5IC7A

Structure of the wd domain of utp18
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
365
structure length
340
Chain Sequence
b'RKLRPETIDIQRTRDIPDTHKAAISSLAFHPRYPILLSSSTSSIMYLHKLDASAYPTPNPLLTSVHVKRTDLRRAAFVGPDGGEIIFAGRRRYFHCWNLSSGLVKKVSKIQGHQKEQRTMERFRVSPCGRYMALVASDKKGGGMLNIINVGTMQWIAQARIDGRHGVADFAWWSDGNGLTIAGRDGQVTEWSMITRRTVGIWRDEGTVMALGGRNGPAELGGDRWVAIGSNSGILNVYDRNDLIEIRIKKYPTPTRVFEQLTTSISVVAFSPDGQLLAFGSQHKKDALRLVHLPSCTVYRNWPTEQTPLGRVTAIAFSSKSDVLAVGNDVGRVRLWEIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
molecule tags Structural protein
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
publication title Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits
pubmed doi rcsb
total genus 75
structure length 340
sequence length 365
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ic7A00
2GC4A 5EAPA 2O9KA 4QL1A 2CN2A 3EI3A 4XYIA 3FM0A 3OKYB 1JMXB 3UVOA 2AGLA 2YBAA 4CI1A 4K3JB 4OWRA 2PBIB 2CO0A 2OIZA 3AL8A 5HYNB 5HE1B 4X60B 4XEIC 1JMZB 1B9YA 4GQ2P 3NVNA 4UI9R 4L3HD 5CXCA 3ORVD 3EI3B 3J80g 1JJUB 2TRCB 2P9NC 3I7KA 4PC0A 3AH8B 4O3UB 1YFQA 3F3PA 3ZWLB 3MKQA 4G56B 2PM9A 4CI2A 2IURA 2P9UC 5CXBA 2I0RA 4J82A 2XL3A 5EMKB 2QXVA 3SBRA 2G9AA 5K1CC 3RMZD 4A2LA 2Z2NA 4E5ZB 2HJ4A 2IWKA 5GSAA 4GGAA 4J8BA 3V5WB 1B9XA 3BWSA 5EMMB 4GQ1A 4J81A 5FKRA 5AJAA 2XYIA 2OJYA 2YNNA 5HE0B 2HKMA 4A7JA 4J77A 4CY3A 5H17A 5IGQA 2UZXB 4YVDA 3SN6B 4QRJA 5EALA 1P22A 3CFSB 3EG6A 1N6EA 4JSXC 1SHYB 3F3GA 1MG3A 5EMJB 4CY1A 4JSPC 2B5MA 3DM0A 3E0CA 1NR0A 3MZLA 2GNQA 4JT5C 3C75H 2I0SA 4A0BB 4JSNC 3DXKC 3MMYA 2PM9B 3OTTA 5C9ZB 4D6VA 1XHMA 4IA9A 4CI3A 5C2WB 3C9CA 2Z2OA 2P9IC 4J78A 4JD2C 3VGZA 2IAAA 4L1QD 5FXYA 2CE9A 5I5JA 5GXIA 3IKOA 3EU7A 5EMLB 4CZVA 5C2VB 5THAA 3EI4B 4BH6A 5IJ7E 4JT6C 3JZNA 2B5NA 4CY5A 3OKYA 4GM3A 1U2VC 3DXMC 3SBPA 4HDJA 3ODTA 2P9LC 4O45A 3IJ1A 4PBYA 4QT8A 1MG2A 4GGDA 3IIWA 3NVXA 4I79A 2YNPA 3OKTA 5I5IA 5FKSA 2H6QA 2HJBA 3V7DB 3VA6A 5HE3B 1PBYB 2AGWA 3C5MA 3EI4A 2XL2A 1SQ9A 4R7AB 2AGXA 4X61B 2H9NA 1L0QA 3I7OA 3BG1A 3UKRC 4FHLA 3GREA 4FA1D 4FWWA 3SHFA 3I8CA 3GFCA 3V9FA 4ERQA 4J86A 3AL9A 3UVKA 3EI1A 5IC7A 3EMHA 4O9DA 2GC7A 2H13A 4LG8A 2W18A 3SXTD 4CY2A 2I3SA 4FAND 2H3XA 1QNIA 4JXMA 3UVMA 2BCJB 1OLZA 5CYKB 3RSEC 2AH0A 3JROA 2IWFA 3NVQA 2CE8A 2YB8B 1GP2B 4KFMB 3FGBA 3PXTD 4X63B 4XYHA 2G99A 1MDAH 5FLXg 1XIPA 3I8EA 5FKTA 3PE7A 3K27A 1TYQC 3JRPA 5EARA 4Y7RA 4GGCA 5GXHA 4PXWA 3SMRA 4A11A 3HFQA 2B5LA 3AL8B 2H6NA 5H1MA 2P9PC 2IUVA 4A11B 2I3TA 3JZHA 4GQBB 5AFU3 3JZGA 4ZOXA 4U7AA 3U4YA 4CI8A 3DSMA 2UZYB 1A0RB 1PI6A 4BL0A 3SJLD 3I7LA 4PSXB 3JB9L 1VYHC 4A0BA 2AH1A 5CYKA 4AEZA 3I7NA 4ZOYA 4AOWA 4ZN4A 2OVRB 3JPXA 1XKSA 5EAMA 3IJ0A 3EI1B 3OKWA 