5IC4A

Crystal structure of caspase-3 deve peptide complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3 subunit p17
publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 139
sequence length 139
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ic4A00
3SIRA 4QULA 5IC4A 2XZDA 3NR2A 4IEFB 4EHAA 4N5DA 1RWPA 4NBNA 2Y0BA 2FUNB 1ICEA 3EDQA 2QL7A 1RHRA 5LUAA 5IAJA 3UOAB 3H1PA 3D6FA 4NBLA 1RE1A 5IAKA 3H0EA 4NOJA 3QNWA 2H4YA 5IBPA 4N6GA 4DCJA 2H5JA 3V3KA 5IANA 5JFTA 4FGUA 4QUIA 1GQFA 2CNKA 1K88A 2H54A 1BMQA 1I4EB 4QUDA 3R7BA 4QUAA 3S70A 1SC4A 3R5JA 1NMEA 1NW9B 4NOMA 4EHDA 1NMSA 1I3OA 2K7ZA 2J32A 3PD1A 2WDPA 3NS7A 4QU5A 2CJYA 1JXQA 4N6NA 4FXOA 1RWVA 3H11B 3R6GA 2XZTA 4PS1A 2P2CA 2HBQA 4N7MA 3R6LA 5IAGA 2DKOA 1CP3A 3GJRA 2H5IA 1RWXA 2Y1LA 3DEKA 5IASA 4I1PA 1RHJA 2HBZA 3D6HA 3GJTA 2HBYA 4HVAA 4JR2A 4ZVTA 2C2KA 2QL9A 3V55A 5LU8A 2CNLA 1NMQA 3BIJA 1PYOA 1RHUA 3UO8B 2CDRA 4QUBA 1IBCA 4PS0A 4IYRA 4JJEA 4JR0A 2QLFA 1K86A 3RJMA 3V4LA 4DCOA 4EHLA 4QUGA 4FEAA 3H11A 4JJ7A 1QTNA 4M9RA 1CVRA 2J30A 2H4WA 1GFWA 2QLBA 3DEJA 3R7NA 1RWMA 2FQQA 3EDRA 4NOKA 4N6OA 4QUHA 1RWOA 1RWWA 2C2MA 2CNNA 1RHKA 2NN3C 4QU0A 4QUEA 3D6MA 5K20A 3V6LA 5LUBA 1I4OA 4QTXA 5IARA 4ZVOA 4PRZA 5IBRA 5IBCA 1I51A 2QL5A 4AWAA 3DEHA 3P4UA 1SC3A 4JQZA 1M72A 4D3XA 4QTYA 3S8EA 3R5KA 3R7SA 4PRYA 4JB8A 3SIPA 3DEIA 4AW9A 3V6MA 5IABA 1RWNA 2FP3A 4HQRA 1RWKA 4JR1A 1SHLA 3GJSA 4FDLA 3H13A 2J31A 3K7EA 3KJNA 1QX3A 4D3YA 4D3ZA 4EHKA 5I9TA 2C2ZA 2H65A 1QDUA 4ZVRA 3NKFA 4I1RA 1F1JA 4QU9A 2C1EA 5IC6A 4AWBA 4EHFA 4NBKA 1PAUA 2XYGA 5IAEA 2C2OA 4DCPA 3GJQA 4HQ0A 4NOLA 4ZVPA 4JQYA 4ZVQA 5H0IA 3PCXA 2XYHA 3IBFA 4ZVUA 4JJ8A 4N7JA 2XYPA 1RHMA 2CNOA 3E4CA 3KJFA 1F9EA 4QU8A 4EHNA 3IBCA 4EHHA 5LU9A 2HBRA 1RHQA 4ZVSA 3V4OA 2H51A 4QUJA 1SC1A 1SHJA 2AR9A 3PD0A 5I9BA 2H48A 2QLJA 3ITNA 2CJXA 3P45A 3KJQA 2J33A 4EJFA 4LSZA 3OD5A 1KMCA
chains in the Genus database with same CATH superfamily
4F04A 3CGWA 2DPHA 4X8LA 4OXRA 1GVHA 3ZK8A 3RAFC 2O8VA 2P68A 2P3QA 2P3LA 1RKBA 2C31A 1QCYA 2VJCA 2IOQA 1KR5A 2MMCA 1OJLA 4PF1A 4V3CA 2HZBA 4QQNA 3RBVA 2WHYA 3GUVA 1OLXB 5F3WB 4Q4HB 4XASA 3NIWA 3VR3A 4MI9A 3OE7D 4X3PA 4H2DA 2E37A 5D85A 2B78A 2ZYHA 3N2YA 1N4DA 3W2EA 4Z7NB 1AA6A 1MABA 1SU4A 1K5HA 3E7DA 5BWCA 2DMRA 1QHSA 1S4QA 1T5DX 2C4TA 2PEZA 4Q4JB 5FFMA 4CMIA 4BQPA 1G4UR 2HA6A 3IIKA 3R2JA 5HGXA 4OU5A 2FFJA 1Z8DA 3R23A 4N54A 4YQZA 5TGDA 5AJVB 4LCEA 3JZFA 1P5HA 5DDIP 4ZPXA 2Q3MA 2QV0A 1ZD8A 1KEVA 2A92A 2D1FA 4FLMA 2G4VA 5JT1A 1KVQA 2UYHA 2ADFA 3PHBE 4WESA 5DKFA 4MI6A 3WISA 3DLPX 1W0JA 4A5SA 5JCJD 5JSYA 3SI7A 3MWJA 5FHRA 1FJHA 2A9OA 4MUXA 4NMHA 2PK3A 2RGXA 1QBKC 4R1TA 1JEOA 3PJEA 3LDHA 5HWSA 3WYCA 2QIOA 1GPKA 4Z7QB 2ZB7A 4AYWA 7ABPA 1FX0B 1H05A 1QFZA 3GAZA 1RMTA 4QDKA 4PG7A 4IOKA 4E5KA 3ZJYA 1JEYA 2CXRA 3RYIB 5JAUA 1N5IA 3Q10A 5KYTA 1T8RA 1TB4A 1Z2OX 1I6MA 4CUZA 1FFSA 4BLWA 1NXTA 4F2HA 3WA7A 1G6OA 1F0NA 4WKNA 1LFDB 4TV8B 3CMMA 3VKVA 2I8LA 3WL5A 4OTZA 2QX4A 2RCYA 4JWTA 3SX0A 1SB9A 3KPVA 3H5RA 3NVAA 1L5LA 3H75A 4WK2B 4NFLA 3ZY6A 3TLYA 2YV5A 2ZQYA 5TE9A 1PGOA 3UKDA 3JQAB 4RSMA 1PSWA 4K9OA 3UJ8A 3DEYX 1SXHA 2C77A 4KAJA 1ZWKA 2YV2A 4MV7A 4GUAA 2OO3A 4UVIA 3KAJA 1XTRA 5KTPA 2ORIA 1GILA 3ESQA 4XIYA 1SMKA 3TSWA 1MJ5A 5BRJA 1U7TA 3I6IA 3Q12A 5AKEA 3KZ1E 1U7HA 3EVZA 3PZBA 4H0CA 4RSGA 3SVTA 2FPIB 1SQ0A 3EPLA 1E61A 2EU8A 3KJNA 4IIBA 1T8SA 1BXGA 1TC2A 4HVLA 2OKGA 1HNZB 3IAHA 2XOXA 3BDIA 3DO6A 1KZ9A 4ER6A 1EG2A 2Z98A 4ZIRA 1V8FA 5C8YA 3CLUD 2EL9A 3GRZA 3KT6A 4ZZIA 1YOVA 3BXHA 1W4BA 3QW2A 4WNAB 3RC7A 2BTQA 1AQJA 3DAGA 2KB0A 4H1VA 1G5RA 1I1HA 1RHQA 1V9SA 4EF5A 4XDZA 3IT3A 2NYUA 3BZUA 5HIJA 4U4AA 1QXSA 4FJ2A 2VHYA 1Z0AA 4W8GA 4R8VA 1P1RA 2GXAA 3CUVA 2HA7A 1NYTA 1AGPA 3D4OA 2YNMC 4KH1A 4YROA 3U4GA 3O0TA 4B8WA 4LOJA 5EJFA 1L3CA 1C9DB 1N25A 5A6SB 3TCKA 3TVYA 1G0NA 2JLVA 4O4LB 1REQB 2B94A 1BAPA 2DQYA 2VH1A 3L2OB 3LLVA 2AMJA 4II7A 2CLFB 1S8OA 4NIMA 1BFDA 1XKTA 5HYVA 2RMKA 3ABRB 4KSCA 1RE1A 1LY1A 4IXNA 4FHZA 4WL0A 2XNCA 4L8GA 1TJ4A 1Z56C 3QXGA 3JWEA 1JUDA 5I7VA 3M1AA 2AJCA 4EO7A 4CGYA 5F76A 5HKBA 1MFZA 3G2OA 4RHCA 3LC2O 1N2CA 4G97A 1CUIA 3PQ3A 5CA0A 5LZ9A 3AEQB 4LYHA 1GCIA 3DGFC 3GRCA 3EIHA 4FE7A 4C6RA 5JWOA 1X1CA 3PVSA 1FMCA 2QN9A 2GJAA 1C0KA 1HE5A 2DFDA 2VP4A 5BSHA 4OB6A 2CLHB 3N76A 4RFVA 1T9KA 5FI5A 2J3EA 4LYJA 4P80A 1P3DA 3BA1A 2EWMA 3V7FA 2I4MA 2PPVA 2Q0XA 4ZJUA 3V8QA 5JH7B 3BJMA 2A5DA 1B1CA 4BNMA 1Q57A 2J7PD 2OVFA 3ZGZA 1NXPA 4JC5A 4WTOA 2GA8A 4QT4A 2VZ0A 5HKKD 2XOKD 2X2EA 2C4HA 3ISVA 4NCJA 2J6IA 2XB4A 3C3WA 4PQYA 3PNPA 5AKGA 2AN1A 3LW7A 3AHIA 1CUSA 4HZUA 3V2GA 2AFIA 3ZTYA 1WNFA 1TFUA 1Z29A 2WKQA 5EZYA 2I4IA 3F73A 3W8EA 5TQ0A 4BKMA 2H1HA 1RBQA 1Z4JA 2XRFA 2P6PA 4AO6A 5JYCA 5LIRA 5B1SA 4LJ4A 4NF2A 2H2WA 4MRVA 4WUVA 1MR3F 1Y82A 3DM5A 3L1JA 5LZ5A 2Y93A 3HM2A 1F0YA 3X1DA 3MB8A 1Z5WA 1XCOA 4RPKA 5ALHA 5KSWB 3BQNB 1NVKA 2GPNA 4Y3UA 3HN7A 1R2QA 2YWFA 1OAOC 4UD2A 1P81A 4HDRB 4B8YA 1GCOA 5CT8A 4F85A 1QG0A 2OGSA 2OQIA 4E3ZA 2XD9A 5DLYA 1M67A 2ZSHA 4ZEMA 2WICA 4QD3A 1VXRA 4CF5A 1KY4A 1DVRA 5B2FA 4R8SA 5FLKA 2PXHA 2NTVA 