5IC7A

Structure of the wd domain of utp18
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
365
structure length
340
Chain Sequence
RKLRPETIDIQRTRDIPDTHKAAISSLAFHPRYPILLSSSTSSIMYLHKLDASAYPTPNPLLTSVHVKRTDLRRAAFVGPDGGEIIFAGRRRYFHCWNLSSGLVKKVSKIQGHQKEQRTMERFRVSPCGRYMALVASDKKGGGMLNIINVGTMQWIAQARIDGRHGVADFAWWSDGNGLTIAGRDGQVTEWSMITRRTVGIWRDEGTVMALGGRNGPAELGGDRWVAIGSNSGILNVYDRNDLIEIRIKKYPTPTRVFEQLTTSISVVAFSPDGQLLAFGSQHKKDALRLVHLPSCTVYRNWPTEQTPLGRVTAIAFSSKSDVLAVGNDVGRVRLWEIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Structural protein
total genus 75
structure length 340
sequence length 365
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ic7A00
1XIPA 2IUVA 3JAMg 3I7KA 3UVNA 3PVWB 4GMBA 4X61B 5CXBB 3OW8A 5EALA 2GC7A 4JSNC 2J57G 4L3GD 1TYQC 2H9MA 1NEXB 2HESX 4ZOZA 3RN1D 4FB1D 3KRWB 4AOWA 1QNIA 3CFSB 5CXBA 3SN6B 4FA4D 3OL2A 5HE1B 5TEFA 3FRXA 2IWFA 3SVWD 4GQBB 5IJ7E 1JMZB 5FKRA 4J79A 2YMUA 5IC7A 3SFZA 4QRJA 2YNPA 3I8EA 2QXVA 4FWWA 4FAND 5TEEA 2P9UC 3RFGA 3ODTA 4K3JB 4X63B 4E5ZB 4GQ2P 5A2Qg 2P9NC 4O1QD 5SXMA 3SBPA 4GM3A 4HDJA 3IIWA 4J78A 2B4EA 1A0RB 5C2VB 4E5ZA 3V9FA 2YB8B 3OTTA 5HE2B 4J77A 5AJAA 3ULEC 5GMKn 3I7LA 4CY5A 4UI9R 4BUJC 3L4OD 1GXRA 1L0QA 3RLMD 4A11B 5KDOB 4PBZA 4JT6C 1RI6A 4A09B 2AH0A 2CN2A 3OKWA 4Y5RD 4EWRA 5IGQA 3PE7A 2HXCA 3MZLA 2PM9B 2BBKH 5H14A 3F3GA 3K27A 2CNXA 3FGBA 3SLED 4GZ8A 4ZOYA 4L1QD 2OVQB 5CYKB 2J55H 5H1MA 1U4CA 3RN0D 2AQ5A 2PM9A 3EI4A 4A2MA 2I0RA 4XEIC 1MG2A 5CYKA 5TDHB 3SBRA 4LG9A 3PSCB 1K32A 2XYIA 3GREA 1K8KC 2UZXB 2XL2A 3V7DB 4IA9A 5K1CC 4JXMA 4GGAA 2OVPB 1FWXA 3RFHA 3C5MA 4O9DA 3BG1A 4J0WA 1SQ9A 1N6EA 3SXTD 4L9OA 4PNKB 2P9LC 3PXTD 5IT9g 4A08B 4FAVD 1S4UX 4JSXC 5GXHA 2H47A 4J87A 3UVOA 2H14A 5C2WB 5HE3B 3NVXA 4O3TB 3DM0A 4U1EI 4FA5D 2Z2OA 3OL2B 3IJCA 3RMZD 4A08A 5HE0B 2BCJB 3F3PA 3I7OA 3SBQA 3SJLD 4ESGA 4J84A 4J81A 3ZWLB 4JSVC 3PVUB 4CI8A 2P9PC 3NVNA 1MDAH 4D6VA 1B9YA 2G9AA 3VH0A 2TRCB 4PSXB 3FM0A 5FKSA 2CN3A 1N6DA 3MZKA 4N14A 1B9XA 4MK0B 4ERQA 4ZOVA 1JMXB 1PI6A 2H9LA 4H5IA 5JWZA 4E54A 3IJ1A 5FQDA 2H68A 2HJ4A 1OMWB 3JB9L 3K26A 3EMHA 3MXXA 4GM9A 2QC5A 5CXCB 3AH8B 4J8BA 3F3FA 3MMYA 4J73A 3EI1B 5C9ZB 3MKQA 3MKSB 3JROA 2PBIB 3C75H 5EARA 2H13A 2CE9A 5CXCA 5FLXg 4O3UB 1NR0A 2PM6B 4J0XA 4LGNA 3JPXA 5HQGA 2EBSA 4J86A 5B4WA 4QQEA 3PXWD 3EI1A 3ORVD 2P9SC 5H17A 1N6FA 4GGDA 2Z2PA 1JOFA 3EI4B 4J82A 3I8CA 3UVLA 4PXWA 3I7HA 4TZ4A 4NSXA 3EI3B 2YNOA 3JZGA 4BL0A 1YFQA 2HJBA 1OLZA 4OZUA 3EI2B 3EI3A 3N0EA 2B5LA 3JZNA 1R5MA 4XYIA 3SWSD 5EM2B 2H6NA 4CZYA 3EI2A 4AEZA 3UVMA 5EMKB 5K19A 2B5MA 3P4FA 4X60B 1XHMA 5EM2A 3I2NA 4QL1A 5EMLB 2AGZA 3UR4A 2I0SA 3PSLA 3VGZA 4OWRA 5EMJB 5HYNB 4KFMB 4L3HD 4O45A 4IMMA 2CO0C 3JZHA 3I7PA 1P22A 2XL3A 3AL8B 4LG8A 4I79A 5FXYA 4QT8A 3RSEC 3C9CA 4K3ID 4CC9A 2H3XA 2IURA 3N0DA 2IUPA 3UKRC 3V5WB 4ERZA 3AL8A 1MG3A 1Q47A 4YVDA 4CI3A 1TBGA 2G99A 4E54B 5FKTA 2CO0A 2H6QA 1VYHC 4A0BA 1XKSA 2H6KA 3AFCA 4CY1A 1U2VC 3J81g 2CE8A 2OK4A 4G56B 1JJUB 4U7AA 4CZVA 3EWEA 2YNNA 3SHFA 4PSWB 4Y7RA 1ERJA 3NVQA 2H9NA 4GGCA 3IJ0A 2AGLA 4GM8A 4CY3A 4R7AB 3IIYA 5EAPA 1PBYB 3C99A 4Z8LA 2OK6A 5THAA 3E0CA 3L4MD 2PM7B 2Q7QA 2HKRA 3PXSD 3BG0A 4FHLA 3SCYA 3VA6A 3EU7A 2B5NA 2OVRB 3W15A 2I3SA 3I7NA 3UVKA 3U4YA 2P9IC 2HKMA 4JD2C 3KRXB 3JRPA 3UKUC 2GNQA 3HFQA 4PC0A 5I5IA 5FA5B 1PEVA 2AGWA 4H5JA 4JT5C 2IWKA 3IKOA 5FKQA 5GSAA 4BH6A 1GOTB 3OKYB 5GXIA 3DXKC 4CY2A 2I0TA 2XU7A 3J80g 2J56H 3CIKB 2AGYA 2O9KA 4X3EA 2YBAA 3OKYA 2IUQA 3OKTA 4A11A 4PBYA 2OIZA 2OJYA 2GC4A 5I5JA 4CZXA 1PGUA 2AH1A 4A09A 1SHYB 5IJ8E 4GQ1A 4J8GA 4A2LA 4ES0A 5EMMB 4XYHA 2UZYB 3DWLC 2MTAH 3I89A 4ERYA 3CFVA 3SMRA 4A0AB 3GFCA 3RRMC 5AMSA 2P9KC 5AFU3 2IAAA 1GP2B 4ZOXA 2HYEA 3EG6A 5TF2A 4ZN4A 2W18A 3B7FA 4FA9D 2H9PA 3BWSA 4A0AA 1SQJA 4FA1D 5IGOA 2AGXA 4JSPC 2Z2NA 3DXMC 4A7JA 2I3TA 1GG2B 5EAMA 4A0BB 3DSMA 5I5MA 4CI1A 3AL9A 4D0KA 4CI2A 3A0FA
