5IC4A

Crystal structure of caspase-3 deve peptide complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
139
structure length
139
Chain Sequence
NSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-3 subunit p17
publication title Cacidases: caspases can cleave after aspartate, glutamate and phosphoserine residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 139
sequence length 139
chains with identical sequence C, E, G
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5ic4A00
2CNLA 2C2ZA 1RHRA 4N5DA 3GJTA 4JJEA 2C1EA 1I4OA 4QTYA 2XZTA 2FUNB 1RHKA 4HQ0A 4QUEA 4JQZA 2C2KA 1RWNA 3DEJA 5IC6A 4EHKA 5K20A 2QLBA 4FEAA 1I4EB 4FGUA 4N6GA 3SIRA 4QU0A 3V4OA 4FXOA 2CNOA 1RHUA 1RE1A 4EHAA 3V6LA 1F9EA 3KJNA 2CNKA 1RWMA 1RWOA 3NKFA 2H4YA 1GFWA 3OD5A 1GQFA 4JR0A 4QUIA 3P4UA 4D3ZA 4PS1A 1PAUA 3IBFA 1I51A 4QU9A 3S8EA 3UOAB 2FP3A 2HBZA 5IAKA 3R7NA 2CJYA 2XYGA 4QTXA 1SC1A 1SC4A 3GJSA 5H0IA 4DCOA 3NS7A 4NOKA 4D3YA 5LU8A 3D6HA 2NN3C 4JQYA 1RWPA 1I3OA 4QUHA 1JXQA 4IEFB 4QUDA 5IANA 3H0EA 5IBRA 3R6GA 1NW9B 3RJMA 5IABA 4QULA 4I1RA 2QL5A 4N6OA 4EJFA 2XZDA 4NBKA 1KMCA 5IASA 1IBCA 1RWVA 3UO8B 4EHHA 2H5JA 2DKOA 3R7SA 2J32A 4HVAA 3D6MA 4QUJA 5LUBA 3V6MA 4QU5A 4DCPA 3R7BA 1RWKA 4N6NA 2CDRA 2C2MA 3P45A 4JB8A 2H48A 2H5IA 1K88A 1RHJA 3QNWA 4JJ8A 4QUBA 5LUAA 3E4CA 2H51A 5IARA 3KJQA 2C2OA 1NMSA 4NBNA 4NOMA 3EDRA 4NOLA 3R5KA 3DEIA 4ZVPA 1BMQA 2HBQA 2Y1LA 4JR1A 1PYOA 4ZVSA 5IAJA 2QL7A 3GJQA 3H11B 2H4WA 4JJ7A 3EDQA 5JFTA 1RHQA 3GJRA 2J33A 5IBPA 1RHMA 2CNNA 4ZVRA 4AW9A 1NMQA 4AWBA 5IAEA 3S70A 3H1PA 3NR2A 1QX3A 2FQQA 3ITNA 1F1JA 4EHNA 5I9TA 1SHLA 1SC3A 1QDUA 2XYPA 4ZVQA 1NMEA 3PD0A 2WDPA 3D6FA 4N7JA 1CVRA 4NOJA 2J31A 4ZVTA 3V3KA 2P2CA 4DCJA 4EHFA 5I9BA 2CJXA 4NBLA 4QUGA 3V55A 2XYHA 4FDLA 5LU9A 3K7EA 2HBYA 3DEKA 2HBRA 4EHDA 4PS0A 3BIJA 2H54A 2AR9A 4I1PA 4PRZA 2H65A 3KJFA 3R5JA 1CP3A 3PCXA 2Y0BA 4PRYA 5IAGA 5IBCA 2K7ZA 3PD1A 3SIPA 1RWXA 2J30A 4M9RA 4QUAA 3H13A 2QLJA 2QLFA 4QU8A 4N7MA 1M72A 4D3XA 1SHJA 4EHLA 5IC4A 1K86A 4IYRA 4AWAA 3IBCA 3R6LA 1QTNA 4ZVUA 3V4LA 1ICEA 4JR2A 3H11A 4LSZA 1RWWA 4ZVOA 4HQRA 3DEHA 2QL9A
chains in the Genus database with same CATH superfamily
4OLBA 3SAJA 5EP3A 3BG5A 3CRMA 1QV9A 3INGA 1NJ8A 4LDRA 1E2DA 4EQ6A 2BGRA 2OO5C 2QP4A 3TLKA 1Q20A 2CC2A 3T3GA 5GZ1A 2PVCA 3OMXA 1U0HC 2JIDA 5DLYA 3B3JA 4MEBA 1I4EB 3MQ2A 1USUA 1E61A 3FPFA 2C29D 2AC7A 3ZOKA 4DLLA 2QG4A 2NXWA 2ZJOA 3F4KA 4IDGA 5ALYA 4RY9A 5KVSA 2NUPA 2PGOA 2GEDA 3ZXSA 2XBUA 1E58A 3FI0A 1M0TA 3MCTA 4IV8A 4L8WB 2RHTA 4LRWA 1GSHA 5HZGA 2MMGA 2VXBA 4D79A 1DCKA 4KCGA 5JQGA 1P1RA 1RFGE 3S2UA 4B2PA 1H65A 1P62B 2IQIA 1W0KA 4MVJH 4QUHA 4EYOA 2P9HA 3I28A 2X3UA 1KJ9A 1IQRA 1SPBS 3LCCA 3R41A 4EGAA 1C30A 1FS6A 1DFHA 3UXEA 4NH0A 1KARA 1H1TA 3AO0B 1VLHA 1W1IA 3H0KA 3MJSA 4OXRA 1EINA 1NUPA 3B6IA 4R1LA 3S0JA 5A0FA 3W5IA 3ODPA 4KXVA 4ZT5A 1C0PA 4QVKA 4RGQA 1FX0B 3ZQUA 3JSXA 2WTBA 2QMUA 1RRVA 4W1PA 1PSDA 3RYHB 2YCLA 3KPYA 4IZ6A 3OQ6A 4DCPA 2Q5OA 3O3NB 4L4RA 1P4JA 3CSSA 4QNMA 2BZ1A 2ZCVA 4J16A 1QIKA 3SXUA 1O0BA 3RRMA 4OHPA 3NAQA 4Y2SA 2AHRA 2VJKA 5LP6A 1KI3A 2LIVA 1CUHA 3JQRA 5K4GA 4RULA 1KKLA 2H0RA 5DYYA 3SYMA 3ZGYA 3HKCB 1GSOA 1WDWB 1WDLA 5L3SA 2YASA 5BR7A 4GOXA 4LOAA 3GFFA 5C8YB 1Y3HA 1Z2AA 1XU7A 1L4NA 1X77A 3ISVA 4LYHA 3L9XA 1RHQA 2W4QA 3H2SA 1VHLA 5JZOA 2VA8A 2EP7A 3MWJA 5JJKA 2MINA 1SVUA 3PS9A 1MP0A 4ON9A 1UFQA 1V7CA 1O89A 1N3YA 2W2LD 3HPQA 4QBHA 1GFIA 3AOGA 2FWMX 3E05A 3N8HA 4N8SA 2JVJA 3IHWA 4XYGA 5F7ZA 2BD0A 2ZSFA 1LLDA 2O0MA 3DEYX 1NZFA 1ULTA 2A8YA 1U9IC 4H3SA 1BVRA 4RA6A 1Y5MA 3M6UA 3STHA 1SKUA 3U7IA 3VR5A 1NJ6A 3LUCA 4AG3A 3KQNA 2GPAA 1EU1A 1Y9DA 4G2TA 4EX7A 1SK8A 5JS7A 5LMCA 2B37A 3ZE6A 1M2FA 2H65A 2V6JA 3L4BA 2QTWB 3DHVA 3FHCB 4BZPA 1TJ4A 4K81B 4LDJA 3QFHA 3DHEA 3VNQA 5L3VA 1W2WB 2DJIA 1I0LA 3HCEA 3OJOA 3C4JA 4XWGA 5JSKA 1NBEA 1LI4A 4UUAA 1T2CA 4S2UA 3HZOA 4L27A 3UHOA 4F0JA 1BHSA 5E0OA 5EJ5A 2R1VA 5AHRA 3PPIA 4EJSA 2FGKA 4KO4S 2X6RA 5ES3A 5G0TA 1R0YA 2GJKA 1A96A 1FVOA 4GZLA 3SDZA 4ENPA 5JJLA 1KO1A 4ROTA 3CW2A 5FPPA 5E9QA 2VUHB 4HDSA 4Q7EA 2OGWA 4L4YA 2BTOA 5UKDA 1DG9A 1JHXA 3GDHA 4E21A 2JIBA 2RGBA 5KWJA 5KPDA 2YWCA 4PLFA 4P2GA 2UZAA 3JU3A 1BD3A 5I7WA 3I62A 1LEHA 5JUWA 1DMSA 1SQ6A 5G40A 1Y6GA 1X2EA 4LGVA 2PYIA 4HMPA 1M2OB 4U0JA 1T3SA 1K7YA 3OE7D 4QLAA 2H4FA 1GCUA 1VCIA 2WAOA 3OEWA 4BQPA 1G2OA 3VZBA 4KH1A 1LBIA 2P1DA 2VDQB 5LOVA 3ZH2A 4ZEMA 3EIOA 3NTUA 1FP7A 2C42A 1C4OA 2Q4RA 5IX8A 1G16A 1NN0A 1T36B 1T9GR 2JANA 3VR1A 2ZRQA 5A3JA 5IAOA 4W8OA 3HR4A 1E69A 3M70A 4LPKA 5LD2C 4NSNA 1SAYA 1FP4B 4NCJA 5IASA 3CFYA 4PQRA 1XAIA 3ZZTA 4YRFA 4YRPA 2OZLB 5B5SA 1W5EA 2FOLA 2ODPA 5B7PA 1WS6A 13PKA 2V9ZA 1ULSA 4HVAA 2J9FB 1YQWA 1D2RA 1GP2A 1L1FA 1V4VA 2VK8A 5LL6P 1UC9A 3I6YA 2C2YA 1I14A 3PEFA 5IJZA 2D1SA 3TKAA 5L3ZA 3KQYA 4Q39A 5HKKD 4C05A 1FU8A 4V0MA 3IA7A 2I65A 5EUQB 5KI6A 1H2HA 3IAS6 2PMEA 2BEUA 3GEPA 4YJ2F 1EZZA 4IAOA 4PPNA 3WKAA 2QT1A 2I4TA 3MBOA 3B7WA 3LHIA 1T1EA 5E7QA 5C5EA 1PI3A 2BR5A 3ADOA 2HF8A 4O0MA 1ZN7A 2ABWA 2Y4NA 3KYDA 4AKIA 4NDZA 4WLOA 2ZZKA 4NESA 5F2OA 5EN4A 3ENZA 4CM4A 3F6BX 5HK8A 