4TTQA 2I1VB 2VCHA 3BH6A 2EYQA 3ED1A 3COWA 2OK7A 1AT1A 3IEXA 4HRXA 4IIYA 4KJZA 4MA4A 3T54A 4QFDA 1Z68A 1RVDA 1H5NA 4HLDA 4EGFA 1PJ4A 4J7XA 2ERYA 3B89A 4ZALA 3GGPA 4MUIA 4WLFA 1C3VA 1D4AA 3EWSA 3VNAA 4AS2A 2HA4A 3BKWA 2BFPA 5IC6A 2VJOA 3DE3X 3I0MA 1CWUA 3H5OA 4RPCA 3SZOA 1HLDA 4EM6A 1B6GA 4RTLA 5CG1A 3HEAA 3GJQA 3IHKA 1KYXA 5KTNA 3UBTA 2HI0A 4PQEA 3JQ9A 4P38A 3JZIA 1NUUA 2EP7A 3HP1A 4R2LA 1T8WA 3JD4A 1LRLA 1TZJA 1X1TA 2BLLA 2IHUA 2TMDA 4KACA 3ELBA 3GGOA 3NYWA 2XUZA 4K9DA 4EYGA 2O8CA 1MDFA 3FFXA 5C1PA 3PV0A 4MWEA 1K7FB 3L7AA 3FI0A 4MDHA 5LBTA 5TJHA 1KZ1A 1S6YA 2JCVA 3GLIB 4EECA 4OQEA 1W48A 3FWKA 3HLYA 3T4XA 4BB9A 2MYPA 3I2KA 3OCYA 3OM1A 3TDMA 1F4PA 4BEBA 5IXYA 4PONA 3USES 1E9DA 3W7VA 5JSFA 2B5WA 4BFCA 4Y0NA 2X3FA 3EFBA 2XNDA 3GGGA 3QOXA 2XWSA 3LPLA 1J0CA 3TNYA 1ABBA 5AW2A 2ZBUA 1QDEA 4TRJA 2R8YA 1XZNA 1JP7A 4WZAA 1MF7A 2BHSA 4EG3A 2J7KA 4PG4A 4DARA 3DR3A 3MW8A 2X42A 1XQ6A 1X9IA 2HA0A 2IXGA 3KT3A 3QJYA 4M8NE 3PX7A 4WVLA 3AQ4A 2A58A 3ESBA 4Q93A 1GNPA 4QO7A 5ALZA 1CY8A 3U09A 4ZV9A 1IM8A 4HNVA 3JQ7A 5AJUA 1LLQA 2K7ZA 2I55A 5C7IO 3TLJA 1T9AA 1XCJA 1ZNQO 4RBNA 1OTHA 2TECE 4EYQA 1P6QA 5ALIA 2QRKA 1QF6A 4DV0B 1KH1A 2ZSJA 2B0CA 3L5OA 2A0XA 4KK4A 2FPXA 2HHJA 3G9QA 4FCVA 3WQRA 5E4FA 3NEPX 4J94A 3FPAA 5IMSA 1L8XA 3BEOA 1TNDA 2MJLA 1I3NA 4P4TA 4ZRNA 4B5LA 2R7NA 3PG5A 1V47A 1AM4D 3SR0A 1M0WA 3RFXA 1AIPA 1N7IA 2FWJA 1ISMA 1DKUA 2Q1SA 1V5EA 5G1PA 2BSAA 2PSFA 5EZQA 1EFRA 2AFHB 3QSGA 4HN9A 2HXGA 4KGZA 1Z0KA 1EEXB 2OMEA 4Q18A 4PGHA 1O94D 1QIJA 3UC5A 4ZEVA 5JS8A 1G63A 1CXZA 2BKAA 4XUCA 1GT6A 3AHFA 4AZWA 1G8JA 3AVTA 3LC7O 2WJ4A 3D6UA 5IJ9A 2BMDA 2NO4A 4ZD6A 3JD1A 4W9NA 5K45A 1RQ2A 2ORYA 2MWMA 1U3CA 3CZAA 4F72A 2CNWA 1FNNA 1XDSA 4BMOB 4ZDWA 2YH2A 3B2EA 4S0XA 4U5QA 2V6BA 3ONDA 1JVSA 1G4AE 4PBSA 4F2GA 1C50A 2O05A 4IF4A 1UT8A 4D8XA 1NTRA 1I36A 2JBWA 3MS2A 2IFTA 4H7DA 5AMXA 5J59A 1BHO1 3OC6A 1AZLA 1W87A 2XEXA 3BAZA 4YCBA 5FBVB 3LQQA 4QEKA 5H02A 4K03A 3HYTA 3ULKA 2OQVA 5KPJA 1ZCZA 2E1RA 3L92A 1JN0A 1UWLA 1VJTA 2FW8A 2WKPA 3NDIA 4JX8A 5K0LA 5CB6A 5E4JA 5BR7A 4LGVA 3UGJA 2Z2IA 3HY3A 2TYSB 1LJLA 4KREA 3NUQA 4O8ZA 5DP2A 5ICCA 4RAQA 1MNAA 3OD1A 2QS9A 1I6WA 1W59A 2L19A 1JJBA 3LQRA 1DP4A 1ECPA 2WE7A 4P9NA 3LPCA 3FN4A 4KFRA 3U1VA 2XDQB 4TWAA 1IBSA 1K7XB 3GARA 2R86A 3QH4A 3LT1A 5ICSA 3PXEA 4YIKA 5EZ6B 4GIBA 3FTQA 1RJGA 1X77A 3CVJA 3R41A 4LAFA 2OUKA 3GG9A 4PYOA 2B4QA 2Y0PA 1EJBA 3WNZA 3SFVA 1NAHA 1CQPA 2LE0A 4G1UC 3OQIB 5TQ2B 4DV7B 1ESNA 5C4IA 1E62A 4MGKR 4ZU1X 1HETA 1VE1A 1NBME 2I29A 4OVKA 4UD6A 1H8EA 3GEDA 1SBTA 4BN4A 4MKZA 5KNCH 4BZZA 2GEBA 2R79A 3DTNA 2C98A 4KBGA 3GOHA 5DYGA 3RIGA 5EE5B 4NNOA 2J48A 5CVUA 2C7VA 4Q4CA 1HDGO 2X14A 4P0QB 3U9LA 3ZCXA 4UDXX 4ZN6A 4ETIA 4X8OA 3VVBA 4TXNA 5LVAA 4HGPA 5K6RA 3WC4A 1NN1A 4QQFA 1PR4A 3MJEA 3OQ6A 5HF6A 1EX1A 1H4TA 1P8JA 4HH0A 3TW0A 5C34B 2J08A 2QN7A 4KN8A 2VRCD 4LA4A 1S1MA 4OHPA 1EFVB 4PX3A 5BSVA 2O2HA 2YDXA 3FTCA 4GECA 1JHMA 2X0IA 4EX6A 4EJSC 1Z2DA 1RYDA 2VEDA 4GOJA 4LWPA 2O5CA 4QLBA 1XMOB 4FOPA 4C03A 5F35A 4NCKA 5CM2Z 3D8HA 4PSDA 4Q03A 5FNZA 2ODQA 1EGMB 3T52A 3N6RA 1N6IA 1LD3A 5CFPA 4J7CA 1M8GA 4GRIA 3TDKA 3CXUA 4GXRA 4H77A 4GP7A 4XFJA 1KBQA 3WGYA 1A5SB 4HHEA 4BGEA 1ETUA 3WWDA 3SMQA 4ZZ1A 2VPZA 4LK3A 5GWXA 1WUJS 1MENA 1XEAA 5B58C 4PFQA 3RFVA 2XBLA 3B6KA 3QE3A 1ZGGA 4AG3A 5JNUA 2OE2A 3PHHA 5KSYA 1VG0B 3OIUA 3C85A 1N9KA 4ZZ2A 2Q1TA 4N0PA 2SBTA 3LLSA 1QTNA 2BDTA 2W6MA 4DNPA 2V55B 1B16A 2QT0A 3CMCO 4RACA 1M6HA 3QKSB 3TD6A 1KH2A 2BFNA 4NXMB 3OMLA 5JROA 2R6CA 1SOAA 4GOLD 3PR1A 1O08A 3ZQ6A 4EL5A 2VQEB 3HPRA 2RGCA 3ELUA 3OUZA 1H3EA 1MZPA 1HE1C 5KYXB 4B8ZA 4P58A 4KFCA 3BHJA 3D6MA 4RMIA 1FBNA 2PYIA 2XJ9A 3HJBA 2P6OA 1XO1A 2WHPA 1T3SA 4LPKA 4NEGA 4ZO8A 3TOCA 3PCRB 1ZIOA 5T4EA 5CUQA 3WQQA 2YY6A 2CD7A 1VCMA 3GLHE 3ZIUA 5LP6B 5LYJA 4LQCA 2WW8A 5BVHB 5AW0A 1XBTA 3UUEA 1CZLA 3QI7A 3TZBA 1ODLA 5KYVA 1M1ZA 3DE5X 3LSTA 3Q7EA 4D02A 3I0NA 4IUDS 4EFMA 5JZSA 4Y8VA 3MMXA 5IVDA 2C03A 2VNKA 3EQ6A 5F2NA 2JCBA 2VJAA 3H13A 1MQSA 1G1AA 4M0UA 2P9BA 1LUAA 1NRJB 1KE2A 2YC2C 4ON9A 4F71A 3FE2A 2H65A 3V2IA 2HUPA 5DN9A 5CBPA 4ZICA 1CERA 1SUFA 2D8AA 2HO5A 4MGIR 4E1VA 1BYUA 3MXOA 4K40A 3GPLA 1R4MB 3OU6A 4PLWA 2IHNA 1MJGA 4OKIA 4YP5A 2V6MA 3IIJA 1Q7CA 2NT3A 1ADGA 5JG7A 2WI8A 1NBOA 4NX2A 3C4JA 4MEBA 4KUGA 2Y77A 4DLPA 3O7WA 3CRQA 3VTKA 4IUYA 3HCAA 5DTRA 4DMMA 1YZFA 2X2PA 4PYRA 5CD9A 3SCZA 2ILVA 1NN0A 1MC5A 4ND6A 1X7WA 1JFFA 1DEHA 1UBSB 1E2JA 1D0IA 3HLTA 3HI6A 3R5TA 1K6MA 1RRGA 3H5NA 5L7TA 3EH2A 3QX3A 3VV2A 4PR0A 4FFNA 1QM5A 2Y6VA 3GUUA 4TVOA 5LQRA 4CR7A 3CVXA 1J4AA 3ZX5A 4WINA 5LXTB 1XPOA 1TT5B 5FJJA 1OC2A 4N3CA 3NBKA 4Z1MD 3F67A 4EJ2A 2YJZA 4D0GA 5DI3A 3DG9A 1UKVY 1Z63A 3CB2A 2ET6A 3PE6A 3PR3A 3QENA 4CEHA 3EXHB 3COZA 4NH4A 5AVOA 2ERXA 1DEOA 2Y1EA 3FRJA 5AI4A 5H3CA 5BPHA 5KJFA 3J81k 2JJ1A 3KS9A 4B3XA 2X1VA 1XLTC 1OLSB 4GVLA 4S1VA 4XGNA 1M0EA 1HV8A 2G28A 1X19A 5LZ4A 3U62A 2ERCA 1XALA 4A2PA 4OSOA 4F3TA 1R0YA 4MRNA 4URYR 2OCGA 3BUSA 4RESA 4FYWA 4F5WA 3HJUA 1G3MA 4I14A 1KO7A 4TT3D 3U0VA 4DJAA 4QJIA 2NXJA 2JEOA 4BFUA 1INLA 4K7JA 4MKIA 4WCFA 