5IC7A

Structure of the wd domain of utp18
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
365
structure length
340
Chain Sequence
RKLRPETIDIQRTRDIPDTHKAAISSLAFHPRYPILLSSSTSSIMYLHKLDASAYPTPNPLLTSVHVKRTDLRRAAFVGPDGGEIIFAGRRRYFHCWNLSSGLVKKVSKIQGHQKEQRTMERFRVSPCGRYMALVASDKKGGGMLNIINVGTMQWIAQARIDGRHGVADFAWWSDGNGLTIAGRDGQVTEWSMITRRTVGIWRDEGTVMALGGRNGPAELGGDRWVAIGSNSGILNVYDRNDLIEIRIKKYPTPTRVFEQLTTSISVVAFSPDGQLLAFGSQHKKDALRLVHLPSCTVYRNWPTEQTPLGRVTAIAFSSKSDVLAVGNDVGRVRLWEIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Structural protein
molecule keywords Putative uncharacterized protein
total genus 75
structure length 340
sequence length 365
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ic7A00
1N6EA 4BH6A 3JB9L 4ERQA 3JZGA 1NEXB 2YBAA 4CI2A 4BL0A 5TF2A 3C9CA 4GM8A 5AFU3 2OVRB 2P9SC 4IMMA 4GM9A 2XL3A 2O9KA 2HESX 3SBQA 4CI3A 2P9KC 2P9IC 3DSMA 2YB8B 4R7AB 3NVQA 1PGUA 2IUPA 1MG3A 2P9NC 1U2VC 3OKTA 5I5IA 4GGCA 4G56B 1GP2B 3I7KA 3RN0D 2AGYA 3UR4A 4Z8LA 2PM6B 2GC7A 2H3XA 5THAA 3I7HA 4J78A 4JXMA 1RI6A 2AGWA 3JZHA 1MDAH 1QNIA 5A2Qg 2XL2A 3EI4B 4A7JA 3ULEC 5IGQA 4J81A 3B7FA 3SN6B 3KRXB 3RFHA 5I5MA 3JAMg 3EWEA 3EI3A 3UVMA 3I89A 4NSXA 3ORVD 3BWSA 4GZ8A 3ZWLB 4O1QD 5H14A 1PI6A 2I0SA 2B4EA 1ERJA 3F3GA 3JPXA 1L0QA 3EU7A 4JSXC 3VH0A 2GNQA 5CXCB 3CIKB 3I8CA 3ODTA 4ES0A 3UVLA 2OIZA 4N14A 3J80g 5IJ7E 4OWRA 3SJLD 5TDHB 2W18A 3SMRA 4A09A 2HXCA 5EMMB 2IUQA 4QT8A 3EI3B 3PXWD 3IKOA 5C2VB 5HQGA 4TZ4A 4X3EA 5AJAA 3GREA 3IJ0A 4FAVD 4O3TB 3OKWA 5K1CC 2UZYB 2Z2NA 3F3FA 4XYIA 5HE1B 4X63B 3P4FA 2AGZA 5TEEA 4CI8A 5FQDA 5K19A 5IJ8E 5EAMA 1XKSA 5CYKB 3V7DB 4A0BB 3PVWB 3RN1D 2H47A 5HYNB 4PBYA 5C9ZB 4GM3A 2YMUA 5CYKA 4A0AA 5EM2A 2I0TA 4PSWB 2YNNA 4Y7RA 4O3UB 4A08A 2Z2OA 1PEVA 3I2NA 4J0WA 2I3TA 2H14A 3EMHA 4J8BA 2H9NA 1GXRA 3RLMD 1VYHC 5FLXg 4CY3A 3CFSB 5IT9g 4CY1A 2CN2A 3SBRA 2HKRA 5CXBA 3IIWA 3NVXA 2XYIA 4PNKB 3I7PA 4GQBB 4A09B 3OL2B 4CZYA 4J0XA 4ERYA 4FWWA 1B9XA 5EMKB 1B9YA 1NR0A 3MXXA 5FXYA 1SQJA 5CXCA 2IWKA 2QXVA 3V9FA 1K8KC 5GXHA 4ERZA 3AL8B 3MKSB 3PVUB 2PM7B 3F3PA 4K3ID 1SHYB 3VA6A 3FRXA 5EMJB 2PM9B 5I5JA 1R5MA 3MZLA 4UI9R 4GMBA 2AGXA 3N0EA 4JSPC 3UVKA 4QQEA 4PBZA 1K32A 3BG0A 3UVNA 1OMWB 5CXBB 4U7AA 3C99A 3OTTA 5GMKn 5IC7A 5EMLB 1GOTB 4FA1D 4LGNA 4J84A 2QC5A 4LG9A 1JMZB 3PSLA 3UVOA 5TEFA 4GGAA 4A08B 5EM2B 3I7OA 4PSXB 2P9LC 5AMSA 5KDOB 2OK4A 4K3JB 4ZN4A 4FB1D 4FA9D 3IIYA 4FAND 3SLED 4J86A 5C2WB 5HE0B 5IGOA 1S4UX 4L3GD 2HYEA 3AH8B 1XIPA 5FKTA 2CO0C 5SXMA 2YNPA 4J73A 5GXIA 2XU7A 3SHFA 2PBIB 3W15A 4QL1A 4PXWA 2GC4A 3SXTD 4L1QD 2IWFA 3OKYA 4CI1A 3U4YA 4A2MA 4J87A 2CO0A 4JD2C 2IUVA 4U1EI 4A11B 3SBPA 3EI1B 2TRCB 3K26A 3K27A 2AQ5A 4J77A 3SFZA 4LG8A 4XEIC 2HJBA 5EALA 4HDJA 5FKQA 3FM0A 3RRMC 3J81g 4AEZA 5FKSA 4CY5A 2IAAA 2H9PA 4JT6C 4ZOXA 4H5JA 4A11A 1JJUB 3JZNA 2IURA 4ZOYA 3UKUC 2OK6A 5JWZA 1N6FA 2H6NA 2H9LA 2UZXB 3OKYB 2J57G 3DXMC 4H5IA 4AOWA 3GFCA 1P22A 3RMZD 2CE9A 4BUJC 2CE8A 3DXKC 2P9PC 1PBYB 4L9OA 3I8EA 4L3HD 2G99A 1YFQA 2G9AA 3KRWB 2AH1A 3SCYA 4JSVC 1OLZA 3CFVA 4ZOZA 4A0AB 4D0KA 2I3SA 4FA4D 3MMYA 3JRPA 4ZOVA 3UKRC 1TBGA 4E54A 2AGLA 4J79A 3RSEC 3V5WB 2BBKH 4E54B 3PXTD 1XHMA 4A0BA 5EARA 1JMXB 2CN3A 1N6DA 4O9DA 3PSCB 4O45A 4JT5C 3I7LA 3N0DA 5B4WA 2YNOA 3HFQA 1GG2B 4CZVA 2OJYA 4PC0A 5HE3B 3FGBA 1A0RB 1TYQC 3A0FA 2HJ4A 2H9MA 2B5MA 4YVDA 3JROA 3NVNA 4A2LA 4CY2A 1Q47A 3C5MA 4EWRA 3VGZA 1U4CA 4JSNC 3EI2B 3MKQA 4FHLA 1MG2A 3PE7A 3AL9A 4X60B 2H6KA 4CZXA 4E5ZB 3EG6A 3RFGA 2PM9A 2Z2PA 2OVQB 4D6VA 3C75H 3MZKA 2H6QA 4ESGA 3I7NA 4MK0B 3DM0A 3EI1A 3PXSD 3AL8A 4KFMB 5H17A 3BG1A 3L4MD 4QRJA 4IA9A 3IJCA 4J8GA 5EAPA 2HKMA 5H1MA 2I0RA 4OZUA 4E5ZA 2H13A 2J55H 5FKRA 2BCJB 4GQ2P 4FA5D 3EI4A 2B5NA 3E0CA 2EBSA 2P9UC 4X61B 4GGDA 3AFCA 3EI2A 2CNXA 3OL2A 3IJ1A 2H68A 2AH0A 2MTAH 3SWSD 4I79A 4CC9A 2Q7QA 1JOFA 5HE2B 4GQ1A 5GSAA 4Y5RD 3OW8A 1SQ9A 3L4OD 2J56H 4J82A 5FA5B 3DWLC 2B5LA 2OVPB 4XYHA 1FWXA 3SVWD