1WAMA 3CE9A 3GJ4A 3ICCA 2OZPA 3HJFA 3ASYA 3P9YA 2P8JA 2NXJA 1RBZA 1D2MA 2PG3A 5KUTA 3K8OE 1N78A 3KU1A 2CLHB 2WTXA 3LC0A 2OO5A 1VSQA 1JEJA 3CU5A 4B7UA 1KI6A 1L4UA 3CRNA 4ZZ2A 4H3HB 3T1NA 1Y8AA 1JQLB 3DQPA 1KDYA 4WKPA 4BJHB 2FN8A 3WLRA 4KNYA 1JPNA 2YQ5A 1BDIA 3B3GA 1UJMA 4CW7A 3G0BA 4DA9A 3HRKA 3LKZA 2FWIA 4UCQA 3L7AA 1H8HD 5FWYA 2VN8A 3L5KA 2BF4A 3JPWA 3HV0A 5G1PA 3Q2KA 1GDDA 1H93A 3WHIA 3INYA 2VK1A 4NP6A 2P75A 4DR4B 2R86A 3RAFC 3ICQB 4HEHA 4LFCB 1XUOA 4EI7A 1L7DA 4PZAA 3M9XA 3BFJA 3ML1A 2C9ZA 2NT3A 2YY7A 3OOEA 1FLNA 4A0FA 2ODWA 2ZP1A 2ZRAA 4IGAA 1OZAA 3V5NA 1DEXA 1DO8A 1VG8A 1DAHA 1G1AA 2Z8XA 3PGLA 2QRJA 3ZBUA 4GRDA 3WV4A 1NUTA 1UBLS 3BJRA 4BNIA 3TDMA 1R4AA 2D7JA 2LDXA 4R05A 1N2CE 2CHEA 4M86A 4MI6A 4ETNA 4Q9DA 4GUDA 3RU2A 2ILTA 2G8LA 3OE4A 3PJEA 4QT0A 4ZOAA 2PRZA 3NGXA 5JG7A 4ARZA 4ZI2A 2Q21A 3H17A 3IDOA 3U13A 4R8VA 1QGDA 1Z82A 2JFUA 3VPFA 2X1LA 3FMGA 4XD2A 3W6NA 1SY7A 5AOBA 1J33A 1DNPA 4M9UA 4QUIA 5CDGA 2DCUA 2VIIA 4PHTA 2I91A 3O4GA 3PZBA 1RM0A 4NBVA 3BMCB 3PHIA 4RZ3A 1JU4A 4MJXA 2FP3A 2B1GA 4LAFA 2QROA 3KZVA 2XYGA 3WA6A 3T35A 3FYTA 2FPLA 4MRMB 4FEEA 5EP4A 5LKAA 3C5WP 4KO8A 1A98A 4N5LA 3QMMA 5AHOA 1HYQA 1JUDA 5E3IA 2UDPA 4AC9A 3U44A 1FCJA 5HQ3B 4KGDA 4DUGA 1D2GA 2G5CA 4XKJA 1DT3A 4EO4A 3ZC3A 3QGMA 1IN5A 4ZQFA 3C3KA 3HRIA 4C5BA 2AC4A 1ZM3A 4GICA 4GG1A 4RGYA 1D4OA 5JLAA 4L2IA 1U9IA 1G8HA 1I7QB 4KK4A 2P5UA 4DLUA 1VE5A 2G07A 2OPBA 3HXQA 1LTQA 1AF4A 2X4GA 3JS5A 4EFDA 5BV1A 5DWVA 1AUOA 1O4VA 3T15A 5B57C 2PL1A 2DQKA 1U5BB 5EP1A 1GA1A 5I4CA 3ZBPA 5IEJA 3S2IA 3U1BA 2QM7A 3PFWO 4K9QA 4MS4A 1LX7A 1E1CB 1SVNA 3GYBA 5IUNC 2QEQA 4M7OA 4ARCA 5REQB 4MVYA 5LZ8A 1YZYA 3IEKA 5JC1A 3DDHA 2ZI6A 4M6WB 2YX1A 3GLFA 3OKFA 2PMCA 2Y77A 3L7CA 4GS5A 2H9IA 4FX2A 4POAA 3AF2A 4CKXA 4N8DA 2X0JA 3SX4A 5CXQA 1W36B 1M66A 3ER8A 4IJKA 2PGIA 2RGWA 3LBHA 3EF1A 3QPWA 3A26A 4MPRA 2YZKA 1VXOA 2D06A 3OECA 4GVPA 3UV3A 4CIDA 1B6GA 3QXHA 5I4KA 2JFWA 3E15A 1U8CB 2QGNA 1DEOA 4UJ3A 1PUXA 5DSXA 3K4QA 2BGMA 2ES4A 1RZ3A 1AZTA 3KTFA 3NB0A 1JDVA 4XH9B 4EBFA 3NU1A 2C07A 5LQMA 5CCXA 1OH6A 5EIOA 1Q6ZA 4NZYA 5F77A 1OB5A 3H4TA 5LB2A 4MGYR 2PZFA 3ZHCA 1XXLA 1TYZA 4NQRA 1GR0A 1KAQA 2AXEA 2BCJQ 4JLAA 2X8WA 1G291 4R1NA 1KAMA 2I7CA 1SG9A 3FNRA 4E3WA 1LC0A 3FCUB 3A0UA 1OREA 5GQSA 5ICFA 5TQ2B 5ESXA 4C1NA 1PBTA 3A4IA 4QWMA 1I1OA 3OTIA 1Q0HA 2IUEA 3WWOA 4EJ6A 5A6VA 4FDVA 4DB2A 3E3MA 3KJXA 1QOPB 2BKEA 4C22A 3JQ7A 1YE3A 3L0CA 3UPTA 1NY5A 1O2DA 4XGNA 4BB5A 4EPWA 3CM0A 1KC3A 2FTKE 4ESEA 3HVUA 4FWIB 4IGFA 3IJEB 2FKAA 4ZVLA 3HYNA 1WW2A 1AURA 4C4OA 1Z73A 1DC7A 1P1BA 2OCPA 3CW9A 3BE4A 3F4BA 4P5EA 5BURA 3ABIA 3PDJA 4YNBA 4LNUA 3W78A 4EO9A 4ZYZA 1QGED 1R74A 1XTBA 4N0PA 1HLGA 4OQMA 3VZPA 2P5SA 3BKWA 1YHYA 3U60B 1FZTA 3TCXB 2LCIA 2HN9A 4NBRA 1M6VA 2QB5A 5BR8B 2G67A 3G17A 3L04A 4TS1A 4Y2YA 2GCOA 3B85A 3DO5A 3QU4A 4H6PA 3TSOA 2VNKA 2W22A 1NSTA 4D8VA 2YS6A 2XVXA 4QHTA 2LZ0A 2ODQA 2XTMA 4FSDA 4C5AA 1EVQA 5BSGA 4C3ZA 1OLUB 3N1UA 2CMFA 4MS3A 3GJSA 2GZAA 1Z6ZA 2K6GA 3C43A 3O82A 1Z74A 4KE8A 4BGVA 3BEOA 4MA0A 2AOXA 4BV8A 1M3SA 4DBVO 5BYAA 2O5RA 4BNFA 3L6UA 3R5XA 2X22A 4G5RA 4E94A 1VMAA 2FRVA 3BSFA 1KO8A 4NMHA 4R5HA 1AK2A 2VSNA 5MN5A 1LX6A 3NDJA 1KRWA 1D07A 1XRQA 1YS2X 5CNIA 5EZYA 4QTTB 3PR3A 1E2QA 3TW8B 4YUVA 3L40A 4B45A 4U6NA 4MLZA 2XUKA 1OU4A 1W5SA 3LCVB 4YXFA 1PFWA 1J2EA 1C3EA 3D8TA 3MINB 4HGQA 5SY4A 2JFVA 3HJGA 4KRYA 1BN7A 1I36A 3LY5A 1GNRA 1K8YB 5BO5A 2X0EA 1SCBA 4E51A 2E5FA 4TVSA 2FHPA 3LX5A 4O1IA 1NJ5A 3KXIA 3UWMA 4J07A 4KFSA 3WJ7A 4DBLE 4RTLA 2HRRA 1HNXB 4MUGA 1C9MA 1J99A 1NDHA 2AYZA 1OPRA 4NU6A 4Q9AA 1FDRA 5HF9A 3SS8A 4HNTA 3THOA 1KPHA 2O52A 4LCEA 5K1ZA 3PEEA 1IZ9A 2AFIE 2ZIZA 4CMBA 2F64A 3WLMA 1DXOA 3RS0A 4URHA 1NNUA 4NPAA 3R40A 3FYUC 3DE7X 1ACMA 4I4NA 2V0GA 4G0YA 1O8CA 4O08A 2WRZA 2Z56A 4ZK2A 4N03A 1II9A 2GVZC 5B2FA 3NR2A 1FEZA 1KVUA 5GP1A 4AT1A 1OX6A 4D56A 1LKZA 5GV8A 1U2EA 3S4YA 5TE9A 1G5PA 1J0XO 3H2BA 1ZMTA 1G8AA 5DV9A 3FETA 3ETEA 2UZIR 4QYIB 2O6LA 2WV7A 4R54A 4GPEA 3R74A 4HI0E 4F06A 4Q48A 2Q5LA 2IEGA 4NJEB 4F2GA 1SIWA 4DR7B 2JEZA 1U8UA 2HBRA 3HZZA 4S3MA 1VI2A 3HJUA 2C8KA 3DUWA 5A03A 3Q3HA 4I1PA 3R3SA 4RDHA 1QOQB 2MR5A 4A0RA 1N5JA 1A04A 4MNTA 3ZLBA 1PVDA 2GDJA 4PRYA 1GPBA 5IAGA 3VI3B 5IBCA 1LQ2A 4EG6A 1NDQA 1HGXA 2Z2YA 4NV3A 3KVNA 4P92A 5IJWA 1Z5WA 2HX1A 4LW8A 3W04A 3HNOA 3I4FA 1US8B 3M5CA 4J2HA 4U3JB 1HLDA 1Z83A 4BQOA 3MXOA 1W87A 4RJIA 1K86A 1QAOA 2EFYA 2V5AA 2J4CA 1W4AA 4OQEA 5F78A 4AZSA 4LSZA 2A1TS 1GARA 1OWNA 3EMKA 2ZIFA 3GAAA 3P0RA 4IIHA 3U1TA 1O58A 1LBHA 4D80A 1E3SA 3QI7A 3RTDA 4U7WA 3T7RA 2ZB4A 2QVCA 2QTBA 3A6GA 1Z5VA 1USKA 1IQ0A 1TU4A 2VF5X 3BMOA 3RRYA 2I67A 2XIQA 3VR3A 3RASA 1DDOA 3NFRA 4OQZA 3HVIA 4YV2A 2ZROA 1H05A 3PKZA 5KTTA 4RHXA 4K9OA 4MX8A 3VDXA 1OUMA 4MUXA 4NPCA 2C8JA 1FSGA 1HZZC 5CB4A 5JSHA 3PPWA 1PJ3A 1VA4A 3ECSA 3OD5A 2Q6LA 3X1JA 4BVAA 1KP9A 4R01A 1N6PA 1JP7A 2BP7A 4RKFA 1DTWB 4C87A 5LDGA 1Z39A 1KS2A 1SWVA 2A1UB 3D6HA 3IAM6 3JYOA 1AD2A 4MS1A 5ITZA 3BL6A 3QBJA 1AE1A 4L5YA 2PIAA 2MYTA 3KVVA 4KSBA 3WMRA 3MTQA 2PTHA 4H0FA 4L76A 3TTXA 1TJ5A 3OCUA 4GKAA 2A92A 4QQRA 1ZOLA 1K27A 3IELA 4WNAB 