4QQEA 1K8KC 3KRWB 5I5MA 3EI2A 3PVUB 4EWRA 2H14A 3PVWB 4JSVC 2MTAH 4OZUA 1SQJA 3FRXA 3RN0D 4O3TB 2HYEA 4X3EA 4FA5D 1Q47A 2CO0C 5HE2B 4L9OA 1N6DA 1GXRA 1PGUA 5TEEA 3UR4A 3AFCA 5GMKn 3RLMD 1R5MA 3RRMC 5K19A 4CZYA 4ESGA 1OMWB 4IMMA 4A09B 4H5JA 2P9KC 3RFHA 1PEVA 1S4UX 5CXBB 3RN1D 2Q7QA 3PXSD 4ERZA 5TF2A 4A2MA 2HESX 1RI6A 2Z2PA 4A08A 3DWLC 4ERYA 4LG9A 2YMUA 4O1QD 2YNOA 3L4OD 4LGNA 5TDHB 4J8GA 5H14A 3UVNA 4CC9A 4FA4D 3SCYA 3UVLA 2QC5A 4PNKB 3PXWD 4GMBA 4MK0B 5B4WA 2IUPA 4Z8LA 4GZ8A 2HKRA 3IIYA 3SWSD 2H9LA 3I89A 1NEXB 3PSCB 4FA9D 5FKQA 4A0AA 3IJCA 2EBSA 3N0DA 2CN3A 1JOFA 3VH0A 2P9SC 4NSXA 5A2Qg 5FQDA 2B4EA 3OW8A 1N6FA 2OK6A 5IGOA 4D0KA 3OL2B 2J57G 3JAMg 1TBGA 4GM8A 3OL2A 4FB1D 3UKUC 2OVQB 2H68A 3L4MD 3BG0A 4J73A 4BUJC 2AGZA 2J55H 4TZ4A 3F3FA 2PM6B 2PM7B 5IT9g 2AQ5A 3CIKB 3PSLA 2H9MA 2XU7A 4PSWB 1GG2B 4ES0A 3RFGA 1ERJA 4E54A 4ZOZA 5IJ8E 5EM2B 2H47A 2OK4A 3CFVA 3MKSB 1FWXA 3KRXB 4H5IA 3SFZA 2HXCA 3B7FA 5EM2A 4CZXA 3ULEC 3A0FA 1GOTB 3W15A 5FA5B 2IUQA 4K3ID 4FAVD 4Y5RD 3SLED 2CNXA 4L3GD 4N14A 2AGYA 5AMSA 4A08B 5CXCB 4PBZA 3K26A 2I0TA 4GM9A 5KDOB 4ZOVA 3C99A 3SBQA 5HQGA 3N0EA 3I7PA 2H6KA 4J0XA 3EI2B 4J0WA 3SVWD 4J84A 3MZKA 3P4FA 2J56H 4U1EI 4A09A 5JWZA 2OVPB 4E5ZA 2H9PA 3I7HA 1K32A 4A0AB 5TEFA 2BBKH 4J87A 5SXMA 4E54B 3J81g 3EWEA 3I2NA 1U4CA 3MXXA 4J79A
chains in the Genus database with same CATH superfamily
2GC4A 5EAPA 2O9KA 4QL1A 2CN2A 2EICA 4JHPC 3EI3A 4XYIA 3FM0A 3OKYB 2QZPA 2XE4A 1JMXB 3UVOA 2AGLA 2YBAA 3NIFA 5FFGA 4K3JB 4OWRA 4CI1A 2PBIB 2XDWA 2CO0A 2OIZA 3AL8A 5HYNB 5HE1B 1GOGA 4X60B 4XEIC 4AMYA 1JMZB 1B9YA 4GQ2P 3NVNA 4UI9R 1T2XA 4L3HD 5CXCA 3ORVD 3EI3B 3QHYB 5C86A 3J80g 1JJUB 1E5TA 2TRCB 2P9NC 3I7KA 4NC4A 4PC0A 3O4IA 3AH8B 4O3UB 1YFQA 3T3MA 4BCDA 3F3PA 3ZWLB 3MKQA 4G56B 5M5UA 2PM9A 4CI2A 2IURA 2P9UC 5CXBA 3IUMA 2I0RA 4J82A 2XL3A 3GD1I 5EMKB 2QXVA 3SBRA 2G9AA 5K1CC 3RMZD 4A2LA 2Z2NA 4E5ZB 2HJ4A 2IWKA 5GSAA 4GGAA 4J8BA 5E6SA 3V5WB 1B9XA 3BWSA 1O6FA 1O6GA 5EMMB 4GQ1A 4JHNA 4J81A 5FKRA 3K72A 5AJAA 1I2MB 3IURA 2XYIA 2OJYA 4D9SA 3ZE1A 1BPOA 4RE6A 2HU8A 2YNNA 5HE0B 2HKMA 4A7JA 4J77A 4CY3A 5H17A 5IGQA 2UZXB 4YVDA 3SN6B 4QRJA 5EALA 1P22A 3CFSB 3IUNA 2VDMA 3EG6A 1N6EA 4JSXC 1SHYB 3F3GA 1MG3A 5EMJB 4CY1A 4JSPC 2VZ3A 2B5MA 3DM0A 3E0CA 1NR0A 3MZLA 2GNQA 1C9IA 4JT5C 3C75H 2I0SA 4A0BB 1TYEA 4JSNC 3ZDXA 3DXKC 3MMYA 2PM9B 3OTTA 5C9ZB 1M1XA 4D6VA 1XHMA 4IA9A 4CI3A 5C2WB 3C9CA 2Z2OA 2P9IC 4AN1A 4Z7OA 4J78A 4JD2C 3VGZA 2IAAA 4L1QD 1H2XA 5FXYA 3EQ9A 2CE9A 5I5JA 5GXIA 3IKOA 3EU7A 5EMLB 4CZVA 2EIDA 3OF7A 5C2VB 2VDPA 1JV2A 3EI4B 5THAA 4BH6A 5IJ7E 4JT6C 3JZNA 2B5NA 4CY5A 3EQ8A 3OKYA 4GM3A 1U8CA 1U2VC 3DXMC 3SBPA 4HDJA 3ODTA 1GOHA 2P9LC 4O45A 3IJ1A 4PBYA 