5KX5B 2C7PA 3S2UA 4J76A 3O82A 2JLYA 1JHDA 3CRRA 3R6LA 5CNMA 2FEKA 5BV2P 3ROEA 5ITVA 3PGLA 1M6VB 1Z5OA 1TEHA 5GINE 4RQAA 2HDOA 4RVNA 5LMZA 3M5DA 3LQKA 1P0PA 2VYNA 1RKVA 3EIXA 3INYA 5FEMA 1U5BA 4R1NA 3FB4A 3ETLA 3FIJA 4Q1BA 5A3SA 2HWWA 3JQQA 3ICWA 1E1KA 4FMBB 4XH9B 1XJ0A 1S7CA 3RKRA 4EHLA 2A9RA 3EXG1 1EXVA 4ZEOA 1NN5A 3H11A 4HK4A 2QPOA 1U1CA 1E63A 1RMQA 3CCCA 3DMTA 3ZVNA 5CB8A 4B3TB 5A6VA 1DKNA 3EVCA 1XPJA 1PYGA 1GCGA 1SK9A 3ER8A 2FZWA 1ZJJA 4LCJA 4FYVA 4PNEA 3AX6A 4TZ6A 5DTIA 4J0IA 1V16A 4WACA 1IZ8A 1X3LA 3P5BA 2E82A 4CQNA 1JA0A 1P2BA 1ENZA 2DTDA 2EZTA 4MQUA 5JTTA 1FU7A 5FBWB 1YCGA 5TEVA 4EPYA 4PYIA 3CUSA 3D8TA 3WRYA 1YRHA 3H3JA 4RZHA 1Z17A 3QLJA 5K8UA 3RS0A 3W5BA 1ZJ4A 1P18A 2AEFA 3HU2A 4PE5B 1CDDA 3WGZA 1MHPA 4CM5A 4MLPA 4HFRA 4AURA 4HB2A 1IY8A 4UXJA 4R83A 1UINA 5FBKA 1RRVA 4E2FA 1YS4A 2SHKA 1BU8A 4UHKA 4CKCB 3TPCA 2D0IA 3OIVA 4MVCA 1VLZA 3SEFA 4PO3X 2GZSA 2KS6A 5COQA 1XNHA 3LCUA 5IJ0A 1A1VA 5HDBB 1VSTA 1G8HA 2D00A 3RS3A 3W9SA 1RZRA 1RLOA 5D00A 1CS0B 1LBSA 4LHVA 3K73O 1QANA 4Q3EA 4LMAA 3NIFB 1R9NA 3VZCA 4A8PA 3NHAA 3NU1A 3IIEA 3P27A 1KQ3A 5EIOA 1SKUA 4LJSA 1Y4AE 2QTZA 4R9UC 4J4HA 1SZDA 5H0IA 1NNEA 3A8TA 1MU0A 3SZLA 1KPIA 3ROGA 4OYLA 3S3TA 4OYYA 1XKQA 3QWHA 4DLZA 5AJYA 3STTA 5D5QA 2K7FA 3Q6IA 5LXTF 1OI3A 2Q5QA 3R24A 1AB5A 1PJ8A 2AK2A 3DAFA 4TYQA 5EKTA 1YO6A 4IZHA 3KOZA 5H81A 3S8MA 5IT5A 4NESA 1IM5A 4YN3A 4TL8A 4RKYA 1NJ5A 3HA2A 1CF9A 4KYIB 1C80A 3EGOA 5CEFA 4L4ZA 2NO9A 4EYSA 1DC6A 1JE1A 5D87A 2WU4A 1RI2A 1RWBA 4F1WA 4G8BA 3TRHA 3WGUA 1YJ5A 2YW9A 5FFNA 4G2NA 4FKMA 1KEPA 3OHMA 3VR4H 4H3VA 4JBXA 3VZSA 5ABPA 2EBUA 1U2DC 1FFXA 1M7HA 4MW1A 1MFPA 2FEWB 3B51X 4JN6B 1HYGA 4X71A 1Q1QA 2W43A 3KUXA 3SN6A 4LKOA 4NE7A 4NJEB 5FPKA 4GZ5A 1J20A 1GQOA 2I67A 3CF4G 2ABWA 1SULA 2CLKB 5CLIA 4D57A 1ILWA 2V9ZA 3IJPA 3MPOA 1QTQA 3R7BA 2O8EB 5A4DA 2ZJOA 1TZBA 3CVUA 1PG0A 1LCIA 4RA6B 3U60B 4IOMA 4EHDA 3WGMA 1QGED 4LC9A 1GN8A 3V3TA 4DJDC 3S8YA 3RPEA 3T6KA 2WTEA 3FZNA 3ROXA 1S8FA 2Y1XA 3DBRA 1XZQA 4HWSA 3K70D 3BMQA 4HNAA 4ZGBA 4F7WA 4YT2A 1BQEA 2JVIA 1ACMA 2RJNA 4BKRA 1K7YA 3Q8WA 1ZK3A 2Y8EA 3O4IA 1ODJA 3I05A 5IHXA 4TLCA 3I2FA 4YWJA 4L9AA 2NSHA 2WM2A 5K8VA 1C1DA 1JTEA 1YTUA 3EDYA 1M1XB 3OJOA 2VQ6A 3ABIA 4FT2A 5KKNB 3FROA 1KKUA 4REMA 2IXAA 4O25A 2JIPA 3ET5A 3R0IA 4UAUA 1KYTA 3VNQA 1PWXA 3I9NA 3MAJA 2RC6A 1B3RA 2Y1DA 2YUIA 4Q16A 1P4HA 2HADA 4CMCA 1LBEA 1Q7BA 2H4WA 4YPVA 2A33A 4CMAA 4MP8A 3H5AA 3OOJA 2FQQA 4I9HA 3SWWA 1UJ4A 1V5GA 2QTLA 2P4UA 2FRDA 5LWHA 3MERA 3L02A 1C7FA 1MO6A 4BMCA 4EW3A 3OT1A 5CGZA 2BKEA 2NU6B 3S1LA 2P2NA 2QDXA 1PHRA 1RQRA 2V6FA 3DOEA 4GX2A 4XEUA 3UIEA 5LJLA 2WOOA 1K5PA 3ZE8A 3ITKA 1A77A 3FAZA 1Q0ZA 4JT9A 4U7GA 1JAXA 1FDUA 2IPOA 2QJFA 3PDIB 4TTTS 4XGQA 3UWSA 1CUDA 2GNAA 3F2IA 4B17A 5B6IA 1JBQA 3BGDA 1DEXA 3V32A 1XX6A 2VBCA 4RJIA 2VHCA 1SIBE 1F2TB 4FUTA 2CF6A 5I7FA 1SXQA 1LJUA 1M2WA 1C3XA 3NPAA 5AKXA 1FS4A 2G5TA 4BFYA 4ZKDA 5KNDD 3A9UA 5B53A 4D4MA 3REGA 3RLFA 2OO5A 4S05A 3CE9A 4Q9NA 3MELA 4NJMA 5AK3A 3ICQB 3TMYA 1E4OA 3OTHA 4OJNA 4E6PA 4ESEA 2JLBA 1QLJA 4QJ5A 4HEJA 1AUXA 3ASYA 5JC8A 5JXGA 4RGBA 1YR6A 5L4LA 3A2KA 1G8MA 4IKOA 3RYHA 2E55A 4KFTA 2QYOA 1TCVA 3H8WA 3E9CA 3DUFA 2C84A 2B30A 1H2EA 2I7XA 4DN6A 1ONBA 3K2EA 5TGTA 4G56A 1OH6A 2I6SA 5KS2A 1UFKA 1Y9ZA 2WTMA 4ZEXA 3SKVA 4YXWD 2PSHA 1Z36A 3H42B 4PZPA 1PQWA 2Q29A 2NYRA 3W9BA 3M4ZA 3QXSA 1XJCA 4KQ9A 1DOZA 2AI2A 4P3XA 3RC9A 2CZCA 2YINC 2QBYA 3FMVA 4IHJB 1CRPA 4IDEA 2SCUB 3CUTA 4D2IA 5I45A 3NEYA 4G0PA 4LJ7A 2J59A 1SOWA 3SIRA 4MW4A 4QULA 2QIPA 3HADA 4CL2A 1GAQA 4IEFB 3H9GA 4NV0A 4NYMQ 3S4YA 4JP8A 5BNZA 2XTNA 4N8DA 1KAOA 4XARA 4X91A 2XD4A 2XIJA 3ETEA 1I3CA 2VOJA 1M10A 4LZLA 1OVMA 2A9QA 3MCVA 2JGAA 1G19A 3L6UA 1OJ7A 3IQEA 4G4SO 2DTXA 3KTAB 4Q1DA 4XLTA 3TI7A 5AVUA 2RAPA 1ONSA 2Q46A 2E5WA 4OGFA 3RSCA 1D1PA 4BXOB 1NKVA 3MJVA 4M0FA 4RNDB 1JDZA 5JVDA 2CNBA 5D2CA 1PIWA 2VUIB 2ZWAA 3MMSA 4N3NA 3W8DA 3WNCA 1RE0A 3SGLA 2R8OA 1PQ4A 4BIMA 4XVHA 4HB4A 4J1TA 4WQMA 3DEKA 3Q3JB 3IS3A 3ZCPA 3KR9A 2H1LA 3AFHA 5FPTA 1TO6A 4XXHA 3T06B 4CKWA 4M54A 4UVDA 3JAWB 2BEJA 1VIDA 3CZRA 1G21B 3PRHA 3RE1A 4YRIA 5C80A 1DCFA 1BX3A 3CH7A 2JLXA 2QE6A 2DWUA 3QWFA 4OHOA 1K86A 1ISFA 3PKZA 2LW7A 1LSSA 1N8KA 4JI3B 3WRWA 4IUBS 4MIEA 4AN4A 2EFHB 2OZVA 2PLAA 3U3RA 4C1BA 2HMYB 5IZ4A 3CN9A 3MWDB 4FDUA 4QGGA 4ENVA 3VNRA 2PNJA 2L42A 4HL6A 2JB9A 4MUGA 4FONA 1H1LA 3C7TA 5JCOC 3EW7A 4N0QA 1NBMA 1R0BA 1WDLA 4R01A 4CQJA 5ALMA 1XZFA 1R88A 2WPDD 2YIDA 1IQ0A 1B8PA 4C76A 1PUJA 2C9DA 3H5LA 3O84A 3QU5A 3QVXA 3R5KA 3BIOA 4M36A 4Q37A 3ENNA 4RCVA 5C5IA 1N6PA 4X8MA 3TL2A 3DOHA 7MDHA 1NUAA 5G0VA 2BEKA 4ZT6A 4QG3A 1K8YB 2FX3A 5BMVA 1DTEA 2DKNA 5ARDA 3O8CA 1HQYE 4UMEA 5JALA 2WK1A 3U0BA 1A4RA 4G89A 3H04A 4G5FA 1CG6A 3IA7A 3ORSA 4CODB 3TLKA 2WLSA 3TVDA 1IWPB 3ONWA 4BL5A 4XGRA 2OAGA 3MRVA 1NW7A 3AILA 3FCXA 4IDHA 3VU0A 2CLMB 3F6CA 3K96A 1H0SA 4JL6A 3WGNA 4F4UA 3CEJA 3SQNA 3AUXA 3VYRB 1JEQB 3AFIA 1GO2A 4O1HA 2OXRA 3JYLA 3VPAA 1OXUA 4I6GA 3FVRA 2OBBA 3FMOB 4HAUA 2H0RA 4LWZA 4CL0A 4YRSA 1EM8A 4L57A 2BMVA 2QN8A 5JQGA 3GLGE 3G5AA 3IDFA 