1CB0A 1ZD9A 1E0JA 2C3UA 4C4AA 2IY9A 1J06A 5GONF 2JGFA 3AVQA 4XVQA 3KQHA 1E3QA 2VRNA 2ZYHA 4PYNA 5AXDA 3TRHA 5LUBA 3OZDA 4B33A 1XYYA 2YC2C 1I6KA 2FYTA 1DWPA 3K6SA 2WMYA 3S2SA 4OP2A 5C34B 1E0DA 5L6LB 1T1IA 4M3NA 3DP9A 1DIBA 5I7HA 4B3TB 4V0NA 1IEXA 1RKVA 1U3WA 3ZHUA 1UBSB 2RAFA 3Q7SA 3TRJA 3VTFA 4BB6A 2NUAA 4AJKA 2W2KA 5CA1F 2R6R1 1L4KA 3AEQB 4N0EA 4Q66C 4RS4A 3CLUC 4NAHA 5G0VA 4O29A 3CZMA 5LB4A 4OATA 2QQGA 2B82A 1S1MA 2CBZA 3FBTA 3I5AA 1V95A 3W4JA 1BYIA 3F6SA 3P96A 1I4DD 2HRZA 3FB4A 3AG6A 5CFQA 5DP2A 1D8TA 4YJ2A 1CRQA 1DRJA 4YJFA 4EF4A 2VJPA 1VJ1A 1R8SA 1Y1QA 4V03A 4EHNA 2IIQA 2ZQZA 4FQ8A 2C95A 1QFJA 1C4WA 3WOVA 2N3ZA 1VECA 4CKCB 5DW0A 3M6AA 1UKAA 3SYKA 2JJ2A 3QWFA 1JMVA 1ECBA 2QOEA 2R6AA 1JTVA 3LVFO 1AKWA 1YDFA 2VNJA 1K7EB 3Q4GA 5IZ4A 2BGKA 3TI9A 4BRUA 1EWYA 4IWXA 3DNPA 4MR8A 3WGYA 1PGPA 3BSWA 4YCLA 4FHZA 3EQ2A 4E12A 4EL5A 2DFKB 4G0VA 3C8DA 4BKPA 1QF7A 4F4DA 3PUZA 3FUWA 1HG1A 2V5UA 4PXSA 2Q3DA 2O8CA 1QGUA 4LBWA 1KKUA 1PT9A 2FUKA 2DFVA 4C6SA 1RLJA 5DU2A 3RIXA 4C6TB 2BFOA 5I9IA 3B2EA 1NXTA 2OAP1 4BHTA 2UVDA 3OEHD 5BW6B 2E6UX 4L5CA 1G2PA 4HNUA 5I8WA 1Z16A 3DMDA 4CMHA 2H1OA 2PD6A 4BN4A 3GUZA 4NQZA 1P72A 4LHWA 1QJ4A 1STOA 1LS1A 2E37A 3L7IA 1Y63A 4RGBA 2YICA 2IEBA 4MJ3A 2JF0A 5CLHA 4RJ2A 1XZLA 3ZZ1A 1PV1A 3KBBA 2F67A 1ISHA 3QFFA 1UZLA 1Y37A 4GAEA 1Y4DE 2VJNA 4V0RA 2X5NA 3M9LA 2EG9A 4GXNA 4A2CA 3SI7A 5LFAA 5PGMA 4EI9A 1K66A 4F60A 3CKYA 3U48A 3CR8A 4TWIA 4PZ9A 4MGEA 3ZNOA 1DXHA 3V7FA 2GQ0A 1O1YA 2J09A 3DZHA 1W76A 3FX2A 3FYUA 5H3CA 1O6GA 3Q9NA 4FFRA 3V00A 5HKLA 2L17A 2YRFA 3WDLA 4WBNA 2O59A 1UJ4A 3AU8A 4IEFB 4L7QA 1WV1A 1ZUIA 3H0EA 5KNDD 3GRUA 1NKVA 1WJGA 2PKWA 3B3AA 3R3VA 2R5FA 3AH8A 1R4MB 2G08A 3JWGA 3OHSX 4PLCA 1PCXA 5FTNA 1KSHA 4FFMA 5EJ4A 4OL0A 2GA8A 2XCOA 2PX0A 4N39A 4QARA 5DCLA 4FW9A 3WIVA 2QTTA 2O2XA 1SWWA 2CCJA 4L02A 2IP4A 4IICA 3GELA 1W581 3RG8A 4AX8A 2IYLD 1PNRA 3OZRA 2PYZA 5EYPA 2OPHA 4AN1A 3IUJA 2FEOA 1DAEA 1AUXA 3X1YA 4HJRA 1YK1A 4KNVA 4H08A 5TJ9A 3LHSA 4YLGA 3RUPA 2CFIA 3MK31 3KJQA 2A35A 3LSTA 4HZUA 2LNDA 1CZRA 3PPVA 5C1BA 5JNUA 3L7KA 1YBAA 2QTMA 1BWRA 4DLPA 3U4IA 3KWLA 4W7IA 3OOHA 2D0IA 2L0XA 2P2SA 2PD3A 3WLJA 2JW5A 4NCKA 1H1LA 3T9DA 2CNNA 1NDUA 2PUWA 3BYZA 3WAGA 4UCFA 3A4YA 3EK2A 1G0NA 3C3JA 1CY0A 1OKKA 1Q0ZA 1B00A 1G20B 1KDRA 2CZCA 3I64A 3DUFB 4BATA 3WGUA 4LOIA 1KZ4A 2YVQA 2FPWA 1JEOA 3UOGA 2E0IA 3O1LA 4JJAA 3ILYA 1P1FA 3R76A 3ONFA 1WHTB 2VKTA 2Q7OE 1HZZA 1GN8A 1LCIA 2R8EA 4D57A 3BK2A 2EYUA 2CE2X 2ONYA 1NVKA 3EC1A 1Y3CE 4G8CA 4KFRA 1FF9A 3EASA 4YS6A 5BNIA 2IH2A 3PLAE 5CG1A 2VH1A 1C1XA 1Q3KA 4AUEA 4LTMA 2O50A 3QLUC 3S2ZA 4D99A 2XCLA 4IOLA 1WF3A 4Q3NA 4R83A 4WFQA 1LS6A 1NVEA 4C2BA 3B70A 4QUAA 1RPTA 2BUAA 2CUKA 4CKBA 1XF1A 3FVWA 1GG5A 5CIQA 1ONBA 2ODBA 4A3SA 5CLJA 3I1YA 3CNEA 2GB4A 1Y4UA 1OMOA 4KG7A 4NNPA 1PR5A 3FLMA 1A7KA 1FXSA 3FSJX 5A2GA 4B4UA 3NUZA 2EZUA 3DXYA 3I34X 5HJEA 4L9AA 4GYJA 4OXIA 2BJHA 1R9JA 1JEEA 4E2XA 1QYXA 1E1QD 4X9XA 3TS1A 1CERA 1UFKA 3UFBA 3EIQA 4QBIA 3J81k 1LUAA 3LT2A 4J9VA 4YHHB 3GLGB 3DYIA 3HHEA 4DCUA 5IKXA 1VFNA 4L5JA 4KP7A 4WOBA 2HV8A 4RORA 1FDSA 1MOPA 2RK6A 3WA7A 3TQRA 2Q3FA 4H15A 2N75A 4NZNA 5D3KA 1A7UA 3EPPA 3LY9A 3JPYA 3R7AA 4DDVA 3O9ZA 1T91A 2J7PA 3P9QA 2KPOA 1L4HA 4Z2AA 1BWPA 1TUBB 3KJIA 4JCCA 3R5SA 4R2WA 5JRZA 1OWPA 1ISJA 1JALA 3E0QA 3RVBA 2AFHE 4ITUA 4C9BA 1IY8A 2OCGA 3P5SA 3GLFE 1OWLA 3E6AA 4I46A 4I08A 1NE7A 3IV7A 3O8BA 4ZCTA 3GLHB 2EVWX 2OBMA 4YMVA 1E9EA 4H77A 1QGAA 3OCWA 2OAQ1 3HADA 3HI6A 4MKXA 3MGGA 3L8MA 3OSZA 1SA0A 4C07A 2FN7A 3UAVA 3BIWA 3EN0A 3I2KA 3KIPA 1GA6A 3PGMA 3QG1A 3UOWA 3WIDA 4A4DA 2WWGA 2G9NA 1E4YA 3QVUA 5E9WA 3HWWA 1QZXA 1J00A 2O57A 3N8IA 1NUQA 3CNOA 4N49A 3JZMA 1A9RA 3I73A 3ZI0A 4B7AA 5ENVA 1A8IA 3LFHA 4CT0A 2WZQA 2YXNA 2DGDA 5CVCA 4K9NA 3NGMA 4E88A 5CPFA 1XDGA 4W1RA 1Q7BA 4Q3LA 4PCAA 2VA9A 4U8HA 4BU1A 2Z6QA 4Y9RA 4RVNA 2DTDA 5PNTA 3WBKA 5JIBA 1DU4A 4TL6A 1W0CA 2A9KA 3IIJA 5I9NA 1TD9A 4QFDA 1LF5A 3II6X 4Q1FA 1AG9A 4RLSA 1EIWA 1GAEO 2VC2B 3DZJA 4OU4A 3TK1A 1AMNA 4G4JA 4MIYA 5K51A 1G21B 2B21A 2IPAB 2Q46A 3JQBC 3WIEA 1YZHA 2GJSA 3L0ZA 4LYJA 5JO0A 5B36A 1K4MA 3NXSA 1PYOA 3OOYA 1EHYA 1S2OA 1EEHA 1XTQA 2GHQA 2J0EA 2W2OA 3IBSA 4P22A 4RK6A 2FSFA 2ZYAA 5JASA 1N75A 2P5YA 3E0XA 2I2FA 4CL3A 1CQWA 2R87A 5TPZA 3Q0TA 1EWRA 2H1HA 3G0IA 4LMAA 2GGSA 1RQPA 2O1SA 4ASUA 1G6KA 4JXKA 1V5EA 2QLLA 2HYDA 1XQXA 4HS9A 3LFTA 5BQPA 5U4XA 2ZXFA 1O94C 1SC3A 3BFPA 3T7SA 3QHQA 3W5UA 1GAXA 1HX7A 3V97A 4CMAA 2G4LA 1J8MF 2NO6A 1HQDA 1Q0RA 2B1JA 4TMFA 1YGPA 2ZUBA 5D00A 3JQAD 3ZHYA 4B6JA 2B92A 2WY2D 2O2CA 3AP2A 2SNIE 3PC8C 4IXWA 2AV6A 2GXQA 2Q1UA 5HF6A 3DE1X 1JAZA 2JAUA 3CURA 4MCAA 2PGXA 3GPBA 2PMDA 3MBKA 2OMKA 4OA5A 3VOSA 3AVYA 5BXYA 2JFHA 3HK2A 3LQ4A 1FRZA 3PL1A 2JIPA 4CVNA 3AY6A 4ENUA 6YASA 3AL2A 3IBCA 3RU3A 3VSEA 3NRCA 1L9KA 1UT5A 3CF6R 1MRNA 2YBDA 4S12A 1C9NA 4YK7A 3ZWXA 3QIVA 4KVAA 1H94A 1N2GA 1OIXA 1QIJA 3MLBA 2HY7A 3ZDRA 3ZCSA 3IDAA 2W6JA 3TTUA 4CR6A 3TDKA 4WY2A 1IPFA 2J45A 3E58A 3VR6D 3IPLA 4L16A 5JW6A 1ZOSA 1I7PA 1GPYA 1U5AA 1S3SA 3MJDA 3PD7A 1O6CA 4HQ6A 5LMNB 1BNCA 3O8OA 4GM4A 3RJ9A 5KNBA 1FS5A 