chains in the Genus database with same CATH superfamily
2VDLA 1N6EA 4BH6A 2EIBA 2WQ8A 3JB9L 4ERQA 2XE4A 5M5SA 2QZPA 1NEXB 2YBAA 3JZGA 1C9IA 4BP8A 2EIDA 2VDMA 5TF2A 4BL0A 4CI2A 3C9CA 4GM8A 5AFU3 2OVRB 2P9SC 4IMMA 4GM9A 2XL3A 2O9KA 2HESX 3SBQA 4CI3A 1GOGA 2P9KC 2BKLA 2P9IC 3DSMA 1M1XA 2YB8B 4R7AB 3NVQA 1PGUA 2IUPA 1MG3A 2P9NC 1U2VC 3OKTA 5I5IA 4GGCA 4G56B 1GP2B 4QAMA 3IULA 3I7KA 3RN0D 2AGYA 3UR4A 4Z8LA 2VDNA 2PM6B 2GC7A 2H3XA 5THAA 3I7HA 4J78A 4JXMA 1RI6A 2AGWA 3JZHA 1MDAH 1QNIA 5A2Qg 3GC3B 2XL2A 3EI4B 4RE5A 4A7JA 3ULEC 3V4VA 5IGQA 4J81A 3B7FA 3SN6B 3KRXB 3RFHA 5I5MA 3JAMg 4UM9A 3EWEA 4Z7OA 3EI3A 3UVMA 3I89A 4NSXA 3ORVD 3BWSA 4GZ8A 3ZWLB 4O1QD 5H14A 1PI6A 3F3GA 2I0SA 2B4EA 1ERJA 3JPXA 1L0QA 3EU7A 4JSXC 3VH0A 2GNQA 3FCUA 5CXCB 3CIKB 3I8CA 3ODTA 4ES0A 3UVLA 4AMYA 2OIZA 4N14A 3J80g 5IJ7E 1O6GA 4G1EA 4OWRA 2VDQA 3T3PA 1YR2A 3SJLD 5TDHB 2W18A 3SMRA 5E6RA 4A09A 2HXCA 5EMMB 2IUQA 4QT8A 3EI3B 4DNWA 3PXWD 1T2XA 4AN1A 3IKOA 5C2VB 5HQGA 1UTCA 4TZ4A 4X3EA 5AJAA 2VDKA 3GREA 3IJ0A 4FAVD 4AN0A 4O3TB 3OKWA 5K1CC 4NAAA 1GOHA 2UZYB 2Z2NA 3F3FA 4XYIA 5HE1B 4X63B 3P4FA 2AGZA 5TEEA 4CI8A 5FQDA 5K19A 5IJ8E 5EAMA 1XKSA 5CYKB 4G55A 3V7DB 4A0BB 1U8CA 3PVWB 3RN1D 2H47A 2VC2A 5HYNB 4PBYA 1QFSA 4BP9A 4GM3A 5C9ZB 2YMUA 5CYKA 3ZDZA 2EICA 2VZ3A 4A0AA 1C9LA 5EM2A 2I0TA 4PSWB 2YNNA 4Y7RA 4O3UB 2XZGA 4A08A 2Z2OA 1PEVA 3I2NA 4J0WA 2I3TA 2H14A 3EMHA 4J8BA 5E6UA 1H2ZA 2H9NA 3VI3A 5M5RA 1GXRA 3RLMD 1VYHC 5FLXg 1A12A 4CY3A 3CFSB 5IT9g 4CY1A 2CN2A 3SBRA 2HKRA 5CXBA 3IIWA 3NVXA 2XYIA 4PNKB 3I7PA 4GQBB 3V4PA 3OL2B 4A09B 2VDRA 4CZYA 4J0XA 4WK4A 4ERYA 4FWWA 1B9XA 5EMKB 1B9YA 1GOFA 1NR0A 3MXXA 5FXYA 1SQJA 5CXCA 2IWKA 2QXVA 3NIFA 2EIEA 3V9FA 1K8KC 5GXHA 4ERZA 3AL8B 1K3IA 4MMXA 3MKSB 3PVUB 2PM7B 2VZ1A 3F3PA 4K3ID 1SHYB 3VA6A 3FRXA 5EMJB 2PM9B 5I5JA 1R5MA 3K71A 3MZLA 4UI9R 4GMBA 3ZE0A 1I2MB 2AGXA 3N0EA 2VDOA 4JSPC 3UVKA 3ZE1A 5M5VA 4QQEA 4PBZA 3O4IA 1K32A 1UOQA 3BG0A 3UVNA 1JTDB 1OMWB 5CXBB 4U7AA 3VI4A 3C99A 3OTTA 1VE7A 5GMKn 5IC7A 3NIGA 1GOTB 5EMLB 4LGNA 4FA1D 4J84A 2QC5A 3EQ8A 3MVDK 4LG9A 1JMZB 3PSLA 3UVOA 5M5TA 3KCIA 3T3MA 5TEFA 1VZ2A 4GGAA 4A08B 3ZE2A 4WJKA 3DDUA 4NENA 5EM2B 4JHNA 3I7OA 1E5TA 4PSXB 3IJEA 3EQ7A 4WK2A 4Z7QA 3ZDXA 2P9LC 5AMSA 5KDOB 2OK4A 4K3JB 4ZN4A 4FB1D 4FA9D 3IIYA 1H2WA 1QFMA 4FAND 3SLED 4J86A 5C2WB 5HE0B 3ZDYA 4BCCA 5IGOA 1S4UX 3K6SA 4L3GD 2HYEA 3AH8B 1XIPA 5FKTA 1H2YA 2CO0C 5SXMA 2YNPA 4J73A 5HDBA 5GXIA 5M61A 2XU7A 3O4JA 2PBIB 3NIDA 3SHFA 3W15A 4QL1A 4PXWA 2GC4A 4BCBA 3SXTD 1E8MA 3EQ9A 1BPOA 2HU8A 2JKXA 2IWFA 3OKYA 4L1QD 4CI1A 3U4YA 4A2MA 1L5GA 4J87A 4WK0A 2CO0A 3FCSA 4JD2C 2IUVA 4U1EI 4A11B 3SBPA 3EI1B 2TRCB 3K26A 3K27A 2AQ5A 5C86A 4J77A 3QI0A 3SFZA 4LG8A 3OF7A 2HJBA 4XEIC 5EALA 4HDJA 5FKQA 3FM0A 3RRMC 3QHYB 1VZ3A 3J81g 4AEZA 3IVMA 5FKSA 2VDPA 4CY5A 2IAAA 4G1MA 2H9PA 4JT6C 4ZOXA 4H5JA 4A11A 1JJUB 3JZNA 4D9SA 5E6SA 2IURA 4ZOYA 3UKUC 2OK6A 5JWZA 1N6FA 2H6NA 4AMZA 