1P17A 1Y5RA 2WWRA 1XHLA 4FNAA 4XM1A 2VYVA 4XR9A 3T5BA 2AOUA 3VVLA 3QEKA 2QX8A 1OMOA 4B2YA 1JR6A 2QRLA 3R3JA 5BSUA 5C9ZA 4ZO6A 3DR5A 4F6RA 2REBA 2JZOA 4TL9A 1SELA 5EJ7A 4ZANA 1H9CA 5EMMA 4HZGA 1QP4A 1AS3A 1XQYA 5FIUA 1IBMB 1PJSA 4RANA 4BDTA 3E5RA 1LZLA 3K9WA 1TEXA 1GPLA 4DIOA 2HFJA 5EJ2A 1XQVA 2EBHX 2X8AA 1R00A 3EY4A 2ZTHA 4GM1A 5D5HA 5I4BA 2REXB 2BFBA 2PSEA 3CT4A 1NWHA 5ALDA 3B3GA 3IO5A 5FYDA 1A71A 3AY6A 3GY0A 5TQVA 4ID3A 2CFIA 2GCOA 1E2GA 1F38A 2AD1A 1NVDA 5CEEA 4X84A 4NSNA 2C0PA 4EEKA 1LI5A 1PEKE 4AI6A 1SCAA 4YMWA 3CIFA 2RKWA 3VKHA 4IV8A 3GLHA 1FQWA 3R6GA 4B6FA 3L7KA 4JUIA 1Y48E 2P78A 1GTJ1 4B3IA 2Q4OA 1WMAA 4D4IA 5HOQA 3AB3A 3G1UA 2GVDC 2NXWA 2ZUEA 1RHJA 4IG4A 4Q3DA 2XGJA 4DE5A 3INRA 1GXSB 1JU9A 2BLNA 3JD2A 4XLZA 5FUQA 4U6SA 4EB8A 3HJRA 4C7BA 5DBOA 1IVNA 5AKKA 3NNSA 1GPDG 1O97C 2UZ1B 4UNPA 1XEXA 4YJ2A 1E89A 1HMPA 3LU1A 4TSFA 2G40A 3B7GA 1PSDA 3OAAD 4KO3S 3C8ZA 2J9GA 5B4TA 3R74A 4CEIB 3M6MD 2PZKA 4XSVA 4V1CA 4DC9A 3GNQA 1YQXA 1E1RD 2VSQA 4NPAA 1PDWA 3OBIA 3OLVA 4QA9A 4TSRA 4ASUD 1RD4A 1A98A 3RSFA 5AW5A 3IPXA 3HR7A 1YFZA 5FPQA 2XQKA 3TZKA 2EGGA 1NU6A 3OKAA 1VZ3A 2AOTB 3DE1X 3PFBA 3U7GA 2V3VA 3B1ZA 2J0UB 4HB0A 4M0KA 4BBJA 4CDMA 1NVXQ 1VYTA 1A04A 2D59A 2XWQA 4A0HA 4BV2A 4IO0A 3TG8A 3QF7A 1E9CA 1L1FA 2ZCJA 5IBRA 3PQ5A 2VUTA 4BO0A 3L7DA 3BXOA 4N49A 4JYCA 3UYKA 1U80A 4BASA 1TUBB 3KE8A 4PHFA 4V24A 2H16A 2PS3A 4NBVA 5EIFA 2ZYRA 4ARUA 4Q3KA 1H2YA 1NQAO 3AUAA 4GGOA 4QOGA 1U9IC 2WD7B 5ERYA 2X0NA 2FJ0A 4EKDA 2WF7A 3OKFA 1PV4A 1XQXA 1P80A 3AIOA 5FWYB 5KAMA 5FBZA 4IX9A 2C8VA 2CVOA 5DM60 4E03A 3BE8A 4JYZA 1ISRA 5J9FA 1OOEA 2WWYA 2HWKA 4N3AA 4ARCA 5HVNA 3KVYA 4NBRA 2VHVA 4DANA 3ETNA 3MCZA 3IHTA 4B3SB 1ZINA 2D54A 1S01A 1EZ4A 1XQ1A 5KREA 2YOFA 2Q49A 2I87A 4LDJA 1BXRB 3ZPXA 4OAOA 2QTFA 3DF7A 3QIAA 1N8SA 3AHEA 4UCWA 5DCWA 2ISCA 3LFUA 4QTZA 1NYLA 2Q2OA 3ZWVA 2YYAA 5EWLA 4BLPA 4XTCS 3M2PA 4MVJH 4D0RA 1KSFX 4A2CA 1GZ4A 3NUZA 3TWOA 2FZVA 1JG6A 4ZCSA 3FOCA 3D8BA 4RIFA 4LFAB 2PO7A 4ZTBA 3H4VA 4L9SA 2AZDA 3DL4A 3IP8A 3UW3A 2IWHA 5JY1A 1UP4A 4G9GA 1GPMA 2G82A 3BOSA 4ZEWA 4HNQA 1Z5GA 1ZK4A 2F3RA 2YY7A 4V1CI 1N2JA 2E6UX 1TU3A 4M1MA 3R9KA 3KV3O 2Z6VA 3GG2A 1E96A 3OHSX 5LZ2A 1PFYA 3DUWA 4HAOA 2UUAB 4HQOA 1L5OA 3L04A 3GIWA 1FNBA 1ZI6A 3AHCA 2Y9PB 4UHCA 1LW6E 1ZI9A 1KY5A 4LGYA 4TPKA 3H2ZA 5IJXA 2CHFA 2J3DA 5K09A 3OE7A 1FTGA 3KDSE 1UM9B 3L7JA 4MUMA 3LUGA 1SCKA 3D1JA 3WKDA 1MD9A 2B83A 2RJ3A 3NCTA 4CMKA 3PP8A 4RY2A 1ORRA 1CEQA 3H2IA 3TQTA 1GU1A 4HDKA 2VDOB 3OF2A 1U7DA 4IH9A 3ZE1B 1EQUA 2MSLA 4HXEB 2ZLBA 1C30A 1U8YA 1V2GA 4B75A 1WDTA 1A0OA 4YFVA 5HIMA 1A9SA 1M6YA 1JYFA 3AU8A 3GGCA 1Y37A 2C29D 5I01A 3GBSA 5TXGA 3LYAA 6ADHA 1GGMA 3BSYA 3J81A 4TLEA 1TECE 2IDZA 5JCJA 2FPMA 3TINA 3E1KA 4O2BF 3H97A 4G09A 1YE3A 2Q8PA 4RQTA 2XZOA 1TD1A 3O8LA 5CT5A 1VLLA 3ZU2A 1UF9A 2K4MA 3ABQB 1L3IA 1U7PA 5IVPA 5EHZA 1TVKA 1CUZA 3W2HA 3D7NA 1PL6A 4I5DA 2WIBA 4DL9A 4MB2A 5ED0A 1QV6A 5K4HA 4K0RA 1H0HA 2TMGA 1OFUX 2AXEA 2O4UX 1RAIA 2HRRA 2R6FA 4B4VA 1WR8A 4KGDA 4QO8A 5K3AA 2I2CA 3IUJA 4O4JA 3LHSA 3R7WA 4YT8A 3S8EA 2P5TB 4BV8A 1NXXA 3R3UA 5F73A 1PEAA 4D26A 1R6UA 4J90A 4XWKA 2CSXA 4HXYA 3RJ5A 1QGUB 2CC2A 2IEGA 3CV3A 4OH1A 3RJ9A 2C2ZA 3M9LA 4HAXA 1Q7EA 1F1JA 1RPJA 1X2BA 2FA9A 5JI3E 2G77B 4BKQA 3WL7A 4BMNA 1B43A 3ZWNA 4XX1A 1UPAA 2BH2A 1MEJA 1ZVVA 3BB3A 1SN7A 3NANA 1YJBA 2DPLA 5JXWA 2MINB 2RI0A 4PQFA 2IS6A 3JVDA 1SB8A 1F7UA 3KPUA 5FAKA 4F38A 3EUAA 3SZRA 4F0JA 4B2LA 3PEWA 4RS4A 2EJCA 2PS1A 1NIJA 2Q3DA 4YH1A 2P4HX 3OCWA 2HJRA 3VAYA 1CULC 3DULA 3ZD9A 2B2NA 1CY2A 4YMLA 1H1TA 1US8B 1ZISA 4XQ0A 3AF1A 1SVOA 1Z4PX 2E4AA 4O4IB 4ZCLA 4B6RA 1D07A 4BC1A 4OXQA 2BRUA 1K6IA 2ZAYA 3DV0B 1DPGA 3HB9A 3PXCX 3RFTA 3THSA 1LK0A 2CMGA 4AFNA 2EATA 1KERA 4KLZA 4ND2A 2JASA 3V1LA 4G1FA 4OM7A 1V37A 1Y81A 2G5GX 4L0QA 2K6GA 4CM4A 3R8FA 1S3SA 2B5OA 3ZDCA 5DM0A 5U4QA 1AXEA 3W5CA 1VJ5A 5KHOC 1DEKA 2IDMA 3AOEC 5A3JA 2R6GA 2REQA 2EWWA 1YRBA 3W4JA 5EPUA 2HTFA 3TR0A 5A7GA 1AKYA 1YZNA 2ORED 1FYWA 1GYPA 2P2GA 3HCNA 4L22A 2QK4A 2RG1A 3ILSA 3I01M 4IP0A 4CW7A 3Q7IA 2IVFA 5HMLA 2D5IA 3AO0B 1E3MA 1WY7A 2CJYA 2D13A 3IIMA 4FOOA 1JQBA 3C8MA 2Q21A 4TWJA 4HDSA 4BAUA 1V7QA 3WGLA 1ZOSA 3KZXA 3SQXA 1DHTA 3VOSA 3V4RA 3IBYA 4GBGA 5FJIA 2O8FB 1ZAKA 2O0HA 4DMFA 2ZIWB 2C5LA 4PXAA 3AQIA 1Q44A 1H6CA 5CYGA 2CFTA 1CR1A 3AT1A 2VNSA 2BCGY 4MKXA 2J7PA 5IKMA 4X93A 3NT2A 4TWRA 3EA0A 3AVOA 1U98A 3JARB 5IT9A 2IU4A 2XOKA 4Y6PA 4P82A 1GU7A 1I24A 3CX3A 2BSQA 4DM7A 4LDRA 4GXNA 2JANA 3IODA 3IUPA 1JQEA 1ZN8A 2EKLA 2QLBA 1A5ZA 3C3BA 4DHEA 4XVCA 2ZRNA 2XMDA 2JGDA 5K3CA 5DSXA 2OV2A 2CYCA 2M9MA 3EIFA 1J7JA 2VHUA 1P3JA 2PBRA 3A36A 2DYKA 3DH0A 2GJ4A 4QTXA 4MEAA 4NYJR 5I8PA 3WWCA 1I51A 2GZRA 4EA8A 2P4SA 5D1NA 1PV1A 5TRTA 1HE2A 1LS6A 3DOOA 1QH0A 1X1QA 1Y3FE 5D7BA 1CU1A 1AGXA 4ZYYA 5CEJA 2O5RA 3U80A 2QVZX 3SXUA 1R7RA 4OF4A 4CCWA 1NR1A 4GKKB 5DMXA 2KM1A 3LYHA 4D8VA 1YDGA 2DC1A 3QHPA 4PAOA 5IYZB 1DUIA 4DQDA 3EVEA 2PA0A 5CT6A 4PSUA 5BV0A 3LF2A 1B7GO 3D59A 5LM3A 1XKXA 1MOSA 1DKQA 2I7TA 3L7BA 4Z0PA 1LV7A 1ZA1A 3IDQA 4G8DA 5LA6B 3RHFA 3WLMA 5BW5A 2AMLA 