4DV7B 2J0SA 4OCZA 1J0DA 1GNVA 4QBGB 4QUEA 2AE1A 4DLAA 2AFRA 4TQGA 1VPEA 4URZR 1U63A 3FUTA 1SIOA 5FYQA 5F1YA 1YB1A 2FW8A 2H4ZA 4HCJA 1Z5OA 1KEUA 2OFOA 3HXLA 5EXPA 5K3SA 5BSEA 1Q6YA 1RWOA 3SC6A 3GLKA 3FMOB 3B6MA 4CV0A 3VHQA 3I23A 4RD6A 5CDUA 2R00C 2WG0A 2CL7X 2LWIA 3WLFA 4N0MA 3LECA 5FLXA 4RAQA 4CCWA 1FMFA 1OX4B 4BFSA 1KEPA 3VU0A 4M7RA 1C7FA 3UJDA 3VXKA 2QRGA 5LZ7A 4ICIA 1T5IA 1AQYA 3NJ8A 4MAMA 1XV5A 1OIVA 4PLTA 2Y6VA 5MN6A 3T7DA 1E2JA 3MD0A 1WCIB 2AN4A 1X7ZA 2PZBA 1LPMA 3D4BA 4OTZA 1UWCA 1VSBA 4JI6B 3SOPA 3TAHA 2OLJA 2N9UA 1MABB 2X8BA 2YYAA 1FPQA 2IQ5A 3OY7A 4BBAA 4IDBA 4KIFA 3LX8A 2OYSA 3B6JA 4TKVA 3DL7A 3OLQA 1OLOA 5IK2D 1XMOB 4MDEA 2BOVA 3TNDA 4A91A 5DX1A 3U9TA 1NQWA 2ZXEA 5K01A 1Z22A 2P9YA 3C3XA 4FQ7A 5D5HA 1E8NA 4GC9A 1K3UB 3QLUA 2XX3A 4UBOA 4B32A 4F6RB 1MQ8B 2YOHA 3DLAA 4MQEB 4R51A 4U7DA 4YP0A 2VCYA 1B6RA 3VJKA 2EXXA 2WKQA 4IIBA 2M6KA 5GONA 3G7SA 4ZD6A 4AX4A 4Y2TA 4TQUS 1SD5A 1Z4LA 5HGJA 3U4HA 2YXDA 1BMQA 1CG6A 3BB1A 5EIBC 2XB2A 2RSLA 3AZOA 5JY6A 4MYSA 3ZS9A 4EFNA 2O8EA 2P4QA 2JFPA 2QRMA 1QLJA 5DHSA 1ETUA 1YGYA 5E6RB 2EBUA 4HWPA 4YV0A 1MDFA 4X95A 4IF4A 5JDIC 2ZM6B 4F4HA 1F20A 2OL4A 4CEJA 2JGDB 3UJHA 3WRVA 1XZIA 4JEHA 5HS4A 1J9ZA 5CA1A 4N3AA 1Z7GA 1E2IA 2IA5A 4BRWA 2C88A 3VNRA 5JSZA 3HXOA 3SBXA 5I9MA 2EKQA 2DU8A 1XNJA 4UW9A 3VX3A 3TE7A 5HIKA 5LYJF 1GL9B 1PL8A 1RS0A 4HFNA 3V55A 1YWGO 3W3AD 3JQ6A 3LPDA 1GDHA 5GPBA 2H54A 2PU5A 1P0IA 2DFTA 2FV8A 3DVAA 4IDCA 4OJYA 2ZI7A 1FXWF 3OA2A 1ACLA 5CX4A 2YYZA 3D0OA 4I6GA 4C20A 3EQ6A 4UU1A 2N0SA 5KTMA 1IJFA 4U2EA 4IW3B 2IEDA 4BMCA 3C15C 1LFDB 2MYNA 3SQNA 2WYHA 3E5NA 1Z07A 4EJ0A 3EWIA 4MCJA 4CR7A 1TMGE 4RNDB 2R1ZA 1KYYA 2FMUA 1R6VA 3TZQA 4S35A 2WFLB 4KREA 3U7FB 2EQAA 2QN3A 5BR1A 3G9UA 4JGGA 4PAOA 2XDWA 1T0BA 3FZGA 5AI9A 1KJQA 2OZKA 3FMVA 3WLSA 2XTZA 1E5DA 2UVQA 4DOMA 1XVIA 2R7NA 3LXUX 2FMHA 2LCQA 1AA9A 4MB2A 4Z9AA 1FJGB 2VUTA 1Z2OX 3UT5B 5GMOA 1CQPA 3IQDB 4K87A 4HQFA 5BN4A 2J6BA 3WGMA 1P2TA 2IV7A 1YVDA 3D2CA 1DFIA 1MOSA 3KUCA 3ORFA 4I5FA 2AOVA 3KQMA 1JQEA 4WHMA 2FZWA 4Y6OA 1M76A 1XKXA 3FNGA 3RTEA 4TLAA 2XUIA 2I29A 5GJCA 3SR4A 5MDHA 4F84A 3SXJA 3HXMA 4N3NA 2PUVA 3IP7A 4YMLA 3I5YA 1I6LA 1ULBA 2DVMA 1EK0A 2GZMA 3HXTA 3OX4A 3ULKA 4BNGA 1PVOA 4D9IA 2WF6A 4DCMA 2R6JA 2JLVA 1Q12A 2GUWA 2P2YA 4OBEA 3I9JA 4CFYA 3KYBA 5C2JB 5KTSA 5KYXB 1I3OA 5CH3A 4U7PB 1N5OX 4D4HA 4JSTA 4QIHA 2KBEA 4PSVA 3A9TA 3WYDA 3WYGA 3D5TA 3TNYA 3NIWA 4MH0R 1TC2A 1IEWA 1O94A 2MSNA 3D43A 2FQYA 2XQJA 1X80A 1O03A 3KK0A 4OHXA 5FBWB 1GTMA 4EHHA 3GP5A 4LE2A 3LF1A 3ZGLA 1RT9A 1W88B 5ED4A 4MW2A 3F5FA 1MG0A 1RKQA 4GBMA 3ASVA 2QLNA 2BH2A 1U4OA 4ALLA 1XD9A 1IY0A 1TE2A 2CXPA 2REQB 2QN2A 1HURA 2Y71A 3GDWA 4MVWA 3PC8A 4Z9FA 4AZVA 1R0RE 4JP1A 3KKZA 1UOQA 3AONB 4QOHA 4ZO6A 1RM4A 2JGKA 3HM2A 3JSAA 3L0BA 4BFLA 1H4VB 2NZXA 1D1SA 4U7GA 3VKHA 3TFQA 3L4JA 2XKKA 3TEJA 4OO3A 4DV1B 2M1ZA 3ZKAA 4MWOA 4S1TA 3ADCA 4QQNA 2NU9B 3KWMA 1ETHA 3H42B 3AFNA 4JVOA 1OILA 2BZ0A 3L0PA 2VHTA 1KETA 1UC5B 3OC0A 3SYRA 2G0TA 1SR8A 4S04A 4U2GA 3DVLA 4DLXA 3UICA 1QHGA 4BO7A 4P7JA 3TQQA 3NOQA 4ZU3A 1L0BA 3SZLA 1XTVA 3OIYA 5EHIA 3UJCA 4AJOA 1J8VA 1C9KA 1XZJA 1CE8B 1ULHA 2CKMA 5BYJA 2Q3BA 2WSLA 1SHUX 3C7AA 5EGSA 4XEUA 5HIIA 3Q1LA 1YIAA 5SZKB 5JXHA 3C7CB 4GRIA 2GWHA 5D5PA 1AOXA 3JWJA 2I6FA 4ME6A 3HKBB 1MZPA 3O8QB 1YL6A 5DSZA 3ADPA 1NKTA 1Z6GA 2R6ZA 2YWEA 3RSZA 3TRIA 4BYGA 1YK0A 1GPMA 3QV1A 1H6DA 2R00A 1NASA 3LT4A 1T3HA 1TUEA 3OTHA 5FOTA 3TZKA 3ZDYB 4C29A 1NI4A 4DMLA 1Z56C 1T2AA 3JYLA 3L49A 3FNIA 4LS3A 2W6CX 4Q9NA 5BXQC 3FB1A 1SN7A 4G5OA 3DZ8A 3AR2A 2IEYA 3C87A 2OILA 3NKLA 4QX6A 4A6PA 4E46A 1A95A 2IIVA 3H2ZA 2IS2A 1L5HB 1T1JA 1XN1A 2OXRA 5ALPA 4EB3A 1SKAA 1M7HA 3Q3IA 1E2HA 2WD8A 2IUUA 1QC5A 3EGCA 1RLOA 4BRSA 4MW4A 1EUQA 2HDNB 1E1RA 2PWBA 1CEEA 3FCYA 4ITRC 3U4GA 3E9QA 2QQEA 3KQQA 2IS6A 1ELOA 3HFGA 1LTHR 4O8ZA 2EBWA 4XM2A 2OG2A 5EFZA 3I2YX 3SC3A 3DO8A 2V65A 3HFRA 3JATB 3DE4X 1WY5A 3DEJA 4UBIA 2AQKA 5AKLA 1FOEB 2XUGA 3SYNA 5TMPA 2Z6VA 2AMVA 4JU8A 3PXBA 5KJCA 3L0YA 2VJLA 5ILQA 2BHTA 3RT1A 3LQRA 1IBMB 1A9TA 2XI4A 1HV8A 2V1UA 5DX8A 4QXMA 4E5MA 3GVHA 4KSYA 1YR7A 2D3WA 2L2QA 3R4CA 4RV9A 1Z0JA 4HDKA 4ZAFA 1TF2A 3NBYC 5ALNA 2G88A 3VUFA 1XHFA 5DTEA 5BP7A 3K9LA 2XZOA 1DKNA 1UK8A 4LIPD 4E4TA 1RI1A 2R5NA 1UKYA 4KKXB 3RJZA 3VKGA 3IBYA 2JIMA 3LG2A 5FBZA 5KNDH 3LCJA 2DBVO 2HH9A 5CPBA 4ZEOA 2WQZA 4KQIA 5JDIA 5B3KA 4QPNA 3K0SA 2EQBA 3A0RB 4YCDA 1KK3A 2H2AA 2YV1A 1ML4A 1N7GA 3TPCA 5BSWA 2R7AA 1JSZA 2XB6A 1V25A 1Y3IA 2WKWA 4XX1A 1XELA 4I50F 1NF9A 2IHNA 4EUKA 3K9FC 2MSWA 3L79A 5HUHA 1WDTA 1T8TA 2Z1MA 1E6WA 4AZTA 4DS3A 4F5EA 2GO7A 4ZTUB 4B3XA 5AOVA 1VBFA 1CCWA 2B0CA 2AUTA 5H02A 3MFQA 2VNIA 4F72A 2OTCA 1EK5A 2TMYA 3ID6C 4PPGA 3W5JA 2BZSA 2HSDA 4JMLA 1OW3B 3EZ2A 3H16A 2VNSA 4BNUA 4BQFA 5AJWA 5ARBA 3P0FA 2VDVE 1GG8A 4H7JA 2VJOA 4QRIA 3S27A 3THXA 4LHVA 3L1VA 1EFVB 3S3TA 2HT6A 2PBRA 1Z5ZA 2OG1A 4BV9A 3GJ3A 4X6LA 3PF9A 3EEQA 3U17A 5K8IA 3G1TA 2XE6A 4OV6B 4DIMA 3VI4B 4PLYA 1PZEA 2VYNA 3OQ1A 4IEIA 4JWTA 1QIGA 2QDKA 1ZN8A 2W6PA 1CVLA 3GLTA 2PBFA 1V8PA 3SS7X 5BOSB 4HDCA 4JLVA 4R4JA 1QRSA 2WJ3A 3MYRA 1B3RA 4EQZA 