2H9LA 2UZXB 3OKYB 2HU7A 2J57G 3DXMC 4H5IA 4AOWA 3GFCA 1P22A 3RMZD 2CE9A 4BUJC 2CE8A 3DXKC 2P9PC 1PBYB 4L9OA 3I8EA 4L3HD 2G99A 1YFQA 2G9AA 3KRWB 3O4HA 2AH1A 3SCYA 4JSVC 1OLZA 3CFVA 4ZOZA 4A0AB 4D0KA 2I3SA 4FA4D 3MMYA 3JRPA 4ZOVA 3UKRC 1TBGA 4E54A 2AGLA 4DNVA 4J79A 3RSEC 3V5WB 3O4GA 2BBKH 4MMZA 3PXTD 4E54B 1TYEA 4UM8A 1XHMA 4A0BA 5EARA 1JMXB 2CN3A 1N6DA 4O9DA 3PSCB 4O45A 4JT5C 3I7LA 4DNUA 4MMYA 3N0DA 5B4WA 2YNOA 3HFQA 1GG2B 4CZVA 2OJYA 4PC0A 2HU5A 2QR5A 5HE3B 4NC4A 3FGBA 1A0RB 1TYQC 1H2XA 3IUNA 3A0FA 4Z7NA 2HJ4A 2H9MA 5M5UA 2B5MA 1UOOA 1E8NA 4YVDA 3JROA 3K72A 3NVNA 4JHPC 4A2LA 4AX4A 4CY2A 1Q47A 3C5MA 4RE6A 4EWRA 3VGZA 1U4CA 1JV2A 4JSNC 3EI2B 3MKQA 4FHLA 1MG2A 3PE7A 5FFOA 3AL9A 4X60B 4BCDA 2H6KA 4L1MA 4CZXA 4E5ZB 3EG6A 3RFGA 2PM9A 2Z2PA 2OVQB 4D6VA 3C75H 3MZKA 2H6QA 4ESGA 3I7NA 4MK0B 1O6FA 3DM0A 3EI1A 3MUNA 3PXSD 3AL8A 4KFMB 5H17A 3BG1A 3L4MD 4QRJA 4IA9A 4O02A 3IJCA 3IUJA 3IUQA 4J8GA 5EAPA 1UOPA 2HKMA 5H1MA 2I0RA 4OZUA 4E5ZA 4IRZA 2H13A 2J55H 5FKRA 2BCJB 4GQ2P 4FA5D 5FFGA 3EI4A 2B5NA 3E0CA 2EBSA 2P9UC 3IUMA 4GGDA 3AFCA 4X61B 3EI2A 2CNXA 3OL2A 3IJ1A 3GD1I 2H68A 2AH0A 1VE6A 2MTAH 3SWSD 4I79A 4CC9A 2Q7QA 2XDWA 1JOFA 5HE2B 4GQ1A 5C92A 5GSAA 4O2WA 4Y5RD 3OW8A 1SQ9A 3L4OD 2J56H 4J82A 5FA5B 3MUOA 3DWLC 2B5LA 2OVPB 4XYHA 1FWXA 3SVWD 4NBMA 3IURA
chains in the Genus database with same CATH topology
1N6EA 4BH6A 3JB9L 4ERQA 3JZGA 1NEXB 2YBAA 4CI2A 4BL0A 5TF2A 3C9CA 4GM8A 5AFU3 2OVRB 2P9SC 4IMMA 4GM9A 2XL3A 2O9KA 2HESX 3SBQA 4CI3A 2P9KC 2P9IC 3DSMA 2YB8B 4R7AB 3NVQA 1PGUA 2IUPA 1MG3A 2P9NC 1U2VC 3OKTA 5I5IA 4GGCA 4G56B 1GP2B 3I7KA 3RN0D 2AGYA 3UR4A 4Z8LA 2PM6B 2GC7A 2H3XA 5THAA 3I7HA 4J78A 4JXMA 1RI6A 2AGWA 3JZHA 1MDAH 1QNIA 5A2Qg 2XL2A 3EI4B 4A7JA 3ULEC 5IGQA 4J81A 3B7FA 3SN6B 3KRXB 3RFHA 5I5MA 3JAMg 3EWEA 3EI3A 3UVMA 3I89A 4NSXA 3ORVD 3BWSA 4GZ8A 3ZWLB 4O1QD 5H14A 1PI6A 2I0SA 2B4EA 1ERJA 3F3GA 3JPXA 1L0QA 3EU7A 4JSXC 3VH0A 2GNQA 5CXCB 3CIKB 3I8CA 3ODTA 4ES0A 3UVLA 2OIZA 4N14A 3J80g 5IJ7E 4OWRA 3SJLD 5TDHB 2W18A 3SMRA 4A09A 2HXCA 5EMMB 2IUQA 4QT8A 3EI3B 3PXWD 3IKOA 5C2VB 5HQGA 4TZ4A 4X3EA 5AJAA 3GREA 3IJ0A 4FAVD 4O3TB 3OKWA 5K1CC 2UZYB 2Z2NA 3F3FA 4XYIA 5HE1B 4X63B 3P4FA 2AGZA 5TEEA 4CI8A 5FQDA 5K19A 5IJ8E 5EAMA 1XKSA 5CYKB 3V7DB 4A0BB 3PVWB 3RN1D 2H47A 5HYNB 4PBYA 5C9ZB 4GM3A 2YMUA 5CYKA 4A0AA 5EM2A 2I0TA 4PSWB 2YNNA 4Y7RA 4O3UB 4A08A 2Z2OA 1PEVA 3I2NA 4J0WA 2I3TA 2H14A 3EMHA 4J8BA 2H9NA 1GXRA 3RLMD 1VYHC 5FLXg 4CY3A 3CFSB 5IT9g 4CY1A 2CN2A 3SBRA 2HKRA 5CXBA 3IIWA 3NVXA 2XYIA 4PNKB 3I7PA 4GQBB 4A09B 3OL2B 4CZYA 4J0XA 4ERYA 4FWWA 1B9XA 5EMKB 1B9YA 1NR0A 3MXXA 5FXYA 1SQJA 5CXCA 2IWKA 2QXVA 3V9FA 1K8KC 5GXHA 4ERZA 3AL8B 3MKSB 3PVUB 2PM7B 3F3PA 4K3ID 1SHYB 3VA6A 3FRXA 5EMJB 2PM9B 5I5JA 1R5MA 3MZLA 4UI9R 4GMBA 2AGXA 3N0EA 4JSPC 3UVKA 4QQEA 4PBZA 1K32A 3BG0A 3UVNA 1OMWB 5CXBB 4U7AA 3C99A 3OTTA 5GMKn 5IC7A 5EMLB 1GOTB 4FA1D 4LGNA 4J84A 2QC5A 4LG9A 1JMZB 3PSLA 3UVOA 5TEFA 4GGAA 4A08B 5EM2B 3I7OA 4PSXB 2P9LC 5AMSA 5KDOB 2OK4A 4K3JB 4ZN4A 4FB1D 4FA9D 3IIYA 4FAND 3SLED 4J86A 5C2WB 5HE0B 5IGOA 1S4UX 4L3GD 2HYEA 3AH8B 1XIPA 5FKTA 2CO0C 5SXMA 2YNPA 4J73A 5GXIA 2XU7A 3SHFA 2PBIB 3W15A 4QL1A 4PXWA 2GC4A 3SXTD 4L1QD 2IWFA 3OKYA 4CI1A 3U4YA 4A2MA 4J87A 2CO0A 4JD2C 2IUVA 4U1EI 4A11B 3SBPA 3EI1B 2TRCB 3K26A 3K27A 2AQ5A 4J77A 3SFZA 4LG8A 4XEIC 2HJBA 5EALA 4HDJA 5FKQA 3FM0A 3RRMC 3J81g 4AEZA 5FKSA 4CY5A 2IAAA 2H9PA 4JT6C 4ZOXA 