chains in the Genus database with same CATH superfamily
1XIPA 2IUVA 4G55A 1TYEA 3I7KA 3JAMg 3UVNA 3PVWB 4GMBA 4X61B 5CXBB 3OW8A 5EALA 2GC7A 3IUJA 2J57G 4JSNC 3VI4A 4L3GD 1TYQC 1YR2A 4WK0A 3OF7A 2H9MA 1NEXB 2HESX 4ZOZA 3RN1D 4FB1D 3KRWB 4AOWA 1QNIA 3CFSB 5CXBA 3SN6B 4FA4D 3OL2A 5HE1B 5TEFA 3FRXA 2IWFA 3SVWD 3NIDA 4GQBB 5IJ7E 1JMZB 3FCUA 5FKRA 4J79A 3T3MA 2YMUA 1E8NA 5IC7A 3ZE2A 3SFZA 4QRJA 2YNPA 3I8EA 2QXVA 4FWWA 4FAND 1VZ2A 3NIFA 2P9UC 5TEEA 3RFGA 5M5TA 3ODTA 4K3JB 4WK4A 4X63B 4E5ZB 4GQ2P 2XE4A 5A2Qg 2P9NC 4O1QD 5SXMA 3SBPA 4GM3A 4HDJA 1UOPA 1C9IA 3IJEA 3IIWA 4J78A 2B4EA 1A0RB 5C2VB 4E5ZA 3V9FA 4UM8A 2YB8B 3OTTA 4MMXA 5HE2B 4J77A 5AJAA 3ULEC 5GMKn 3I7LA 4CY5A 4RE5A 4UI9R 3L4OD 4BUJC 5C86A 4JHPC 1GXRA 1L0QA 3RLMD 4A11B 3ZDZA 5KDOB 4PBZA 4JT6C 1RI6A 4A09B 2AH0A 2CN2A 3OKWA 4Y5RD 4EWRA 5IGQA 3PE7A 2HXCA 4AX4A 3MZLA 4Z7QA 2PM9B 2BBKH 5H14A 3F3GA 3K27A 4RE6A 2CNXA 1UTCA 3FGBA 4GZ8A 3SLED 4ZOYA 4L1QD 2OVQB 3ZE0A 5CYKB 4AMZA 2J55H 5H1MA 1U4CA 3RN0D 2AQ5A 2PM9A 3EI4A 3IULA 4A2MA 2I0RA 4Z7NA 4XEIC 4Z7OA 1MG2A 3K6SA 3O4IA 4D9SA 5CYKA 5HDBA 2VDNA 5TDHB 3SBRA 4BP8A 4LG9A 3PSCB 1K32A 2XYIA 2HU7A 3GREA 1K8KC 2UZXB 2XL2A 3V7DB 4IA9A 5K1CC 4JXMA 3KCIA 3QHYB 4GGAA 3O4GA 4IRZA 1QFMA 2OVPB 2WQ8A 1FWXA 3RFHA 3C5MA 4O9DA 3BG1A 4J0WA 1SQ9A 1N6EA 3SXTD 4L9OA 3ZDYA 1JTDB 1H2WA 1L5GA 4PNKB 2P9LC 3PXTD 4DNUA 1U8CA 3FCSA 5IT9g 4A08B 1GOHA 1S4UX 4FAVD 4JSXC 5GXHA 2VZ1A 2H47A 4J87A 5M5UA 3UVOA 2H14A 5C2WB 5HE3B 3NVXA 4O3TB 2VDQA 3DM0A 4U1EI 4FA5D 2Z2OA 3OL2B 3IJCA 2VDLA 3RMZD 4A08A 5HE0B 2BCJB 3F3PA 3I7OA 3SBQA 3SJLD 4ESGA 4J84A 4J81A 3ZWLB 4JSVC 4O02A 3PVUB 2EIBA 4CI8A 2P9PC 3NVNA 1MDAH 4D6VA 1B9YA 1VZ3A 2G9AA 3VH0A 2TRCB 4PSXB 3FM0A 5FKSA 2CN3A 1N6DA 3MZKA 4N14A 1B9XA 3NIGA 3GD1I 4MK0B 4BP9A 4DNVA 3QI0A 4ERQA 4ZOVA 1H2XA 1JMXB 1PI6A 3O4JA 2H9LA 4H5IA 5JWZA 1O6GA 1VE6A 4E54A 1QFSA 2XDWA 3IJ1A 5FQDA 2H68A 2HJ4A 1OMWB 3JB9L 4G1MA 5E6RA 4JHNA 3K26A 1E5TA 2QR5A 3K72A 3EMHA 3MXXA 4GM9A 2QC5A 5CXCB 4NAAA 3AH8B 5FFOA 4J8BA 3F3FA 3MMYA 3IUQA 4J73A 3EI1B 5C9ZB 1T2XA 2VDKA 3MKQA 3MKSB 3JROA 5FFGA 2PBIB 3C75H 5EARA 2H13A 2CE9A 2VZ3A 5CXCA 3EQ9A 3ZE1A 4O3UB 1NR0A 2PM6B 4J0XA 4LGNA 5FLXg 3JPXA 5HQGA 2EBSA 4J86A 5B4WA 4QQEA 3PXWD 3EI1A 3ORVD 1O6FA 2P9SC 5H17A 1N6FA 4GGDA 2Z2PA 1JOFA 3EI4B 4J82A 3I8CA 2HU5A 3UVLA 4PXWA 3I7HA 4TZ4A 4NENA 4NSXA 3EI3B 2VDMA 2BKLA 2YNOA 3JZGA 4BL0A 1YFQA 3IUNA 3V4PA 2HJBA 1OLZA 4OZUA 3EI2B 3EI3A 1H2ZA 3N0EA 2B5LA 3JZNA 1R5MA 4XYIA 3SWSD 2VDOA 5EM2B 3IVMA 3MUOA 2H6NA 4G1EA 4CZYA 4DNWA 3T3PA 4AEZA 3EI2A 3UVMA 5EMKB 5K19A 2B5MA 3ZDXA 3P4FA 4X60B 3O4HA 1XHMA 5EM2A 3I2NA 4QL1A 5EMLB 2AGZA 3UR4A 2I0SA 3PSLA 3VGZA 4OWRA 4BCBA 5EMJB 5HYNB 4KFMB 4L3HD 4O45A 4IMMA 2CO0C 3JZHA 3I7PA 1M1XA 1P22A 2XL3A 1A12A 3AL8B 3MVDK 4LG8A 4I79A 5FXYA 4QT8A 3GC3B 3RSEC 3C9CA 4K3ID 3VI3A 4CC9A 2H3XA 3IUMA 2IURA 3N0DA 2IUPA 3UKRC 4QAMA 3V5WB 4BCDA 4ERZA 3AL8A 1H2YA 4O2WA 1MG3A 1Q47A 4YVDA 4CI3A 2HU8A 1TBGA 2G99A 