4QT8A 1MG2A 1GOFA 4GGDA 3IIWA 3NVXA 4I79A 3O4HA 2YNPA 3OKTA 5I5IA 5FKSA 2H6QA 3GC3B 1QFSA 2HJBA 4G55A 3V7DB 5M5TA 3DDUA 3VA6A 2VDLA 5HE3B 4BP8A 1PBYB 2AGWA 5E6UA 3C5MA 2HU5A 3EI4A 5HDBA 2XL2A 1SQ9A 3MUOA 5M5SA 2VDKA 4R7AB 2AGXA 4X61B 2H9NA 1L0QA 3I7OA 4WK2A 3O4GA 3BG1A 4MMZA 4BCCA 3UKRC 1H2WA 4FHLA 3GREA 4FA1D 4FWWA 3SHFA 3I8CA 3GFCA 3V9FA 4ERQA 4J86A 3AL9A 3UVKA 3EI1A 4MMXA 5IC7A 3EMHA 4O9DA 2GC7A 2H13A 4LG8A 3NIGA 2W18A 3SXTD 4IRZA 2I3SA 4CY2A 4FAND 2H3XA 1VZ3A 1QNIA 4JXMA 3UVMA 2BCJB 1OLZA 4RE5A 5CYKB 3RSEC 2AH0A 3JROA 2IWFA 3ZE2A 3NVQA 2CE8A 2EIEA 2YB8B 5C92A 1GP2B 4KFMB 2VDNA 3FGBA 3PXTD 4X63B 4XYHA 2G99A 1MDAH 5FLXg 4NBMA 1XIPA 3I8EA 5FKTA 3PE7A 3FCSA 1TYQC 3K27A 3JRPA 5EARA 4Y7RA 4GGCA 5GXHA 4PXWA 3SMRA 4A11A 3HFQA 2B5LA 3AL8B 2H6NA 5H1MA 2P9PC 2IUVA 4A11B 2I3TA 1E8NA 2VC2A 3JZHA 1UOQA 3ZE0A 4GQBB 5AFU3 4BCBA 4NAAA 3JZGA 2EIBA 4ZOXA 3IULA 3MVDK 5M5RA 4U7AA 3U4YA 3FCUA 4CI8A 4NENA 3DSMA 2UZYB 1A0RB 1PI6A 4BL0A 3SJLD 3I7LA 1L5GA 4PSXB 3JB9L 1VYHC 1UOPA 4A0BA 3O4JA 2AH1A 5CYKA 4AEZA 3I7NA 4ZOYA 4AOWA 4BP9A 4ZN4A 2OVRB 3JPXA 1XKSA 5EAMA 3IJ0A 2QR5A 3EI1B 3OKWA 4QQEA 1K8KC 3KRWB 5I5MA 3EI2A 1YR2A 3EQ7A 3PVUB 2BKLA 4EWRA 4UM9A 2H14A 3PVWB 4JSVC 2MTAH 1H2ZA 1SQJA 3FRXA 4OZUA 3RN0D 4O3TB 2HYEA 4X3EA 4FA5D 1Q47A 2CO0C 5HE2B 1A12A 4L9OA 4L1MA 1N6DA 1GXRA 1PGUA 5TEEA 3UR4A 3AFCA 5GMKn 4WJKA 1R5MA 3RLMD 3RRMC 1C9LA 5K19A 4CZYA 4ESGA 1OMWB 4IMMA 4AMZA 4Z7NA 4WK4A 5FFOA 1K3IA 4DNVA 4A09B 4H5JA 2P9KC 3RFHA 1PEVA 1S4UX 5CXBB 4MMYA 3RN1D 1E8MA 1JTDB 2Q7QA 3PXSD 4ERZA 5TF2A 3K6SA 4A2MA 2HESX 4AN0A 1RI6A 2Z2PA 4A08A 3DWLC 2JKXA 4ERYA 4LG9A 2YMUA 3IVMA 3IJEA 4O1QD 2YNOA 3L4OD 4LGNA 5TDHB 2XZGA 4J8GA 5H14A 1UOOA 3UVNA 4CC9A 4FA4D 3SCYA 3UVLA 2QC5A 4PNKB 3PXWD 4GMBA 4MK0B 5B4WA 2IUPA 4Z8LA 4GZ8A 2HKRA 3K71A 4QAMA 3IIYA 3SWSD 2H9LA 2VDQA 3I89A 1NEXB 3PSCB 5E6RA 4FA9D 5FKQA 4A0AA 3IJCA 2EBSA 3N0DA 2CN3A 1JOFA 3VH0A 4O02A 2P9SC 3KCIA 4G1MA 4NSXA 5A2Qg 5FQDA 2B4EA 3OW8A 1N6FA 2OK6A 4WK0A 5IGOA 1VZ2A 4D0KA 3OL2B 2VDOA 2J57G 3JAMg 1TBGA 4GM8A 3OL2A 1VE7A 4FB1D 3UKUC 2OVQB 4DNWA 2H68A 3L4MD 3BG0A 4J73A 3ZDYA 2AGZA 4BUJC 2J55H 4TZ4A 4G1EA 3MUNA 3F3FA 2PM6B 2PM7B 5IT9g 2VDRA 3V4VA 2AQ5A 3CIKB 3PSLA 2H9MA 2XU7A 4PSWB 1QFMA 1GG2B 4ES0A 3RFGA 3V4PA 1ERJA 4E54A 4ZOZA 1H2YA 5IJ8E 2WQ8A 5EM2B 2H47A 2OK4A 3CFVA 3MKSB 4AX4A 4O2WA 1FWXA 3KRXB 4H5IA 3SFZA 2HU7A 3VI4A 2HXCA 3B7FA 5EM2A 1VE6A 4CZXA 3ULEC 3A0FA 1GOTB 5M5VA 3W15A 2VZ1A 5FA5B 2IUQA 4K3ID 4FAVD 4Y5RD 3SLED 2CNXA 3QI0A 4L3GD 4N14A 2AGYA 5AMSA 4A08B 5CXCB 4PBZA 3K26A 2I0TA 4GM9A 4UM8A 5KDOB 4ZOVA 3C99A 3SBQA 5HQGA 3N0EA 3VI3A 3NIDA 3I7PA 2H6KA 4J0XA 3ZDZA 3EI2B 3IUJA 4J0WA 3SVWD 4J84A 4DNUA 3MZKA 3P4FA 2J56H 4U1EI 4Z7QA 4A09A 5JWZA 2OVPB 4E5ZA 5M61A 2H9PA 3I7HA 1UTCA 1K32A 4A0AB 3IUQA 5TEFA 2BBKH 4J87A 5SXMA 4E54B 3J81g 3T3PA 3EWEA 3I2NA 1U4CA 3MXXA 4J79A