7YASA 1PNTA 2DRIA 4K7JA 1CEXA 2RGXA 3I9FA 3KD3A 3TQHA 1RRGA 3I1IA 4DSAA 5C8ZA 1WXIA 3P2YA 5B1EA 3B7PA 3WC4A 4ZVQA 4CF3A 2DKFA 1A9XA 1LBTA 5KCMA 3D2AA 3NYQA 1Y7PA 4G81A 3K30A 3KOMA 1BZYA 1V39A 1V16A 3FY4A 4DRXB 5L7WA 1WBBA 1MCZA 2PO5A 1RAEA 3WNQA 4ZJZA 3GPLA 1AQLA 2DF8A 4PSUA 3O90A 2OR3A 3DL2A 3IE0A 4C03A 3AHGA 1J8YF 3W5BA 3IB6A 4RVSA 4G1MB 1Z06A 3RBZA 2G1PA 3DE0X 1FFSA 2A2ZA 3D54D 4H4DA 5DW3A 2DBZA 1TW3A 1VL0A 2CZQA 1JT9A 1WULS 1EBFA 3KSMA 2JGLA 2W71A 3JRNA 4II3A 2J9ZB 2ZSBA 1P1IA 4M1SA 4WX2B 3X44A 1TX4B 1FFAA 4MI9A 1JHYA 3IUNA 1H0SA 2W90A 4Q4HA 3L92A 1V2GA 2QMHA 4YR9A 3N28A 4HUTA 1B2LA 1KJIA 2R8BA 1UKCA 1QONA 1Z4IA 4WKNA 3WTBA 4YCAA 1R0CA 2NSLA 4WDRA 1ZRNA 2C1EA 1HMPA 3G9QA 5EKTA 4BGEA 2CDAA 3EHEA 3RO7A 3H6KA 1VKOA 3TTYA 3W2FA 4F9GA 2B99A 2ZWOA 3B38A 4HDNB 2CL5A 2Q50A 3ZBTA 1C0KA 1C7IA 1ZOPA 5K20A 2G0AA 4U7TB 2HTFA 3WL4A 1MC8A 1VIYA 2GN4A 4HDRA 1AMOA 1E3WA 3CWZA 4M98A 4UOEA 4O33A 1QG0A 2YIVX 3CUYA 4YQEA 4LJ6A 4OBBA 1B26A 1WXQA 4INOA 5EZSA 1NVGA 2QAGB 5C7LO 4DIOA 2NQTA 2YTZA 1U2ZA 1OHHA 4MUFA 3HPRA 2XQIA 1K5PA 4L5AA 5F1OA 1SCJA 3K0AB 4HHEA 2IS1A 4TXNA 1OXTA 3P9ZA 4IHKA 4XIYA 4KQFA 5B2EA 3LCUA 4BKQA 1SC9A 1T9ZA 2FW6A 3DXFA 1RRMA 4C4PA 1J6UA 3PLNA 1A5ZA 1XXHB 4UAVA 4I4TF 1OJLA 3EXHB 3PKIA 4LHSA 5EPEA 1GUBA 1IPHA 2H06A 4LZWA 1MX5A 2GF2A 4IHJB 1ZIPA 2WM8A 3R7DA 3HN7A 3JAKA 1V4NA 3QJ5A 4N82A 3KKMA 1F9AA 1E9RA 3C24A 4MW7A 1U1FA 4ALJA 3STTA 3LP5A 2ZIEA 4AUKA 2Q2NA 3R20A 1KDVA 1WB5A 2OK7A 3PFIA 5FBHA 1YQTA 2Q2VA 1EJ6A 1TCAA 2IU4A 3NC0C 4XYEA 2YWHA 2WI8A 4X8HA 1XVUA 2XMZA 2W2VA 1ZM7A 2FFBA 2NZ8A 4GX1A 3UPUA 4PAQA 3WYCA 1QM5A 2UVPA 3AZPA 3CINA 4HL6A 2QTHA 4NENB 5G4KB 4ZYUA 2PTGA 5JR3A 3R9XA 1EP9A 4C43A 3DOFA 3FRIA 2GNOA 3RUEA 2WU8A 5HK9A 2ZPTX 3B1KA 1JAIA 2H5EA 3F5QA 2QUKA 1BX1A 4YPFA 2BT4A 1TRKA 3BK7A 3BMQA 4QGBA 3SNKA 1HYBA 3LSYA 1T2EA 2GAIA 3UKOA 2ZE8A 3HCPA 4FD2A 5A0VA 2EFCB 2IYOA 1DELA 2BKXA 4JLKA 4IIUA 5EUBA 1X1DA 1GFZA 1WMAA 2A5JA 3AQ4A 4HQNA 4DMKA 5C3UA 5B55A 1SELA 4WZ6A 2WD7B 1ODKA 2J41A 3SSMA 3I9NA 1CP2A 4KXMA 5IXJA 2FEWB 1VCNA 1QIMA 4R9RA 3LLVA 2NXCA 4A5SA 1H2EA 3DDZX 2BC9A 1EX6A 4IJ6A 2Q3JA 4IWYA 2YJZA 1XI2A 1ZM4A 2Q5FA 2WJJA 1L7OA 3IB3A 2AZTA 3ZHOA 1MA3A 5IVDA 3U4QA 3ZY4A 5I47A 3TEFA 5LYJA 2D0PB 3A1WA 2J5XA 3HY6A 1J0AA 4J0FA 4D3XA 3DV9A 1RPNA 2ZJ0A 2XOEA 2XMPA 1IZ7A 4BP3A 2B1RA 4F6LA 1QWSA 2J5KA 1PL7A 4L4XA 4YUAA 1IWPB 1BMFA 3VVCA 1FXWA 1VIVA 2ORYA 4BUCA 5DWQA 1EAMA 1JR3A 2XA1A 4L3OA 5K3AA 4XYMA 4NBUA 3AM3A 2O5VA 2I71A 3ZDEA 2G4CA 5DM1A 4D41A 4HYYA 1QXSA 4QG3A 4KPEC 2FPUA 3EOZA 2I8AA 3IP3A 1G60A 3VU9A 1NYLA 3N8KA 1AXGA 2NO9A 1NBOA 4ECEA 3QPAA 1TF5A 1RZUA 1EVJA 2C2BA 2JFNA 3BWXA 1A4RA 5DOVA 4DQKA 2ZE6A 4NCAA 3I30X 4HB3A 1Q2XA 1ILWA 2GZRA 2DE0X 1QG2A 4EGFA 2YDXA 4MR9A 1FXUA 3T1OA 1YUMA 2PZJA 4NE2A 4OPMA 1CPYA 3CCBA 1NV9A 2IU3A 1B0AA 2JZCA 2HJRA 1SXJC 4AAYA 2JHCA 1DRVA 1QNFA 4IF6A 1UH5A 2YVKA 1N9KA 4AECA 1X8KA 4QULA 4R1SA 4MUMA 1J25A 1FFGA 1LDMA 3N3BC 2IKQA 5KNCH 1M1YA 3V1LA 1EP3B 3DMTA 4OHCA 1IRIA 1SU8A 4BZWA 4Z4GA 3W8NA 3N0RA 1KORA 1QGZA 1QZTA 2AOUB 2QYSA 2REOA 4GQIA 4HNAB 521PA 3V42A 4UQLA 2DQZA 3OOWA 3PXGA 3KSDO 2VP6A 3V6MA 3ZIUA 5C18A 5ALIA 3GNLA 1DIRA 5H5JA 1U7TA 4D81A 2QMQA 1QCDA 2IJGX 2GPSA 4FYKA 1XNHA 4GWLA 2J3DA 4DIEA 2COKA 4LRTB 4Y3UA 2NW6A 1D6NA 1I13A 3AR3A 4BO9A 3GBPA 5CR9A 1H1DA 7ADHA 5TQ0A 4PZPA 3WWEA 3IJRA 5H59A 3N2ZB 4FYMA 5KDDA 1XWIA 3Q9SA 1KVRA 4IRXA 4OHVA 1OY1A 1ZHOA 1NVDA 1XU4A 5AKYA 4AXBA 2WABA 1JTFA 4GLJA 5BWBA 4FE4A 1BQ3A 1UBFA 4M21A 3A1FA 4PG8A 2WPDA 1KMMA 4PPFA 3E1SA 1RYDA 2QJWA 2UYQA 4IUDS 5CEJA 1R6DA 2SKEA 3WK4A 2PK3A 4B35A 2BGWA 3UWOA 2MMCA 3ROQA 3KZMA 4EECA 4D42A 3FSEA 3UK2A 4GVXA 1M5UA 2FZ4A 5E1OA 4B40A 3BHMA 1QVVA 4Q4JA 4CKYA 1U2SA 1OYYA 2IE8A 4B74A 3DULA 1OGJA 2AOWA 2A4MA 1UF9A 2B69A 4TS9A 5HDQA 2ECQA 4B9AA 2AYYA 4QQFA 1G66A 3I6QA 5JD4A 1IJBA 3IT1A 1AA6A 1JR2A 4FOLA 5A1JA 3GRZA 5E9JA 4I3GA 1RWXA 2O8FA 2OXEA 4TV9A 3FTEA 4QATA 1VLVA 6REQA 1B8UA 1A5SB 1CR2A 2GFHA 1PJ4A 1XZQA 3AVOA 2YKGA 4FFVA 2I7TA 2BFCB 3GRCA 1P2FA 1SZCA 3B1VA 3NTRA 5AKGA 4YAIA 1II0A 2A4KA 3EF3A 3OQHA 3K0FB 4FGKA 1ZITA 2HJGA 1B8OA 2IPNA 2OEPA 1IN1A 2OV2A 3L7BA 2VPTA 5BQOA 3IT0A 5LNK1 1UXKA 2FZLA 4BNDA 3WKDA 3SLKA 2O8DA 1TCUA 4MUJA 4ZICA 4OYYA 5M3BA 4M49A 1YZLA 4FEAA 4JLWA 3RNOA 3IDSA 2R8PA 3JYQA 4YIHA 4K0RA 1YZ3A 5G0SA 3TRKA 1P75A 3BHJA 4Q47A 5F23A 2E9SA 1YCDA 3EA0A 4TS4A 2WF8A 2Q5JA 3EULA 4H59A 2B4AA 1NC3A 2AI2A 2H85A 2YNMA 3MWFA 4EUEA 1QZZA 3EGDA 1RKXA 4G3XA 5CD1A 3CXUA 1OTXA 1L4BA 1QTRA 1X39A 1KU6A 4I1SA 3ZD6A 3EUEA 1R12A 1U6JA 2J08A 3Q6NA 4N48A 1ZIXA 1Z4MA 2XQKA 4LJ8A 3ZCQA 2OBFA 3D4LA 1LW7A 3EH2A 4FGWA 1UK7A 1MNAA 4DC0A 1WMDA 2G09A 2Q9UA 3EDMA 3VTKA 1MGOA 1XROA 3BTVA 4JJZA 4WMLA 1N77A 3MWEB 3FTFA 1OBVA 2H2FA 2FB9A 3NHRA 3I9V1 3QM1A 3D3EA 4WXMA 4GEKA 1JR4A 2NZVG 1COWD 5ED0A 3FNBA 3WR5A 5E3HA 2DC1A 4US0R 1AN0A 1DC4A 2Z2ZA 3N2KB 3CNNA 4IHQA 4RJKA 4C08A 3RC7A 5EJ6A 2JJ2D 3BC1A 1WNTA 1DOAA 3I92A 1Z26A 2DLNA 1IAVA 1Z7WA 1JJIA 1XEWY 1MTOA 3MS2A 4I50A 1SCNE 4BWFB 1Y33E 2NSJA 2OCYC 3L1IA 3KKOA 1DIAA 3F3MA 2FG7C 1R2QA 2DJ5A 2PKYX 