1BPOA 4E54B 5FKTA 2CO0A 3EQ7A 2EIEA 2H6QA 1VYHC 4A0BA 1XKSA 2H6KA 3MUNA 3AFCA 4CY1A 1U2VC 3J81g 2VDRA 4NBMA 2CE8A 2OK4A 4G56B 1JJUB 4U7AA 4CZVA 3EWEA 2YNNA 3SHFA 1C9LA 1UOOA 4PSWB 4Y7RA 1E8MA 1ERJA 3NVQA 2H9NA 4MMZA 4GGCA 3IJ0A 2AGLA 2VDPA 4GM8A 4CY3A 4R7AB 3IIYA 5EAPA 1PBYB 3C99A 4Z8LA 2OK6A 5THAA 3E0CA 3L4MD 2PM7B 2Q7QA 2HKRA 3PXSD 3BG0A 4FHLA 3SCYA 3VA6A 3EU7A 2B5NA 1K3IA 1UOQA 5M5RA 2OVRB 3W15A 2I3SA 2EIDA 3I7NA 3UVKA 3U4YA 2P9IC 2HKMA 4JD2C 3KRXB 4UM9A 4MMYA 3JRPA 1GOFA 3UKUC 2GNQA 3HFQA 4WK2A 4PC0A 5I5IA 5FA5B 1PEVA 2AGWA 4H5JA 4JT5C 2IWKA 3IKOA 5FKQA 5GSAA 4BH6A 1GOTB 3OKYB 2JKXA 5GXIA 5M5VA 3DXKC 4NC4A 4CY2A 2I0TA 2XU7A 3J80g 2J56H 3CIKB 2AGYA 2O9KA 4X3EA 5E6SA 2YBAA 1I2MB 3OKYA 2IUQA 3OKTA 4A11A 4L1MA 4PBYA 2OIZA 2OJYA 2GC4A 5I5JA 4CZXA 1PGUA 2AH1A 3IURA 4AMYA 4A09A 1SHYB 3K71A 5IJ8E 4GQ1A 4J8GA 4A2LA 4ES0A 5EMMB 2VC2A 4XYHA 4BCCA 2UZYB 3DWLC 4AN0A 2MTAH 3I89A 4ERYA 3CFVA 3SMRA 4A0AB 3GFCA 2QZPA 3RRMC 3EQ8A 5AMSA 2P9KC 5AFU3 2IAAA 1GP2B 1GOGA 4ZOXA 2HYEA 3EG6A 5TF2A 4ZN4A 2W18A 3B7FA 4FA9D 3V4VA 2H9PA 3BWSA 4A0AA 1SQJA 4AN1A 1VE7A 4FA1D 5IGOA 5M5SA 2XZGA 2AGXA 4JSPC 2Z2NA 5C92A 3DXMC 4A7JA 2I3TA 5M61A 3DDUA 5E6UA 1GG2B 5EAMA 4A0BB 3DSMA 5I5MA 4CI1A 1JV2A 3AL9A 4D0KA 2EICA 4CI2A 4WJKA 3A0FA
chains in the Genus database with same CATH topology
1XIPA 2IUVA 3JAMg 3I7KA 3UVNA 3PVWB 4GMBA 4X61B 5CXBB 3OW8A 5EALA 2GC7A 4JSNC 2J57G 4L3GD 1TYQC 2H9MA 1NEXB 2HESX 4ZOZA 3RN1D 4FB1D 3KRWB 4AOWA 1QNIA 3CFSB 5CXBA 3SN6B 4FA4D 3OL2A 5HE1B 5TEFA 3FRXA 2IWFA 3SVWD 4GQBB 5IJ7E 1JMZB 5FKRA 4J79A 2YMUA 5IC7A 3SFZA 4QRJA 2YNPA 3I8EA 2QXVA 4FWWA 4FAND 5TEEA 2P9UC 3RFGA 3ODTA 4K3JB 4X63B 4E5ZB 4GQ2P 5A2Qg 2P9NC 4O1QD 5SXMA 3SBPA 4GM3A 4HDJA 3IIWA 4J78A 2B4EA 1A0RB 5C2VB 4E5ZA 3V9FA 2YB8B 3OTTA 5HE2B 4J77A 5AJAA 3ULEC 5GMKn 3I7LA 4CY5A 4UI9R 4BUJC 3L4OD 1GXRA 1L0QA 3RLMD 4A11B 5KDOB 4PBZA 4JT6C 1RI6A 4A09B 2AH0A 2CN2A 3OKWA 4Y5RD 4EWRA 5IGQA 3PE7A 2HXCA 3MZLA 2PM9B 2BBKH 5H14A 3F3GA 3K27A 2CNXA 3FGBA 3SLED 4GZ8A 4ZOYA 4L1QD 2OVQB 5CYKB 2J55H 5H1MA 1U4CA 3RN0D 2AQ5A 2PM9A 3EI4A 4A2MA 2I0RA 4XEIC 1MG2A 5CYKA 5TDHB 3SBRA 4LG9A 3PSCB 1K32A 2XYIA 3GREA 1K8KC 2UZXB 2XL2A 3V7DB 4IA9A 5K1CC 4JXMA 4GGAA 2OVPB 1FWXA 3RFHA 3C5MA 4O9DA 3BG1A 4J0WA 1SQ9A 1N6EA 3SXTD 4L9OA 4PNKB 2P9LC 3PXTD 5IT9g 4A08B 4FAVD 1S4UX 4JSXC 5GXHA 2H47A 4J87A 3UVOA 2H14A 5C2WB 5HE3B 3NVXA 4O3TB 3DM0A 4U1EI 4FA5D 2Z2OA 3OL2B 3IJCA 3RMZD 4A08A 5HE0B 2BCJB 3F3PA 3I7OA 3SBQA 3SJLD 4ESGA 4J84A 4J81A 3ZWLB 4JSVC 3PVUB 4CI8A 2P9PC 3NVNA 1MDAH 4D6VA 1B9YA 2G9AA 3VH0A 2TRCB 4PSXB 3FM0A 5FKSA 2CN3A 1N6DA 3MZKA 4N14A 1B9XA 4MK0B 4ERQA 4ZOVA 1JMXB 1PI6A 2H9LA 4H5IA 5JWZA 4E54A 3IJ1A 5FQDA 2H68A 2HJ4A 1OMWB 3JB9L 3K26A 3EMHA 3MXXA 4GM9A 2QC5A 5CXCB 3AH8B 4J8BA 3F3FA 3MMYA 4J73A 3EI1B 5C9ZB 3MKQA 3MKSB 3JROA 2PBIB 3C75H 5EARA 2H13A 2CE9A 5CXCA 5FLXg 4O3UB 1NR0A 2PM6B 4J0XA 4LGNA 3JPXA 5HQGA 2EBSA 4J86A 5B4WA 4QQEA 3PXWD 3EI1A 3ORVD 2P9SC 5H17A 1N6FA 4GGDA 2Z2PA 1JOFA 3EI4B 4J82A 3I8CA 3UVLA 4PXWA 3I7HA 4TZ4A 4NSXA 3EI3B 2YNOA 3JZGA 4BL0A 1YFQA 2HJBA 1OLZA 4OZUA 3EI2B 3EI3A 3N0EA 2B5LA 3JZNA 1R5MA 4XYIA 3SWSD 5EM2B 2H6NA 4CZYA 3EI2A 4AEZA 3UVMA 5EMKB 5K19A 2B5MA 3P4FA 4X60B 1XHMA 5EM2A 3I2NA 4QL1A 5EMLB 2AGZA 3UR4A 2I0SA 3PSLA 3VGZA 4OWRA 5EMJB 5HYNB 4KFMB 4L3HD 4O45A 4IMMA 2CO0C 3JZHA 3I7PA 1P22A 2XL3A 3AL8B 4LG8A 4I79A 5FXYA 4QT8A 3RSEC 3C9CA 4K3ID 