chains in the Genus database with same CATH topology
2GC4A 5EAPA 2O9KA 4QL1A 2CN2A 3EI3A 4XYIA 3FM0A 3OKYB 1JMXB 3UVOA 2AGLA 2YBAA 4CI1A 4K3JB 4OWRA 2PBIB 2CO0A 2OIZA 3AL8A 5HYNB 5HE1B 4X60B 4XEIC 1JMZB 1B9YA 4GQ2P 3NVNA 4UI9R 4L3HD 5CXCA 3ORVD 3EI3B 3J80g 1JJUB 2TRCB 2P9NC 3I7KA 4PC0A 3AH8B 4O3UB 1YFQA 3F3PA 3ZWLB 3MKQA 4G56B 2PM9A 4CI2A 2IURA 2P9UC 5CXBA 2I0RA 4J82A 2XL3A 5EMKB 2QXVA 3SBRA 2G9AA 5K1CC 3RMZD 4A2LA 2Z2NA 4E5ZB 2HJ4A 2IWKA 5GSAA 4GGAA 4J8BA 3V5WB 1B9XA 3BWSA 5EMMB 4GQ1A 4J81A 5FKRA 5AJAA 2XYIA 2OJYA 2YNNA 5HE0B 2HKMA 4A7JA 4J77A 4CY3A 5H17A 5IGQA 2UZXB 4YVDA 3SN6B 4QRJA 5EALA 1P22A 3CFSB 3EG6A 1N6EA 4JSXC 1SHYB 3F3GA 1MG3A 5EMJB 4CY1A 4JSPC 2B5MA 3DM0A 3E0CA 1NR0A 3MZLA 2GNQA 4JT5C 3C75H 2I0SA 4A0BB 4JSNC 3DXKC 3MMYA 2PM9B 3OTTA 5C9ZB 4D6VA 1XHMA 4IA9A 4CI3A 5C2WB 3C9CA 2Z2OA 2P9IC 4J78A 4JD2C 3VGZA 2IAAA 4L1QD 5FXYA 2CE9A 5I5JA 5GXIA 3IKOA 3EU7A 5EMLB 4CZVA 5C2VB 5THAA 3EI4B 4BH6A 5IJ7E 4JT6C 3JZNA 2B5NA 4CY5A 3OKYA 4GM3A 1U2VC 3DXMC 3SBPA 4HDJA 3ODTA 2P9LC 4O45A 3IJ1A 4PBYA 4QT8A 1MG2A 4GGDA 3IIWA 3NVXA 4I79A 2YNPA 3OKTA 5I5IA 5FKSA 2H6QA 2HJBA 3V7DB 3VA6A 5HE3B 1PBYB 2AGWA 3C5MA 3EI4A 2XL2A 1SQ9A 4R7AB 2AGXA 4X61B 2H9NA 1L0QA 3I7OA 3BG1A 3UKRC 4FHLA 3GREA 4FA1D 4FWWA 3SHFA 3I8CA 3GFCA 3V9FA 4ERQA 4J86A 3AL9A 3UVKA 3EI1A 5IC7A 3EMHA 4O9DA 2GC7A 2H13A 4LG8A 2W18A 3SXTD 4CY2A 2I3SA 4FAND 2H3XA 1QNIA 4JXMA 3UVMA 2BCJB 1OLZA 5CYKB 3RSEC 2AH0A 3JROA 2IWFA 3NVQA 2CE8A 2YB8B 1GP2B 4KFMB 3FGBA 3PXTD 4X63B 4XYHA 2G99A 1MDAH 5FLXg 1XIPA 3I8EA 5FKTA 3PE7A 3K27A 1TYQC 3JRPA 5EARA 4Y7RA 4GGCA 5GXHA 4PXWA 3SMRA 4A11A 3HFQA 2B5LA 3AL8B 2H6NA 5H1MA 2P9PC 2IUVA 4A11B 2I3TA 3JZHA 4GQBB 5AFU3 3JZGA 4ZOXA 4U7AA 3U4YA 4CI8A 3DSMA 2UZYB 1A0RB 1PI6A 4BL0A 3SJLD 3I7LA 4PSXB 3JB9L 1VYHC 4A0BA 2AH1A 5CYKA 4AEZA 3I7NA 4ZOYA 4AOWA 4ZN4A 2OVRB 3JPXA 1XKSA 5EAMA 3IJ0A 3EI1B 3OKWA 4QQEA 1K8KC 3KRWB 5I5MA 3EI2A 3PVUB 4EWRA 2H14A 3PVWB 4JSVC 2MTAH 4OZUA 1SQJA 3FRXA 3RN0D 4O3TB 2HYEA 4X3EA 4FA5D 1Q47A 2CO0C 5HE2B 4L9OA 1N6DA 1GXRA 1PGUA 5TEEA 3UR4A 3AFCA 5GMKn 3RLMD 1R5MA 3RRMC 5K19A 4CZYA 4ESGA 1OMWB 4IMMA 4A09B 4H5JA 2P9KC 3RFHA 1PEVA 1S4UX 5CXBB 3RN1D 2Q7QA 3PXSD 4ERZA 5TF2A 4A2MA 2HESX 1RI6A 2Z2PA 4A08A 3DWLC 4ERYA 4LG9A 2YMUA 4O1QD 2YNOA 3L4OD 4LGNA 5TDHB 4J8GA 5H14A 3UVNA 4CC9A 4FA4D 3SCYA 3UVLA 2QC5A 4PNKB 3PXWD 4GMBA 4MK0B 5B4WA 2IUPA 4Z8LA 4GZ8A 2HKRA 3IIYA 3SWSD 2H9LA 3I89A 1NEXB 3PSCB 4FA9D 5FKQA 4A0AA 3IJCA 2EBSA 3N0DA 2CN3A 1JOFA 3VH0A 2P9SC 4NSXA 5A2Qg 5FQDA 2B4EA 