1SOVA 4R1TA 2OY0A 3R5HA 3OJFA 1OXKB 3VV2A 2ETVA 2Z5GA 3R5KA 3HSSA 5FBQB 3IP6A 3V2IA 4A2PA 4BLPA 1NC1A 2P4HX 1RCTE 4MB0A 2E4AA 3K9QO 4JJ7A 5I9SA 1WXHA 2PV0A 3I5MA 4I6EA 2GXAA 1MAWA 3L6BA 3QP9A 1O9HA 1T43A 3RK1A 3L0SA 5IJ0B 4ENWA 3HP1A 1MU0A 2CYAA 2W2TA 3TLBA 1DDGA 3CG4A 3V2UA 4QUKA 2HEIA 1Z25A 2WDPA 3TJMA 2YV4A 3C3PA 3I8SA 1KL7A 1QDLB 2NGRA 4PYRA 1KQNA 5KYKA 5I4BA 2EC5A 1WV0A 4P32A 3DHYA 4QLOA 1GU7A 2J9RA 1NJSA 1Z2DA 3DMRA 4X6UA 5ESRA 2FEPA 3HBFA 2X0NA 2M98A 3RYHA 4AF7A 1I9GA 4ZV9A 2I9KA 1PR0A 2PXHA 4RY8A 4RUKA 4CKWB 3O84A 1PJBA 5FULA 3ON5A 2B2NA 1C8LA 1RACA 6PFKA 2HWKA 1E1MA 1ANKA 1I01A 3CW8X 1X3LA 3IODA 2PX2A 3I39X 4D1YA 4D0NA 1FMJA 1OU0A 5KVVA 1SXJA 2WD9A 1ULZA 2DT5A 3FKQA 3TIGA 2XQVA 1JXOA 1A50B 2C5SA 2V9PA 4PO3X 4RK5A 5C8YA 3M1IA 4KBFA 4GNKA 1BAPA 5D1HA 4X84A 1QYRA 2NV2B 3VA7A 4B6PA 2DXIA 2WQ6A 1TKAA 3MLEA 2DHEA 1AQUA 4MR7B 2AMFA 1EWTA 2FSGA 2OKGA 2PR7A 2QF7A 4X60A 2ON6A 2PKEA 3DEHA 3ZH9B 4CIXA 5DNUA 4TTQA 1VQ1A 2M9MA 3O95A 3H4IA 4XA8A 3GR6A 4XX0A 5JAOA 2FMXA 5F51A 1H0KA 1G9SA 4FC7A 2O2SA 1G7CA 4HZGA 2IOQA 2ZUWA 1M1ZA 2DM6A 3DKIA 3V2GA 1Q57A 3AETB 4DYHA 4LRXA 1QBKC 4BN0A 5AM2A 2JRLA 2E7ZA 4RYDA 4Y0AA 2CLMB 4AS3A 2WOJA 1YQUA 2J6CA 4J0EA 3CQ9A 4IXTA 4JBLA 3BCRA 3SZRA 2LPMA 3D1LA 1VE1A 1TF7A 2QYHA 1RNLA 4Q9HA 4ZXFA 4PC7A 4CIBA 3B12A 3G9ZA 3OKCA 4NONA 4DIFA 4OHWA 2CL0X 3GAMA 5C81A 1AKMA 5IXSA 3EW9A 2XIJA 3GD5A 4X1IA 2FG6C 4J9UE 4XSHA 4HDQB 3RJMA 1O97C 4DNFA 1XTSA 1ZQ9A 1BW9B 2G40A 4GX5A 4ROSA 1DRWA 1U2GC 4CTOA 4FFOA 4M1TA 3E9CA 2VP0A 1U7PA 3M82A 1EG2A 1WB4A 3JZIA 3MWYW 2G77B 3WGIA 1B1CA 1OKKD 2R7MA 2HMAA 3DAPA 4F4IA 1B14A 3ROKA 5LN1A 3TXYA 4OXQA 4IDQA 4CXMA 4LZJA 3HHPA 2I2CA 1XZGA 3IR5A 3B2QA 3BS4A 5EEHA 4FWBA 3EIXA 4I4TA 3HDTA 4OH1A 2ST1A 4PO1A 2UU9B 1ORDA 2V98A 3OM9A 2RKOA 1F2TB 2JBWA 4OM7A 4KPFC 1ONOA 1SG0A 2J1LA 1OSNA 1SCKA 1YIOA 1V11A 3KAJA 4WNCA 1BXRB 5ESWA 1QIFA 2AK3A 3FFAA 2IEIA 2ZSIA 1VG0B 1QSGA 4GRAA 5TRTA 1AV6A 2PLNA 3LDFA 4R1UA 1XC7A 1JLMA 2DH6A 4WW0A 5FBKA 4NKRA 2ZS9A 4I19A 4YQYA 4RVOA 1YJCA 3FCEA 4BBZA 3SVLA 4M36A 3CB2A 3K2QA 3KUKA 3QWIA 4E31A 2P3OA 5ELXA 4N0DA 4QOIA 1THTA 1FP4A 3FUVA 3LUGA 3QYJA 4DV2B 5C1PA 2OZLA 3ZY5A 2FR0A 5EIWA 1TK3A 2J7KA 2V6FA 4RPGA 2ECFA 4MCHA 4NBWA 1EM8B 5A05A 1VMKA 3BDAA 1YBFA 1V37A 4ZVVA 2VDNB 1V7QA 4E7OA 2QYOA 1QRAA 3U4AA 4B9EA 5I8ZA 5I7RA 3LQQA 1IOWA 1AS3A 4FCVA 4IQFA 2J7PD 3ZW7A 4RXUA 3EG5A 4UD2A 1A7AA 3O9MA 2VDWB 2PYDA 1V26A 2KX7A 5BWNA 1H2XA 1BCRA 3I8XA 3PENA 3RJ5A 3CLUD 3CVJA 4O4HF 2HW8A 3IH5A 1DO2A 2PUHA 2Q0XA 3E3OA 3ZTYA 5IDWA 1IIRA 5EWLA 4WJZA 2CKDA 2V97A 1K3TA 3R2JA 3RD5A 2NU6A 2ZTLA 3ABSB 4P3OA 4LX8A 5L40A 2YFHA 5H9WA 1AKNA 3THYA 4WI1A 1GAWA 3EPHA 4QYMA 2BEKA 4BQQA 5BWCA 2EHJA 2G1UA 3P0IA 1Q7RA 3QVJA 3DMYA 4UXHA 3UGKA 1T9GS 1YB7A 1JHVA 4N01A 1SQFA 1TVKB 1WP4A 3EZ7A 2JLAA 1M6WA 3GRKA 2BPOA 5AKIA 2JBHA 3T7KA 1E64A 1SIUA 3E22B 3PV0A 4NF2A 3MUOA 2HO4A 2OCXA 4P3XA 2OB2A 5BT9A 4LBVA 3EE6A 1DJPA 2FMIA 4LSMA 3L18A 4MQMA 4R7ZA 4X45A 2B78A 2PO7A 4TUYF 3GP8A 1U0BB 1ZXXA 2V54A 3GVCA 4IKPA 3RKRA 2NVOA 3UW3A 4RDIA 4H16A 4LXUA 4I81A 3AB8A 3WLQA 4OF4A 5IJXA 2GX6A 2Q7XA 4BU0A 4BP8A 4R71A 1DP4A 1ENYA 3ERCA 1RP1A 4UMVA 2HRCA 4Y30A 1E3EA 1F8UA 1U6KA 3LQYA 2QTLA 2PGDA 3T3HA 1A4IA 2A6PA 4FBLA 3SBOA 3VV3A 4E07A 4D6PA 1C9JA 2FFAA 4URXR 3QFSA 5TF4A 4EEXA 3L8GA 3LL7A 4FFBB 2J3EA 3R0IA 4HADA 4ZGBA 2RB5A 1ZGZA 3KTDA 3G9XA 1PDOA 4B46A 3BL5A 1ADGA 1JW9B 4YP9A 4MUEA 4KN8A 5TARA 4YUYA 4X64B 4YBZA 5FAXA 3NM5A 4C3UA 1VJTA 4KLCA 3W05A 3KHTA 1JZQA 4P1ZA 2QVXX 4EQ6B 1GQYA 1CQJB 4QDKA 2RH5A 4LJKA 4EYGA 4DJDC 4LBZA 5J1TB 3HH8A 2CMKA 5FPQA 3UXYA 5FTMA 3ZK7A 4DA4A 4BNMA 2GNPA 1JEYB 1NY6A 2GEBA 2EIHA 4F91B 1MEJA 2NUPB 5A4IS 5EMMA 5EHNA 2ZU6A 4WY5A 3T5CA 3FDFA 1HDRA 2XWPA 4EKDA 4Y2GA 1GNQA 3BB3A 4NMMA 1V1JA 1X8XA 2RHGB 5JFGA 4AY2A 2CW5A 3HV2A 5EINA 4RPHA 1T2VA 5JQGB 2I87A 4YMHA 1VZ2A 2LGJA 4Q18A 5HQ3A 4MULA 2H18A 3AU9A 3CN7A 2PKCA 1P4RA 2WIAA 5JVDF 2Z3ZA 2X1VA 1E2GA 1EFTA 2VVTA 2W6JD 1JHAA 3G6WA 2QUBA 2JLCA 2C4UA 4N7JA 1NNSA 1WVGA 1V9CA 4Z0NA 4ZVKA 2XMGA 5ES4B 4N5HX 5KNBD 5CAEB 4R3NA 5B6IA 3VH3A 1DTEA 1Z5PA 2VOJA 3AHIA 1MOQA 3PE3A 4FYJA 3U4DA 3BD7A 1U5BA 2C0CA 3LUPA 5K8LA 1NNI1 1RW4A 4Z4CA 4TMZA 1DIHA 3QFCA 3E81A 3K1TA 1RM3A 3KYJB 1IEQA 4YC7A 2ISSD 1CRPA 1YD7A 5EIAA 4U39A 3TD9A 4HYQA 2WYWA 5REQA 1B4DA 3CJRA 3SXUB 1ATIA 2XNDD 2QZ9A 4TSKA 5LP6B 2BDUA 2GZHA 1TQ4A 4IP0A 1W93A 1ADFA 4RF3A 4UU8A 1GPKA 5L3SB 2O05A 1PR1A 1U2GA 2J6HA 3P0JA 1HT2E 1Y7HA 1GNSA 3I2IA 1OBOA 2HQRA 4F8EA 1M0WA 3AXTA 2JAQA 2CNLA 2DAPA 3FR7A 1J5EB 4C4YA 5DGDA 2IHJA 3D5EA 4B81A 1PJQA 1VMEA 2Y68A 4HKTA 3Q12A 1ZCBA 1YHZA 5IUKC 2MINB 3ONVA 3QX8A 2NTJA 4E09A 1U0GA 3OZIA 1Q14A 3EFOA 3ZU3A 2F3PA 3CX4A 1NFQA 4P34A 4M1KA 4Q34A 3KKNA 5NULA 1AC5A 1G0OA 2B4QA 1MHPA 1PQUA 1L5NA 4LZLA 4J6EA 1XMQB 4J1NA 4RA6B 4KN9S 1Q19A 2QAJA 2G04A 3CJQA 1LH0A 1MC1A 4G86A 4XTRA 1KQGA 1D7OA 3VZSA 4BGDA 3KQSA 5TQ2A 2KW5A 2GMWA 2RONA 1E6MA 2XOKA 4EP1A 3JX9A 4Y6SA 1JFFA 3VNBA 4C1BA 4WCFB 1ORHA 4HGNA 4YFYA 3ME5A 2VK4A 2EKPA 5CT5A 4C0WA 3ZDZB 3UAOA 4BO4A 3G49A 1N57A 1OVGA 4MQFA 4R16A 1JT2A 