4CC9A 2H3XA 2IURA 3N0DA 2IUPA 3UKRC 3V5WB 4ERZA 3AL8A 1MG3A 1Q47A 4YVDA 4CI3A 1TBGA 2G99A 4E54B 5FKTA 2CO0A 2H6QA 1VYHC 4A0BA 1XKSA 2H6KA 3AFCA 4CY1A 1U2VC 3J81g 2CE8A 2OK4A 4G56B 1JJUB 4U7AA 4CZVA 3EWEA 2YNNA 3SHFA 4PSWB 4Y7RA 1ERJA 3NVQA 2H9NA 4GGCA 3IJ0A 2AGLA 4GM8A 4CY3A 4R7AB 3IIYA 5EAPA 1PBYB 3C99A 4Z8LA 2OK6A 5THAA 3E0CA 3L4MD 2PM7B 2Q7QA 2HKRA 3PXSD 3BG0A 4FHLA 3SCYA 3VA6A 3EU7A 2B5NA 2OVRB 3W15A 2I3SA 3I7NA 3UVKA 3U4YA 2P9IC 2HKMA 4JD2C 3KRXB 3JRPA 3UKUC 2GNQA 3HFQA 4PC0A 5I5IA 5FA5B 1PEVA 2AGWA 4H5JA 4JT5C 2IWKA 3IKOA 5FKQA 5GSAA 4BH6A 1GOTB 3OKYB 5GXIA 3DXKC 4CY2A 2I0TA 2XU7A 3J80g 2J56H 3CIKB 2AGYA 2O9KA 4X3EA 2YBAA 3OKYA 2IUQA 3OKTA 4A11A 4PBYA 2OIZA 2OJYA 2GC4A 5I5JA 4CZXA 1PGUA 2AH1A 4A09A 1SHYB 5IJ8E 4GQ1A 4J8GA 4A2LA 4ES0A 5EMMB 4XYHA 2UZYB 3DWLC 2MTAH 3I89A 4ERYA 3CFVA 3SMRA 4A0AB 3GFCA 3RRMC 5AMSA 2P9KC 5AFU3 2IAAA 1GP2B 4ZOXA 2HYEA 3EG6A 5TF2A 4ZN4A 2W18A 3B7FA 4FA9D 2H9PA 3BWSA 4A0AA 1SQJA 4FA1D 5IGOA 2AGXA 4JSPC 2Z2NA 3DXMC 4A7JA 2I3TA 1GG2B 5EAMA 4A0BB 3DSMA 5I5MA 4CI1A 3AL9A 4D0KA 4CI2A 3A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XIP A;  2IUV A;  3JAM g;  3I7K A;  3UVN A;  3PVW B;  4GMB A;  4X61 B;  5CXB B;  3OW8 A;  5EAL A;  2GC7 A;  4JSN C;  2J57 G;  4L3G D;  1TYQ C;  2H9M A;  1NEX B;  2HES X;  4ZOZ A;  3RN1 D;  4FB1 D;  3KRW B;  4AOW A;  1QNI A;  3CFS B;  5CXB A;  3SN6 B;  4FA4 D;  3OL2 A;  5HE1 B;  5TEF A;  3FRX A;  2IWF A;  3SVW D;  4GQB B;  5IJ7 E;  1JMZ B;  5FKR A;  4J79 A;  2YMU A;  5IC7 A;  3SFZ A;  4QRJ A;  2YNP A;  3I8E A;  2QXV A;  4FWW A;  4FAN D;  5TEE A;  2P9U C;  3RFG A;  3ODT A;  4K3J B;  4X63 B;  4E5Z B;  4GQ2 P;  5A2Q g;  2P9N C;  4O1Q D;  5SXM A;  3SBP A;  4GM3 A;  4HDJ A;  3IIW A;  4J78 A;  2B4E A;  1A0R B;  5C2V B;  4E5Z A;  3V9F A;  2YB8 B;  3OTT A;  5HE2 B;  4J77 A;  5AJA A;  3ULE C;  5GMK n;  3I7L A;  4CY5 A;  4UI9 R;  4BUJ C;  3L4O D;  1GXR A;  1L0Q A;  3RLM D;  4A11 B;  5KDO B;  4PBZ A;  4JT6 C;  1RI6 A;  4A09 B;  2AH0 A;  2CN2 A;  3OKW A;  4Y5R D;  4EWR A;  5IGQ A;  3PE7 A;  2HXC A;  3MZL A;  2PM9 B;  2BBK H;  5H14 A;  3F3G A;  3K27 A;  2CNX A;  3FGB A;  3SLE D;  4GZ8 A;  4ZOY A;  4L1Q D;  2OVQ B;  5CYK B;  2J55 H;  5H1M A;  1U4C A;  3RN0 D;  2AQ5 A;  2PM9 A;  3EI4 A;  4A2M A;  2I0R A;  4XEI C;  1MG2 A;  5CYK A;  5TDH B;  3SBR A;  4LG9 A;  3PSC B;  1K32 A;  2XYI A;  3GRE A;  1K8K C;  2UZX B;  2XL2 A;  3V7D B;  4IA9 A;  5K1C C;  4JXM A;  4GGA A;  2OVP B;  1FWX A;  3RFH A;  3C5M A;  4O9D A;  3BG1 A;  4J0W A;  1SQ9 A;  1N6E A;  3SXT D;  4L9O A;  4PNK B;  2P9L C;  3PXT D;  5IT9 g;  4A08 B;  4FAV D;  1S4U X;  4JSX C;  5GXH A;  2H47 A;  4J87 A;  3UVO A;  2H14 A;  5C2W B;  5HE3 B;  3NVX A;  4O3T B;  3DM0 A;  4U1E I;  4FA5 D;  2Z2O A;  3OL2 B;  3IJC A;  3RMZ D;  4A08 A;  5HE0 B;  2BCJ B;  3F3P A;  3I7O A;  3SBQ A;  3SJL D;  4ESG A;  4J84 A;  4J81 A;  3ZWL B;  4JSV C;  3PVU B;  4CI8 A;  2P9P C;  3NVN A;  1MDA H;  4D6V A;  1B9Y A;  2G9A A;  3VH0 A;  2TRC B;  4PSX B;  3FM0 A;  5FKS A;  2CN3 A;  1N6D A;  3MZK A;  4N14 A;  1B9X A;  4MK0 B;  4ERQ A;  4ZOV A;  1JMX B;  1PI6 A;  2H9L A;  4H5I A;  5JWZ A;  4E54 A;  3IJ1 A;  5FQD A;  2H68 A;  2HJ4 A;  1OMW B;  3JB9 L;  3K26 A;  3EMH A;  3MXX A;  4GM9 A;  2QC5 A;  5CXC B;  3AH8 B;  4J8B A;  3F3F A;  3MMY A;  4J73 A;  3EI1 B;  5C9Z B;  3MKQ A;  3MKS B;  3JRO A;  2PBI B;  3C75 H;  5EAR A;  2H13 A;  