4H5JA 4A11A 1JJUB 3JZNA 2IURA 4ZOYA 3UKUC 2OK6A 5JWZA 1N6FA 2H6NA 2H9LA 2UZXB 3OKYB 2J57G 3DXMC 4H5IA 4AOWA 3GFCA 1P22A 3RMZD 2CE9A 4BUJC 2CE8A 3DXKC 2P9PC 1PBYB 4L9OA 3I8EA 4L3HD 2G99A 1YFQA 2G9AA 3KRWB 2AH1A 3SCYA 4JSVC 1OLZA 3CFVA 4ZOZA 4A0AB 4D0KA 2I3SA 4FA4D 3MMYA 3JRPA 4ZOVA 3UKRC 1TBGA 4E54A 2AGLA 4J79A 3RSEC 3V5WB 2BBKH 4E54B 3PXTD 1XHMA 4A0BA 5EARA 1JMXB 2CN3A 1N6DA 4O9DA 3PSCB 4O45A 4JT5C 3I7LA 3N0DA 5B4WA 2YNOA 3HFQA 1GG2B 4CZVA 2OJYA 4PC0A 5HE3B 3FGBA 1A0RB 1TYQC 3A0FA 2HJ4A 2H9MA 2B5MA 4YVDA 3JROA 3NVNA 4A2LA 4CY2A 1Q47A 3C5MA 4EWRA 3VGZA 1U4CA 4JSNC 3EI2B 3MKQA 4FHLA 1MG2A 3PE7A 3AL9A 4X60B 2H6KA 4CZXA 4E5ZB 3EG6A 3RFGA 2PM9A 2Z2PA 2OVQB 4D6VA 3C75H 3MZKA 2H6QA 4ESGA 3I7NA 4MK0B 3DM0A 3EI1A 3PXSD 3AL8A 4KFMB 5H17A 3BG1A 3L4MD 4QRJA 4IA9A 3IJCA 4J8GA 5EAPA 2HKMA 5H1MA 2I0RA 4OZUA 4E5ZA 2H13A 2J55H 5FKRA 2BCJB 4GQ2P 4FA5D 3EI4A 2B5NA 3E0CA 2EBSA 2P9UC 4X61B 4GGDA 3AFCA 3EI2A 2CNXA 3OL2A 3IJ1A 2H68A 2AH0A 2MTAH 3SWSD 4I79A 4CC9A 2Q7QA 1JOFA 5HE2B 4GQ1A 5GSAA 4Y5RD 3OW8A 1SQ9A 3L4OD 2J56H 4J82A 5FA5B 3DWLC 2B5LA 2OVPB 4XYHA 1FWXA 3SVWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N6E A;  4BH6 A;  3JB9 L;  4ERQ A;  3JZG A;  1NEX B;  2YBA A;  4CI2 A;  4BL0 A;  5TF2 A;  3C9C A;  4GM8 A;  5AFU 3;  2OVR B;  2P9S C;  4IMM A;  4GM9 A;  2XL3 A;  2O9K A;  2HES X;  3SBQ A;  4CI3 A;  2P9K C;  2P9I C;  3DSM A;  2YB8 B;  4R7A B;  3NVQ A;  1PGU A;  2IUP A;  1MG3 A;  2P9N C;  1U2V C;  3OKT A;  5I5I A;  4GGC A;  4G56 B;  1GP2 B;  3I7K A;  3RN0 D;  2AGY A;  3UR4 A;  4Z8L A;  2PM6 B;  2GC7 A;  2H3X A;  5THA A;  3I7H A;  4J78 A;  4JXM A;  1RI6 A;  2AGW A;  3JZH A;  1MDA H;  1QNI A;  5A2Q g;  2XL2 A;  3EI4 B;  4A7J A;  3ULE C;  5IGQ A;  4J81 A;  3B7F A;  3SN6 B;  3KRX B;  3RFH A;  5I5M A;  3JAM g;  3EWE A;  3EI3 A;  3UVM A;  3I89 A;  4NSX A;  3ORV D;  3BWS A;  4GZ8 A;  3ZWL B;  4O1Q D;  5H14 A;  1PI6 A;  2I0S A;  2B4E A;  1ERJ A;  3F3G A;  3JPX A;  1L0Q A;  3EU7 A;  4JSX C;  3VH0 A;  2GNQ A;  5CXC B;  3CIK B;  3I8C A;  3ODT A;  4ES0 A;  3UVL A;  2OIZ A;  4N14 A;  3J80 g;  5IJ7 E;  4OWR A;  3SJL D;  5TDH B;  2W18 A;  3SMR A;  4A09 A;  2HXC A;  5EMM B;  2IUQ A;  4QT8 A;  3EI3 B;  3PXW D;  3IKO A;  5C2V B;  5HQG A;  4TZ4 A;  4X3E A;  5AJA A;  3GRE A;  3IJ0 A;  4FAV D;  4O3T B;  3OKW A;  5K1C C;  2UZY B;  2Z2N A;  3F3F A;  4XYI A;  5HE1 B;  4X63 B;  3P4F A;  2AGZ A;  5TEE A;  4CI8 A;  5FQD A;  5K19 A;  5IJ8 E;  5EAM A;  1XKS A;  5CYK B;  3V7D B;  4A0B B;  3PVW B;  3RN1 D;  2H47 A;  5HYN B;  4PBY A;  5C9Z B;  4GM3 A;  2YMU A;  5CYK A;  4A0A A;  5EM2 A;  2I0T A;  4PSW B;  2YNN A;  4Y7R A;  4O3U B;  4A08 A;  2Z2O A;  1PEV A;  3I2N A;  4J0W A;  2I3T A;  2H14 A;  3EMH A;  4J8B A;  2H9N A;  1GXR A;  3RLM D;  1VYH C;  5FLX g;  4CY3 A;  3CFS B;  5IT9 g;  4CY1 A;  2CN2 A;  3SBR A;  2HKR A;  5CXB A;  3IIW A;  3NVX A;  2XYI A;  4PNK B;  3I7P A;  4GQB B;  4A09 B;  3OL2 B;  4CZY A;  4J0X A;  4ERY A;  4FWW A;  1B9X A;  5EMK B;  1B9Y A;  1NR0 A;  3MXX A;  5FXY A;  1SQJ A;  5CXC A;  2IWK A;  2QXV A;  3V9F A;  1K8K C;  5GXH A;  4ERZ A;  3AL8 B;  3MKS B;  3PVU B;  2PM7 B;  3F3P A;  4K3I D;  1SHY B;  3VA6 A;  3FRX A;  5EMJ B;  2PM9 B;  5I5J A;  1R5M A;  3MZL A;  4UI9 R;  4GMB A;  2AGX A;  3N0E A;  4JSP C;  3UVK A;  4QQE A;  4PBZ A;  1K32 A;  3BG0 A;  3UVN A;  1OMW B;  5CXB B;  4U7A A;  3C99 A;  3OTT A;  5GMK n;  5IC7 A;  