3OW8A 1N6FA 2OK6A 5IGOA 4D0KA 3OL2B 2J57G 3JAMg 1TBGA 4GM8A 3OL2A 4FB1D 3UKUC 2OVQB 2H68A 3L4MD 3BG0A 4J73A 4BUJC 2AGZA 2J55H 4TZ4A 3F3FA 2PM6B 2PM7B 5IT9g 2AQ5A 3CIKB 3PSLA 2H9MA 2XU7A 4PSWB 1GG2B 4ES0A 3RFGA 1ERJA 4E54A 4ZOZA 5IJ8E 5EM2B 2H47A 2OK4A 3CFVA 3MKSB 1FWXA 3KRXB 4H5IA 3SFZA 2HXCA 3B7FA 5EM2A 4CZXA 3ULEC 3A0FA 1GOTB 3W15A 5FA5B 2IUQA 4K3ID 4FAVD 4Y5RD 3SLED 2CNXA 4L3GD 4N14A 2AGYA 5AMSA 4A08B 5CXCB 4PBZA 3K26A 2I0TA 4GM9A 5KDOB 4ZOVA 3C99A 3SBQA 5HQGA 3N0EA 3I7PA 2H6KA 4J0XA 3EI2B 4J0WA 3SVWD 4J84A 3MZKA 3P4FA 2J56H 4U1EI 4A09A 5JWZA 2OVPB 4E5ZA 2H9PA 3I7HA 1K32A 4A0AB 5TEFA 2BBKH 4J87A 5SXMA 4E54B 3J81g 3EWEA 3I2NA 1U4CA 3MXXA 4J79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GC4 A;  5EAP A;  2O9K A;  4QL1 A;  2CN2 A;  3EI3 A;  4XYI A;  3FM0 A;  3OKY B;  1JMX B;  3UVO A;  2AGL A;  2YBA A;  4CI1 A;  4K3J B;  4OWR A;  2PBI B;  2CO0 A;  2OIZ A;  3AL8 A;  5HYN B;  5HE1 B;  4X60 B;  4XEI C;  1JMZ B;  1B9Y A;  4GQ2 P;  3NVN A;  4UI9 R;  4L3H D;  5CXC A;  3ORV D;  3EI3 B;  3J80 g;  1JJU B;  2TRC B;  2P9N C;  3I7K A;  4PC0 A;  3AH8 B;  4O3U B;  1YFQ A;  3F3P A;  3ZWL B;  3MKQ A;  4G56 B;  2PM9 A;  4CI2 A;  2IUR A;  2P9U C;  5CXB A;  2I0R A;  4J82 A;  2XL3 A;  5EMK B;  2QXV A;  3SBR A;  2G9A A;  5K1C C;  3RMZ D;  4A2L A;  2Z2N A;  4E5Z B;  2HJ4 A;  2IWK A;  5GSA A;  4GGA A;  4J8B A;  3V5W B;  1B9X A;  3BWS A;  5EMM B;  4GQ1 A;  4J81 A;  5FKR A;  5AJA A;  2XYI A;  2OJY A;  2YNN A;  5HE0 B;  2HKM A;  4A7J A;  4J77 A;  4CY3 A;  5H17 A;  5IGQ A;  2UZX B;  4YVD A;  3SN6 B;  4QRJ A;  5EAL A;  1P22 A;  3CFS B;  3EG6 A;  1N6E A;  4JSX C;  1SHY B;  3F3G A;  1MG3 A;  5EMJ B;  4CY1 A;  4JSP C;  2B5M A;  3DM0 A;  3E0C A;  1NR0 A;  3MZL A;  2GNQ A;  4JT5 C;  3C75 H;  2I0S A;  4A0B B;  4JSN C;  3DXK C;  3MMY A;  2PM9 B;  3OTT A;  5C9Z B;  4D6V A;  1XHM A;  4IA9 A;  4CI3 A;  5C2W B;  3C9C A;  2Z2O A;  2P9I C;  4J78 A;  4JD2 C;  3VGZ A;  2IAA A;  4L1Q D;  5FXY A;  2CE9 A;  5I5J A;  5GXI A;  3IKO A;  3EU7 A;  5EML B;  4CZV A;  5C2V B;  5THA A;  3EI4 B;  4BH6 A;  5IJ7 E;  4JT6 C;  3JZN A;  2B5N A;  4CY5 A;  3OKY A;  4GM3 A;  1U2V C;  3DXM C;  3SBP A;  4HDJ A;  3ODT A;  2P9L C;  4O45 A;  3IJ1 A;  4PBY A;  4QT8 A;  1MG2 A;  4GGD A;  3IIW A;  3NVX A;  4I79 A;  2YNP A;  3OKT A;  5I5I A;  5FKS A;  2H6Q A;  2HJB A;  3V7D B;  3VA6 A;  5HE3 B;  1PBY B;  2AGW A;  3C5M A;  3EI4 A;  2XL2 A;  1SQ9 A;  4R7A B;  2AGX A;  4X61 B;  2H9N A;  1L0Q A;  3I7O A;  3BG1 A;  3UKR C;  4FHL A;  3GRE A;  4FA1 D;  4FWW A;  3SHF A;  3I8C A;  3GFC A;  3V9F A;  4ERQ A;  4J86 A;  3AL9 A;  3UVK A;  3EI1 A;  5IC7 A;  3EMH A;  4O9D A;  2GC7 A;  2H13 A;  4LG8 A;  2W18 