2CE9 A;  5CXC A;  5FLX g;  4O3U B;  1NR0 A;  2PM6 B;  4J0X A;  4LGN A;  3JPX A;  5HQG A;  2EBS A;  4J86 A;  5B4W A;  4QQE A;  3PXW D;  3EI1 A;  3ORV D;  2P9S C;  5H17 A;  1N6F A;  4GGD A;  2Z2P A;  1JOF A;  3EI4 B;  4J82 A;  3I8C A;  3UVL A;  4PXW A;  3I7H A;  4TZ4 A;  4NSX A;  3EI3 B;  2YNO A;  3JZG A;  4BL0 A;  1YFQ A;  2HJB A;  1OLZ A;  4OZU A;  3EI2 B;  3EI3 A;  3N0E A;  2B5L A;  3JZN A;  1R5M A;  4XYI A;  3SWS D;  5EM2 B;  2H6N A;  4CZY A;  3EI2 A;  4AEZ A;  3UVM A;  5EMK B;  5K19 A;  2B5M A;  3P4F A;  4X60 B;  1XHM A;  5EM2 A;  3I2N A;  4QL1 A;  5EML B;  2AGZ A;  3UR4 A;  2I0S A;  3PSL A;  3VGZ A;  4OWR A;  5EMJ B;  5HYN B;  4KFM B;  4L3H D;  4O45 A;  4IMM A;  2CO0 C;  3JZH A;  3I7P A;  1P22 A;  2XL3 A;  3AL8 B;  4LG8 A;  4I79 A;  5FXY A;  4QT8 A;  3RSE C;  3C9C A;  4K3I D;  4CC9 A;  2H3X A;  2IUR A;  3N0D A;  2IUP A;  3UKR C;  3V5W B;  4ERZ A;  3AL8 A;  1MG3 A;  1Q47 A;  4YVD A;  4CI3 A;  1TBG A;  2G99 A;  4E54 B;  5FKT A;  2CO0 A;  2H6Q A;  1VYH C;  4A0B A;  1XKS A;  2H6K A;  3AFC A;  4CY1 A;  1U2V C;  3J81 g;  2CE8 A;  2OK4 A;  4G56 B;  1JJU B;  4U7A A;  4CZV A;  3EWE A;  2YNN A;  3SHF A;  4PSW B;  4Y7R A;  1ERJ A;  3NVQ A;  2H9N A;  4GGC A;  3IJ0 A;  2AGL A;  4GM8 A;  4CY3 A;  4R7A B;  3IIY A;  5EAP A;  1PBY B;  3C99 A;  4Z8L A;  2OK6 A;  5THA A;  3E0C A;  3L4M D;  2PM7 B;  2Q7Q A;  2HKR A;  3PXS D;  3BG0 A;  4FHL A;  3SCY A;  3VA6 A;  3EU7 A;  2B5N A;  2OVR B;  3W15 A;  2I3S A;  3I7N A;  3UVK A;  3U4Y A;  2P9I C;  2HKM A;  4JD2 C;  3KRX B;  3JRP A;  3UKU C;  2GNQ A;  3HFQ A;  4PC0 A;  5I5I A;  5FA5 B;  1PEV A;  2AGW A;  4H5J A;  4JT5 C;  2IWK A;  3IKO A;  5FKQ A;  5GSA A;  4BH6 A;  1GOT B;  3OKY B;  5GXI A;  3DXK C;  4CY2 A;  2I0T A;  2XU7 A;  3J80 g;  2J56 H;  3CIK B;  2AGY A;  2O9K A;  4X3E A;  2YBA A;  3OKY A;  2IUQ A;  3OKT A;  4A11 A;  4PBY A;  2OIZ A;  2OJY A;  2GC4 A;  5I5J A;  4CZX A;  1PGU A;  2AH1 A;  4A09 A;  1SHY B;  5IJ8 E;  4GQ1 A;  4J8G A;  4A2L A;  4ES0 A;  5EMM B;  4XYH A;  2UZY B;  3DWL C;  2MTA H;  3I89 A;  4ERY A;  3CFV A;  3SMR A;  4A0A B;  3GFC A;  3RRM C;  5AMS A;  2P9K C;  5AFU 3;  2IAA A;  1GP2 B;  4ZOX A;  2HYE A;  3EG6 A;  5TF2 A;  4ZN4 A;  2W18 A;  3B7F A;  4FA9 D;  2H9P A;  3BWS A;  4A0A A;  1SQJ A;  4FA1 D;  5IGO A;  2AGX A;  4JSP C;  2Z2N A;  3DXM C;  4A7J A;  2I3T A;  1GG2 B;  5EAM A;  4A0B B;  3DSM A;  5I5M A;  4CI1 A;  3AL9 A;  4D0K A;  4CI2 A;  3A0F A; 
#chains in the Genus database with same CATH topology
 1XIP A;  2IUV A;  4G55 A;  1TYE A;  3I7K A;  3JAM g;  3UVN A;  3PVW B;  4GMB A;  4X61 B;  5CXB B;  3OW8 A;  5EAL A;  2GC7 A;  3IUJ A;  2J57 G;  4JSN C;  3VI4 A;  4L3G D;  1TYQ C;  1YR2 A;  4WK0 A;  3OF7 A;  2H9M A;  1NEX B;  2HES X;  4ZOZ A;  3RN1 D;  4FB1 D;  3KRW B;  4AOW A;  1QNI A;  3CFS B;  5CXB A;  3SN6 B;  4FA4 D;  3OL2 A;  5HE1 B;  5TEF A;  3FRX A;  2IWF A;  3SVW D;  3NID A;  4GQB B;  5IJ7 E;  1JMZ B;  3FCU A;  5FKR A;  4J79 A;  3T3M A;  2YMU A;  1E8N A;  5IC7 A;  3ZE2 A;  3SFZ A;  4QRJ A;  2YNP A;  3I8E A;  2QXV A;  4FWW A;  4FAN D;  1VZ2 A;  3NIF A;  2P9U C;  5TEE A;  3RFG A;  5M5T A;  3ODT A;  4K3J B;  4WK4 A;  4X63 B;  4E5Z B;  4GQ2 P;  2XE4 A;  5A2Q g;  2P9N C;  4O1Q D;  5SXM A;  3SBP A;  4GM3 A;  4HDJ A;  1UOP A;  1C9I A;  3IJE A;  3IIW A;  4J78 A;  2B4E A;  1A0R B;  5C2V B;  4E5Z A;  3V9F A;  4UM8 A;  2YB8 B;  3OTT A;  4MMX