2ZOSA 1ZIYA 2VT6A 3TE6A 1H6CA 4Q4CA 1WY7A 1GADO 3SNHA 4DDWA 4IR7A 4H7KA 3ONWA 2PGLA 4ISCA 3MJFA 4L0DA 1D2AA 3DHNA 2CXOA 4QXAA 1KH2A 4Y2JA 3ZHVA 2B9EA 4BLUA 3HCDA 3NOOA 2Z3VA 4RGVA 1M2WA 4HAZA 5FUBA 3ZVMA 2GEKA 3D02A 2POQX 3SM3A 2QSYA 2CHGA 2ZIVB 1VYUA 2TS1A 4F9EA 3COJA 1K68A 1U2PA 3KHKA 3TAXA 1TW2A 3G5TA 4YJKA 2H00A 1T8WA 5TNXA 2YQ4A 1BDMA 1W34A 1KAGA 3N6XA 4DV0B 4HY3A 5HA5A 1QE0A 2EERA 2H48A 4K8RB 1CUCA 1ECFA 3LY8A 1GAJA 1LBQA 1N8NA 4ARIA 3C8HA 1RWQA 1EFDN 3S44A 1M8KA 5B7QA 4QD3A 5HOQA 4RD0A 3TZBA 2Y3IA 3QMPA 3KB2A 2WWXA 1V8OA 1F2DA 3T5AA 2AGVA 4BMDA 3P19A 1KK1A 4DF3A 1BH2A 1XMXA 5MN4A 1JQ5A 1V7ZA 3IOYA 1C1DA 1TJ3A 4DJFC 1QB8A 2DQSA 1EB9A 3QPVA 4XCQA 1DBVO 4UKDA 3W8RA 4ZMBA 4G5YA 4K5QA 1DUIA 1L8LA 1MGPA 1Z6XA 4FGLA 4DAEA 5K99A 3VAZA 3L8ZA 3SY8A 3TW8A 1TGYA 1WUYA 5LQJA 4DCJA 3Q8WA 2J31A 5CJPA 5ICEA 1KAOA 3ELWA 1BSVA 1MV8A 3ITEA 2D00A 1E5LA 2ACKA 3MJ4A 5CNKA 1CZHA 3UGJA 3MJTA 5AHKA 2G9RA 3K3PA 4GMHA 9LDTA 1IEVA 1WPGA 2Q45A 4BTLA 4LYDA 1GRCA 2ONCA 4LXQA 5JECA 1YL7A 1P17A 3Q87B 1E92A 4FX5A 5MHTA 2RHCA 1H2RS 3IDFA 1N2ZA 4KDCA 1UINA 4LOJA 3OM8A 5DGTA 4LZOA 1K6XA 2NTYC 3C4QA 3WMWA 2NZYA 2ZLBA 3SEZA 2WSIA 3BJIC 4KSCA 4C0LA 2HB6A 3FDZB 3KYDB 5FFMA 4ZCQA 1X92A 1MO6A 4XPIA 3ANYB 3T3PB 3VR2D 4B4VA 4CM4B 4Z5XA 3I12A 1PK9A 1RTKA 3PHGA 2ZZMA 5CH8A 3EG9A 1NJGA 4G41A 4LOKA 1VC2A 5GOTA 4HDMA 4K9KA 5ADVA 2GLUA 2FCRA 4L6AA 3PSHA 4QRDA 3TX6A 3PFHA 4MYCA 4QYIA 2W48A 2XBLA 3F9IA 3C5CA 5B4UA 3O2SB 2HM7A 2JZOA 4NJEA 1GSIA 4G89A 5HILA 2D1QA 1A1SA 5KQRA 3FCCA 3D6UA 5CVTA 4DQXA 4OSEA 2H0QA 1XMIA 2VT2A 4WN9A 4ZHSA 4LPSA 1U81A 2PKQP 4U6SA 1X0XA 4ZC8A 3WNVA 5FWYB 4R2LA 1IK4A 4FYIA 1UJ6A 2HBZA 3VZQA 3QJGA 5TLSA 2ADMA 2VCHA 5CT8A 4E1AA 1KEEB 2J3LA 3CGGA 3DM5A 3L4EA 1H2FA 1V6CA 3K0EA 1SQGA 4HPXB 2FG5A 2BMJA 2GN9A 1OTHA 2ZAOA 3BXZA 1KYVA 1I33A 2NV0A 3EEFA 4JC8A 4U5XA 1UBUS 1MEEA 2WIKA 3CB4A 1R66A 2IYEA 2HWWA 3CMCO 1PKXA 4LE1A 4UREA 1RYMA 1ZH0A 4AZ3B 1R5BA 3FAZA 3LL4A 4OYHA 3PHLA 5AI8A 3TRDA 4B7XA 3BOSA 5BWOA 1E79D 1YFZA 5HTOA 2XCQA 1FTQA 3C5HA 1JHRA 1FNCA 4M54A 1KZHA 1N6KA 4FR5A 1X19A 1ULUA 3EVAA 5HJ5A 2P2DA 2CCKA 3QX3A 3B6EA 1C7EA 4O59O 3MJEA 3IURA 3BAFA 2OGZA 1ZISA 3CR7A 1PZXA 1NN1A 3B1WA 1YS1X 3OZWA 1XAHA 1ZA2A 4ARZB 3D7RA 2NVUB 4IDEA 2EGGA 4FS3A 2AKYA 3QNWA 4AMGA 2IOYA 2W8BA 1XB2A 3OT4A 3VFDA 2XGGA 3G8DA 1DTWA 2EZ4A 4G1BA 2ZT8A 4ZCIA 4MSUA 5K0CA 2HHLA 3JWHA 4MLCA 4RKQA 4CL0A 3KQKA 2GF0A 2A1UA 1BKDR 4MUKA 1EQUA 1K7XB 1GTVA 1PV4A 4WASA 4PW0A 3TOXA 3I05A 1CYEA 3ZZNA 2EJBA 3U44B 3S7ZA 2LKCA 2I76A 5T4EA 4WNAA 3V1UA 3WTCA 3ZI4A 1E1RD 3CH4B 4NU8X 2D74A 2V59A 1KYTA 1KP3A 4QWWA 5TMDA 2B36A 3NOVA 3AWIA 4BFVA 2JJ1A 1MXFA 3HSYA 4L2IB 5A9SB 2ATIA 5J2TF 3WIOA 2H2IA 2O4UX 4NLLA 1ST2A 1VDMA 1WUKS 2OM6A 4KIUA 5J59A 4XWWA 5DN9A 2XRZA 1GGNA 4Y1RA 1CIJA 1TEHA 3R5JA 1E4VA 5CB6A 3RVJA 3GDOA 3DPIA 4JDPA 1JYEA 3Q7IA 3BWEA 1YUNA 4HH0A 4RDCA 5E1BA 5BQ5A 4DMGA 4BVLA 2H59A 3T1TA 2R48A 3A06A 4JROA 2WNIA 1MAAA 1SBNE 1SZDA 3V8PA 3MWDB 4CV1A 4RTMA 1A5BB 1P6XA 1IUPA 2O3QA 3AIKA 4ZPJA 2C03A 4ALNA 1TKRA 1YMUA 2CFSA 2GO1A 4NS1A 4G07A 2VO1A 3IOEA 3P2IA 2QZSA 2IXEA 2ZWIA 3K96A 2J0UA 4OFXA 1H4SA 3H3FA 2C97A 4ZT3A 2ATEA 3R24A 4BO2A 4KYVA 3JARA 4O4HA 4PHCA 1O95D 3RC8A 1KE1A 3TQTA 1FDIA 1KI9A 4F85A 5IM4F 4ZVNA 2WF9A 5K0GA 5DCWA 5TS3A 4EG0A 3DEFA 3RDPA 5C52B 3QA9A 5FFNA 3ACCA 4P81A 1POXA 1VL1A 3BXGA 5FNVF 2PUFA 2ZBQA 2DLCX 4TMVA 3CV3A 1SUCA 4KO1S 2WJWA 4D3ZA 1BCSA 1QFZA 1YJAA 2E4YA 3G0DA 3HB7A 4DTCA 4B43A 1KY2A 3N6VA 1MLDA 3TZHA 3KQUA 5ENDA 1NP3A 4XJXA 4W7SA 2WMDA 4WK6A 1OLXB 2VTBB 2FPSA 3NPMA 3HBMA 1WB9A 3K4PA 2DR0A 2WWFA 4AMUA 4KACA 2VYND 4TUYA 3CRRA 3A6KA 7MHTA 2O5CA 3CEHA 1J2JA 3LOUA 1U02A 3WO1A 3RYCA 3QLEA 4KVFA 4Z4QA 3LYUA 1BHO1 1N8KA 2XYVA 3FHLA 3DD1A 1ENZA 3PX3A 4ZO7A 3HCRA 4JZKA 5SYMA 1OA0A 3U49A 5FTLA 2PD4A 3U62A 5EE1A 3TI7A 3ET5A 4LNUB 4BMSA 4MV5A 1XZDA 1RLMA 2GHRA 3A3KA 4GMDA 3H1GA 5GZ6A 5TB5A 2VR1A 4HTAA 4ZI7F 5BN3A 2Q6IA 3AK4A 2JJYA 3I9LA 2VDMB 4UDYX 3BEDA 3B60A 4N6NA 4IZHA 1QG6A 2JKYA 3NVMB 2RH8A 1M6VB 3DNFA 5F98A 2PJDA 2ZZNA 2J07A 2W2QA 1S96A 3AW8A 2GCOB 3I6ZA 1Z47A 1AB6A 4MK4A 4TZ0A 2PHZA 4OFWA 3W2TA 5HIMA 2GZ3A 4QDUA 4WZAB 1S3FA 1E0AA 4LF7B 1LZLA 5FHQA 3UB4A 3B5JA 4Z0PA 4BO5A 4LF4B 3UK6A 3CWQA 4Z6KA 4MS3B 1CDOA 2RHLA 5HKAA 4AY6A 3BGOS 3AR7A 1Q7CA 2MDTA 1NV8A 1NF2A 2J3JA 1GPAA 2BV3A 2V6BA 4L8LA 1R4MA 4LVUA 5DHUA 5JO9A 3S70A 1A2BA 2G1KA 2OP0A 4DMMA 4HDOB 1J23A 3GLIA 2D8AA 4FKMA 1F1JA 1BXGB 3U3JA 4HGYA 3WNBA 1V0JA 3DE5X 3N87A 1GUZA 1ISSA 2J3QA 5CT6A 5GJBA 4UXIA 5DKFA 1FQKA 4EUSA 1YVUA 3MLAA 3IP1A 1RI4A 3H87A 4W82A 3MCVA 1NBAA 3EXFA 2WIFA 3ZCVA 5JVDA 4FHGA 1ZN9A 1F3OA 2QSZA 2XE7A 4BQNA 3NMUF 2XKAA 3ILVA 4G5FA 1BA3A 1CJCA 2AZMA 4D9JA 3IEXA 4KQWA 3MZ0A 3OFND 4IHAA 2ZJ1A 3FHOA 3OOJA 1W2HA 2NZUG 3WAKA 4ZYVA 3ZVNA 2DP4E 4A2QA 4ENSA 3B5IA 4OQYA 1OHHD 1DAPA 2IDKA 1QWOA 1JHMA 3WJAA 1YSCA 2HCFA 2O7VA 4HG2A 2PJZA 3ZX4A 1ORWA 4RV5A 4I4CA 4O1MA 3ABZA 4KUHA 1KSFX 4D4MA 2A78A 4O4IF 3N39C 1ZU4A 3RS4A 4EPYA 3EARA 4Q19A 1V2HE 1NVFA 1NW3A 2VJCA 5D3MA 2E4UA 5JARA 3T3DA 1IWBB 3GJTA 1E63A 1Z0AA 3FUXA 