1FPTH 2CPCA 3MNVB 4Y1AA 5ADPL 4PJGE 4U2YA 5D5MB 1XF1A 5BS0D 2VIRA 4MX7A 3O11A 1RUQH 3ARPA 4K9EC 2DQFA 4KZEH 5JUEH 3F5WB 4Y0GA 3VFTA 3RUGE 3F62A 2A0LC 1NUNB 3AY4C 3R06A 1W72B 3QXVA 4YQXH 5HPMB 4G8GA 1RZKL 3SQBA 4PJEE 3L3KA 4BFGA 5IQ7H 5D6CB 1JFQL 1AO7A 2K7PA 4GSDL 1CE6B 2CDEA 2BC4A 3RPIA 3FQXB 4NKIL 3W11D 3CIQA 1A6ZB 3LS5H 4EN3C 1WBZB 4X6DB 3UPCA 4FQ2L 1JN6A 5I8OL 2IALB 2AKRB 3C08H 3QNXB 4X7EC 3OPZL 4X6FA 2GTWA 3NTCH 1EJOL 1F6AA 4X7CC 2DQUL 3SDAB 3RIFF 4OGAD 1C7TA 1B90A 4TSAL 5EU7E 4MQ7A 5B3NA 1A6TB 3GBNL 4IIQB 4GRMA 1OAYH 1ZVSA 1T7XA 3HNSL 1QBMH 4WEUD 5DEFB 4APQD 1MNUL 1Z9SA 4J4PA 4R0LA 1WSST 4PJCA 4XNUL 1G7IA 4G8IB 3TFKD 2BOCB 2DICA 2VXQH 1OM3H 4GQ9H 3VH8B 3QEQA 5DD3H 5MP6H 2IGFH 1ITBB 4OZHA 2H26A 1ZTXH 4X6BB 3WKMH 3HI6H 4OCWH 4WW2A 4RRPG 4K3EH 3HZVB 1JGLL 3KJ6H 2ARJQ 3MLXH 1UADC 4S0TD 1FAKT 1XGUB 4CADB 5A3IC 5MEPB 5FV2A 1ZSDB 4R90H 3SCMC 3IKCA 4MVBD 2G5BA 1A1MB 3Q0HA 1BWMA 3O6FC 4JM2C 4Y2OA 5T3ZL 1JMZA 1XF5B 1KPUA 2R1XB 3G08A 4S1QL 4OCLC 4PLKD 2CUIA 4A2LA 1QFWI 1MRFH 3OKEA 5LBSL 5JMOC 4GG6E 2N7AA 4ELKB 4LLMB 4WUUD 3DO7A 1NLDL 3T0EE 1MJUL 4RMSA 1RIVL 4WI6A 5ERWA 3GZKA 3CFDA 3JV4B 1O5DT 3UZVB 2EYRB 2FYYA 3EO0B 1J86A 3V5DA 3GRWH 2A6IA 3BH9B 5F7FA 5H2BA 4AQ1B 5ESAA 4JQIL 3LN4B 1UWXK 1OWRM 3IDGB 4BJLA 5J0BA 3LQAL 4JREB 1U8KB 3SE3C 2HKFH 1V3KA 1QLRA 3MRNA 4D9QD 1UWGH 5TDNA 2BNRA 2PF6A 1KNOA 4TNVK 4P9HL 1SVZA 4LCIH 1QPPA 1M71B 2PTUA 2RB8A 5DR5L 2K7QA 1UKTA 4JY5H 2OJEB 3NFPB 3H7LA 3FQUB 3QDMB 3G5ZB 3RX8A 5FA3B 1KB9K 5D7JA 4C55A 1N7MH 1PW3A 4HXBL 1PZ5A 5CLTA 1A1NB 3ULVL 5B4MC 2UWEB 3U6RA 2GTZB 4L5FL 4S2SB 4O58H 1JYNA 3H7BA 5DHVA 3PL6D 1I7TA 2BJML 2GI7A 4GUPB 3T4AA 5HYSA 4XMLL 4PRPA 1ZVYA 4Q6IB 3T1FA 4P5TA 3IGAA 1X7QA 1T5XB 1LK3L 2BSRA 3KHOA 2GJ6A 3O4LE 2UY6A 4HLJA 4HFUH 4JO2H 4UT7L 3RTQB 3L3GA 5TDOB 4MCZB 5TF1L 5GGVL 4OLVH 1XGPB 1SJHB 2J6EH 5TF0A 1CF8L 4JR9H 4WY7H 2XQBL 1K8IB 2MQCA 3MR9B 2O5YH 1FL5B 3FHQA 2F54A 2JJSA 5JPNB 5J6GA 1CGSL 4HF5H 3UPRA 1B9ZA 3U30C 5FKPB 4WU7B 1L4IA 2MHAB 2R2HA 4XNYH 1UM5L 4KZDL 2AI0L 3I9GL 2PYEE 4XH2A 4HIJA 4ELMA 1GAFL 1WTGT 2EYSB 3H9ZA 1KYOJ 2D7TH 3PL6A 5IESH 5C08E 4H8WL 4P4KB 5GIRB 1RD6A 3PWVB 3P30H 3GMLB 3HAEH 2LTQC 1BM3L 2AQ1A 3SGDI 2I9TA 1RHHA 2ENYA 3GSVB 3L5XH 5DGQA 3X3GH 3BZ4B 4JG0H 3QG6A 1T0MA 2XI9A 3TEUA 1EAPB 4WUKL 1ZKAA 3ARGC 5HHMB 1T89A 2ADGB 1NL0L 1IGCH 4GMSL 4P4RB 1QOKA 3QUXB 4D0DB 4AEIH 1BFVH 1MWAL 3PWUB 1R3IL 2KDGA 3ZYIA 1A5FH 4YFEA 4XBPB 1U3YA 4HKXB 2IC2A 1ND0B 4UDTA 3WS6A 5D4QA 4HJGB 1CXFA 4XI5D 3SN6N 5AAWA 1GGUA 4OM0L 3B4NA 4E5XA 1X6NA 2FBJL 4QXGH 5CJQH 4PJFB 5HHQB 1DLFH 1TZGH 5F1IB 5JHLL 2HRLA 8CGTA 4OUUA 4Z0XA 3AS3A 1BF8A 1EDQA 3H9SE 2OSLB 3S9DB 1M7XA 3TBSB 5IV2B 1HSAA 3JUYA 1MQKH 5D7LD 3HC0B 5L6YL 5D70H 1ROWA 1D9KC 3RAJL 3ZKSD 3UAJC 4XXCA 1N59A 5I1CH 3RX5A 4I3SL 4U1SB 3Q1SL 4ZOCA 4JO4H 5EA0H 2ICEB 2GSIA 5DJAB 1OGAE 3U46B 4P2RD 4JFYA 3DNKA 3MO1A 3MCLH 2NQCA 4GRLB 4XVTH 2FZ3B 2FR4B 5EZIL 4WGVB 3SJVE 1BAFH 3WNMA 4JQVC 1AHWA 1T83C 3BPLC 2Z0BA 3MCKB 4PB9L 5DJCA 3Q3GB 4CVWA 5JHDB 3PQYB 1OAQH 4OCYL 1Y0LA 1CTNA 3I6LE 1S5HB 3HPJB 4PJIF 4Q7DA 1JJUA 1QRNB 1RPQA 4JN2A 1EGJA 3BKCL 1K2DA 3G6AA 4K3JL 3S7GA 5DMKA 4K8RD 4PP2B 5HHXL 3UYRH 5I74C 3ZKXC 4WV1A 5C0CD 3CH1B 3NCYP 2VAAB 3GIVA 3QHFL 1KB5B 3STLA 3DARA 5DHXB 5JZ7D 4P2RA 5CJXA 3L3OB 5F3HB 1SBBA 1KIQB 4NO0A 4MAYB 5IVZB 1RUKL 4LCWD 3HLAA 3ARSA 5GGUA 1I8KB 1RK0A 2C9AA 1W0WA 3RY6A 1NCWH 2OXGA 5I76A 2CRMA 3FKUS 3O8XB 3O3BB 4XAKD 5E6IB 4EZMA 3I75B 1P9MA 3GB7B 4TUOB 4MD0A 5DJDB 2Z4QB 4M61A 2GT9B 1BQLL 1FZOB 1M7IB 1URLA 5B3JF 1U92A 3OGCA 2Z91A 2J5LC 4F7PA 3MBED 5TQ0H 3HHRB 4XPBL 2H32B 1DQDL 1WZMA 1B4JH 1PKOA 2YN3A 4MYWB 5FYJL 5FM4A 1BQSA 2V5MA 2PXYA 3U0TA 4HS8H 1KLUB 5JA9A 3UCRA 2OS7A 1CN4A 3QEHA 5DJZB 3CVIH 3TO2B 2DQDL 5IMMA 1RJZA 1OSZA 1VFOA 5D7KE 5ISZE 7FABL 