5CBKA 4FSXA 1X0VA 5ALXA 3WRXA 2Q2WA 4E7PA 2CL7X 4BIIA 2MMGA 4L16A 1GG8A 4NPCA 1EXMA 3QE4A 3HJNA 3VVCA 3OJLA 5C8XA 1JR4A 1XZEA 2XT6A 4QICA 2IPAB 5DRTA 5B12A 2I6QA 4E88A 3VV3A 4Z4EA 3W7BA 2QAGB 4QYSA 4ABYA 3NB0A 3MWEA 3EWNA 3H4TA 4ZVMA 4OP1A 2H48A 1ZS9A 2CY0A 1Y7HA 2X2OA 3L06A 3K92A 2Q9CA 3D3EA 2YS7A 1WQ1R 1S2NA 2HL6A 4G2TA 4KIGA 1MV8A 1GRCA 4PG5A 3AY3A 4MYUA 4YCJA 3DLAA 4AJOA 4BFZA 1RXCA 5FNVB 2CDAA 2C5BA 3R6WA 5IEJA 2GYUA 2C4VA 2G36A 1AOXA 5DHFA 1QFXA 4GDMA 3E58A 4NV3A 3COJA 4OMCA 1ZEMA 1YZVA 2OV3A 3T7DA 1GZVA 1FEZA 1NURA 1NYRA 2R68A 1XMSA 4LISA 4LY0A 4U7WA 1T8TA 3TJMA 2YYYA 3UM9A 4BJ1A 4L08A 3PDWA 4MNTA 4YEDA 5AWFC 3VH4A 3ZU6A 3I1FA 3EVDA 4JBNA 1MX9A 3ZZ1A 5JDCA 3AUTA 4DBZA 3STXA 3ZZ0A 3OWHA 4DT1B 4O4HF 2AG8A 3VH3A 1CZKA 2DHQA 4XCQA 3LY9A 4UHEA 1Z39A 2R9VA 3WP1B 2VJDA 3ZTWA 5CVDA 3J7TA 1T4MA 3DZFA 3HKDA 4JH0A 4P0TA 1G5QA 5AJZA 4EAQA 4ZI2A 5A4IS 5LD2B 5ADUS 1EE9A 2WWXA 3LPAA 3QLTA 4ILKA 2Z5VA 2ANBA 3DWEX 3TLMA 5JZVA 2W6NA 2FHSA 3X2SA 1OYYA 5CAEA 5EYPB 1DCTA 2CXTA 2ID8A 2Y71A 4R2WA 4QHYA 3JWHA 1M73E 1KZGB 1NN3A 1DC5A 1QH8B 2QD3A 2Q6KA 2VXOA 2PWAA 1SXJB 2XKJE 1YV9A 3I76A 3OZUA 1R64A 1XD9A 5E3IA 3T4UA 4CKEB 1AU9A 2YJ5A 3QPVA 3ZBPA 1RQNA 2QX7A 4JLSA 4LI0A 4LX0A 5FA8A 2C9OA 1PNTA 3HDTA 1EK2A 3OZWA 2QY9A 5FL3A 7GPBA 4CUJA 1GU0A 4UNRA 3HDJA 4JJGA 5FI0B 5J2UB 2JRCA 1L2TA 4KOAA 5H8WA 1O94A 1YNOA 4UREA 2BDUA 5C31A 4L6AA 1WMBA 1PS9A 3L0SA 1NQOA 1SJ9A 7REQA 1ZUNB 1YR1A 2X9QA 4A27A 1UMDA 1JI0A 1FLNA 2H4XA 3MINA 3WKBA 2VLIA 3NBMA 4Q7MB 3JYHA 1A2BA 1G2IA 4CU2A 1FP4A 3QXHA 821PA 1EWYA 2CCKA 3GA0A 5BNIA 4AMZA 3FBTA 3MLBA 2WSMA 2FHPA 2N0SA 2ZKLA 4GWLA 1E94E 1XC7A 2EJWA 2Q3BA 3AEXA 2I5PO 1QWOA 3WADA 2BOVA 1QV9A 1YONA 3KLMX 3CISA 4IQ8A 4PXSA 5JEEA 3KAPA 3KUDA 1UBGA 3D3WA 4AKEA 3FYUC 5ITWA 4X97A 3OFSA 2JGJA 2V74B 1CNFA 2C9YA 4EMBA 1B6SA 3BMOA 4US2R 2VRWA 5M29A 2ZBPA 2PKQP 2W8BB 1CRLA 1RJDA 3VH1A 1KARA 5GQSA 1UMCB 1MJGM 2KLHA 1RRKA 3NOVA 2G0AA 3K5WA 5FNVF 2FG5A 3CNBA 2E4UA 3VDXA 3FSRA 1DIRA 3X2EA 1WQ4A 1QAOA 5AOCA 5KOIA 1DIGA 2G25A 2JFFA 3OPYB 3HZZA 3RC8A 3JTMA 4PU0A 2DSTA 4HWGA 2GBFA 1YL7A 2Q5CA 4KDFA 2UVQA 2ZYDA 3OTWA 3NDRA 3OD5A 5K0FA 1TMYA 4EQ6B 5AM4A 4LDZA 1ENOA 1YDFA 2WSSD 3KZOA 3K0AB 3H19A 2IX9A 3HB7A 2WU0A 4UNSA 3TLBA 3UMGA 3VUFA 1I2DA 1ARZA 1X70A 2IT1A 4MQBA 2RB4A 3V46A 1YJXA 1L7AA 1L8AA 3GJ3A 3WK6A 2H11A 3EZYA 2BFCA 1L7XA 3AG5A 5FBHA 1NV9A 3ST7A 1GQSA 1N8NA 2I1LA 2P8JA 4QGHA 1XJWA 4RD2A 4ZCQA 1SG6A 5J4YA 3DT9A 4REOA 3U6KA 1EBUA 5AXAA 3LDFA 4LZJA 4CDNA 5EIEA 2IYTA 1LGYA 4NULA 1NKTA 5LP1A 3ONFA 3JAMA 2DPYA 2NZUG 1RI4A 4K9RA 2VRCA 4X1KB 3MBIA 4OXXA 3V2UA 4MHTA 4FDMA 5LWQA 1CLUA 4I55B 3YASA 1P4GA 2C0QA 3EARA 4H16A 3NC4A 1FSPA 5HJEA 2QN6A 5DU2A 3UZUA 2FFAA 3PLRA 3SM9A 2H1WA 4C29A 2J5KA 2RDMA 1JILA 4AULA 1IIBA 1LNSA 2Z1MA 3W1WA 1WCIB 3TOZA 1QYDA 1XA0A 1P9OA 3ZI7A 4TS9A 5DYNA 3W8NA 2G06A 4YAFA 3RHSA 4ZOAA 4CCAA 2PLWA 3T9FA 5EHXA 4CG3A 1I6KA 2H8GA 3OPQA 2ZBEA 1U28C 5LQUA 3LS2A 4YP1A 1JHZA 1IEXA 2BI4A 2O7SA 3TKYA 3GEGA 1XAGA 3GUCA 5DEIA 1FJGB 5FOTA 4UNQA 2IC5A 3R3ZA 4S0ZA 4JUBA 1Z8NA 1Y6JA 3DVRX 3I39X 3QF4A 2W6ZA 1S2DA 1IXZA 3UC9A 3U7QB 3OPMA 4DA0A 4N5HX 3MD9A 4QM6A 1KSGA 2BDEA 1BNCA 5B2ZA 1QHGA 1GUAA 2RHHA 2ZDGA 5H70A 4F92B 4OKNA 1VJCA 1XVVA 1SC3A 3GH1A 5DXFA 3A9SA 1KFJB 4UVEA 3UAOA 2X8JA 2I54A 3R1IA 3IOCA 3R40A 4NZ9A 5FLYA 5L3RA 1LFAA 4QFBA 1E4EB 4PIMA 3FYCA 4RJ2A 5DYWA 5SZJA 5JRJA 3U19A 2JLUA 3FMFA 4GPTA 3EFOA 1BYIA 4DQXA 5KVSA 3SC3A 1GSHA 4NQRA 2RSLA 3GLIE 1TW3A 2CVFA 3PHCA 3OQJA 4OXNA 4ZODA 4U1RA 2YWGA 2ACVA 1KSHA 3FTPA 4CETA 1K6EA 5A1JA 3QV2A 1Y9EA 3C2QA 5ALSA 1UBRS 2XYGA 1J8MF 4BEWA 3OFNA 2F1KA 1VGVA 1EFPB 2FPLA 2KMLA 3GYGA 5HBRA 2BMFA 3RWMB 3NMUF 1QGDA 1PDOA 2D3WA 1ES9A 1XTKA 2HNAA 3ZQJA 1GQRA 3KQYA 2G8LA 1QK4A 3UGKA 2VT3A 4CJXA 1DPFA 4AU1A 5TDHA 3SS9X 4UUAA 3ZCSA 1P6XA 4NFHA 5DGXA 1XE3A 3UTCA 1Y9DA 1DJMA 3TSYA 1KETA 3C4QA 1H42A 5KJEA 4MLZA 5BNWA 5LKAA 3FNIA 3R7LA 1ZSYA 1A9QA 1SVNA 2AR9A 2ZATA 3B38A 3L7OA 3KXIA 3QHQA 1YQEA 2G83A 2XCOA 2HSWA 3L6RA 3K8ZA 2JGRA 3F6RA 3U13A 5JI2E 3IAFA 1IOVA 1EWTA 3OF3A 3Q40A 5CXSA 3SJCA 3KSDO 1JVNA 3MQFA 3O7MA 4M37A 1QVAA 3ZIDA 1SK8A 1XD2B 5C3MA 5AI0A 4P81A 4ER3A 3KFVA 5IX8A 1X87A 4Q01A 2G9QA 4FR2A 2HYIC 2ST1A 2WIDA 5LL6P 2EX0A 2IP1A 3F7TA 4JP5A 1B93A 4DA8A 3V80A 4Z1MA 4B3GA 1G38A 4FGUA 4D4KA 1X39A 3E8SA 2ZBGA 2WYOA 2ZBRA 3FLBA 4LOAA 1EESA 2WYWA 3C3XA 4BLSA 3RK4A 4WBNB 4RJTA 2AG5A 1H6DA 4NCHA 2VQ3A 2YHIB 5DM4A 1MH1A 3NS7A 4L50A 2X58A 5TB5A 5EY5B 3U3ZA 2PL3A 3JVIA 4B31A 2WVAA 1G16A 2LUOA 3O2QB 1TKRA 3BZWA 3PFWO 3TIIA 4JJAA 2VHTA 1WKVA 4UEOA 1QH1A 3CA8A 3ISJA 3QEMB 4JITA 1ND6A 2F59A 4TT3A 3FIUA 5JRZA 3RSSA 4LZPA 4ZMBA 1VE5A 3L8GA 4EKIA 3N53A 4EKYA 5BOSB 3D5EA 5CTAA 3CUUA 4KHPB 1OA1A 4PS0A 1CE8B 1Z6TA 3EC1A 4KODA 2BMJA 4QHSA 5CIWA 5I3CA 4M55A 1GPNA 2QLFA 3IQDB 4G1EB 3G2JA 4RZSA 1MAUA 4AJKA 4OIMA 3TAHA 3VJMA 3W2FA 1U4SA 1EMDA 3FYDA 4N7BA 4QOJA 3RUPA 1M1NB 1TF7A 4OLFA 4CLOA 2NW6A 2GUWA 4YV7A 2ZB3A 1EHYA 4PFKA 2QTTA 3P32A 1ZHFA 1FTNA 4QU0A 2Q4DA 4PYMA 3ZDBA 1N6OA 1SIWA 2VK4A 4QXRA 3RTBA 