A;  3SXT D;  4CY2 A;  2I3S A;  4FAN D;  2H3X A;  1QNI A;  4JXM A;  3UVM A;  2BCJ B;  1OLZ A;  5CYK B;  3RSE C;  2AH0 A;  3JRO A;  2IWF A;  3NVQ A;  2CE8 A;  2YB8 B;  1GP2 B;  4KFM B;  3FGB A;  3PXT D;  4X63 B;  4XYH A;  2G99 A;  1MDA H;  5FLX g;  1XIP A;  3I8E A;  5FKT A;  3PE7 A;  3K27 A;  1TYQ C;  3JRP A;  5EAR A;  4Y7R A;  4GGC A;  5GXH A;  4PXW A;  3SMR A;  4A11 A;  3HFQ A;  2B5L A;  3AL8 B;  2H6N A;  5H1M A;  2P9P C;  2IUV A;  4A11 B;  2I3T A;  3JZH A;  4GQB B;  5AFU 3;  3JZG A;  4ZOX A;  4U7A A;  3U4Y A;  4CI8 A;  3DSM A;  2UZY B;  1A0R B;  1PI6 A;  4BL0 A;  3SJL D;  3I7L A;  4PSX B;  3JB9 L;  1VYH C;  4A0B A;  2AH1 A;  5CYK A;  4AEZ A;  3I7N A;  4ZOY A;  4AOW A;  4ZN4 A;  2OVR B;  3JPX A;  1XKS A;  5EAM A;  3IJ0 A;  3EI1 B;  3OKW A;  4QQE A;  1K8K C;  3KRW B;  5I5M A;  3EI2 A;  3PVU B;  4EWR A;  2H14 A;  3PVW B;  4JSV C;  2MTA H;  4OZU A;  1SQJ A;  3FRX A;  3RN0 D;  4O3T B;  2HYE A;  4X3E A;  4FA5 D;  1Q47 A;  2CO0 C;  5HE2 B;  4L9O A;  1N6D A;  1GXR A;  1PGU A;  5TEE A;  3UR4 A;  3AFC A;  5GMK n;  3RLM D;  1R5M A;  3RRM C;  5K19 A;  4CZY A;  4ESG A;  1OMW B;  4IMM A;  4A09 B;  4H5J A;  2P9K C;  3RFH A;  1PEV A;  1S4U X;  5CXB B;  3RN1 D;  2Q7Q A;  3PXS D;  4ERZ A;  5TF2 A;  4A2M A;  2HES X;  1RI6 A;  2Z2P A;  4A08 A;  3DWL C;  4ERY A;  4LG9 A;  2YMU A;  4O1Q D;  2YNO A;  3L4O D;  4LGN A;  5TDH B;  4J8G A;  5H14 A;  3UVN A;  4CC9 A;  4FA4 D;  3SCY A;  3UVL A;  2QC5 A;  4PNK B;  3PXW D;  4GMB A;  4MK0 B;  5B4W A;  2IUP A;  4Z8L A;  4GZ8 A;  2HKR A;  3IIY A;  3SWS D;  2H9L A;  3I89 A;  1NEX B;  3PSC B;  4FA9 D;  5FKQ A;  4A0A A;  3IJC A;  2EBS A;  3N0D A;  2CN3 A;  1JOF A;  3VH0 A;  2P9S C;  4NSX A;  5A2Q g;  5FQD A;  2B4E A;  3OW8 A;  1N6F A;  2OK6 A;  5IGO A;  4D0K A;  3OL2 B;  2J57 G;  3JAM g;  1TBG A;  4GM8 A;  3OL2 A;  4FB1 D;  3UKU C;  2OVQ B;  2H68 A;  3L4M D;  3BG0 A;  4J73 A;  4BUJ C;  2AGZ A;  2J55 H;  4TZ4 A;  3F3F A;  2PM6 B;  2PM7 B;  5IT9 g;  2AQ5 A;  3CIK B;  3PSL A;  2H9M A;  2XU7 A;  4PSW B;  1GG2 B;  4ES0 A;  3RFG A;  1ERJ A;  4E54 A;  4ZOZ A;  5IJ8 E;  5EM2 B;  2H47 A;  2OK4 A;  3CFV A;  3MKS B;  1FWX A;  3KRX B;  4H5I A;  3SFZ A;  2HXC A;  3B7F A;  5EM2 A;  4CZX A;  3ULE C;  3A0F A;  1GOT B;  3W15 A;  5FA5 B;  2IUQ A;  4K3I D;  4FAV D;  4Y5R D;  3SLE D;  2CNX A;  4L3G D;  4N14 A;  2AGY A;  5AMS A;  4A08 B;  5CXC B;  4PBZ A;  3K26 A;  2I0T A;  4GM9 A;  5KDO B;  4ZOV A;  3C99 A;  3SBQ A;  5HQG A;  3N0E A;  3I7P A;  2H6K A;  4J0X A;  3EI2 B;  4J0W A;  3SVW D;  4J84 A;  3MZK A;  3P4F A;  2J56 H;  4U1E I;  4A09 A;  5JWZ A;  2OVP B;  4E5Z A;  2H9P A;  3I7H A;  1K32 A;  4A0A B;  5TEF A;  2BBK H;  4J87 A;  5SXM A;  4E54 B;  3J81 g;  3EWE A;  3I2N A;  1U4C A;  3MXX A;  4J79 A; 