4N8CL 4J7RA 3P0YH 2CUHA 1KG0A 4FQ2H 2DWEB 1MRDH 2GJZA 2EE2A 4HGWA 3PWJB 3FQNB 32C2A 2HFGH 1C1EH 4X7TA 1UT9A 4XP9L 2DQUH 4N90D 2I9LB 3QCTL 2GSGA 3VD3A 3KPLB 2E9BA 3WXWL 3D0VB 3GBNH 1ADQL 3MUHL 4K94C 2P5EA 4Y5YB 1OW0A 1MNUH 1I9JH 3AU1A 3IDXH 1RUPL 3V2AR 4HMDA 2GQHA 5FO9A 5HJ3B 4JM4L 4NOFA 4MJIE 5IHZA 1KTKE 2BY3A 2ZCLH 4R3SA 5JR1L 1MAJA 3MV7E 3OKMB 4KMTH 4OLWH 5KZCD 3D1MC 2DMBA 2VLJB 3JVGC 4LKXB 4UDUB 1AI1L 4PJXA 5C2BL 1HQRA 2NY5C 3NA9H 4YGVA 1QVOA 1HHHA 5EUOE 2EDTA 1JRHL 4X7SL 2LAGB 1ZHKB 5BOZG 2G9HA 1I8IA 2NY2D 4LSRL 4RX4A 1JGLH 5AAMA 4Q58C 5T3XE 4JKKA 1WBXB 1FNAA 3GHEL 4HKBB 3UTTA 4HUUA 1AGCB 2JB6B 2VB5A 1MQ8A 1CIUA 4ZDHB 5L8KB 5T3ZH 3H3PL 4Q9QH 3HRZA 4S1QH 1S9VA 1CXHA 4WTZA 4YX2L 1S7VB 2AK1H 3NPSC 1FNEB 3UBXG 4U1LB 5D5ME 1MCHA 1NUDA 2YC1A 1UACH 4FQCH 4QXUL 4QRUB 4NZRL 2YKLL 1I9RL 4NWTH 3AS2A 3D9AL 5DT1H 3V0VA 3MGTA 4CVZB 4PD4K 5C0AE 1RIVH 3SOBH 1BECA 4M7LT 2OL3L 3WXVH 4C58B 2O61B 1UXWB 1A64A 3GHBL 5EBMA 5F3BA 5SWSE 3VRLF 3MV9A 3G9AB 1NCNA 1CFTB 1Q8MA 4JQIH 4LIQL 1HINL 4TOYL 4WENB 2YSSB 4PPTA 3QUYC 4XHJD 3LQAH 2DJSA 3MLTB 4FQXA 3GEWB 3IU3B 4Y2DC 4F15B 4X6DE 4OAWA 4X6CF 5KVFL 5DD1H 4RFEA 5HGAA 2WV3A 4P9HH 5F1OB 4QYOB 1VENA 5L7XH 2ZG1A 3OKOA 5DR5H 5CP3A 1LO5A 2VLMD 3QQ3B 4PJ9D 3U0PB 2VXVL 4HXBH 3VFSA 3L7EA 4OQTL 3ULVH 3RNKA 4PJDF 3IJHB 3BPCB 3QCUL 4EN3A 4LLQA 1YA5A 3P2TA 1MAML 3IRPX 4LSSH 2HJLA 1FN4B 1TVHB 2BJMH 4XMLH 3MUGA 2R1WB 3ZKNC 2PW1A 4Z8FL 1LK3H 4G7YL 2IQAA 3K0WA 3JWDC 3O9WC 3DX9B 5HY9A 4UT7H 3LD8C 4D9RE 2RR3A 2ZG3A 3P0GB 2JCCF 2D9CA 1Q9OB 4G6ML 1NC2A 1HWGB 1IC7H 4O02H 1CF8H 2VKWA 4K3DH 2XQBH 3FFDA 3HAEA 2AJ3A 4OT1L 1FP5A 3KLAA 2AJYL 1ZHBA 1X9QA 4YBQC 4QHNA 1KC5L 4QRQB 5FYJU 5E6ZA 1UCBH 2WNGA 4P5KA 5ID0B 4OD1H 1H5BC 1F6FB 2QSQA 2NY1B 1ZMYA 1GAFH 4Z7OE 4NO2A 3LKOB 3OX8B 5I6XC 4LPTA 4I9WD 5EC1B 1IGML 2FGWH 5C0GB 1U8QA 4NO5B 3N85L 3FONA 4PJIE 3SCMA 4J6RH 5FK9B 3TM6A 2W9DL 1BM3H 1CGYA 5E1AA 1ULVA 5E03A 3O6FA 4TUKH 5AUMA 5BVPL 3IVKB 3GGWA 3M8OL 1FZMA 1MCSA 1AXIB 4WUKH 4GRWF 2P7TA 3C6LC 2NY5H 4XC3H 1I1FA 4EDWH 4C56B 4P2QB 1MWAH 3ES6A 4DEPB 3ARFD 5FYKE 4XP4L 3OR7B 2X70B 1OT2A 1JPGB 3DXAD 3JTTB 3F7YB 3KXFD 1CFQB 2CDFA 3SDDC 1DE4B 4KV5F 2X09A 3F12B 4Z18A 4JFOA 3CDFA 3NFSL 4OM0H 3ZE0E 3TC9A 5GHWL 4XCNB 4F3FA 3C5ZD 1DLHB 5FEBA 4ZFOA 2ITCB 5JHLH 1WF5A 3ET9F 2Z92A 1NGXA 4ZS7H 5B3JE 2CKBB 4XWOD 1NMAL 2A6DA 1OTTC 4P9MH 4UBDD 3MFFA 1G9NC 4ORGB 1FZJA 1UXSB 2FHCA 3DMMB 5HI4C 3U36A 4OZGA 2FHBA 2X4SB 4OI9A 1SMAA 4YH6A 3UBXB 2OK0H 3RWGA 2K1MA 4HBCH 5EO9B 5DMIL 5DA4A 4EEEA 4YEEA 4QRPA 4MA7H 5E9DB 5I1LB 3ARFA 5F7YC 4PRID 3PP3H 1IFHL 4HIXL 3V6OC 4M7KH 1E0OB 3QXAA 1LEKA 4PG9A 4NHCH 1X5ZA 4W6YB 4LMQE 1PAMA 2R56H 1LO4H 3LPFA 2B5IC 3C5ZA 3QCVH 3WIFA 5EZIH 5FO8B 1MIML 4MWFB 5E2UL 1K8DA 3G6JB 2VLRD 4LHQB 3BAEL 3NIFF 3ISWA 4U1JA 4F7TA 4FTVB 4YHML 1NCCL 1TTFA 5D1XB 1MREH 3ZE1F 4OCYH 3ARBD 3TVMC 2WBWB 3D69B 3IJYB 2DBLH 5CSBA 1I4FB 1NDGA 4X80L 4ZUWB 4R2GC 2FX9L 5HHOD 4G80A 3QBTB 1F42A 5JORB 4PRIA 2PW2A 3G5XB 3WFHB 1E4JA 3QHFH 1R3JA 3DO3A 1U8OB 1T7WA 2EDHA 3GMPA 3JWDH 3E0GA 3BGMA 2ICWJ 5E95B 3O45B 5EORH 4HDIA 1UQSB 3P11L 3UZEA 3U2SB 2YD6A 1UA6L 3AREC 5I30H 4IHOA 1JGDB 1MCWW 1CIDA 3ILPB 4HK0B 4JDVB 3ZTJG 3UJIL 4YAQB 3ARBA 2VQ1A 4GAJL 1D5ZB 2VQUA 2FD6L 1YNLL 4PJHF 2ZUQC 1XH3A 2R39A 1ZLWH 5EU6B 4NBYB 2DL2A 3SQOL 3OJDB 2E27H 2GK2A 4XPBH 1DQDH 4XP5L 3O3EA 3ZT5A 5FYJH 3VRLE 1FFPB 5ICYA 4JFQA 1XGRB 4JZOB 1OLLA 4OCXH 3R1GH 5T3ZD 1YEGL 3NCCB 3OG4B 5E1HB 3H0TB 2VDLH 1P4BH 2C4FU 5I19H 4XRCA 2XG4A 1BVLA 1C5CL 1S7XB 3C09C 3LCYA 3OB0H 2PO6B 3KDMB 1J12A 1PG7W 4X6CE 4PJ7F 5EU5A 1NFKA 5DJ8A 3QO1B 4OFYA 3RBSA 2EYTB 5FHBH 5FM5O 5M94B 1MHEB 4H26A 4AMKL 3N1MC 5KSUB 4MA3A 3ARZA 2YPLD 1F3RB 5D1ZD 4I4WB 2XRAH 1AIFB 1V7NL 3QCTH 4P3CH 5GGQH 3BXNA 3GUTA 4YK4B 1DDHB 2SEBB 1D9KA 3E6HB 5JHDE 