5EML B;  1GOT B;  4FA1 D;  4LGN A;  4J84 A;  2QC5 A;  4LG9 A;  1JMZ B;  3PSL A;  3UVO A;  5TEF A;  4GGA A;  4A08 B;  5EM2 B;  3I7O A;  4PSX B;  2P9L C;  5AMS A;  5KDO B;  2OK4 A;  4K3J B;  4ZN4 A;  4FB1 D;  4FA9 D;  3IIY A;  4FAN D;  3SLE D;  4J86 A;  5C2W B;  5HE0 B;  5IGO A;  1S4U X;  4L3G D;  2HYE A;  3AH8 B;  1XIP A;  5FKT A;  2CO0 C;  5SXM A;  2YNP A;  4J73 A;  5GXI A;  2XU7 A;  3SHF A;  2PBI B;  3W15 A;  4QL1 A;  4PXW A;  2GC4 A;  3SXT D;  4L1Q D;  2IWF A;  3OKY A;  4CI1 A;  3U4Y A;  4A2M A;  4J87 A;  2CO0 A;  4JD2 C;  2IUV A;  4U1E I;  4A11 B;  3SBP A;  3EI1 B;  2TRC B;  3K26 A;  3K27 A;  2AQ5 A;  4J77 A;  3SFZ A;  4LG8 A;  4XEI C;  2HJB A;  5EAL A;  4HDJ A;  5FKQ A;  3FM0 A;  3RRM C;  3J81 g;  4AEZ A;  5FKS A;  4CY5 A;  2IAA A;  2H9P A;  4JT6 C;  4ZOX A;  4H5J A;  4A11 A;  1JJU B;  3JZN A;  2IUR A;  4ZOY A;  3UKU C;  2OK6 A;  5JWZ A;  1N6F A;  2H6N A;  2H9L A;  2UZX B;  3OKY B;  2J57 G;  3DXM C;  4H5I A;  4AOW A;  3GFC A;  1P22 A;  3RMZ D;  2CE9 A;  4BUJ C;  2CE8 A;  3DXK C;  2P9P C;  1PBY B;  4L9O A;  3I8E A;  4L3H D;  2G99 A;  1YFQ A;  2G9A A;  3KRW B;  2AH1 A;  3SCY A;  4JSV C;  1OLZ A;  3CFV A;  4ZOZ A;  4A0A B;  4D0K A;  2I3S A;  4FA4 D;  3MMY A;  3JRP A;  4ZOV A;  3UKR C;  1TBG A;  4E54 A;  2AGL A;  4J79 A;  3RSE C;  3V5W B;  2BBK H;  4E54 B;  3PXT D;  1XHM A;  4A0B A;  5EAR A;  1JMX B;  2CN3 A;  1N6D A;  4O9D A;  3PSC B;  4O45 A;  4JT5 C;  3I7L A;  3N0D A;  5B4W A;  2YNO A;  3HFQ A;  1GG2 B;  4CZV A;  2OJY A;  4PC0 A;  5HE3 B;  3FGB A;  1A0R B;  1TYQ C;  3A0F A;  2HJ4 A;  2H9M A;  2B5M A;  4YVD A;  3JRO A;  3NVN A;  4A2L A;  4CY2 A;  1Q47 A;  3C5M A;  4EWR A;  3VGZ A;  1U4C A;  4JSN C;  3EI2 B;  3MKQ A;  4FHL A;  1MG2 A;  3PE7 A;  3AL9 A;  4X60 B;  2H6K A;  4CZX A;  4E5Z B;  3EG6 A;  3RFG A;  2PM9 A;  2Z2P A;  2OVQ B;  4D6V A;  3C75 H;  3MZK A;  2H6Q A;  4ESG A;  3I7N A;  4MK0 B;  3DM0 A;  3EI1 A;  3PXS D;  3AL8 A;  4KFM B;  5H17 A;  3BG1 A;  3L4M D;  4QRJ A;  4IA9 A;  3IJC A;  4J8G A;  5EAP A;  2HKM A;  5H1M A;  2I0R A;  4OZU A;  4E5Z A;  2H13 A;  2J55 H;  5FKR A;  2BCJ B;  4GQ2 P;  4FA5 D;  3EI4 A;  2B5N A;  3E0C A;  2EBS A;  2P9U C;  4X61 B;  4GGD A;  3AFC A;  3EI2 A;  2CNX A;  3OL2 A;  3IJ1 A;  2H68 A;  2AH0 A;  2MTA H;  3SWS D;  4I79 A;  4CC9 A;  2Q7Q A;  1JOF A;  5HE2 B;  4GQ1 A;  5GSA A;  4Y5R D;  3OW8 A;  1SQ9 A;  3L4O D;  2J56 H;  4J82 A;  5FA5 B;  3DWL C;  2B5L A;  2OVP B;  4XYH A;  1FWX A;  3SVW D; 
#chains in the Genus database with same CATH topology
 2VDL A;  1N6E A;  4BH6 A;  2EIB A;  2WQ8 A;  3JB9 L;  4ERQ A;  2XE4 A;  5M5S A;  2QZP A;  1NEX B;  2YBA A;  3JZG A;  1C9I A;  4BP8 A;  2EID A;  2VDM A;  5TF2 A;  4BL0 A;  4CI2 A;  3C9C A;  4GM8 A;  5AFU 3;  2OVR B;  2P9S C;  4IMM A;  4GM9 A;  2XL3 A;  2O9K A;  2HES X;  3SBQ A;  4CI3 A;  1GOG A;  2P9K C;  2BKL A;  2P9I C;  3DSM A;  1M1X A;  2YB8 B;  4R7A B;  3NVQ A;  1PGU A;  2IUP A;  1MG3 A;  2P9N C;  1U2V C;  3OKT A;  5I5I A;  4GGC A;  4G56 B;  1GP2 B;  4QAM A;  3IUL A;  3I7K A;  3RN0 D;  2AGY A;  3UR4 A;  4Z8L A;  2VDN A;  2PM6 B;  2GC7 A;  2H3X A;  5THA A;  3I7H A;  4J78 A;  4JXM A;  1RI6 A;  2AGW A;  3JZH A;  1MDA H;  1QNI A;  5A2Q g;  3GC3 B;  2XL2 A;  3EI4 B;  4RE5 A;  4A7J A;  3ULE C;  3V4V A;  5IGQ A;  4J81 A;  3B7F A;  3SN6 B;  3KRX B;  3RFH A;  5I5M A;  3JAM g;  4UM9 A;  3EWE A;  4Z7O A;  3EI3 A;  3UVM A;  3I89 