1UC4B 1TUIA 3WTCA 4JJZA 5MFPA 2QP3A 3ELWA 3T5TA 1S3IA 4XPIB 1HSOA 3GT4A 1FTQA 3LL7A 2GM4A 2IDJA 2YY5A 3WGOA 3S99A 1XP5A 1KQFA 1M2OA 1KU0A 3SIPA 1ADFA 4C43A 4E22A 2O1SA 2PSJA 2BKUA 2UYYA 3M5WA 2PZMA 3BZBA 5EUQB 1MB0A 3BQ9A 2ZJ1A 3L82B 4L5IA 3STWA 1IEVA 4N5NA 3NBUA 1P29A 1KHHA 1Q95A 3ONEA 2E4YA 1Z2CA 3FNEA 3KYIB 5TGZA 3TZLA 2YXNA 3WB1A 3MTIA 3QKUA 5JAIA 4E4RA 1AUQA 3PCXA 4QKQA 2JJ8A 2YV4A 3I83A 5DVZA 2Q6VA 5F1YA 5AUNB 1QMGA 1V95A 5K6AC 2YIMA 1AUOA 1WB4A 1QK3A 3KLNA 5DNWA 1KAMA 4AZVA 5JAHA 2PL9A 2O57A 2GWRA 5EVJA 3ER6A 1LSOA 3IAM6 1FRQA 5I9MA 3HVHA 4F2WA 3R9WA 3SJ7A 3TPFA 2W7TA 2H2DA 4J9VA 3GDOA 5BYJA 1FLDA 3HMQA 1VLMA 2PT9A 1I5EA 4B5KA 3QEAZ 3KJQA 4RCYA 1TCBA 4MQMA 3WB9A 4BX8A 5IF9A 1UBTS 2GM9A 3ZCTA 4ROSA 3OLYA 4INJA 1DLIA 3CIOA 3D7RA 4FE4A 2ZTSA 4LWQA 1FLAA 1SCUB 2PGLA 1Q0TA 3KQLA 4J6FA 5DFAA 2AG0A 5SZHB 2WFLB 2R6HA 1IUNA 1HLPA 3EWAA 1S2OA 3LUKA 4KLRA 3VKGA 4UHHA 1NJ8A 1DJOA 1HFEL 1LZKA 1QC5A 3KHTA 4WA8A 5KKAA 1CZRA 8ABPA 1EX7A 5MFZA 2AF3C 1ORWA 2D62A 3N2NA 3KR0A 1OA0A 2HRZA 2BM1A 3VHXA 1F0PA 4B3CA 5ISMA 2OBMA 2Q9AA 3UHPA 3L40A 3K0FB 3MIZA 3WHIA 1G5IA 1EBFA 2BGTA 1IXSB 5IEBA 5I5EA 1GLGA 1YT5A 3A10A 4J3NA 2O8DB 5IM4A 3VDNB 1YSCA 4KSYA 2QGNA 3WB0A 4O5OA 1C3EA 4E1BA 3BH7A 3I62A 4JBWA 1UIMA 3GT0A 1QO9A 1AO3A 1RHUA 1VKHA 1ODKA 5B6JA 1L5VA 2D1RA 3HFRA 3L6DA 1JKIA 4DY4A 1SA0B 4L0DA 3BE6A 2OFFA 3WK4A 3SBEA 5KMGA 2FH5B 3R3HA 3SC2B 4MPJA 4WAUA 1P2TA 2D5BA 2B4RO 4GZ6A 5SY4A 5LN1A 2WHXA 3KD3A 4P22A 4QUGA 5EQTA 1PWEA 1DTSA 3WZMA 1MXHA 1T36B 3KOWA 4MITA 5FPSA 2ZIXA 3U48A 1Z9BA 3NDJA 4JBLA 2VYQA 4NU6A 4DR2B 1G9SA 2HNBA 3SLGA 2F9FA 2C3YA 3OJ0A 1YB1A 2YZGA 3GRVA 1DBVO 3P0JA 1H94A 4IJUA 4M1EA 4P35A 3C14C 4XUEA 4QJ3A 4M6WA 4MKGA 1BVUA 3RRBA 1J22A 3KD2A 2PKRA 4RYLA 3AR2A 2BGKA 3SOZA 2I3GA 1U8TA 1RT9A 1U9JA 4LYEA 1YRYE 2NACA 1EE1A 3B1KA 3TW8B 3EVNA 1NXWA 3NTUA 4Z0TA 1XDUA 2IKSA 1FQJA 2Z2XA 2ZBQA 2PSDA 2PM8A 1SC9A 2ZB2A 5FR1A 3O74A 5L40A 3BQMB 1ZRHA 4QEZA 2BFDA 5CLGA 4YAOA 5IABA 3ID6C 3CLUC 2JAXA 1K7EB 2O59A 5K6TA 3PQ2A 1DBQA 2FVYA 4WBSA 2UYGA 4AWXA 4LJ9A 2C7OA 1FCJA 1JH8A 1HQCA 2FW0A 2QMOA 2R00C 4OO3A 4EWLA 1PN3A 2KJQA 2VF2A 4Q6WA 1RZUA 4P4GA 1PLJA 1XL1A 4IZIA 5KNDA 4GP9A 3LBIA 3OFJA 4MVJP 1JSXA 3IEMA 4YJGA 5BR1A 3TUIC 1IN1A 2YZNA 2CLDX 3I23A 2DFLA 4Q48A 4QGAA 1S4MA 3UA3A 2NQTA 4KDEA 5C37A 3F1KA 1SQGA 4KKVA 1LLFA 1IZ9A 1HURA 2PD3A 3GI1A 3IKJA 5KTKA 3MTBA 1QO0D 2KBFA 3GNSA 4Q7EA 2OAQ1 2XKKA 2DF8A 4C0LA 3F3YA 2OEPA 4CQLB 3RF6A 4DR4B 1MX1A 1NW6A 2PGAA 3C5WP 3MT8A 4NBSA 4DMHA 2FWRA 4YXWA 5FRDA 3GA5A 3A04A 3UK7A 3VR5D 1VGRA 4Q24A 5FTKA 1KPGA 2OHJA 1VB5A 2QAJA 2UVPB 3IJRA 1T3HA 1BJKA 1LU9A 5FWNA 4LV5B 1A8SA 4JFAA 5CK4A 2OZLB 1GL3A 3CH4B 5ALWA 4AK9A 1E1DA 1U7UA 1T1SA 1B8VA 3O2JA 2DJ5A 1BEZA 3LV8A 2R8BA 1S1CA 2OHIA 1H85A 3ANLA 3V8RA 1PS8A 2O50A 3II6X 5I8ZA 2R1VB 1DG3A 3OT5A 5J4HA 1XK7A 1FXSA 1HEIA 1HKHA 3G0CA 4J43A 4YR7A 1IK4A 4JV5B 4D9GA 3ZD8A 5C0OE 4MS1A 1OWNA 4JYAB 4RGVA 1QOQB 4GE0A 5JAOA 3GJ4A 2C1XA 2EV9A 2QMYA 3AVQA 1OBOA 3Q7SA 3GMIA 1HZZA 2X8WA 3A6ZA 2ZULA 3BEDA 2MDTA 2PO5A 5GMOA 5LLSA 5TIIA 4K88A 4HC4A 3SE0A 4LG1A 2XQFA 1ULTA 1U65A 2XT9A 4E5SA 1JFLA 4FK8A 2UZAA 5CHYA 2FSVC 3D4NA 1FSSA 4Q1VA 4GMFA 1NVVQ 1Z6AA 4PHHA 3L1HA 4IAOA 3IQHX 4M1OA 3BWYA 4PC1A 2VTDA 1WW2A 4Z53A 1BS2A 1T9ZA 3KSRA 4BLUA 1Q77A 4RFSA 1A8HA 3P94A 1JHYA 1M2JA 5LSAA 5JD6A 1FSZA 3FNBA 1V8BA 4RGQA 1USKA 2WB2A 4OGWA 3CRNA 4N03A 5JO0A 4GR4A 4MMZB 4H7JA 5ULLA 2LDBA 1ULBA 3B3FA 4ZO7A 1CQIB 4HOYA 4UU8A 5AXDA 5C1IA 5T57A 3RBZA 1KMHA 4QUHA 3SYKA 5EMKA 1ANKA 1PTJA 5JADA 2VO1A 4ZCTA 4NCAA 1T6ZA 1J8FA 2Y67A 3BWDD 3DZGA 4CMGA 2Y0CA 2OD7A 2H63A 1V1MB 1ZSVA 1OXVA 2FSFA 4OREX 3AERA 1YU6A 2V6IA 2JKZA 2XQVA 2AZ4A 1QS0A 2ZTUA 4MGZR 2J1LA 1JR3D 1U2ZA 1D2EA 1USVA 4FFWA 3ZWQA 1Z5NA 2V7BA 1D9XA 4LQ4A 5F1OA 4CIWA 5K2OA 1JFSA 1LNZA 1EVEA 1QK5A 1NI5A 2DFPA 1PDVA 1XU7A 1N9GA 4XD7D 5D5PA 3FHCB 1JVBA 2WINI 2PMBA 3K9CA 2A1UB 1JKFA 3UYLA 2OQ2A 1CZUA 2DGDA 2I3DA 3EMVA 3KU1A 5T64A 4ID9A 2I4TA 4MJ7A 3WLTA 2MR5A 1Z7YA 5T7BA 2WVHA 4OI0A 3C41J 3RK0A 1X6VA 4FFBA 1JHAA 1PNVA 3GRFA 1B00A 5KQRA 4R84A 2J9YB 3SIWA 2IQIA 3HVJA 1NZJA 4MW5A 4ARVA 3BHIA 3GCDA 2YNMD 3AI2A 3LBFA 4K1LA 3HA7A 4BRWA 5HP4A 1DX9A 4EHHA 3T5AA 2Z6QA 4DNXA 1XZJA 4DMKA 1BRMA 3IPRA 1HOXA 3D8RA 3DTVD 4FP9A 4PV7A 1EZZA 5DNCA 1VKRA 1SUPA 1IATA 1ZH2A 2XMBA 4NAHA 5C52B 4Y2GA 2X6TA 4BMYA 3KB2A 1PG2A 4EJMA 1I01A 4TTPA 3NCHA 3VO8A 1MPXA 3I30X 1HG1A 1T9DA 1WW8A 1TJ3A 3MGAA 5EXDA 3WLKX 1AG9A 2YYZA 3AOGA 3VGPA 4CT5A 3EXFB 1EIZA 2WA2A 4QJBA 1FTYA 4OXKA 2XZDA 4EVIA 1JDSA 4BQNA 4RHUA 3EPJA 4AZ3A 3QVKA 1Y8QA 4H7EA 3RIMA 3G9UA 4GZ3A 3EDQA 2QQFA 4FMCF 3N0RA 2C3MA 4MJ3A 3ZD7A 3T9DA 4AP6A 4YK7A 4OM8A 4TLBA 2ZYVX 1YZYA 3B48A 2CSUA 5AIAA 4C3UA 3TG2A 3QPCA 1ESDA 2OCKA 1CJSA 1IZ0A 4R1UA 2NUAB 1F48A 1QB8A 1EFHA 3WWEA 1IUOA 2F00A 3K16A 3JQFA 4MS3A 1D5WA 1S9HA 1JTVA 1WMFA 2O20A 2HK6A 1KPHA 2QZSA 1TW2A 3FKSD 4YP9A 5LCXA 3VOBA 4B2PA 1V6CA 2PX6A 1FFDA 1XXHB 3K4HA 2B1QA 3NHWA 4HMOA 4ZXPA 3QNMA 1CYEA 2AJTA 2GT1A 2GZ1A 1AZWA 2ONYA 4EUHA 4A0SA 1RS0A 3X1KA 