3LIZH 5EFIA 1JHTA 3W2DL 1ADQH 5I16A 1AGEB 5DVLA 3RIFK 1K5NB 4QY8B 3FRUB 1E6JL 4OFVA 3WFZA 3TO4D 2DM4A 1LK2B 1T0NB 3WL9B 5EUKB 1DQLH 5JR1H 1VFAB 1S78D 3VXPA 3KPMB 3MZTA 3RDTB 1GOFA 2B1HH 2H3NA 3P4MB 3CFJB 1JRHH 2BFVH 2JCCE 2XFXA 5FB8A 4D0BB 1D5XA 1KJ3H 2VITA 4JQVA 4KK8D 2Z8VC 2F9BT 1T83A 4BSVB 4NKDA 3BO8A 4KQ3L 2UUDK 3ULVD 2WUBL 4I13B 4ODTL 3IKKA 1ZLSH 3BP5A 5D1ZA 2EDQA 4DN4H 2G60H 4YXHH 1RQ5A 1JWMB 3RFZC 1E4XH 2OMNA 5GZNC 4XNXL 4U6HB 1R5VA 1KCUH 1GVIA 3H3PH 4YHZL 4L4VB 5I1HL 5ACZB 3LQZB 4K9EL 1RJYB 1K4CB 4L8CB 3LSOA 2HAZA 1FYTB 3THMH 2P45B 4HHAB 4NZRH 1F2XK 1YNTB 1NBVL 1YPZF 2YKLH 1RMFH 4QGYA 4AH2A 2G75A 5D9SB 3TBVB 5DS8B 4LGRB 3BZEB 3GHBH 4YLQT 5HDLA 2P24B 1XR8A 5DQJB 3MRKB 5EULV 3RL2A 2RAMA 2VDPH 3UC0H 5DUPL 1CR9L 1OF2A 1G7JA 3PHQB 1KXTB 3IFPB 1PSKH 1HINH 5EC2A 2CH8A 5FM5M 1JNHA 3RWJB 3UZQA 1T1XB 4GRWE 3TGXA 5FECA 1AC0A 2VQTA 3EOBB 1QKZH 3WUWA 1CICC 2IG2H 3SDAC 5KVFH 1BBJB 3JV6B 1AD0A 5CZXD 1LQSR 2PCPB 3IDMB 4IIQC 5CHNB 2EIEA 2RFXB 1HZHH 5CSGA 4GKOA 1KEML 4BK5A 3NA4A 4LLVB 3HFMH 4KV5E 1IKNA 3WD5H 1X5LA 3HI5L 1NCUA 5SX4H 1F90H 5JIHA 1CGXA 2Q7YA 3QWQB 4CVXB 4NN5B 5IR1A 3W0WA 3K8KA 5C09B 1FFNB 4X9IA 4MNQE 1H3PH 4S11A 4YXKL 4G3YL 4M6MH 3LHPL 5DJYA 3QULA 1BVZA 1QO3B 4K07A 4ETYA 4NDMA 2E9JA 3W9DA 4DZBA 1EHLH 4LF3A 4G7YH 1J0KA 3OJVC 1GC1C 3VFRB 4H0GA 1BZ9A 1KCLA 3DUUA 3EUUA 5IB5B 2P43B 4OLZL 4JY6A 3W9EB 4DQOH 1ED3A 2C3HA 4ZNEE 2P49B 1F5WA 4H0HB 3MRRA 3MROB 4LPXA 1OAKL 3AAZA 4U6XA 2R2EB 4OT1H 3S36X 1NMBH 3IDNA 5HHPB 1QLEH 1LP9B 5IEKA 2BVQB 2AJUL 5SWQA 3NCJL 1CDUA 2O5ZL 3JVGA 3NIFE 2FJHB 1D5MA 2IBBA 3LAFA 1PKQE 5CILH 3SKMA 4X8JA 4LSVL 4XT1C 5DI8A 1AXTL 3ZE1E 3QI9D 4F80A 3QAZB 2DN7A 4HH8A 3N85H 4JREC 1G7MA 4D9LL 3EYOB 5BQ7B 2W9DH 2VUYA 4A6YH 2CLVA 4RGMB 3KR3L 3MRGA 4YR6B 2AEIT 3ORJA 3UTPD 4H1LG 4HIIB 1OP5K 4OV5A 4MXVF 3LMJL 4GS7B 3MV8D 5FV1L 5J1AB 4KTEH 3MXVH 1ZGLB 4QT5B 4OD2A 5I15H 4QTIL 4C83B 1A7PH 5LWYH 5FDWB 3S96B 1MHCA 1CD1B 3BP4A 4JFED 1XCQA 1JPST 5C0IB 4R8WL 4U6YA 2GIYA 3MA9L 4UU9A 1BREA 4ONHA 2DM7A 3V4VH 2BHZA 5DDHA 1EFQA 3VXNB 3CPLA 3VJ6A 1F97A 2DLIA 4OCNC 1NCDH 4Q6IC 4R26H 2FECL 4PJHE 4Y2DA 3ESVF 2X4PA 5DD0L 4WIQA 2B2XH 2FL5B 1WWBX 5D2NB 4EVNB 4QRSB 3RTQC 4W70A 3RL1A 3BUYA 4CBPA 1JWSB 1INEH 1YMMA 1A7BA 1OVZA 1X6LA 4QHUA 4LSUL 1A2YA 3HCVA 1FFOB 4WCYH 5C3TA 1BJMA 4MHHI 4F9LC 3PHOA 2AXFB 2AAVA 3UJTH 3QEGH 1NFIA 4XP6H 4FXKA 2CK0H 1CGVA 4HIXH 4PJ7E 5KSAD 4NKMA 3VRJA 3MLYL 5AD0B 4AT6A 4E0RA 4BSJA 2DQEL 2O93L 2P8LA 1RFDL 1U8JA 2DBJA 3OR6A 4MD5A 2H2SD 5FYJD 1L6XA 4ZUUA 4P4KC 4L8DB 2ZUTA 3PGFL 4M8QB 4ZFFB 4HGKC 1R3HA 4PRBB 1MCFA 3BAEH 5MENE 4MJ4A 3RVXD 4BQCA 5AG9A 3NFNA 2DIAA 4YHMH 3DV6A 3CFCL 3E8UH 3O9WA 2X7LB 1IGFH 4J3OC 5TE4L 5TH2A 4YNYB 3EOTL 4ISVB 4TTDC 1C8PA 4R6UA 1KPVA 2ICWA 3VGDA 4PRAA 4Y4KD 4TVPL 5JOPD 3QUXC 1OTSD 1E4WL 1C5DA 1AXSB 3T77B 4LEXH 4LDEB 2EIZA 1YQ2A 5CEXB 4JANA 1QFHA 5KSAA 2ZSVB 1UZ8B 4ZO6A 3GKWH 2E9WA 3CAFA 4KAQL 1YMHB 1XGQA 4P2QE 1GC1H 4KROC 5JPMA 4I0PB 4ORZC 3BIAX 3QO0B 2A6KB 1RIHH 2D7OA 4HJJL 5DFVD 3U7WL 2FEEL 3P11H 3T3PF 5DLMH 1UA6H 4X7FC 3MYJA 2Q86B 3LEVL 4AIXA 3RU8H 4PRHE 4EI5B 1WFNA 1YJDH 3VWKB 4W4OC 3UJIH 1FSKC 3X11B 1T20B 2VDKL 2QHLA 4LASL 1FVCA 4XXDB 4YIQA 1A9BB 3G5YA 3P4OA 4GAYA 4UIMB 4BH8A 5IB1B 5E2WH 1YPZE 1BOGA 1X3DA 3SQOH 5L8LB 3O3AA 4HPOL 4I3RL 4PGBA 4P46D 4XP5H 1GGIL 2O5XL 2F19H 3OXSB 3RWHB 3WFEL 2IAMB 5IB4A 1CG9B 4JDZA 5E9DE 1I7UA 3N1FC 4Q2ZB 1NANH 3SDDA 1WTLA 4GRLC 4L4TA 1I3RA 4XX1E 5LGJA 3BWAA 5K9QI 4NRYA 4DCQB 3BMWA 3PDOA 5D72H 3VW3H 2VMFA 2AV7A 5A16A 2NW3A 3OKLA 1A6WH 1WWAX 1V8HA 3FFCB 3S8WA 1CDBA 4AMKH 4QO1A 1YY9C 1A9EB 3ULUH 3IF1A 5DUML 3FQRA 3V4PL 3LRHA 4IRJA 5L2KD 3QWRD 1I7RA 1BP3B 3AB0B 3HR5A 3QUKA 1XIWC 3W2DH 4OLUL 4P46A 4Z7WF 2WLZA 4O2CA 3MA7B 1E6JH 5E94B 4O2EA 3MRJA 3V6OA 1OTUD 3MLZH 2LVEA 