A;  4NSX A;  3ORV D;  3BWS A;  4GZ8 A;  3ZWL B;  4O1Q D;  5H14 A;  1PI6 A;  3F3G A;  2I0S A;  2B4E A;  1ERJ A;  3JPX A;  1L0Q A;  3EU7 A;  4JSX C;  3VH0 A;  2GNQ A;  3FCU A;  5CXC B;  3CIK B;  3I8C A;  3ODT A;  4ES0 A;  3UVL A;  4AMY A;  2OIZ A;  4N14 A;  3J80 g;  5IJ7 E;  1O6G A;  4G1E A;  4OWR A;  2VDQ A;  3T3P A;  1YR2 A;  3SJL D;  5TDH B;  2W18 A;  3SMR A;  5E6R A;  4A09 A;  2HXC A;  5EMM B;  2IUQ A;  4QT8 A;  3EI3 B;  4DNW A;  3PXW D;  1T2X A;  4AN1 A;  3IKO A;  5C2V B;  5HQG A;  1UTC A;  4TZ4 A;  4X3E A;  5AJA A;  2VDK A;  3GRE A;  3IJ0 A;  4FAV D;  4AN0 A;  4O3T B;  3OKW A;  5K1C C;  4NAA A;  1GOH A;  2UZY B;  2Z2N A;  3F3F A;  4XYI A;  5HE1 B;  4X63 B;  3P4F A;  2AGZ A;  5TEE A;  4CI8 A;  5FQD A;  5K19 A;  5IJ8 E;  5EAM A;  1XKS A;  5CYK B;  4G55 A;  3V7D B;  4A0B B;  1U8C A;  3PVW B;  3RN1 D;  2H47 A;  2VC2 A;  5HYN B;  4PBY A;  1QFS A;  4BP9 A;  4GM3 A;  5C9Z B;  2YMU A;  5CYK A;  3ZDZ A;  2EIC A;  2VZ3 A;  4A0A A;  1C9L A;  5EM2 A;  2I0T A;  4PSW B;  2YNN A;  4Y7R A;  4O3U B;  2XZG A;  4A08 A;  2Z2O A;  1PEV A;  3I2N A;  4J0W A;  2I3T A;  2H14 A;  3EMH A;  4J8B A;  5E6U A;  1H2Z A;  2H9N A;  3VI3 A;  5M5R A;  1GXR A;  3RLM D;  1VYH C;  5FLX g;  1A12 A;  4CY3 A;  3CFS B;  5IT9 g;  4CY1 A;  2CN2 A;  3SBR A;  2HKR A;  5CXB A;  3IIW A;  3NVX A;  2XYI A;  4PNK B;  3I7P A;  4GQB B;  3V4P A;  3OL2 B;  4A09 B;  2VDR A;  4CZY A;  4J0X A;  4WK4 A;  4ERY A;  4FWW A;  1B9X A;  5EMK B;  1B9Y A;  1GOF A;  1NR0 A;  3MXX A;  5FXY A;  1SQJ A;  5CXC A;  2IWK A;  2QXV A;  3NIF A;  2EIE A;  3V9F A;  1K8K C;  5GXH A;  4ERZ A;  3AL8 B;  1K3I A;  4MMX A;  3MKS B;  3PVU B;  2PM7 B;  2VZ1 A;  3F3P A;  4K3I D;  1SHY B;  3VA6 A;  3FRX A;  5EMJ B;  2PM9 B;  5I5J A;  1R5M A;  3K71 A;  3MZL A;  4UI9 R;  4GMB A;  3ZE0 A;  1I2M B;  2AGX A;  3N0E A;  2VDO A;  4JSP C;  3UVK A;  3ZE1 A;  5M5V A;  4QQE A;  4PBZ A;  3O4I A;  1K32 A;  1UOQ A;  3BG0 A;  3UVN A;  1JTD B;  1OMW B;  5CXB B;  4U7A A;  3VI4 A;  3C99 A;  3OTT A;  1VE7 A;  5GMK n;  5IC7 A;  3NIG A;  1GOT B;  5EML B;  4LGN A;  4FA1 D;  4J84 A;  2QC5 A;  3EQ8 A;  3MVD K;  4LG9 A;  1JMZ B;  3PSL A;  3UVO A;  5M5T A;  3KCI A;  3T3M A;  5TEF A;  1VZ2 A;  4GGA A;  4A08 B;  3ZE2 A;  4WJK A;  3DDU A;  4NEN A;  5EM2 B;  4JHN A;  3I7O A;  1E5T A;  4PSX B;  3IJE A;  3EQ7 A;  4WK2 A;  4Z7Q A;  3ZDX A;  2P9L C;  5AMS A;  5KDO B;  2OK4 A;  4K3J B;  4ZN4 A;  4FB1 D;  4FA9 D;  3IIY A;  1H2W A;  1QFM A;  4FAN D;  3SLE D;  4J86 A;  5C2W B;  5HE0 B;  3ZDY A;  4BCC A;  5IGO A;  1S4U X;  3K6S A;  4L3G D;  2HYE A;  3AH8 B;  1XIP A;  5FKT A;  1H2Y A;  2CO0 C;  5SXM A;  2YNP A;  4J73 A;  5HDB A;  5GXI A;  5M61 A;  2XU7 A;  3O4J A;  2PBI B;  3NID A;  3SHF A;  3W15 A;  4QL1 A;  4PXW A;  2GC4 A;  4BCB A;  3SXT D;  1E8M A;  3EQ9 A;  1BPO A;  2HU8 A;  2JKX A;  2IWF A;  3OKY A;  4L1Q D;  4CI1 A;  3U4Y A;  4A2M A;  1L5G A;  4J87 A;  4WK0 A;  2CO0 A;  3FCS A;  4JD2 C;  2IUV A;  4U1E I;  4A11 B;  3SBP A;  3EI1 B;  2TRC B;  3K26 A;  3K27 A;  2AQ5 A;  5C86 A;  4J77 A;  3QI0 A;  3SFZ A;  4LG8 A;  3OF7 A;  2HJB A;  4XEI C;  5EAL A;  4HDJ A;  5FKQ A;  3FM0 A;  3RRM C;  3QHY B;  1VZ3 A;  3J81 g;  4AEZ A;  3IVM A;  5FKS A;  2VDP A;  4CY5 A;  2IAA A;  4G1M A;  2H9P A;  4JT6 C;  4ZOX A;  4H5J A;  4A11 A;  1JJU B;  3JZN A;  4D9S A;  5E6S A;  2IUR A;  4ZOY A;  3UKU C;  2OK6 A;  5JWZ A;  1N6F A;  2H6N A;  