1I30A 1E2UA 4EB3A 1QYIA 3PX3A 3INNA 3FY4A 2GHQA 5AHRA 3RYFB 3WK5A 1YJAA 2HBZA 2YWCA 3OQPA 1E8DA 2B2CA 3PQDA 4DLVA 1XRPA 4C22A 4UM8B 1PQYA 4KMOA 2GHRA 1CJUC 2HDWA 3KVVA 4MUEA 1X80B 3RSHA 4TKVA 3Q2IA 5B7GA 1JS1X 3WB2A 5P8WA 4HAIA 2PL1A 2QQ5A 2G7ZA 2FP4A 5EHQA 1NI4B 1SZCA 2WJ3A 1A2KC 5J4LA 4LYDA 1EWRA 2BHTA 3R6DA 2WM8A 1EUZA 1AZTA 2EEZA 2H3EA 4DRXA 3ZDEA 1NLZA 4P4SB 1GL9B 4MEJA 5DGTA 1E9EA 5JARA 3UHOA 3MFYA 5HSGA 3ITDA 1HDOA 1Q0PA 3ZY4A 4F3RA 1E1RA 2X5OA 4ASUA 2AQ8A 5JBQA 2FW9A 2AQIA 2HJGA 2ZE5A 3R9XB 2FW6A 4GR5A 2Y6UA 2GAIA 2B9EA 2ZJ5A 4QT0A 5HFJA 3ESYA 4JZYA 2W2TA 5CG2A 1NW8A 2O54A 1WCXA 4GKVA 2Q9UA 4Y2QA 1F4VA 3DFUA 4BNIA 1MNQA 4YRGA 1TTQB 4RTRA 2RBKA 1ZBQA 5EWMB 4PRYA 2QPLA 2YZKA 4JNCA 4REQB 1XFDA 3VTFA 1JPNA 2H5LA 1TA9A 4MO9A 4YMVA 1UBNA 3LXXA 1KOGA 4WOBA 4KP7A 1BX1A 1U0BB 5FTWA 4GYYA 4E32A 5FLXA 1LBQA 3DWFA 1I10A 2R5NA 2A6PA 4H7HA 4BV9A 3BB4A 1FX1A 3SF8B 1Y5LA 3SKXA 2GYVA 3C1TA 2Y1CA 4MCJA 3VISA 5EMLA 2Y1FA 1B73A 4R69A 2IW3A 1J2JA 1WMSA 2WZQA 4XWGA 1E20A 5SYAA 1JAHA 3V5NA 5HA5A 4ALMA 2OC9A 2A0UA 4IVQA 1KU6A 5CVEA 4G4GA 1CR4A 3KQOA 5G2OA 3UK2A 2AZXA 2NU7A 1RQXA 4XCVA 3VTAA 4JUCA 4BPBA 3E9EA 3P8ZA 2YXPX 3LVBA 5DGDA 1QMPA 1E2EA 1QHYA 1BZYA 1QQ6A 1THMA 4LOKA 3IO3A 3SICE 4XDHA 3N2KB 3K8YA 4H35A 3V4VB 1L7VC 4MKFA 1X1DA 4BFVA 4M0LA 3UAXA 4B34A 3E9RA 1KZ6A 3DJFA 3G59A 4RCZA 2VVTA 1HE8B 4IV0A 4DIEA 3HH8A 4E5NA 4C7XA 1DUVG 2RGNA 4B79A 5DBGA 4JASB 1C0PA 3SVZA 5KUTA 3EK2A 4FMPA 4D74A 4EW1A 3GQBA 4YBZA 3JQ8B 1NM5A 3UOAB 2ZWVA 3CZQA 3OO0A 3DA8A 1FPQA 3C45A 3E6AA 3KYCA 3L4EA 1F5SA 4Q3CA 2FUG1 1CR6A 2H5JA 2ZBDA 2Y76A 2J9RA 3CW2A 3FCEA 3GCGA 2EBFX 3QBVA 3WBBA 4DWWA 4A15A 4N65A 3VM6A 3UJAA 2ONKA 2VCYA 2QPAA 5B1HA 5C5CA 1G21E 5BURA 4A6EA 3I72A 2ZWPA 1RAHA 5AK0A 1RXWA 2ZDQA 3L5KA 2HPHA 4BLVA 2O8DA 2QM3A 4IM7A 2A84A 2FSIA 3TTXA 2MSNA 3LPMA 2VI5A 2FZEA 2QWXA 1C7QA 3M1YA 3OC0A 4ZTUB 1MDBA 1QJ4A 1D1TA 1YI0A 4Y1GA 2AUMA 4HN2A 5K5EA 2ZPAA 1YZGA 2JFBA 3JALB 3OJCA 5FWXA 2BEUB 1JYSA 1FE8A 2Q1YA 4M3NA 4PC3A 5BN5A 5DISB 1ZM4A 1D7OA 1TGVA 4RIIA 4X60A 4IVPA 4IGAA 2F62A 3G49A 2QVYX 2ZM5A 2R6ZA 1T24A 4OFXA 3P2MA 4KPUA 4EFKA 3LHFA 4D9BA 3DXYA 1VBKA 1MIHA 5F7OA 3CZ9A 3NFRA 1Z6YA 3OZGA 4UDNA 5PNTA 2I7DA 3ZQKA 2FPGA 4M9RA 1KVRA 2EZ9A 2OP1A 4ZQFA 3U5ZB 4GL4A 4JI2B 1JECA 4AKSA 1OV6A 3P9NA 1K8ZB 3EW9A 3CUYA 1UJCA 2D4HA 2WNSA 1VZ2A 3RCBA 2R1ZA 1CY1A 2OHVA 3L0DA 5K20A 2F55A 3VBEA 4HAYA 5SV2A 5KTOA 3U7IA 5JSHA 3K94A 3L7YA 3LK6A 4DLTA 3W78A 1MO4A 4QSMA 2YBDA 1DWPA 4CM7A 5DXJA 2PLFA 3FETA 1P0IA 2EQAA 1T9HA 4UHBA 4NHOA 1NOIA 4M0PA 3U4MA 4R2IA 2A3NA 5ALPA 3C5VA 2V5VA 3PZRA 3QVJA 4FYXA 3A1VA 1DQRA 4LDAA 1GTL1 1U3FA 1ZGAA 2FEPA 2IHKA 2PPLA 4K2AA 4D4JA 5AJTA 4EHFA 3QFFA 4JOQA 1VL5A 3HXLA 2Q0QA 3Q3CA 3AJAA 4YBRA 3RW9A 4EB6B 4ZMRA 1JG7A 1PK8A 3HYSA 1J0EA 3RRYA 2OPHA 4YYZA 3I6YA 2P6UA 3HSKA 2PX5A 1L5KA 4DGQA 1QCZA 1F9EA 4F8YA 3KBBA 3PDCA 2CXSA 2QRMA 3THYA 4D1YA 1W1IA 4M9CA 5DNAA 1O6GA 2I6UA 2WYVA 1U2TA 2WZDA 4FEYA 5EJEA 4WFIA 5HK9A 2ECOA 2WJVA 1COZA 3HCDA 5AW9A 5I9IA 3E22B 4AJLA 2WJJA 5EKDA 1WULS 5BVGB 2RH8A 1HRKA 2GS9A 1YC2A 3PQ6A 4HY3A 4BFSA 3BB1A 3M0EA 1W5EA 1JXAA 2CCGA 4MV3A 1XTUA 1QF9A 2X19A 3K2QA 1VFPA 3GJ8A 3W90A 2VZEA 1PJQA 4M7RA 5IPFA 1N36B 5AI6A 2IIQA 1RHRA 3LHIA 3NAMA 2VZLA 2C5EA 2M6SA 4EMUA 5BWMA 2OM2A 1YD7A 1D4FA 1C3OB 2AUNA 1LPOA 1YZUA 3MJRA 4Y1FA 4KGXA 4QYIB 4D81A 1B8NA 4TN1A 2FPPA 3U1BA 2RIPA 3FYTA 1FC0A 2QNRA 1X74A 2MOKA 3CT6A 1JR2A 4JBYA 2Q3HA 4LVUA 1ISHA 4XB2A 3ZWMA 1DZIA 2C20A 4KSBA 4P3PA 5CNKA 4KE7A 3WLAA 3HWSA 4YCLA 3LUJA 4TN5A 2B8NA 1G2PA 2BYTA 1R8SA 5FI3A 1R5BA 4DLAA 4PZUA 5HKAA 4G0QA 3FBGA 1G3RA 1J0DA 4RZ2A 3TKLA 1QIEA 5EERA 4DKJA 3QEBZ 1OR8A 4E70A 4L8LA 4O0MA 3G2PA 3V48A 3PQ4A 2Y1LA 5JD4A 4IVNA 1Q7TA 4BE4A 1BN7A 3GJTA 1GT91 4JR2A 4QSHA 3VOAA 3ZC3A 4A8JA 4LTMA 1C0IA 3N8DA 2GVZC 2PMDA 3AP2A 2NVWA 2NSDA 1QKKA 1QONA 2B37A 2FN7A 3IP7A 4RKRA 4F7DA 4QBHA 5KB3A 5GOZA 3M1LA 4D82A 3W1EA 3WLFA 3E8XA 4OUDA 1BW9A 3SSNA 1STOA 4JCOA 3NTOA 4MVWA 1S7GA 4RPJA 4G0YA 3C7CB 2QMEA 4MAMA 4HGZA 1XLVA 2HX1A 1RWOA 2OGUA 3UMVA 3ZR4B 1J2UA 1LLCA 4E4YA 3TD9A 1KJQA 1M76A 2XXAA 3A27A 2B20A 5CDUA 3DYVA 1JDUA 1PZNA 3BWMA 2MT9A 3KT0A 3PXBA 1E9AA 3ZJ4A 1JTFA 4BWVA 2QY6A 4F12A 5JD5A 4NCBA 3JQRA 2JAWA 5DIFA 5DTQA 3KNZA 2Y9MB 4UE6A 1UBUS 2BVNA 1AF7A 1YB5A 1ZC3A 2WAAA 1JSCA 3BF7A 3SC4A 3UAVA 3EXIA 3ZGXA 4KQXA 3BRWD 3WKAA 3HCEA 3RVLA 1NQXA 3U37A 1Z6QA 2DQZA 5HJ2A 1TLFA 4JOSA 1EE2A 2UXDB 5LQDA 1GPBA 2HHAA 3R09A 4HRAA 3PU6A 2OORA 4XX0B 6AT1A 5ADHA 3F5DA 5JMTA 2Q0HA 4AWBA 1KFEB 1RXVA 4TX1A 1P1JA 5AM5A 2W8ZA 4ZAVA 5AVZA 4MB6A 2BMEA 3F6PA 3IP9A 1T6YA 2XTJA 3QWBA 4U02A 1FFEA 4HV4A 2A0FA 5AP9A 5BR4A 4N0MA 4H1UA 1QFMA 2JF0A 4IIJF 4DRZA 3I6BA 4HG2A 4FHEA 3IOEA 3UPUA 2ACKA 2Z2KA 5CJPA 3A3OA 2VHEA 5BNFA 1P5RA 3EVGA 1PGQA 1UMBB 2VPWA 4OK5A 3HYCA 4B76A 4M60A 3A1CA 4MB0A 2PWZA 3UB4A 1XMXA 4KQKA 5GM2A 3A14A 1FDIA 4E21A 3SFTA 4DTIA 2H51A 4JVSB 1XCPA 5TT0A 1GEEA 1QX4A 4LJ6A 2VP5A 1UIRA 1X7XB 5HGJA 1GOTA 2E87A 5AVXA 3WFJA 3L4JA 4G0MA 3EVBA 4DKXA 1GG9A 2O0LA 5EIWA 5CA1F 5IC4A 4JU8A 