1JGVL 4G9FA 2C1PB 1ORSB 2AK4D 2I07B 3OV6A 4K2UH 3VXMD 4TVSa 1K6QL 3S35H 2HT3C 4KDTC 3SGJC 1U58A 3B2UC 4JO1L 4MAYC 3HE6B 1I9IL 1S9KC 2NXZD 2VDQH 4EBQL 3O8XC 4U2ZA 5E6IC 4JRYE 5IG7A 4KQ3H 3BEWB 4DFHA 2WUBH 1JRHI 3R0NA 4YPGB 4JFXA 3TVMA 4DAGL 1U95A 4MJ6B 1MFCL 2R4SL 1YN6B 3MOAL 3SDXB 1A6VL 5D2LA 5L2KA 3KYNA 1B0WA 1X5FA 4XNXH 5K9KA 3DX7B 1UWXH 1BGXL 3R8BB 2B0SH 1XT5A 1C08A 5IFJA 1F4XL 1BD2E 4WTWA 4OZIA 2FWOB 4NQDA 4MAUL 4HZLB 3QXUA 4H5SA 3T0BA 1NJ9A 5IF0A 5JLZB 1KB9J 3UMTA 5ANMB 1IGJA 3V5HB 1IC1A 5JOEA 1RZJL 3CFIC 3BKYH 3HZYA 4RAVB 5EBWB 5I71B 3BEVA 4DKAA 5ICZB 2R1YA 4KQ4H 3GDBA 5DVNA 2DI9A 1ZA3A 1CR9H 1FNLA 1G7QA 1OSPL 1TZIB 5E00B 2A9NH 2HFFB 4Y19A 1RVFL 2IADB 1WCBB 3EJJX 2DQTH 3MRHB 4P99A 1R5IA 1PY4A 3C8DA 4XNQB 5JO5B 4ZAKB 5IMOA 3GI9H 4Y5YC 4RGNE 1MRCL 2CLRA 2EDXA 2OTWB 4Y5VA 3VXOB 1CLOL 5HD8C 1T1YB 3TH2T 1GGCL 2DWDB 1HDMB 4EUPH 2HLAB 4HQQL 1DBAL 3L7FB 4Z9KB 3PABB 4YXKH 1NBZB 4NQCE 5T1MB 1RIUH 3LHPH 3ETBF 4NQXB 1NFDF 5C70A 4PV9A 3VWJB 5HYSG 2FJFB 4BKLB 4WI2A 4EXKA 2EDKA 3N06B 1J1OL 2FATL 5DC4B 4N8VA 4F2MB 3HKFA 1YN7A 1JE6A 1HH9A 5LQBL 4N1CA 1AY1L 1J0JA 2VIRB 3UDWC 1YECH 5B39A 2CKNA 2FIKA 2DQFB 5HYJD 1MFNA 3HRPA 5IBTL 4M1CD 3VFTB 1J1XL 4JB9L 4WVRA 1WK0A 4YGAB 4AIOA 1FAIL 3DIFB 4A6YA 1MPAL 4L4VE 5E8OA 2AJUH 3HMWH 1FV1B 1NSNL 3WDHA 2BCKA 5DYOB 5J9PA 3L3KB 5HI5D 4Z7NF 5BVJA 1RZFH 4AEFA 1AO7B 1IM9B 2CDEB 3RPIB 1UGNA 1A4JA 5B22A 2R29L 4V1DB 5C0BD 1AXTH 2QADB 1IRAY 1DVFC 1XGYH 1JN6B 2B4CL 2HWZH 1MLCA 1WEJL 3VFPA 4D9LH 2FSEA 5T1KD 5C0ND 1JIBA 4F15C 4X6FB 2GTWB 4ZPVB 1Q9KA 1F6AB 4UAOC 2P8PB 3MNVA 1A0QL 5KBNC 5D71L 3MOQA 4P3DA 1HQ4A 4MQ7B 2ZKHH 2CR3A 2CK2A 4GRMB 3F5WA 4ZYKB 3D2UA 4R0LB 3GK8L 1W72A 4PJCB 4LHUA 2HMID 2Q8BL 1G7IB 5CS7A 5AWNH 3QEQB 3MA9H 4PJBF 1HIMH 4OZHB 2H26B 4HEME 1MCQA 4N9GA 3WFBL 5C0BA 5J56B 1A6ZA 5TE6H 4WW2B 5F9DC 5DZNA 1WBZA 2EIDA 4DKEL 3KHQA 5I8CA 2V2WA 3W81A 3TLRA 4KI5D 5C09E 2IALA 4LSPH 2AKRA 2MCPH 2ZJSH 3QNXA 4PGJA 2IPUG 1MFDL 2WAHA 3IKCB 1CICA 1FGNH 1IAKA 2W65A 4NZUH 4ZXBD 3IFOA 1G9ML 1L0YA 1AGBA 4HK3N 1RULH 2FX7H 4LSUH 5E0QA 3QQ9C 1RU9L 5DEFA 3TPKA 3OAUL 3OKEB 1CD0A 3SO5A 3U4AA 1AQKL 1NGZA 2DQIL 3JWOC 3TT3L 3QUMB 4S1RL 2WK2A 4FG6D 1YEIL 3DO7B 5ALBH 4PS4L 3WV0A 3O6KH 1SM3H 3VH8A 5ERWB 3CFDB 2NY1C 3QIWD 5DUBB 4X6BA 3BISA 4LLYB 1PLGH 2FYYB 3FN0L 5D6DC 2HRPL 2NZ9D 3T2PA 2BHYA 4I0CC 1XGUA 4CADA 4PIRF 1LHZA 3GO1L 1TFHA 3QHTC 4MXQD 3FO9B 1ZSDA 3D3VD 4ESKA 4H88L 1A1MA 1PZUB 1OB1A 5DVOA 5TDNB 2BNRB 4Z7WE 4N5EC 4E41E 4N0YL 1MI5D 1XF5A 1TVDA 5ADOH 3KLHC 1TTUA 5I1JL 1I1AD 3KLDA 4CJ1A 5DO2C 3HC3L 3NMEA 2D3VA 3Q5OA 5CWSB 3GNMH 1H8SA 3OF6D 3U4EA 4HK3J 4ZO8A 4WUUB 1FGVL 5IW1A 3ULUD 4PLJC 1PZ5B 3JV4A 4L3EA 2DLHA 3LDBB 1KXVC 2V9TA 4KAQH 3CZJA 5SV3A 2ZUWA 2Z8WC 2Q8AH 3H7BB 1KCVL 5DHVB 4YC2B 3VD4A 4ERSL 1UVQB 3O2WH 4HJJH 4LPWA 2F53D 5HYSB 3IDGA 3C8KA 3KYOA 4JFDE 5GGRY 3TNMB 2BSRB 3MLRL 3RKDD 4LSQH 3A67H 3CLFL 4WFEE 3BZFB 2AEQL 5KS9A 1G9NL 1T03H 1EJ6A 3DMMC 1M7DA 5E7BA 5D2NE 2F54B 5F7MC 3NFPA 2ADIB 2DI7A 5J6GB 1RAMA 3QDMA 4X99B 1U8MA 4R97B 3UPRB 2VZTA 2R2HB 5TGBA 2UWEA 1CLYL 2KBGA 1JNLH 2GTZA 4HIJB 4ELMB 4GW5A 5BO1L 1YNKL 4ODWB 2GW5A 3T08A 4ALAL 3AGVA 3PL6B 2R23A 4ZFGH 4GUPA 3SKOB 4Q6IA 1ZV5A 4JRXD 4X9HA 1NANI 1T5XA 1T7ZA 4F9PC 4LQFL 25C8H 4IEFB 1CZ8L 3PF2A 2I9TB 1RHHB 3U1SH 5I9QB 5TDOA 3GJFK 4YDIL 5D1XC 4RMVA 1IC4L 1T0MB 4NWUH 2ARWA 1E6OL 5DUMH 3V4PH 4C54A 4NNPH 2EICA 1PG7L 3ILQD 1CCZA 4F9LA 4AEHL 1X4YA 4BFEA 2MHAA 5A2JH 3PJSA 1NFDE 4ONFL 4OF7A 4HUWA 3QPXL 5T5NF 2ZCHL 5DRNB 4PD4J 2Y36L 1Q38A 4E5XB 1U3HC 2A77H 4I0KA 4NQUA 1CI5A 4LOUD 4EBQH 4OUUB 4Z0XB 4UB0L 1PEZA 3GSVA 4O5LL 1CK0L 3SGKC 1MHPH 1WCQA 4FZ8H 1QP1A 4M6OH 3QFJE 3EAKA 2HTKC 1J8HD 5BXFB 1MFCH 2R4SH 3LRGA 3NCMA 2D4DA 1A6VH 5DJ6B 5AEAA 1YC7A 4PJAA 2XWBA 4Y4HD 3RHWF 1FL6A 4OF0A 