#chains in the Genus database with same CATH topology
 2GC4 A;  5EAP A;  2O9K A;  4QL1 A;  2CN2 A;  2EIC A;  4JHP C;  3EI3 A;  4XYI A;  3FM0 A;  3OKY B;  2QZP A;  2XE4 A;  1JMX B;  3UVO A;  2AGL A;  2YBA A;  3NIF A;  5FFG A;  4K3J B;  4OWR A;  4CI1 A;  2PBI B;  2XDW A;  2CO0 A;  2OIZ A;  3AL8 A;  5HYN B;  5HE1 B;  1GOG A;  4X60 B;  4XEI C;  4AMY A;  1JMZ B;  1B9Y A;  4GQ2 P;  3NVN A;  4UI9 R;  1T2X A;  4L3H D;  5CXC A;  3ORV D;  3EI3 B;  3QHY B;  5C86 A;  3J80 g;  1JJU B;  1E5T A;  2TRC B;  2P9N C;  3I7K A;  4NC4 A;  4PC0 A;  3O4I A;  3AH8 B;  4O3U B;  1YFQ A;  3T3M A;  4BCD A;  3F3P A;  3ZWL B;  3MKQ A;  4G56 B;  5M5U A;  2PM9 A;  4CI2 A;  2IUR A;  2P9U C;  5CXB A;  3IUM A;  2I0R A;  4J82 A;  2XL3 A;  3GD1 I;  5EMK B;  2QXV A;  3SBR A;  2G9A A;  5K1C C;  3RMZ D;  4A2L A;  2Z2N A;  4E5Z B;  2HJ4 A;  2IWK A;  5GSA A;  4GGA A;  4J8B A;  5E6S A;  3V5W B;  1B9X A;  3BWS A;  1O6F A;  1O6G A;  5EMM B;  4GQ1 A;  4JHN A;  4J81 A;  5FKR A;  3K72 A;  5AJA A;  1I2M B;  3IUR A;  2XYI A;  2OJY A;  4D9S A;  3ZE1 A;  1BPO A;  4RE6 A;  2HU8 A;  2YNN A;  5HE0 B;  2HKM A;  4A7J A;  4J77 A;  4CY3 A;  5H17 A;  5IGQ A;  2UZX B;  4YVD A;  3SN6 B;  4QRJ A;  5EAL A;  1P22 A;  3CFS B;  3IUN A;  2VDM A;  3EG6 A;  1N6E A;  4JSX C;  1SHY B;  3F3G A;  1MG3 A;  5EMJ B;  4CY1 A;  4JSP C;  2VZ3 A;  2B5M A;  3DM0 A;  3E0C A;  1NR0 A;  3MZL A;  2GNQ A;  1C9I A;  4JT5 C;  3C75 H;  2I0S A;  4A0B B;  1TYE A;  4JSN C;  3ZDX A;  3DXK C;  3MMY A;  2PM9 B;  3OTT A;  5C9Z B;  1M1X A;  4D6V A;  1XHM A;  4IA9 A;  4CI3 A;  5C2W B;  3C9C A;  2Z2O A;  2P9I C;  4AN1 A;  4Z7O A;  4J78 A;  4JD2 C;  3VGZ A;  2IAA A;  4L1Q D;  1H2X A;  5FXY A;  3EQ9 A;  2CE9 A;  5I5J A;  5GXI A;  3IKO A;  3EU7 A;  5EML B;  4CZV A;  2EID A;  3OF7 A;  5C2V B;  2VDP A;  1JV2 A;  3EI4 B;  5THA A;  4BH6 A;  5IJ7 E;  4JT6 C;  3JZN A;  2B5N A;  4CY5 A;  3EQ8 A;  3OKY A;  4GM3 A;  1U8C A;  1U2V C;  3DXM C;  3SBP A;  4HDJ A;  3ODT A;  1GOH A;  2P9L C;  4O45 A;  3IJ1 A;  4PBY A;  4QT8 A;  1MG2 A;  1GOF A;  4GGD A;  3IIW A;  3NVX A;  4I79 A;  3O4H A;  2YNP A;  3OKT A;  5I5I A;  5FKS A;  2H6Q A;  3GC3 B;  1QFS A;  2HJB A;  4G55 A;  3V7D B;  5M5T A;  3DDU A;  3VA6 A;  2VDL A;  5HE3 B;  4BP8 A;  1PBY B;  2AGW A;  5E6U A;  3C5M A;  2HU5 A;  3EI4 A;  5HDB A;  2XL2 A;  1SQ9 A;  3MUO A;  5M5S A;  2VDK A;  4R7A B;  2AGX A;  4X61 B;  2H9N A;  1L0Q A;  3I7O A;  4WK2 A;  3O4G A;  3BG1 A;  4MMZ A;  4BCC A;  3UKR C;  1H2W A;  4FHL A;  3GRE A;  4FA1 D;  4FWW A;  3SHF A;  3I8C A;  3GFC A;  3V9F A;  4ERQ A;  4J86 A;  3AL9 A;  3UVK A;  3EI1 A;  4MMX