A;  5HE2 B;  4J77 A;  5AJA A;  3ULE C;  5GMK n;  3I7L A;  4CY5 A;  4RE5 A;  4UI9 R;  3L4O D;  4BUJ C;  5C86 A;  4JHP C;  1GXR A;  1L0Q A;  3RLM D;  4A11 B;  3ZDZ A;  5KDO B;  4PBZ A;  4JT6 C;  1RI6 A;  4A09 B;  2AH0 A;  2CN2 A;  3OKW A;  4Y5R D;  4EWR A;  5IGQ A;  3PE7 A;  2HXC A;  4AX4 A;  3MZL A;  4Z7Q A;  2PM9 B;  2BBK H;  5H14 A;  3F3G A;  3K27 A;  4RE6 A;  2CNX A;  1UTC A;  3FGB A;  4GZ8 A;  3SLE D;  4ZOY A;  4L1Q D;  2OVQ B;  3ZE0 A;  5CYK B;  4AMZ A;  2J55 H;  5H1M A;  1U4C A;  3RN0 D;  2AQ5 A;  2PM9 A;  3EI4 A;  3IUL A;  4A2M A;  2I0R A;  4Z7N A;  4XEI C;  4Z7O A;  1MG2 A;  3K6S A;  3O4I A;  4D9S A;  5CYK A;  5HDB A;  2VDN A;  5TDH B;  3SBR A;  4BP8 A;  4LG9 A;  3PSC B;  1K32 A;  2XYI A;  2HU7 A;  3GRE A;  1K8K C;  2UZX B;  2XL2 A;  3V7D B;  4IA9 A;  5K1C C;  4JXM A;  3KCI A;  3QHY B;  4GGA A;  3O4G A;  4IRZ A;  1QFM A;  2OVP B;  2WQ8 A;  1FWX A;  3RFH A;  3C5M A;  4O9D A;  3BG1 A;  4J0W A;  1SQ9 A;  1N6E A;  3SXT D;  4L9O A;  3ZDY A;  1JTD B;  1H2W A;  1L5G A;  4PNK B;  2P9L C;  3PXT D;  4DNU A;  1U8C A;  3FCS A;  5IT9 g;  4A08 B;  1GOH A;  1S4U X;  4FAV D;  4JSX C;  5GXH A;  2VZ1 A;  2H47 A;  4J87 A;  5M5U A;  3UVO A;  2H14 A;  5C2W B;  5HE3 B;  3NVX A;  4O3T B;  2VDQ A;  3DM0 A;  4U1E I;  4FA5 D;  2Z2O A;  3OL2 B;  3IJC A;  2VDL A;  3RMZ D;  4A08 A;  5HE0 B;  2BCJ B;  3F3P A;  3I7O A;  3SBQ A;  3SJL D;  4ESG A;  4J84 A;  4J81 A;  3ZWL B;  4JSV C;  4O02 A;  3PVU B;  2EIB A;  4CI8 A;  2P9P C;  3NVN A;  1MDA H;  4D6V A;  1B9Y A;  1VZ3 A;  2G9A A;  3VH0 A;  2TRC B;  4PSX B;  3FM0 A;  5FKS A;  2CN3 A;  1N6D A;  3MZK A;  4N14 A;  1B9X A;  3NIG A;  3GD1 I;  4MK0 B;  4BP9 A;  4DNV A;  3QI0 A;  4ERQ A;  4ZOV A;  1H2X A;  1JMX B;  1PI6 A;  3O4J A;  2H9L A;  4H5I A;  5JWZ A;  1O6G A;  1VE6 A;  4E54 A;  1QFS A;  2XDW A;  3IJ1 A;  5FQD A;  2H68 A;  2HJ4 A;  1OMW B;  3JB9 L;  4G1M A;  5E6R A;  4JHN A;  3K26 A;  1E5T A;  2QR5 A;  3K72 A;  3EMH A;  3MXX A;  4GM9 A;  2QC5 A;  5CXC B;  4NAA A;  3AH8 B;  5FFO A;  4J8B A;  3F3F A;  3MMY A;  3IUQ A;  4J73 A;  3EI1 B;  5C9Z B;  1T2X A;  2VDK A;  3MKQ A;  3MKS B;  3JRO A;  5FFG A;  2PBI B;  3C75 H;  5EAR A;  2H13 A;  2CE9 A;  2VZ3 A;  5CXC A;  3EQ9 A;  3ZE1 A;  4O3U B;  1NR0 A;  2PM6 B;  4J0X A;  4LGN A;  5FLX g;  3JPX A;  5HQG A;  2EBS A;  4J86 A;  5B4W A;  4QQE A;  3PXW D;  3EI1 A;  3ORV D;  1O6F A;  2P9S C;  5H17 A;  1N6F A;  4GGD A;  2Z2P A;  1JOF A;  3EI4 B;  4J82 A;  3I8C A;  2HU5 A;  3UVL A;  4PXW A;  3I7H A;  4TZ4 A;  4NEN A;  4NSX A;  3EI3 B;  2VDM A;  2BKL A;  2YNO A;  3JZG A;  4BL0 A;  1YFQ A;  3IUN A;  3V4P A;  2HJB A;  1OLZ A;  4OZU A;  3EI2 B;  3EI3 A;  1H2Z A;  3N0E A;  2B5L A;  3JZN A;  1R5M A;  4XYI A;  3SWS D;  2VDO A;  5EM2 B;  3IVM A;  3MUO A;  2H6N A;  4G1E A;  4CZY A;  4DNW A;  3T3P A;  4AEZ A;  3EI2 A;  3UVM A;  5EMK B;  5K19 A;  2B5M A;  3ZDX A;  3P4F A;  4X60 B;  3O4H A;  1XHM A;  5EM2 A;  3I2N A;  4QL1 A;  5EML B;  2AGZ A;  3UR4 A;  2I0S A;  3PSL A;  3VGZ A;  4OWR A;  4BCB A;  5EMJ B;  5HYN B;  4KFM B;  4L3H D;  4O45 A;  4IMM A;  2CO0 C;  3JZH A;  3I7P A;  1M1X A;  1P22 A;  2XL3 A;  1A12 A;  3AL8 B;  3MVD K;  4LG8 A;  4I79 A;  5FXY A;  4QT8 A;  3GC3 B;  3RSE C;  3C9C A;  4K3I D;  3VI3 A;  4CC9 A;  2H3X A;  3IUM A;  2IUR A;  3N0D A;  2IUP A;  3UKR C;  4QAM A;  3V5W B;  4BCD A;  4ERZ A;  3AL8 A;  1H2Y A;  4O2W A;  1MG3 A;  