4AMZ A;  2H9L A;  2UZX B;  3OKY B;  2HU7 A;  2J57 G;  3DXM C;  4H5I A;  4AOW A;  3GFC A;  1P22 A;  3RMZ D;  2CE9 A;  4BUJ C;  2CE8 A;  3DXK C;  2P9P C;  1PBY B;  4L9O A;  3I8E A;  4L3H D;  2G99 A;  1YFQ A;  2G9A A;  3KRW B;  3O4H A;  2AH1 A;  3SCY A;  4JSV C;  1OLZ A;  3CFV A;  4ZOZ A;  4A0A B;  4D0K A;  2I3S A;  4FA4 D;  3MMY A;  3JRP A;  4ZOV A;  3UKR C;  1TBG A;  4E54 A;  2AGL A;  4DNV A;  4J79 A;  3RSE C;  3V5W B;  3O4G A;  2BBK H;  4MMZ A;  3PXT D;  4E54 B;  1TYE A;  4UM8 A;  1XHM A;  4A0B A;  5EAR A;  1JMX B;  2CN3 A;  1N6D A;  4O9D A;  3PSC B;  4O45 A;  4JT5 C;  3I7L A;  4DNU A;  4MMY A;  3N0D A;  5B4W A;  2YNO A;  3HFQ A;  1GG2 B;  4CZV A;  2OJY A;  4PC0 A;  2HU5 A;  2QR5 A;  5HE3 B;  4NC4 A;  3FGB A;  1A0R B;  1TYQ C;  1H2X A;  3IUN A;  3A0F A;  4Z7N A;  2HJ4 A;  2H9M A;  5M5U A;  2B5M A;  1UOO A;  1E8N A;  4YVD A;  3JRO A;  3K72 A;  3NVN A;  4JHP C;  4A2L A;  4AX4 A;  4CY2 A;  1Q47 A;  3C5M A;  4RE6 A;  4EWR A;  3VGZ A;  1U4C A;  1JV2 A;  4JSN C;  3EI2 B;  3MKQ A;  4FHL A;  1MG2 A;  3PE7 A;  5FFO A;  3AL9 A;  4X60 B;  4BCD A;  2H6K A;  4L1M A;  4CZX A;  4E5Z B;  3EG6 A;  3RFG A;  2PM9 A;  2Z2P A;  2OVQ B;  4D6V A;  3C75 H;  3MZK A;  2H6Q A;  4ESG A;  3I7N A;  4MK0 B;  1O6F A;  3DM0 A;  3EI1 A;  3MUN A;  3PXS D;  3AL8 A;  4KFM B;  5H17 A;  3BG1 A;  3L4M D;  4QRJ A;  4IA9 A;  4O02 A;  3IJC A;  3IUJ A;  3IUQ A;  4J8G A;  5EAP A;  1UOP A;  2HKM A;  5H1M A;  2I0R A;  4OZU A;  4E5Z A;  4IRZ A;  2H13 A;  2J55 H;  5FKR A;  2BCJ B;  4GQ2 P;  4FA5 D;  5FFG A;  3EI4 A;  2B5N A;  3E0C A;  2EBS A;  2P9U C;  3IUM A;  4GGD A;  3AFC A;  4X61 B;  3EI2 A;  2CNX A;  3OL2 A;  3IJ1 A;  3GD1 I;  2H68 A;  2AH0 A;  1VE6 A;  2MTA H;  3SWS D;  4I79 A;  4CC9 A;  2Q7Q A;  2XDW A;  1JOF A;  5HE2 B;  4GQ1 A;  5C92 A;  5GSA A;  4O2W A;  4Y5R D;  3OW8 A;  1SQ9 A;  3L4O D;  2J56 H;  4J82 A;  5FA5 B;  3MUO A;  3DWL C;  2B5L A;  2OVP B;  4XYH A;  1FWX A;  3SVW D;  4NBM A;  3IUR A; 
#chains in the Genus database with same CATH homology
 1N6E A;  4BH6 A;  3JB9 L;  4ERQ A;  3JZG A;  1NEX B;  2YBA A;  4CI2 A;  4BL0 A;  5TF2 A;  3C9C A;  4GM8 A;  5AFU 3;  2OVR B;  2P9S C;  4IMM A;  4GM9 A;  2XL3 A;  2O9K A;  2HES X;  3SBQ A;  4CI3 A;  2P9K C;  2P9I C;  3DSM A;  2YB8 B;  4R7A B;  3NVQ A;  1PGU A;  2IUP A;  1MG3 A;  2P9N C;  1U2V C;  3OKT A;  5I5I A;  4GGC A;  4G56 B;  1GP2 B;  3I7K A;  3RN0 D;  2AGY A;  3UR4 A;  4Z8L A;  2PM6 B;  2GC7 A;  2H3X A;  5THA A;  3I7H A;  4J78 A;  4JXM A;  1RI6 A;  2AGW A;  3JZH A;  1MDA H;  1QNI A;  5A2Q g;  2XL2 A;  3EI4 B;  4A7J A;  3ULE C;  5IGQ A;  4J81 A;  3B7F A;  3SN6 B;  3KRX B;  3RFH A;  5I5M A;  3JAM g;  3EWE A;  3EI3 A;  3UVM A;  3I89 A;  4NSX A;  3ORV D;  3BWS A;  4GZ8 A;  3ZWL B;  4O1Q D;  5H14 A;  1PI6 A;  2I0S A;  2B4E A;  1ERJ A;  3F3G A;  3JPX A;  1L0Q A;  3EU7 A;  4JSX C;  3VH0 A;  2GNQ A;  5CXC B;  3CIK B;  3I8C A;  3ODT A;  4ES0 A;  3UVL A;  2OIZ A;  4N14 A;  3J80 g;  5IJ7 E;  4OWR A;  3SJL D;  5TDH B;  2W18 A;  3SMR A;  4A09 A;  2HXC A;  5EMM B;  2IUQ A;  4QT8 A;  3EI3 B;  3PXW D;  3IKO A;  5C2V B;  5HQG A;  4TZ4 A;  4X3E A;  5AJA A;  3GRE A;  3IJ0 A;  4FAV D;  4O3T B;  3OKW A;  5K1C C;  2UZY B;  2Z2N A;  3F3F A;  4XYI A;  5HE1 B;  4X63 B;  3P4F A;  2AGZ A;  5TEE A;  4CI8 A;  5FQD A;  5K19 A;  5IJ8 E;  5EAM A;  1XKS A;  5CYK B;  3V7D B;  4A0B B;  3PVW B;  3RN1 D;  2H47 A;  