2Z4TA 3JQQA 4TT3D 2C7BA 3DUFA 2FEXA 1KY3A 4F3CA 5ER9A 4XASA 3EGXA 3O1IC 1SPXA 5J5CA 5FD8A 3WQBA 1IC6A 2CF6A 5L95A 1EWVA 4JLOA 3WYNA 3DE3X 1CFJA 2DG2A 1WHTA 3FCOA 3M0EA 4IL5A 4BASA 5EZQA 1SHZA 5KOHB 4DUPA 3N74A 3COZA 4JFAA 7REQB 3P9PA 3EOAI 3AC0A 3QVKA 1QNLA 4HV4A 1NPYA 1CF9A 2FLVA 5F33A 3RH0A 3RW9A 4CFSA 3GCGA 1KVSA 2AQHA 1CKEA 4OHBA 2ZYDA 4OREX 3VDRA 3KR1A 4ZK6A 4LCJA 5DHAA 3NZEA 4M76B 2EQ5A 4CCYA 5EIEA 1JXQA 3DZBA 2C00A 4LWOA 1TYDE 5FI0B 3K2BA 1Y8RA 1IDOA 3M5WA 2C77A 4UQOA 2IX3A 1CUFA 4ETMA 1XF9A 2WBLC 2PSJA 5E1MA 1KH1A 2XZDA 1U1EA 4S1NA 5G3ZA 5BUZA 1E8MA 3TECE 5IT4A 4MWGA 4WOCA 4YTEA 4CTJA 3GJXC 3N75A 4RLFA 3KB8A 2DKOA 4HR7A 4AJIA 1S4QA 3SIXA 4F96A 3U6KA 3GLGA 4GLLA 1VMIA 1PQ4A 2X4LA 1WETA 2FZEA 2XUAA 3BMOB 2ZDHA 4WVLA 2YOFA 3REFA 1RR6A 1GGJA 1E60A 1X6VA 4Z0HO 3ICWA 2GFIA 3WQHA 4B48A 2TMDA 4NX2A 3OSUA 2Q0HA 3MGCA 1MMFB 3HO6A 1TUBA 1A8UA 1YB4A 2IPLA 4X7MA 4MUNA 1M2NA 3VHLB 2XMRA 4BO0A 2XCRB 1BE6A 3H65A 4BNNA 2NPIA 4QJ5A 3EY9A 4GI3A 5DT9A 3ZWQA 4F38A 1UZNA 2ZIGA 1L8XA 4B8YA 3I53A 4NZPA 4WVFA 4X3PA 2A7XA 2BP7B 5BPFA 5KQSA 1TEVA 3R3WA 2H4WA 1AUVA 2DPYA 5AM1A 5L4NA 1W4RA 1OPXA 2YL2A 4G4SP 3TFOA 5KC8A 2GYWA 1FUYB 1NONA 3PQ8A 4MS1B 2ZJ2A 2V45A 4WCDA 5ITZB 1L5MA 3RSOA 1SGWA 5T67A 1CUSA 1I5RA 1BMFD 4HWSA 4MA5A 5CD9A 1HFEL 3V8RA 2WG1A 5I9TA 1YQ9A 1TM1E 5M34A 1CQIA 3DP7A 1JR3D 3V32A 5KNBH 2R2AA 2D1FA 2G25A 4DQLA 2I3GA 2GBIA 5DN6D 1LJLA 3L93A 5HMMA 1EH5A 1R8JA 1U90A 2AN9A 4ZOCA 5LM3A 5IWCA 1ZXLA 1OCEA 3W5DA 1EMDA 2CVQA 1EM6A 5HIJA 4JOQA 5EJFA 1TI7A 3VC2A 3MMNA 3MSCA 4PINA 4IIYA 3ND9A 4O4LF 4ZYLA 1YA6A 2BKUA 3WLAA 3KLMX 4XR9A 1P74A 2OLEA 1LY1A 1SVMA 3H99A 2GK4A 4BX2A 4PX3A 1E1NA 2Q28A 1MG5A 1G21A 2SKDA 2WAAA 4MUBA 1NJ1A 5BQFA 3ZD7A 4RMNA 2W2KB 3SQOA 4AO8A 4WZZA 2QN1A 1CBUA 3FFTA 2MSCB 10MHA 1TO6A 1JPVA 3RF6A 3GNTA 3MTAA 6GPBA 3HJRA 1CFZA 1JEAA 2WJVA 2P62A 1FQWA 3H7IA 5JADA 4F4UA 5LP1A 1Z4KA 1GPDG 1ZCZA 4YBRA 5FPHA 4EMSA 1AGNA 1I4OA 4OQ4A 4YJ2B 3SHWA 2AC2A 4YJFB 4GBED 4MIKA 3BFVA 4YUXA 1IQPA 2R8YA 5IC6A 2PE5A 3QTLA 3D4PA 5AK4A 1S9HA 4Q4LA 3B6KA 3OZAA 4LDNA 3VHXA 1L5SA 4B6QA 4IQ0A 5C8VA 2FDCA 2DTEA 2XCIA 1MW9X 1THGA 4HAVA 4WL0A 3QTBA 4XJVA 3R6DA 1WOMA 1UEIA 4TL7A 1GRQA 1WABA 3E1KA 5EUMA 1UJ2A 5I5GA 2EIXA 2J67A 4JV5B 2XNCA 4MQ5A 3FPEA 3L2OB 2JGIA 4AUMA 4MR8B 3PK0A 4KXXA 1XTZA 3U0VA 5KYUB 1JX6A 1C4KA 3NS7A 4OJTA 3UMJA 4RXTA 1CIPA 3G2OA 5B4VA 1LVHA 1RBYA 3CT4A 3FLEA 4X8OA 1Q0QA 3E3NA 3NYWA 2O8CB 3WX0A 2JIOA 2BAGA 5DI9A 3ETHA 3MOSA 3FWPA 4BQSA 2Q5QA 1ZLYA 2VAMA 4PU0A 4TSFD 3QJYA 3D8HA 4JP8A 1LW6E 3X3HA 2PH7A 3KOOA 2WPDD 4J3FA 3BGDA 3A2MA 2GBFA 1T6ZA 3KKQA 4YACA 5ELMA 1ZHHA 5F5NA 2JASA 2XDAA 5CLLA 5ERYA 1PHRA 2GPTA 2AZXA 2WZCA 3N2GB 4IGIA 5ALTA 5ERGB 1SUBA 1QFSA 3HJTA 1I3CA 3TLJA 1PYGA 3A1SA 4RTJA 4UBMA 1MV5A 1K08A 1V45E 3RWOA 5KCZA 1XEWX 1FTWA 1UXGA 5T4HA 4EBBA 1E7MA 4NEHB 1IY1A 1DAFA 1RI5A 4ZEXA 3QUBA 2JK1A 4EZEA 4II7A 2QUHA 2HA2A 2NTNA 3CKMA 3KT6A 5CW2A 2OENG 4N4AA 4OHRA 3QELA 2PKXA 4ZDKA 2R1UA 2J48A 1NHWA 2PEYA 2W5UA 3H84A 4OBWA 5A2QA 1AY0A 1XU9A 1JEQA 2POCA 3OFSA 4YGXB 3KDSE 1RQGA 3ZGXA 1R6AA 2OCIA 1DEKA 2Q7DA 4BLSA 4UUBA 1KOFA 4KXQA 3D0QA 4H6XA 1TCVA 5KYGA 4EY7A 5THXA 1ZC4A 3I9OA 4KFUA 4IXMA 1N1MA 3ADKA 4TX1A 3ZWNA 1FYDA 1MABA 1I3NA 3B78A 5EOVA 1DWUA 4O2BF 4ZVTA 4B17A 4UM5A 5T6BA 1J56A 1HYEA 3CLRD 3Q41A 4FLMA 5IKMA 2E5WA 3CCFA 3DYVA 2WJ6A 5DDIP 2HBYA 4L28A 2R3SA 1GDTA 1C8KA 3GMDA 3QBVA 3PJDA 3GRYA 3GDFA 1M0EA 3T1YB 1KDPA 2CXUA 1C50A 2H7CA 3WRXC 1EWKA 3BF8A 5EYPB 4D9NA 4YASA 1W35A 1C29B 3G0GA 4X7PA 5HTKA 4MQEA 4EY5A 1QF6A 3TZ6A 4DR5B 3SIPA 4ESVA 2P2GA 4BX9A 4Z9XA 3M6WA 3M4XA 5JJIA 2OV4A 1UPCA 4HB4A 5FL7A 1Z2NX 2LDBA 1QO0D 3VOAA 4HZUB 5J2TA 2HLHA 4RD1A 1G7TA 3QF4A 4M89A 5E6RA 1KIMA 1Q21A 1KK0A 1KQOA 4DXHA 4DKJA 1J97A 1PVVA 1E66A 4LXIA 4KHZA 2JGDA 5DHTA 4GSKA 1L7VC 3SF8B 4K0KB 1HL3A 4MV8A 3CXRA 1PEYA 2Z4RA 3NUGA 4LZZA 1GNLA 2XB4A 3VC3A 2IH5A 1L3CA 1NXSA 3L8FA 3WP0A 1HDGO 5J4HA 1S8OA 4Q37A 3JQ8A 1TU0A 4PONA 1F6DA 4J0QA 2RBKA 4S0XA 5D5QA 1GPWB 2ZDGA 3BIFA 1GPJA 1TFRA 3FZQA 1LK7A 4DCCA 4I6JA 2KSQA 2O3UA 5EERA 1ZGJA 5FWXB 2VPZA 5ALQA 3K9HA 1Y9ZA 4KYTA 3V2HA 3WK6A 1YU9A 2YZ2A 4RW0A 1RYHA 5BSKA 3HI4A 4F12A 4GOLD 1C1XB 1ZU5A 2VPYA 4AB1A 1Z18A 2XA2A 3MBIA 3GUHA 1MPTA 2IVFA 3LQ2A 5JZSA 5IM4A 3KS9A 1XIVA 1ZBDA 4CKBB 5EHQA 4RA9B 3QMWA 3MUEA 1TJNA 4RPCA 5FNVA 1IXYA 3HCAA 1WKVA 1KXZA 1JIIA 4H0NA 2HA4A 2RGNC 3C6ZA 2G6TA 4XE5A 1HDOA 1KJ8A 2M2IA 2KMLA 2PUJA 2ZYUX 1ZR2A 4ZODA 1YTUA 1EK2A 1T13A 1OASA 2OHFA 4RLHA 3WGJA 2FX5A 4B5KA 1JA0A 4RIHA 4CLRB 5AUPB 3NGLA 3EZ6A 3D2BA 1J39A 1Y6ZA 4JBIA 3AVUA 3EVFA 2CZGA 2HQ1A 1QMGA 2ZBRA 3U3OA 3SFZA 1OGYA 1B16A 3VVBA 1A27A 2AYXA 2DLDA 3LUBA 2PT7A 2FZGA 3H4VA 2DPXA 3C8MA 4DIDA 3B89A 2V03A 2J59A 4JGBA 4TKLA 2IY7A 4OAQA 3U26A 4RJTA 3VO1A 4NZ9A 5ALRA 1DJQA 4UUNA 2CL6X 4YWJA 2YUIA 4HVCA 4Q6WA 3V1MA 2EKBA 4PBTA 1KMHB 4P4SB 3B13B 1XQ9A 1Z6TA 5BMOA 2QL6A 1UFVA 4R1PA 1SVKA 4ZI7A 1MPXA 1SMKA 3Q10A 2IZ0A 4JC5A 4PTYA 4G24A 3RVQA 4Z49A 3KX2A 3L05A 2QLMA 3PQ4A 5BNZA 1EHIA 4RWZA 2ZYGA 4UDOA 2G9QA 3K15A 3UA3A 5K8JB 1ISFA 1SOMA 4QLBA 5HE8A