3I2HA 4F4FA 1ZDMA 2IP2A 3IEKA 1HNWB 4FGKA 3EZ6A 3ZHRA 4UEKA 1PGJA 3TAUA 1ZN7A 2GA9A 1MOZA 5T5QA 4D9NA 3IFSA 1J49A 4IGEA 1FP2A 4ZHQF 1Y42X 1K89A 4C3VA 1F5NA 2JIDA 4KQ1A 4V2IA 1LPPA 3H2KA 3WBJA 3FHJA 4IQGA 3CQ9A 3WLNA 3Q7TA 1ID8A 2RAUA 3ZHSA 1J9GA 4GSLA 4WSOA 4RTJA 1EUDB 3QG5A 3GFVA 2WUGA 3DDWA 3GRRA 3EFHA 2BBSA 1I3LA 4S1PA 1DUSA 2G88A 1IOZA 1P4RA 3NH6A 4BP9A 4Q3BA 3HDHA 4NZZA 5CHEA 5CIYA 5EUCA 3VYSB 1UKYA 3A4TA 5B57C 2HFKA 5KC8A 3FDZB 5GJWC 3JVVA 1DMSA 4JI1B 3ZCRA 1R6BX 4MWGA 4D8YA 3K9FC 3AL0C 3AXSA 4MCIA 4KO4S 4RD4A 5KTYA 3WJ7A 1DOHA 2ZANA 3OCXA 3AUFA 4MGEA 2XXBA 1DINA 2NU9B 1K4KA 4FX5A 4GFDA 3GQVA 5BSKA 2QUHA 2XE4A 2AC7A 1YIDA 1E1CA 4LDNA 3ILHA 3RBAA 2VDJA 3K6SB 4JT4A 4B09A 1J1IA 1M0SA 1SVKA 1ULZA 3TK1A 5B6PA 2XGMA 3DNFA 3DAOA 4WLOA 3RT7A 2D1SA 2QW1A 3MLAA 1P60A 4RK5A 1XYYA 3QFRA 1IDOA 2WV7A 4P3KA 3DBVO 2EXXA 1XZLA 3C15C 2EW8A 4OGKA 1RHKA 4ENRA 4FD3A 5IVIA 1IJFA 4YAJA 1XWWA 4MRMB 1C8BA 4DCGA 2P9CA 2Z95A 5ALNA 1NSTA 4TSKA 1MO3A 3WJ1A 2AI1A 1O2DA 2VPTA 1EHCA 3RNLA 3AH8A 2GJ9A 4DJ5X 2Z43A 1CY7A 1IHDA 4JCCA 4MX8A 1MMFB 1URPA 3RARA 4MA0A 3PE3A 4EEZA 1Y8ZA 4G36A 1PW7A 5DYYA 4L4RA 1FFHA 4U7HA 4YDSA 2CJPA 3VC1A 3SBDA 4WGGA 3R5SA 3R77A 4DYHA 1SKAA 2X5XA 4Q12A 1J2RA 4MR9A 4L5YA 3U3MA 5K0GA 1Y8CA 1NXQA 2OXIA 3PGXA 2YICA 4CM8A 5F9HA 2XWBF 3GZJA 3RTDA 2FR8C 4K9QA 3MYRA 2ZI5A 3WDKA 1SCJA 4ZYXA 1KZ4A 4FYMA 3HKEA 5CFRA 5JDIA 5AKJA 3PJFA 1N2EA 3EOBI 2PH1A 4PIVA 3ETHA 3CZPA 2W2OA 4LSWA 3WGGA 1OLUB 5JU6A 1RJEA 1VHJA 2AT1A 2QZ4A 2M6LA 2VHQA 3TSZA 5JSUA 1M2VA 2I6GA 1U3TA 3IAAA 4FKZA 3BCHA 2IQ5A 4P5PA 1O0BA 1KY2A 3IAS1 1XIVA 5SY9A 1QR2A 2IPXA 4QUJA 4HDOB 3PD0A 3H6GA 3GZTB 5HUHA 4DA6A 2VH5R 3PWKA 3HXOA 2ODWA 1ACJA 3F97A 5KYUA 4WFJA 2NIPA 1Y3DE 1P77A 3GP3A 4MYRA 1FNDA 3WA6A 3N8IA 1IWOA 1GL7A 3EEFA 3PYXA 3QVUA 4LSMA 4DA9A 3L1IA 3RHTA 4GPD1 5I51A 3UT0A 3OIGA 1GA1A 4TMWA 2AX3A 3WNDA 3PICA 2Z8ZA 4IS2A 3P9KA 1JR3E 2WSSA 2I91A 4ZI7F 3ABZA 2MHCA 3GEHA 5IWAB 2ZR8A 4ZC8A 5AESA 1H93A 1EQ2A 2B4AA 2CYBA 3T3DA 4MRPA 4EGAA 3PB3A 1KZ7B 1KEEA 4V03A 2RFLA 1RYYA 1R0ZA 1GCUA 2CLLB 1RXUA 3ND7A 4PHTA 5EP1A 4HBZA 1I3OA 2QL6A 4JVNA 4DQUA 3OT4A 4LCBA 1JLHA 3DMNA 3Q2OA 5G4KB 1RWVA 5CLLA 3QX9A 2WJWA 5EIHA 2FWNA 2OV6A 3FYHA 3G5MA 3N58A 3AR8A 3H9JA 3ZX4A 4FLEA 4WRRA 1VXOA 2GPYA 3DWIA 4DWOA 3G9ZA 2O3UA 4K6HA 3HDYA 4M1KA 4R9VA 1LNQA 2Q3LA 3OUTA 4M9XA 3OE5A 2YR0A 1BJTA 4DB2A 7AT1A 5NULA 2PGOA 1VLQA 3ENQA 2ZXFA 2CNLA 4WLUA 1T4DA 5HOEA 2BGNA 5C8VA 3B2QA 1D9ZA 3N28A 2V7TA 2PUEA 3EVAA 3R3SA 1MCZA 3ND6A 3QMVA 2JLRA 3QLVA 4I3GA 1IPHA 4L51A 5AOAA 3UMBA 1PWZA 5GONA 1KOLA 1YRLA 3UVEA 1RABA 2C5SA 3WYAA 5FTLA 3UY4A 1CNMA 1FU4A 1MT3A 1KJZA 3QU2A 4K28A 4CKXA 3PXDA 4C5CA 2EEPA 2J46A 1E2LA 4CLDA 2P9GA 4Q39A 4GI3A 4NK5A 4Y2YA 2WJGA 3MILA 5JNSA 4H15A 4M9QA 1JBKA 1B6TA 2CK3D 3FCAA 4FPXA 4LXUA 1PJLA 2JIRA 4YCDA 2AMVA 4B6JA 3JY6A 3MJHA 4JC4A 1EZ1A 3M82A 4DCTA 1QU3A 1NMXA 1K0UA 3SZ3A 5IXJA 3G2NA 3KXDA 1A9OA 2OVBA 5E2BA 1W581 5HTKA 8OHMA 1XT6A 1FQOA 3PWSA 4G37A 4GRDA 2D74A 3GCZA 3AVVA 4QXAA 4B7AA 1HE3A 3IC5A 4C87A 2I9PA 3IDAA 2H7CA 2YJGA 3N70A 1Y33E 5F51A 4CHGA 3N0TA 2J6BA 1L5HB 3E18A 1LDEA 3GPIA 1R27A 3L3BA 1CDZA 4AP9A 2H06A 4MR7A 2C07A 1Z13A 1CDEA 1DJQA 3WMWA 5JZMA 1TO2E 2P4EA 1H69A 3MQ4A 4B85A 5L53A 3SXPA 1BWPA 3CH6A 1RM3A 3JR7A 4RPHA 4LVNA 3JWGA 4FS8A 3M49A 1IPFA 1MX5A 4I7EA 1O4VA 3GVIA 4GH5A 1Y1LA 3CZ5A 4OSPA 4B4KA 4AZSA 1WKCA 1FUKA 2A57A 4F4DA 2F4NA 4LXYA 4TL6A 1XMPA 1HT0A 1TM7E 1GQQA 4N5LA 4UBOA 3SHTA 1W36D 2QLTA 5D01A 1V43A 3WRYC 2NUTA 1ZHOA 3EIUA 3JWJA 1ESCA 1KWGA 3MUFA 4IILA 4KXVA 3HBJA 2P2ZA 4MVJG 4IR7A 4JJ4A 2PKQO 2ZS7A 2JHFA 1M34E 4G3XA 3R7DA 2VWGA 5M04A 3UFXB 1VCHA 4BFLA 3H05A 1R6XA 3CONA 4HQFA 4HSEA 2CWDA 1HYQA 4AIIA 3K2IA 4QOEA 2XGGA 4TQAA 5ES3A 2FG7C 2BHLA 2GRAA 3KUKA 2XA1A 3EZ2A 4GPBA 1T1RA 2Y0BA 3F3MA 2VP9A 3BG5A 5IAJA 4UTPA 1U0HC 2G71A 5IFLA 4IJ6A 1BCSB 5P21A 1RLMA 2UAGA 2Z83A 2NQ8A 1UJNA 3H2HA 3TLEA 4KITB 1WPQA 5K8CA 1J56A 1Y1SA 1YE5A 2F90A 1GDDA 1Q83A 4PLYA 1DBWA 1OFIA 2YJ4A 3UV6A 3LTNC 2E5FA 4NZYA 5TEWA 3A2LA 4AO7A 2V5UA 1NVMB 2BF7A 1CQWA 1GTG1 4NAUA 4BUCA 4FTWA 1NE2A 3OX1A 1XRMA 4YRFA 4ACAA 1W8DA 4TUYB 2YMPA 3WK8A 1YGPA 1Z12A 3T3NA 2R4QA 3BGVA 3TS1A 1ZCFA 2VT7A 2QRQA 4D7AA 3EQ2A 3KVRA 1H4QA 4Q47A 2IYQA 3FRIA 2X77A 3NAGA 3R0ZA 4HYQA 3ANYB 2DFKB 3UT5A 5J5AA 4IHAA 2PZBA 2HPVA 1YVUA 4EB0A 4X3CA 3OQNA 2E85A 1ZKDA 2W2PA 1XN1A 4LE1A 3OLCX 3AF0A 5YASA 2BUAA 1KP2A 1YAHA 3NW9A 3ZCUA 2YN2A 5DN6D 2B69A 1U63A 1T2AA 2DM6A 4NNJA 3LHDA 1MRZA 1GDTA 4WGFA 4V2UA 1T3GA 1ZLXA 1E0DA 2H4ZA 2Z8XA 3IEUA 4X7RA 2WZBA 3RK1A 3QQPA 5H83A 4HNUA 1EA7A 4EYOA 1RRPA 3ZWOA 2QM7A 1OBFO 2CHGA 1B0UA 1OWMA 3GGSA 1A1SA 4TXMA 5BSFA 1A7JA 2NU8A 1WM1A 1JHRA 2BEWB 121PA 3EISA 3JPYA 5FORA 4PSKA 5E4TA 5JY6A 4KEAA 3A9TA 3H9UA 2Q8NA 3STVA 3VPSA 1ZUWA 2OA0A 1N34B 2LRHA 4AVYA 1UOEA 2J09A 3ND8A 2C3OA 3PRKE 3ZWYA 1K3UB 4CWAA 2Q4EA 3BGOS 2Y2UA 3S1SA 3RROA 2ZB8A 2XI4A 5KOHA 3GJ0A 2YN0A 1UEIA 4MUAA 3G89A 1OPRA 3AFMA 1EUYA 3A3NA 4BMPB 1PLKA 4UAJA 4YI5A 4EITA 3ZCQA 4DQKA 5D86A 2FPUA 2IBMA 4MV0A 2O2CA 3PFKA