1Q47 A;  4YVD A;  4CI3 A;  2HU8 A;  1TBG A;  2G99 A;  1BPO A;  4E54 B;  5FKT A;  2CO0 A;  3EQ7 A;  2EIE A;  2H6Q A;  1VYH C;  4A0B A;  1XKS A;  2H6K A;  3MUN A;  3AFC A;  4CY1 A;  1U2V C;  3J81 g;  2VDR A;  4NBM A;  2CE8 A;  2OK4 A;  4G56 B;  1JJU B;  4U7A A;  4CZV A;  3EWE A;  2YNN A;  3SHF A;  1C9L A;  1UOO A;  4PSW B;  4Y7R A;  1E8M A;  1ERJ A;  3NVQ A;  2H9N A;  4MMZ A;  4GGC A;  3IJ0 A;  2AGL A;  2VDP A;  4GM8 A;  4CY3 A;  4R7A B;  3IIY A;  5EAP A;  1PBY B;  3C99 A;  4Z8L A;  2OK6 A;  5THA A;  3E0C A;  3L4M D;  2PM7 B;  2Q7Q A;  2HKR A;  3PXS D;  3BG0 A;  4FHL A;  3SCY A;  3VA6 A;  3EU7 A;  2B5N A;  1K3I A;  1UOQ A;  5M5R A;  2OVR B;  3W15 A;  2I3S A;  2EID A;  3I7N A;  3UVK A;  3U4Y A;  2P9I C;  2HKM A;  4JD2 C;  3KRX B;  4UM9 A;  4MMY A;  3JRP A;  1GOF A;  3UKU C;  2GNQ A;  3HFQ A;  4WK2 A;  4PC0 A;  5I5I A;  5FA5 B;  1PEV A;  2AGW A;  4H5J A;  4JT5 C;  2IWK A;  3IKO A;  5FKQ A;  5GSA A;  4BH6 A;  1GOT B;  3OKY B;  2JKX A;  5GXI A;  5M5V A;  3DXK C;  4NC4 A;  4CY2 A;  2I0T A;  2XU7 A;  3J80 g;  2J56 H;  3CIK B;  2AGY A;  2O9K A;  4X3E A;  5E6S A;  2YBA A;  1I2M B;  3OKY A;  2IUQ A;  3OKT A;  4A11 A;  4L1M A;  4PBY A;  2OIZ A;  2OJY A;  2GC4 A;  5I5J A;  4CZX A;  1PGU A;  2AH1 A;  3IUR A;  4AMY A;  4A09 A;  1SHY B;  3K71 A;  5IJ8 E;  4GQ1 A;  4J8G A;  4A2L A;  4ES0 A;  5EMM B;  2VC2 A;  4XYH A;  4BCC A;  2UZY B;  3DWL C;  4AN0 A;  2MTA H;  3I89 A;  4ERY A;  3CFV A;  3SMR A;  4A0A B;  3GFC A;  2QZP A;  3RRM C;  3EQ8 A;  5AMS A;  2P9K C;  5AFU 3;  2IAA A;  1GP2 B;  1GOG A;  4ZOX A;  2HYE A;  3EG6 A;  5TF2 A;  4ZN4 A;  2W18 A;  3B7F A;  4FA9 D;  3V4V A;  2H9P A;  3BWS A;  4A0A A;  1SQJ A;  4AN1 A;  1VE7 A;  4FA1 D;  5IGO A;  5M5S A;  2XZG A;  2AGX A;  4JSP C;  2Z2N A;  5C92 A;  3DXM C;  4A7J A;  2I3T A;  5M61 A;  3DDU A;  5E6U A;  1GG2 B;  5EAM A;  4A0B B;  3DSM A;  5I5M A;  4CI1 A;  1JV2 A;  3AL9 A;  4D0K A;  2EIC A;  4CI2 A;  4WJK A;  3A0F A; 
#chains in the Genus database with same CATH homology
 1XIP A;  2IUV A;  3JAM g;  3I7K A;  3UVN A;  3PVW B;  4GMB A;  4X61 B;  5CXB B;  3OW8 A;  5EAL A;  2GC7 A;  4JSN C;  2J57 G;  4L3G D;  1TYQ C;  2H9M A;  1NEX B;  2HES X;  4ZOZ A;  3RN1 D;  4FB1 D;  3KRW B;  4AOW A;  1QNI A;  3CFS B;  5CXB A;  3SN6 B;  4FA4 D;  3OL2 A;  5HE1 B;  5TEF A;  3FRX A;  2IWF A;  3SVW D;  4GQB B;  5IJ7 E;  1JMZ B;  5FKR A;  4J79 A;  2YMU A;  5IC7 A;  3SFZ A;  4QRJ A;  2YNP A;  3I8E A;  2QXV A;  4FWW A;  4FAN D;  5TEE A;  2P9U C;  3RFG A;  3ODT A;  4K3J B;  4X63 B;  4E5Z B;  4GQ2 P;  5A2Q g;  2P9N C;  4O1Q D;  5SXM A;  3SBP A;  4GM3 A;  4HDJ A;  3IIW A;  4J78 A;  2B4E A;  1A0R B;  5C2V B;  4E5Z A;  3V9F A;  2YB8 B;  3OTT A;  5HE2 B;  4J77 A;  5AJA A;  3ULE C;  5GMK n;  3I7L A;  4CY5 A;  4UI9 R;  4BUJ C;  3L4O D;  1GXR A;  1L0Q A;  3RLM D;  4A11 B;  5KDO B;  4PBZ A;  4JT6 C;  1RI6 A;  4A09 B;  2AH0 A;  2CN2 A;  3OKW A;  4Y5R D;  4EWR A;  5IGQ A;  3PE7 A;  2HXC A;  3MZL A;  2PM9 B;  2BBK H;  5H14 A;  3F3G A;  3K27 A;  2CNX A;  3FGB A;  3SLE D;  4GZ8 A;  4ZOY A;  4L1Q D;  2OVQ B;  5CYK B;  2J55 H;  5H1M A;  1U4C A;  3RN0 D;  2AQ5 A;  2PM9 A;  3EI4 A;  4A2M A;  2I0R A;  4XEI C;  1MG2 A;  5CYK A;  5TDH B;  3SBR A;  4LG9 A;  3PSC B;  1K32 A;  2XYI A;  3GRE A;  1K8K C;  2UZX B;  2XL2 A;  3V7D B;  4IA9 A;  5K1C C;  4JXM A;  4GGA A;  2OVP B;  1FWX A;  3RFH A;  3C5M A;  4O9D