5HYN B;  4PBY A;  5C9Z B;  4GM3 A;  2YMU A;  5CYK A;  4A0A A;  5EM2 A;  2I0T A;  4PSW B;  2YNN A;  4Y7R A;  4O3U B;  4A08 A;  2Z2O A;  1PEV A;  3I2N A;  4J0W A;  2I3T A;  2H14 A;  3EMH A;  4J8B A;  2H9N A;  1GXR A;  3RLM D;  1VYH C;  5FLX g;  4CY3 A;  3CFS B;  5IT9 g;  4CY1 A;  2CN2 A;  3SBR A;  2HKR A;  5CXB A;  3IIW A;  3NVX A;  2XYI A;  4PNK B;  3I7P A;  4GQB B;  4A09 B;  3OL2 B;  4CZY A;  4J0X A;  4ERY A;  4FWW A;  1B9X A;  5EMK B;  1B9Y A;  1NR0 A;  3MXX A;  5FXY A;  1SQJ A;  5CXC A;  2IWK A;  2QXV A;  3V9F A;  1K8K C;  5GXH A;  4ERZ A;  3AL8 B;  3MKS B;  3PVU B;  2PM7 B;  3F3P A;  4K3I D;  1SHY B;  3VA6 A;  3FRX A;  5EMJ B;  2PM9 B;  5I5J A;  1R5M A;  3MZL A;  4UI9 R;  4GMB A;  2AGX A;  3N0E A;  4JSP C;  3UVK A;  4QQE A;  4PBZ A;  1K32 A;  3BG0 A;  3UVN A;  1OMW B;  5CXB B;  4U7A A;  3C99 A;  3OTT A;  5GMK n;  5IC7 A;  5EML B;  1GOT B;  4FA1 D;  4LGN A;  4J84 A;  2QC5 A;  4LG9 A;  1JMZ B;  3PSL A;  3UVO A;  5TEF A;  4GGA A;  4A08 B;  5EM2 B;  3I7O A;  4PSX B;  2P9L C;  5AMS A;  5KDO B;  2OK4 A;  4K3J B;  4ZN4 A;  4FB1 D;  4FA9 D;  3IIY A;  4FAN D;  3SLE D;  4J86 A;  5C2W B;  5HE0 B;  5IGO A;  1S4U X;  4L3G D;  2HYE A;  3AH8 B;  1XIP A;  5FKT A;  2CO0 C;  5SXM A;  2YNP A;  4J73 A;  5GXI A;  2XU7 A;  3SHF A;  2PBI B;  3W15 A;  4QL1 A;  4PXW A;  2GC4 A;  3SXT D;  4L1Q D;  2IWF A;  3OKY A;  4CI1 A;  3U4Y A;  4A2M A;  4J87 A;  2CO0 A;  4JD2 C;  2IUV A;  4U1E I;  4A11 B;  3SBP A;  3EI1 B;  2TRC B;  3K26 A;  3K27 A;  2AQ5 A;  4J77 A;  3SFZ A;  4LG8 A;  4XEI C;  2HJB A;  5EAL A;  4HDJ A;  5FKQ A;  3FM0 A;  3RRM C;  3J81 g;  4AEZ A;  5FKS A;  4CY5 A;  2IAA A;  2H9P A;  4JT6 C;  4ZOX A;  4H5J A;  4A11 A;  1JJU B;  3JZN A;  2IUR A;  4ZOY A;  3UKU C;  2OK6 A;  5JWZ A;  1N6F A;  2H6N A;  2H9L A;  2UZX B;  3OKY B;  2J57 G;  3DXM C;  4H5I A;  4AOW A;  3GFC A;  1P22 A;  3RMZ D;  2CE9 A;  4BUJ C;  2CE8 A;  3DXK C;  2P9P C;  1PBY B;  4L9O A;  3I8E A;  4L3H D;  2G99 A;  1YFQ A;  2G9A A;  3KRW B;  2AH1 A;  3SCY A;  4JSV C;  1OLZ A;  3CFV A;  4ZOZ A;  4A0A B;  4D0K A;  2I3S A;  4FA4 D;  3MMY A;  3JRP A;  4ZOV A;  3UKR C;  1TBG A;  4E54 A;  2AGL A;  4J79 A;  3RSE C;  3V5W B;  2BBK H;  4E54 B;  3PXT D;  1XHM A;  4A0B A;  5EAR A;  1JMX B;  2CN3 A;  1N6D A;  4O9D A;  3PSC B;  4O45 A;  4JT5 C;  3I7L A;  3N0D A;  5B4W A;  2YNO A;  3HFQ A;  1GG2 B;  4CZV A;  2OJY A;  4PC0 A;  5HE3 B;  3FGB A;  1A0R B;  1TYQ C;  3A0F A;  2HJ4 A;  2H9M A;  2B5M A;  4YVD A;  3JRO A;  3NVN A;  4A2L A;  4CY2 A;  1Q47 A;  3C5M A;  4EWR A;  3VGZ A;  1U4C A;  4JSN C;  3EI2 B;  3MKQ A;  4FHL A;  1MG2 A;  3PE7 A;  3AL9 A;  4X60 B;  2H6K A;  4CZX A;  4E5Z B;  3EG6 A;  3RFG A;  2PM9 A;  2Z2P A;  2OVQ B;  4D6V A;  3C75 H;  3MZK A;  2H6Q A;  4ESG A;  3I7N A;  4MK0 B;  3DM0 A;  3EI1 A;  3PXS D;  3AL8 A;  4KFM B;  5H17 A;  3BG1 A;  3L4M D;  4QRJ A;  4IA9 A;  3IJC A;  4J8G A;  5EAP A;  2HKM A;  5H1M A;  2I0R A;  4OZU A;  4E5Z A;  2H13 A;  2J55 H;  5FKR A;  2BCJ B;  4GQ2 P;  4FA5 D;  3EI4 A;  2B5N A;  3E0C A;  2EBS A;  2P9U C;  4X61 B;  4GGD A;  3AFC A;  3EI2 A;  2CNX A;  3OL2 A;  3IJ1 A;  2H68 A;  2AH0 A;  2MTA H;  3SWS D;  4I79 A;  4CC9 A;  2Q7Q A;  1JOF A;  5HE2 B;  4GQ1 A;  5GSA A;  4Y5R D;  3OW8 A;  1SQ9 A;  3L4O D;  2J56 H;  4J82 A;  5FA5 B;  3DWL C;  2B5L A;  2OVP B;  4XYH A;  1FWX A;  3SVW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...