4Z7NE 1KJMB 1GRWA 3KYAA 3N9GH 4WTZG 3PWUA 2IEPA 4ZTOL 1MCWM 4JM2D 3QDJD 4LCYA 4HKXA 5C07D 2QQNH 5C6TH 1ND0A 5I8EA 4RRPA 4QF1A 5I18L 4QOKE 4U1KB 2VTFA 4JFYB 1F4YL 1QA9B 1RZJH 3MO1B 4UUJB 1FG2B 4ZFZA 2XZCH 4G43A 2PO6C 4QRRD 5HHQA 3I50L 5F1IA 1QSFE 5MEOB 4I77L 5D96C 2V5YA 4EQ2A 5DJCB 4W4OA 3UTSE 4PGDB 4EUPA 4EI6B 2OSLA 2WWMC 3T09A 1RVFH 5D7LB 4IOFC 4YK4C 3S5LA 3HC0A 1ZAGA 3FMGL 4JN2B 2YUWA 4BA8A 5D7IF 3QIUC 4JFFD 1JHLL 1WITA 1Q0XH 4PJBE 1OWWA 4U1SA 1FL3B 1A3RH 3GIVB 2ICEA 1BZ7B 4WWKD 3B3IB 1CLOH 4OLEA 5DJAA 5E5RB 1P6AB 1MCDA 4P2RB 1KN4L 3RDTC 4KY1H 3RZCD 1AKJD 3ABZA 3SKJL 3HC4L 4NO0B 3TT1L 3HLAB 3H8NA 1RK0B 1W0WB 5I76B 4NYLA 4RISH 3BSZL 2ATPA 4R7NA 1PYWA 4K3HA 4ZG1A 5FOBB 3GBLA 2WMPA 4M61B 2W07A 4U7SA 5DC9B 1NAMH 4FQLH 3OGCB 2Z91B 4XNMA 4PP2A 4F7PB 1Q94B 1KBGL 1XIWA 1KULA 4JFFA 1B0GA 3VXRD 3SDXE 1J1XH 5C0CB 3HAEG 3CH1A 2ED8A 4ODXA 5LCVH 2Y06H 4NP4L 5GSRB 1M05A 4WWKA 3TJHC 1OAZL 5EZOL 2EH7H 1B0RA 1DQJA 3L3OA 5GGTL 3QEHB 3FO0L 3PIQB 5F3HA 4YE4L 5IMMB 1RJZB 1AKJA 4KDTA 1KIQA 4JFPB 3SGJA 2R29H 4G7VL 4MAYA 4LCWB 2VXTL 3BGFB 1I8KA 4B41A 4HULB 1YEKH 4MDJA 4O51A 5BRZD 2HTLC 3M1BB 2B4CH 5E6IA 6FABL 1BJ8A 3I75A 1Z3GH 2V5SA 4NZTH 1X5JA 3VXSE 3GB7A 2VISA 4BZ1L 5CFHA 1ZT4B 32C2B 5DJDA 5GSVB 1MCOH 2GT9A 4U7KA 4CNIA 4WHCA 1A0QH 2GSGB 1M7IA 3HZMA 4MNGA 4XVSL 4J3TA 1ZHNA 2AEPH 3PWPE 3VXRA 2H32A 1KT2A 4LFHD 5DZLA 1V7ML 3VXTA 3Q5TA 5FO9B 2YUXA 2BVEA 1KLUA 4K23H 5IHZB 3MLSH 4OIBA 4UILL 3FN9A 3HUJB 4R3SB 5KSVA 3VD7A 2R8SL 4NN5C 5DJZA 3VU2A 5DFWH 4KRNA 2QQQA 4PJXB 2G2RB 4YGVB 4OF5A 2HVJB 3S34L 4GW1B 4HKJB 3WFBH 1HHHB 3G5VA 1P84K 3OZ9H 3FQTB 2BP3A 4Z77B 3BIKA 3VGFA 4DKEH 1I8IB 1WVZA 1DBJL 3EHBC 2MSPA 2IPTL 5FHAH 3R0MA 1A3QA 3E6FA 3PWJA 1MFDH 5C1MB 3HNVL 1DQQA 3IDUA 3R8QA 1D3CA 1WZKA 3KJ4B 2XN9E 3WIIH 1G9MH 3ARWA 2EDDA 1A14L 2FECI 3PGDA 2EXWD 1DANT 1KCSL 3HRZB 1S9VB 1RU9H 1L7IL 1UH3A 4Y5YA 4Y1AE 5AG8A 2J7LA 2Q7NA 3O3DB 2Y5TA 2FB4H 5IKCB 5HJ3A 4G6FD 1G84A 2YC1B 2VJXA 3DVIA 2QQKL 1YEIH 3V0VB 1H3XA 1QPXA 3OKMA 2VLJA 5DC0A 4XPTH 2OYPA 4XPHH 5IP4A 4UDUA 2DKMA 5F3BB 5EBMB 4DGIL 3GMNB 3MV9B 4G8GE 5D1QD 3T65A 1JTTA 1T21B 5D7SH 3QAZC 1AO7E 1A7NH 1EEYA 4YUEL 3HB3D 3GO1H 1S7SA 1F00I 1UH2A 4HV8A 1AGCA 2JB6A 3RVWC 2R15A 1FC2D 4BQ8A 5F1KC 4OAWB 3ARDD 4HC1L 1NMCB 5HGAB 2B1AL 2IBGA 3U7YL 1UB6B 2A74A 2EDOA 1AFVL 3UDWA 5I1JH 2WSKA 2NY7H 3DX8A 3HC3H 3JTSA 2UV3A 4Y7MA 3OKOB 1S7VA 4FN0A 4CDHA 1FNEA 1LO5B 5FYKL 2BXZA 4U1LA 2ADFH 4QRUA 4WW1A 3VFSB 4F33B 2BVPB 2V7NB 2XA3A 1FBIL 2O61A 3RNKB 4PJCE 1OCWH 4UV7L 4MD4B 3SE4A 3FZUD 4WI7A 5D1QA 3GFUA 2F15A 4DOHE 2HJLB 4OTXH 3QEQE 3U4BH 4C57C 1DVFA 3MUGB 4QTHB 2PW1B 3PWNA 3CX5K 3MLTA 5E5MB 4PJ5D 2AV1A 3IU3A 1VB9A 2IQAB 4A2MA 2YPVH 2FEEI 5D2NC 3VXUD 4NM4H 1NEUA 3T0XA 2AEQH 2DQHL 2VLKD 4QYOA 3ARYA 4WRLA 5HYQB 3QRFM 4LDOB 2NW2B 2E6JA 3HAEB 3VDAA 1KPRA 3GSNL 2YRPA 3L5JA 1ITCA 3QQ3A 4LAJH 5ENWB 4NT6B 3F65A 3KLAB 1ORQA 2OM5A 1QFOA 1VCAA 3P40A 3WLWC 1A47A 2L0DA 3U0PA 4IDJL 1W2KT 1ETZB 4P5KB 1KCRL 3DURA 1CLYH 5E7FA 3IJHA 3AVEA 1QFUH 4UNUA 1TXKA 5BO1H 4ALAH 3SDYH 2IBZX 2YUVA 3C87A 3IFNL 3NN8B 4FQIL 4GKZB 5IW6A 3FONB 2DI8A 4LQFH 5KOVC 3IDIA 5J57B 3O6FB 5AUMB 1DJSA 2WIIA 3GGWB 4RMTA 5D7IE 1A7RH 1FZMB 1IC4H 2EDWA 1FVDB 1BWWA 1E6OH 2CXKA 4KPHH 3BD5A 4KJWD 2BNRE 3ZZ1A 5L2JA 2P7TB 2OR8A 5CP7A 5CMAB 3V52L 2UUDH 1I1FB 4PJGA 4AEHH 5D8JL 1XAUA 3KPNA 3ES6B 4Z7UA 1F3JA 3U9UA 1JPSH 4V2CB 3QP3A 1AD9A 3EO9H 5D6DA 2CDFB 3LKOA 5GISL 1JNJA 1DR9A 2Y36H 4JFOB 4L3CB 5C0GA 4GAGL 2XZQL 2PTTB 4F3FB 3WO4B 4YBLB 4NJAL 4ZFOB 4ZUTA 5INCB 1NGXB 1RK1B 4EI5C 2JLLA 3QXWA 1LWRA 1AR2A 4JG1H 3LEYL 4PRPE 2A6DB 2XTJB 3PE9A 4UQ3B 4DKFH 3MFFB 4YHYB 3IVKA 1CXIA 5IROC 1ES0B 1JI2A 4KJPD 1FZJB 1P4LB 2GJ6E 4UIKH 2BSED 2NLJA 1A4KB 1U42A 3U36B 4OZGB 1UH4A 1WIUA 4OI7A 2J8UB 2DMKA 3RWGB 4OF3A 1KJ2H 