A;  3BG1 A;  4J0W A;  1SQ9 A;  1N6E A;  3SXT D;  4L9O A;  4PNK B;  2P9L C;  3PXT D;  5IT9 g;  4A08 B;  4FAV D;  1S4U X;  4JSX C;  5GXH A;  2H47 A;  4J87 A;  3UVO A;  2H14 A;  5C2W B;  5HE3 B;  3NVX A;  4O3T B;  3DM0 A;  4U1E I;  4FA5 D;  2Z2O A;  3OL2 B;  3IJC A;  3RMZ D;  4A08 A;  5HE0 B;  2BCJ B;  3F3P A;  3I7O A;  3SBQ A;  3SJL D;  4ESG A;  4J84 A;  4J81 A;  3ZWL B;  4JSV C;  3PVU B;  4CI8 A;  2P9P C;  3NVN A;  1MDA H;  4D6V A;  1B9Y A;  2G9A A;  3VH0 A;  2TRC B;  4PSX B;  3FM0 A;  5FKS A;  2CN3 A;  1N6D A;  3MZK A;  4N14 A;  1B9X A;  4MK0 B;  4ERQ A;  4ZOV A;  1JMX B;  1PI6 A;  2H9L A;  4H5I A;  5JWZ A;  4E54 A;  3IJ1 A;  5FQD A;  2H68 A;  2HJ4 A;  1OMW B;  3JB9 L;  3K26 A;  3EMH A;  3MXX A;  4GM9 A;  2QC5 A;  5CXC B;  3AH8 B;  4J8B A;  3F3F A;  3MMY A;  4J73 A;  3EI1 B;  5C9Z B;  3MKQ A;  3MKS B;  3JRO A;  2PBI B;  3C75 H;  5EAR A;  2H13 A;  2CE9 A;  5CXC A;  5FLX g;  4O3U B;  1NR0 A;  2PM6 B;  4J0X A;  4LGN A;  3JPX A;  5HQG A;  2EBS A;  4J86 A;  5B4W A;  4QQE A;  3PXW D;  3EI1 A;  3ORV D;  2P9S C;  5H17 A;  1N6F A;  4GGD A;  2Z2P A;  1JOF A;  3EI4 B;  4J82 A;  3I8C A;  3UVL A;  4PXW A;  3I7H A;  4TZ4 A;  4NSX A;  3EI3 B;  2YNO A;  3JZG A;  4BL0 A;  1YFQ A;  2HJB A;  1OLZ A;  4OZU A;  3EI2 B;  3EI3 A;  3N0E A;  2B5L A;  3JZN A;  1R5M A;  4XYI A;  3SWS D;  5EM2 B;  2H6N A;  4CZY A;  3EI2 A;  4AEZ A;  3UVM A;  5EMK B;  5K19 A;  2B5M A;  3P4F A;  4X60 B;  1XHM A;  5EM2 A;  3I2N A;  4QL1 A;  5EML B;  2AGZ A;  3UR4 A;  2I0S A;  3PSL A;  3VGZ A;  4OWR A;  5EMJ B;  5HYN B;  4KFM B;  4L3H D;  4O45 A;  4IMM A;  2CO0 C;  3JZH A;  3I7P A;  1P22 A;  2XL3 A;  3AL8 B;  4LG8 A;  4I79 A;  5FXY A;  4QT8 A;  3RSE C;  3C9C A;  4K3I D;  4CC9 A;  2H3X A;  2IUR A;  3N0D A;  2IUP A;  3UKR C;  3V5W B;  4ERZ A;  3AL8 A;  1MG3 A;  1Q47 A;  4YVD A;  4CI3 A;  1TBG A;  2G99 A;  4E54 B;  5FKT A;  2CO0 A;  2H6Q A;  1VYH C;  4A0B A;  1XKS A;  2H6K A;  3AFC A;  4CY1 A;  1U2V C;  3J81 g;  2CE8 A;  2OK4 A;  4G56 B;  1JJU B;  4U7A A;  4CZV A;  3EWE A;  2YNN A;  3SHF A;  4PSW B;  4Y7R A;  1ERJ A;  3NVQ A;  2H9N A;  4GGC A;  3IJ0 A;  2AGL A;  4GM8 A;  4CY3 A;  4R7A B;  3IIY A;  5EAP A;  1PBY B;  3C99 A;  4Z8L A;  2OK6 A;  5THA A;  3E0C A;  3L4M D;  2PM7 B;  2Q7Q A;  2HKR A;  3PXS D;  3BG0 A;  4FHL A;  3SCY A;  3VA6 A;  3EU7 A;  2B5N A;  2OVR B;  3W15 A;  2I3S A;  3I7N A;  3UVK A;  3U4Y A;  2P9I C;  2HKM A;  4JD2 C;  3KRX B;  3JRP A;  3UKU C;  2GNQ A;  3HFQ A;  4PC0 A;  5I5I A;  5FA5 B;  1PEV A;  2AGW A;  4H5J A;  4JT5 C;  2IWK A;  3IKO A;  5FKQ A;  5GSA A;  4BH6 A;  1GOT B;  3OKY B;  5GXI A;  3DXK C;  4CY2 A;  2I0T A;  2XU7 A;  3J80 g;  2J56 H;  3CIK B;  2AGY A;  2O9K A;  4X3E A;  2YBA A;  3OKY A;  2IUQ A;  3OKT A;  4A11 A;  4PBY A;  2OIZ A;  2OJY A;  2GC4 A;  5I5J A;  4CZX A;  1PGU A;  2AH1 A;  4A09 A;  1SHY B;  5IJ8 E;  4GQ1 A;  4J8G A;  4A2L A;  4ES0 A;  5EMM B;  4XYH A;  2UZY B;  3DWL C;  2MTA H;  3I89 A;  4ERY A;  3CFV A;  3SMR A;  4A0A B;  3GFC A;  3RRM C;  5AMS A;  2P9K C;  5AFU 3;  2IAA A;  1GP2 B;  4ZOX A;  2HYE A;  3EG6 A;  5TF2 A;  4ZN4 A;  2W18 A;  3B7F A;  4FA9 D;  2H9P A;  3BWS A;  4A0A A;  1SQJ A;  4FA1 D;  5IGO A;  2AGX A;  4JSP C;  2Z2N A;  3DXM C;  4A7J A;  2I3T A;  1GG2 B;  5EAM A;  4A0B B;  3DSM A;  5I5M A;  4CI1 A;  3AL9 A;  4D0K A;  4CI2 A;  3A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...