3LH2L 4QRPB 1GHFL 4NZDA 3BRDA 4C56A 1OAUH 3FO1A 4Q6YA 3IJSA 3ARFB 4UT9L 2F54E 4FHBD 3WNPA 2MPAH 3EKCA 2IAMC 2X44D 3QXAB 5DRXB 1JPGA 2OJZL 3KXFB 3ALPA 3F7YA 3Q5YA 1DE4A 3F12A 3K1KC 4KWUA 2ZUUA 3T0ED 3S6CA 5IJKC 2R4RL 3C5ZB 3WIFB 4TQEL 1DLHA 2ITCA 5GRXG 3DLQR 4U1JB 4F7TB 2OR9H 1UEMA 2NNAB 2CKBA 3BKJL 4G6JL 5FCUL 4MXWH 3GMRA 4L8BA 4GH7B 1UXSA 3CFEA 1SJXA 1BX2A 1G6VK 2X4SA 2JB5H 3FT3B 5I75C 1NDGB 2VAJA 3MRBB 5F7DA 3FMGH 1BF2A 1UENA 1JZ7A 2KL6A 4G80B 5I1LA 4PRIB 1INQB 5FYKU 1GIGL 5E4EB 3RA7L 1RUML 1KB5L 1R3JB 1NAMA 4UOW1 3OMZA 1F4WH 4KVNL 1NUFA 2GHWB 3W39B 5KVGL 3NZHL 3AM8C 2EDLA 4OBSA 5T3XH 3SKJH 5FO8A 3HC4H 4MWFA 5IOPB 3HE6C 2YD4A 1CD9B 3G6JA 2J88L 1MCPL 5EU3A 3QIBD 4FTVA 4FXGB 5I8KH 3BSZH 5EOQL 1BHGA 5HHVL 5D1XA 4L9DA 2DF3A 4DVRL 3TYFB 1IAIL 2VQ1B 3ARBB 3D69A 1F58L 2VZSA 1HYSC 1I4FA 3O4LD 3DTXB 1T2QH 1XH3B 3R4DA 3CVHL 4ODSL 3OHXA 4L4JA 3MNZA 5I2IB 2IANA 5JORA 3IS0X 1QSEA 2OP4L 2DL9A 2YS4A 3K8LA 5JW3L 2DYPD 4IM8A 1B2WL 1IGIL 1OAZH 5EZOH 5DMYA 1ZOXA 2VN7A 5GGTH 3FO0H 1N0XL 4YE4H 5I71C 4TPRL 3O45A 1UQSA 3U2SA 1U3HA 4NCC1 3HI1B 2VXTH 3MJ8B 2PYED 1U8LA 2Z31C 4XNZB 5DJ8B 5EU5B 2BVYA 1JGDA 2H2PC 3ILPA 4JDVA 2X4OB 6FABH 3KPPB 3SGKA 4L29A 3QXTA 4BZ1H 1GGYA 4OJFL 1NUGA 5C08D 4MA3B 3B9EA 1OLZA 1A6UL 1E28A 1CL7L 5C9KA 4LCCC 3GUTB 5EU6A 2BNUB 3CUPA 1EAJA 2FEDC 4ZAKC 4OBRA 2R0LH 5EFIB 1LD9A 2E7BA 5CBAA 3BQUD 4RDQF 3JXAA 2V5RA 5HYIA 3V7MA 1KIRA 4JM2F 1IEBA 2OQJB 4MHHG 2HFEB 3HTLX 4YHKL 2R8SH 3VXPB 3VCLB 5JQ6H 4OFIA 2DKUA 3BJ91 4HGMA 2A73B 2H3NB 3KDMA 4L3AA 2X9WA 1O0VA 2W0KA 3QO1A 2XFXB 2EYTA 4D8PB 1D5XB 1DBJH 3BPLB 5F7NC 3VWJC 2IPTH 1MHEA 4NKDB 3BO8B 5GGVY 4HJ0C 2YPLB 5D1ZB 4I4WA 1HOCB 1AIFA 3OQ3B 3LEXB 4BZ2L 1QLFB 4JN1H 3D87B 1DDHA 1IAIM 1KCSH 2SEBA 3CNKA 4J1UA 4XBGA 4G8FA 3H9SD 5I74B 1MCKA 3QIUA 4Y4FD 1AC6A 2Q20A 3TO4B 1FJ1A 5A40E 2YMXH 1LK2A 2CIKA 1T0NA 3WL9A 4M3KB 2HVKA 4PREB 4OCRH 1VFAA 4AH2B 3RVUC 2ZUXA 1J0YA 3EYQC 2A1WL 4GXVL 3RDTA 4TSBL 3H2WA 1XR8B 4DGIH 5KN5B 1J0HA 1OF2B 5A1AA 1OP3K 1G7JB 5KANI 1OGAD 5EC2B 4YUEH 5E08L 5IFHL 2VDMH 1KUMA 2OTUB 1PBYA 4HXAH 5FECB 5C9JA 3C60C 4E42B 4M48H 1SEQH 4NQEE 5KSBB 3H9YA 1JWMA 3SJVD 4HC1H 3EW3B 4U6HA 5JTWA 1U8IB 1LO3L 3H9SA 5ACZA 1T04B 1RJYA 4NRZB 2KQNA 1YC8A 5FYKH 5EPMB 4R0LC 3I6LD 3EZ8A 3WEXA 1FYTA 3S35X 5C71A 1YNTA 1CQYA 4ODHH 2P5EE 3AXLA 4RGOL 3FL7A 2Q7YB 4S1DD 4WI5A 5IR1B 1FBIH 4NKQB 4KJYB 3W11C 1K4DA 1ZVHA 1RZIA 3CMOL 3MODL 4JHZA 1DBBH 2W9LA 4GXUN 4Y16D 2Q76B 5DJYB 4OV6F 3HG1A 1WZ1L 3IFPA 4JZNA 1BLNB 1D5IH 3NVQA 1NGQH 3RWJA 1B6UA 4NC2B 3EOBA 3FB8A 4ZSOB 1TJIL 4TULL 3INUL 1BZ9B 1EFXD 4OGAC 2CO6B 2WBJD 1WWWX 3ZDXE 3DWTA 4JY6B 3UTTE 1ED3B 3K3QA 2PCPA 4I2XE 1CDJA 3MRRB 4APQC 3AAZB 4U6XB 2JE8A 3GSNH 3IDNB 1DN0A 1JHKL 4LLVA 1AJ7H 2X4TB 3JWOL 3O81A 4KRMB 1W0YT 1YEJL 3TFKC 4WO4D 2CD0A 2MKLC 4CVXA 3M07A 5SX5K 4WI9A 1HKFA 4Y16A 4MB5A 3SKMB 4X8JB 3VFMA 1MWAB 4PBXA 5DI8B 1RURL 3MV9E 1LEIA 4OM1L 3KPSA 4MVBC 3VFRA 5F9OH 2DJUA 5D7KD 1FO0L 1U2CA 2CLVB 2WBJA 5FUCE 5ISZD 5F6IB 3IAQA 5DEGA 5K9OA 5TE7L 4PLKC 4P57A 1U3JA 4JFHE 2R2EA 4L1HA 3DX6B 1ZA6A 5AZEL 4OD2B 5D8JH 2X40A 2E8YA 1MHCB 1XCQB 3ROOA 3V0WH 4U6YB 5DWUH 1Q9WA 4UU9B 3SKNB 3LDBC 2FJHA 1KJ2A 2FCBA 1D7FA 5DDHB 12E8L 1OGTB 4U1GB 4MJID 4HUMB 4YC2C 3CPLB 2JJTC 3VJ6B 3QI9B 2V6HA 3MV7D 4GAGH 2Y1VA 2XZQH 3DVNB 4UT6H 4X4ZA 4XVJH 3D5OF 3EYOA 4EIGB 1HKLL 3QJFA 5BQ7A 5ILTH 2X4PB 3NGBB 5DURD 1B88A 2UYLB 1R0AH 3RL1B 5T3XD 3BUYB 2YOCA 5IUSA 4DVBB 3L9RA 4QHUB 2VR4A 4HIIA 3HCVB 1A1OB 4POZD 5IVXB 2JJSC 4IOIB 5J1AA 2YR3A 2EEBA 1NKOA 2BRRL 2NR6D 3BN3B 3CSPA 3MLUH 4LU5L 1JNNL 4QT5A 4R97C 5CEZE 3PHOB 4M5ZL 4C83A 5FDWA 1NFIB 4JFEB 4M1GL 5C0IA 4UT9H 1A7QH 3TH3T 1BQUA 4F57H 3FRPG 5E2TL 1G6RH 1U6AH 4NKMB 5IBLD 3VRJB 1MJ8L 1SJEB 4HUVA 4MJIA 4E0RB 1GPOH 3PL6C 4N1HB 1U8JB 3OR6B 4MD5B 1C12A 2V7HB 2R4RH 4K7FB 4LL9A 5C0AD 1QSVA 3LKNA 2B39A 4NJ9L 1MEXL 4ZMAT 1R3HB 4O2FA 5SWSD 3NFNB 3DV6B 1IAMA 3LD8B 1Y6NR 4NN7C 1QFWH 5FCUH 5I9QC 3NABH 2Y7QA 5TH2B 1JWSA 2PUQT 3G04B 2R0WL 2YPKB 3Q6FB 2J3SA 2ICWB 4U3XA 1ONQB 2P42B 5DD5L 1LDPH 3VI3E 1EO5A 4H20L 1BMGA 2EIZB 4JANB 4NUJA 1GIGH 4P2YA 5KSAB 4JKMA 3RA7H 4I3GA 5HTSA 1UG9A 3ARRA 2BY1A 3RUGF 5IB2B 2VABA 2P5WD 3QSKB 4UQ2A 5JPMB 2IFFL 5KVGH 1A21A 1DEEA 3NZHH 3B5HA 3P4NB 3BPOB 4PJEF 1PD6A 1KENL 3ZT6A 5I66A 1P5UA 3DSFL 3MYJB 4JVUA 4ZFFA 2J88H 1QEWB 4Z95L 1DCLA 1ODAA 3F58L 1SYSB 4FNLL 2X7LA 1BEYL 2C3GA 1G7HB 5JOFA 1NCTA 3VFUA 4F58H 1WQVT 4ISVA 1F58H 3W82A 2NX5E 4I5BB 4XTRD 3G5YB 3P4OB 4BH8B 4N8VG 2XTJE 5FGCE 1GGBH 4Y4KB 1BOGB 4ODSH 5E8NA 4D9RD 1T80A 4B53A 1S3KL 3BIBX 2W38A 2YXMA 4OZGE 1CQKA 1QNZH 5JW3H 1NCBH 1X5GA 4JPWH 4X4XA 2X1QA 3KAAA 3LV3B 4QRPE 1B2WH 5IB4B 1IGIH 2P5WA 1YMHA 1LO2L 1I7UB 4JDZB 5FCSH 1DQTA 4XI5C 3QO0A 1N0XH 1T7YA 2R2CA 4R4FL 1I3RB 3BWAB 4HMCA 3MOBL 4NRYB 5IVOA 4GRWH 2IBZY 3VDCA 5JXAL 1SBSH 2C7UB 4FZEL 4XPFH 3V9FA 5A16B 2AV7B 1N5YH 2CO7B 3X11A 4OJFH 5IROA 5EOTA 1T20A 3G6DH 5JQHC 15C8H 4PTUB 1YYLL 1Y6KR 4U6TA 1CBVL 1A6UH 4JEGB 3FQRB 4UIMA 5IB1A 3M17B 2DTML 4IRJB 1I7RB 1SY6H 1VACA 3HR5B 3QUKB 1HNGA 4P46B 2W60A 3WMSA 2F8OA 4O2CB 3SKUD 3TYGL 4P3WA 2H1PL 1XR9A 3K1DA 3OXSA 4P5MB 4O2EB 3RWHA 3S97C 3MNWA 2IAMA 3BHBB 1CG9A 1J1PL 2XXMB 4LHUG 4TN9A 4M6AA 3N1PC 4Q2ZA 4GG6F 4LHJB 3OB8A 3PNWA 5E2VH 5IJKA 4ZPTB 5FYKD 1U58B 4MQSB 2IQ9H 2JTDA 4ZOEA 2YK1H 3S3PA 5IG7B 4KVCH 4Y89A 4OLYL 4MLIA 1A9EA 3TVMB 1GXEA 1FC1A 1U95B 3D18A 4BZ2H 3CC5A 4WJ5A 5D2LB 5L2KB 3KYNB 5K9KB 5GQBA 1DANU 4K8RC 3ZHKA 3ZKMD 5IFJB 4Z5RB 4OZIB 2EXYD 4O4YH 4RBPK 5E56A 3D0LA 4Q0XH 2AJSL 5DQDH 4TVPE 5CSZA 2EE6A 2IPUK 1NJ9B 1NBYA 1ORSA 1JF6A 2I07A 4G9DA 4TRPL 4U0RC 5IF0B 4HD9A 3S37H 4NQVB 2VSCA 5JZ7C 1C7SA 4LKCB 4GXVH 2A1WH 3AM8A 4RMQA 3WFCL 1CXLA 1I1RA 4LBEA 2A6JA 3ME0A 2XT1B 3HE6A 3BGFC 1ZA3B 4NO3A 5CZVL 2NXZB 4M1DH 2APBA 5CUSL 3RP1A 4FS0A 1Z2KA 5K59F 3P9MB 1CLZH 5C8JB 1DBKH 1S8DB 3T0DA 1KELL 4OCSL 2CR6A 1LO0L 4Y19B 1PDKA 3BP7A 1TTGA 3DX7A 4OZ4B 3H42H 1R5IB 3MBEC 4TTGA 4KK6D 3ZHLA 3BRGC 2MJWA 2NYYD 4YXLL 3V6ZA 4ONGH 2FWOA 5IGXL 2VL5A 3NH7H 2CLRB 2CIIA 1I3UA 4Y5VB 4FMFA 5F9AC 1LEGB 1HILB 5JLZA 2VH5H 5ANMA 3TCXA 1TPXB 1MOEA 3C09B 5ICZA 2G5RA 1KEGL 2KQMA 2QSVA 4Z76A 5FAAA 1IC5L 2Z31A 1JGUL 1J8KA 4PV9B 4WWID 4QRTB 1P7HL 3BT2L 2BMKA 3AUVA 1RZ7H 3X3FL 5C7XL 2VZUA 3KJ4C 2A83B 2QR0B 1EVTC 1S7WB 3INUH 4J3UA 2C5DC 4Y8DC 1HH9B 4JPVL 4LCCA 3RVVD 2EH8L 2GCYA 3HA0A 4XNQA 5A2IH 4X5XA 4NPYA 3BE1L 4U49A 1FLRH 2FIKB 1NLBL 3I85A 4YHLH 1NGPH 2AJVH 3LB6D 2OTWA 4MZ3A 5CJBA 1JHKH 4A6YB 4K7PL 3GJFH 1YEJH 1C5BH 2B7DT 2NXYD 1K3ZA 4RMRA 2I60H 1TJGL 1KSRA 1H0DA 2BCKB 5J9PB 2DWDA 1HDMA 5BVJB 4DN3H 3MUZ1 1KF9B 1A4JB 5T5FL 3P77B 3QISA 3PABA 1NBZA 5T1MA 3MJ7A 5F88A 2NY2C 4LMQI 1OQXA 2C26A 1DUZA 1YYML 3VWJA 3J7HA 3AMKA 3FO2B 4XCCL 1MLCB 5I1IL 4V2BA 3VFPB 4BKLA 2FSEB 1JTPA 2Q3AA 5DJ2A 4X83A 5HPOA 5IHUH 3U9PH 1TETH 3LKSA 1FO0H 4F2MA 3K8MA 1D6EA 1NMCC 1G7LB 4GRLD 4P3DB 3B9KD 1HQ4B 1N64L 4CJ0A 1S7UA 4X5LA 4PUBL 2E7HA 3WFDH 4X8XA 2H41A 5HGHA 4FMKA 3D2UB 4QGTA 5GZOD 5BOPA 3EYUL 3DIFA 3SE9L 3DVFA 4JE4B 2JIXD 3C2AL 2GY7B 4LHUB 1FV1A 2ORBH 3DVGA 4PY7A 2C4FT 4IS6A 5DYOA 5JHDD 4M93B 1IM9A 4JPKL 4HWEH 4N9GB 1P1ZA 4V1DA 4Z7QF 5C0BB 2ZUYA 5I8CB 2V2WB 4G6AD 4FFVD 1NEZA 3W0WE 3D6GA 4KKCD 4XHJC 4MJ5A 5MHSE 4K8RH 4QKXB 4QEGA 5T1KB 1G6RA 4YDJA 1ACYL 1AP2A 1HKLH 3C60A 4ZPVA 4X6CA 1CICB 1IAKB 2W65B 2P8PA 4PYHA 3IFOB 1S7RA 1HHGA 5BS0A 1AGBB 2DLFL 2JELL 1M6OB 5M7QA 4ZYKA 2UZIH 2WW8A 2DD8H 1KLGA 3B6SB 1NGZB 1YUHB 2JIXA 4LU5H 4YHOL 5E8PB 3TCLB 4PJ9C 4GQPH 3T1WA 3VDBA 1PFCA 1CTOA 4WHYH 3JUZA 4EXPX 4PJDA 1IKFH 2R0KL 4MSWB 5E2TH 1DBMH 1FNSL 2IH1A 2AP2A 1O7VA 5GRZA 5SV4A 2WP3T 1CWVA 3NZ8B 3PDDA 4OIIL 1P69B 3RKPA 2LAAA 1TMCB 5EIQA 1OPGL 3TZVD 3HMXL 4WHDA 1UZ6E 4XGZB 1OB1B 4RZCA 5EIIA 3UJJL 3L3JA 1DL7L 4EUPG 3MACH 4ZTPL 5E8EB 3PWLA 2HG5A 4APQA 1IQWH 4JKPH 3S5LG 3EJYD 3U4EB 2Y07H 2BVUA 3QUMA 2N56A 4NNYB 4X5WA 5IT2L 4KGLA 5IW1B 4XPAL 3MRIA 5TPWH 4L3EB 1ZGLM 4RWYH 4L9LA 4AZ8A 5KAQF 5DUBA 4JQXC 1IM3A 5DK2B 4LLYA 3RY5A 1IGTA 2KH2B 2IFFH 3WIHL 1TVBA 3RWDA 3MRPB 1KENH 3WO4C 3C8KB 4YBLC 5HYFA 5MEQA 3FO9A 3KYOB 1JWUB 3D3VB 4HUXB 1CU4L 4HCRL 3QH3A 3ZSSA 3F58H 2RBLA 4MNQD 2VO5A 4FNLH 5IBUB 1BEYH 3HS0A 2XTJC 4MNHA 3QT2A 4M7JL 2WM0A 4YHYC 1MI5B 4NQSB 2BNQE 5KS9B 1ZHLB 2E5EA 1RUAH 1I1AB 4KKAD 3DGGA 1M7DB 1ZE3C 3NACH 2D7PA 4J23A 4N0FA 4X4ME 5CWSA 2XKUA 3MJGX 4OCMC 2CRZA 1IAII 1YQVL 1YMME 1U8MB 4G5ZH 4WUUA 4R96A 3ARFC 4P0DA 5TGBB 3O0RL 3VFGL 3Q48A 1SY6A 1LO2H 3VGAC 4XC1L 4GW5B 4U6VL 1OHQA 4XPGL 5K59E 4UMGA 2R23B 1UB5A 2AERT 1UVQA 2JJTA 1NCAL 2F53B 3B2VL 3C5ZC 3MOBH 3TNMA 1DFBL 5I73B 1P84J 1ZLUK 1H8NA 2VC2L 4XWOC 3B5GA 5EUOF 4UBDC 5KW9L 3BZFA 1AE6L 4MZ2A 2Y25A 5IB3A 1KIUA 1YYLH 1A3LH 2E9IA 3RWEA 5J13B 2QSTA 3MRDA 3WHXA 2DTMH 1MJJA 2ADIA 2Y72A 4X99A 5EZJB 5IM7B 4XAWL 3PP4L 1CL7I 1FRGL 4Z7VF 3L1OL 5E4EC 5F96L 3DV4A 4JPIA 1J1PH 3PJSB 3MJ9A 3O6LL 4HUWB 2CSPA 5D5MF 4ODWA 2MQ3A 3QA3B 1T5WA 3CLEL 3SKOA 4UTBL 1N6QH 4JRXB 3KPQB 5GS0L 3T04D 1VFUA 5DTFA 5I1DA 4NZJA 4NBZB 2YXFA 3BMVA 3VD9A 4W68A 2OZ4A 3IETA 3ARBC 1CT8A 1MCJA 4X6DF 4PJAB 1MF2L 2XWBB 4N0UB 3EOYG 1FL6B 3IRZA 3KPRE 5ALCL 1P4IL 1HN1A 2PN5A 5GGRA 4HWBA 3UEZA 4CUCA 4M43L 3EYSL 2Y6SD 3GMMA 4AL8L 4OD3H 3GJEB 3DETD 4LCYB 3MLWH 4TRPH 5LKNA 5I8EB 1JV5B 3VG0L 4M00A 4KROB 1DUYA 4QF1B 5DJXA 4IMKA 5DRNA 3D25B 1X5XA 4ZFZB 3WFCH 1F8TH 4M62L 5BV7H 1F02I 4G43B 3GSWB 4I48A 5F7KC 4XNZC 5CZVH 1YDPA 5FUZH 5T33L 1IVLA 4JY4B 4L4TE 2Y4SA 5CIPH 4EUPB 3NAAL 1A02N 1FSKB 3LS4L 1VGKB 3ZDZF 3CX5J 4OCSH 5BXFA 4HT1L 4PJHA 4XCEB 5MEND 1UEYA 5DJ6A 5FA4B 2NY4D 3S5LB 2EKSB 3MRCA 4RCAA 1KJMA 4YXLH 3HNTH 3MUY1 5IGXH 4HS3B 4Z7QE 1AQDB 1KCKA 3QDJB 4B0MM 5C07B 4PGCA 4OKDA 1MVUA 4U1MA 2F58L 4U1KA 1QA9A 4UUJA 3V6OE 1MIEL 2CJUL 1FG2A 2J8HA 35C8L 4PJ7A 5I1GL 4G9FE 1KEGH 3HE7D 1IC5H 5MEOA 4P2QD 1D6VH 4NYLB 4Z7OF 1HI6B 3QDGE 2ATPB 4PGDA 3BT2H 4R7NB 1PYWB 4EI6A 1IEHA 5GRWA 1JZ6A 5C7XH 2EDRA 3WNKA 5D1ZC 3SE8L 3CK0L 2WUCL 5D7LA 3RWCA 4PRHD 2QTEA 4POYA 4XNMB 4XWGH 3LQAC 1XIWB 4JFFB 3P0VL 1B0GB 4R4ND 1NLBH 1JP5A 5EWIH 2R0ZL 4ODXB 5D2LE 3TO4C 4JFZL 1FL3A 4K7PH 1M05B 1Z0MA 4LSDA 4WWKB 1BZ7A 1OAXH 1Q72L 3B3IA 1YEDA 4P9HC 1XGTB 4F8QA 5HDQH 1S78C 4NQDE 1B0RB 1DQJB 3DMMD 3B9AA 1BQHA 1O7SA 1AKJB 4YDLC 4BQBA 5T5FH 1J5OL 1OARH 3HE7A 5HI3D 4KK8C 1L7TH 4MDJB 5E9DD 3GBML 3O2VL 1L0QA 4O51B 1YYMH 3ULVC 3QPQD 4XCCH 1GH7A 3O2DH 2VISB 1EO8H 2UWEF 5FOBA 5HHNB 3WUZA 3ZE0F 3F6IA 2WANA 4CNIB 5I17A 3LN9A 3HZMB 5BMFL 4MNGB 5ADPH 3ZLQC 4DJMA 1TNMA 1ZHNB 3I3EA 2ARJA 1Q94A 2DQGL 3VXRB 1KTDB 4IJ3B 4CU8A 1KT2B 4Y19E 5K33A 5C0CA 3QUZD 5EN2B 1TQBB 3EYUH 3VXTB 5GSRA 3SE9H 4KUZL 3WLBB 3QJHB 4HSQA 1IKNC 5CINL 1RZKH 5M95B 5KSVB 3BRFA 2F5AL 3TH4T 5JW4R 3PIQA 1JFQH 4GSDH 4JPKH 4JFPA 4NKIH 3D39E 4UI2A 3WKNA 4LCWA 3L95A 3G5VB 5SWZE 4OF8A 3BIKB 5BRZB 3M1BA 5I8OH 1ERNA 3ARQA 3LKQB 1JZ4A 3E6FB 4BK4A 1ACYH 3OPZH 1ZT4A 1DQQB 1EJOH 4JRWA 5GSVA 5GGSY 1JPTL 5CZXC 3PGDB 4TSAH 4JRYD 3MBEA 3K2UL 5CGYD 1WT5C 3HNSH 3LKRA 3TN0D 2Y5TB 4JCLA 2VXSL 4YHOH 4XNUH 4F37F 5TFSL 3HUJA 3UBXI 4KTDL 1UYWL 1BD2D 4PB0L 2G2RA 4MDIA 2HVJA 4GW1A 3DGCR 4HKJA 3TBTA 3FQTA 3T65B 2VERN 3BDBA 4Z77A 4Z78B 5AYUL 4NUGL 1W0VB 1EEYB 1S7SB 5JW5A 3L3HA 4HV8B 1EIBA 5FUOL 3FCTB 5HDBF 3HMXH 1S9WB 3GRWA 3O41A 5F6IC 1DL7H 5CD5D 2A9ML 2OMBA 4FFWD 4JRYA 2A74B 4Z7VE 5J6HA 3DX8B 3JTSB 2VZ1A 4PJFF 3TWCL 3TN0A 5LBSH 1UM4L 3O3DA 2B20A 4G6FB 5IKCA 2ZZUT 5IHBA 1V3MA 2WWMD 4X9GA 4BFIB 1NLDH 2HH0L 1MJUH 4WW1B 3NOIA 5GGSB 5GS3A