A;  5IC7 A;  3EMH A;  4O9D A;  2GC7 A;  2H13 A;  4LG8 A;  3NIG A;  2W18 A;  3SXT D;  4IRZ A;  2I3S A;  4CY2 A;  4FAN D;  2H3X A;  1VZ3 A;  1QNI A;  4JXM A;  3UVM A;  2BCJ B;  1OLZ A;  4RE5 A;  5CYK B;  3RSE C;  2AH0 A;  3JRO A;  2IWF A;  3ZE2 A;  3NVQ A;  2CE8 A;  2EIE A;  2YB8 B;  5C92 A;  1GP2 B;  4KFM B;  2VDN A;  3FGB A;  3PXT D;  4X63 B;  4XYH A;  2G99 A;  1MDA H;  5FLX g;  4NBM A;  1XIP A;  3I8E A;  5FKT A;  3PE7 A;  3FCS A;  1TYQ C;  3K27 A;  3JRP A;  5EAR A;  4Y7R A;  4GGC A;  5GXH A;  4PXW A;  3SMR A;  4A11 A;  3HFQ A;  2B5L A;  3AL8 B;  2H6N A;  5H1M A;  2P9P C;  2IUV A;  4A11 B;  2I3T A;  1E8N A;  2VC2 A;  3JZH A;  1UOQ A;  3ZE0 A;  4GQB B;  5AFU 3;  4BCB A;  4NAA A;  3JZG A;  2EIB A;  4ZOX A;  3IUL A;  3MVD K;  5M5R A;  4U7A A;  3U4Y A;  3FCU A;  4CI8 A;  4NEN A;  3DSM A;  2UZY B;  1A0R B;  1PI6 A;  4BL0 A;  3SJL D;  3I7L A;  1L5G A;  4PSX B;  3JB9 L;  1VYH C;  1UOP A;  4A0B A;  3O4J A;  2AH1 A;  5CYK A;  4AEZ A;  3I7N A;  4ZOY A;  4AOW A;  4BP9 A;  4ZN4 A;  2OVR B;  3JPX A;  1XKS A;  5EAM A;  3IJ0 A;  2QR5 A;  3EI1 B;  3OKW A;  4QQE A;  1K8K C;  3KRW B;  5I5M A;  3EI2 A;  1YR2 A;  3EQ7 A;  3PVU B;  2BKL A;  4EWR A;  4UM9 A;  2H14 A;  3PVW B;  4JSV C;  2MTA H;  1H2Z A;  1SQJ A;  3FRX A;  4OZU A;  3RN0 D;  4O3T B;  2HYE A;  4X3E A;  4FA5 D;  1Q47 A;  2CO0 C;  5HE2 B;  1A12 A;  4L9O A;  4L1M A;  1N6D A;  1GXR A;  1PGU A;  5TEE A;  3UR4 A;  3AFC A;  5GMK n;  4WJK A;  1R5M A;  3RLM D;  3RRM C;  1C9L A;  5K19 A;  4CZY A;  4ESG A;  1OMW B;  4IMM A;  4AMZ A;  4Z7N A;  4WK4 A;  5FFO A;  1K3I A;  4DNV A;  4A09 B;  4H5J A;  2P9K C;  3RFH A;  1PEV A;  1S4U X;  5CXB B;  4MMY A;  3RN1 D;  1E8M A;  1JTD B;  2Q7Q A;  3PXS D;  4ERZ A;  5TF2 A;  3K6S A;  4A2M A;  2HES X;  4AN0 A;  1RI6 A;  2Z2P A;  4A08 A;  3DWL C;  2JKX A;  4ERY A;  4LG9 A;  2YMU A;  3IVM A;  3IJE A;  4O1Q D;  2YNO A;  3L4O D;  4LGN A;  5TDH B;  2XZG A;  4J8G A;  5H14 A;  1UOO A;  3UVN A;  4CC9 A;  4FA4 D;  3SCY A;  3UVL A;  2QC5 A;  4PNK B;  3PXW D;  4GMB A;  4MK0 B;  5B4W A;  2IUP A;  4Z8L A;  4GZ8 A;  2HKR A;  3K71 A;  4QAM A;  3IIY A;  3SWS D;  2H9L A;  2VDQ A;  3I89 A;  1NEX B;  3PSC B;  5E6R A;  4FA9 D;  5FKQ A;  4A0A A;  3IJC A;  2EBS A;  3N0D A;  2CN3 A;  1JOF A;  3VH0 A;  4O02 A;  2P9S C;  3KCI A;  4G1M A;  4NSX A;  5A2Q g;  5FQD A;  2B4E A;  3OW8 A;  1N6F A;  2OK6 A;  4WK0 A;  5IGO A;  1VZ2 A;  4D0K A;  3OL2 B;  2VDO A;  2J57 G;  3JAM g;  1TBG A;  4GM8 A;  3OL2 A;  1VE7 A;  4FB1 D;  3UKU C;  2OVQ B;  4DNW A;  2H68 A;  3L4M D;  3BG0 A;  4J73 A;  3ZDY A;  2AGZ A;  4BUJ C;  2J55 H;  4TZ4 A;  4G1E A;  3MUN A;  3F3F A;  2PM6 B;  2PM7 B;  5IT9 g;  2VDR A;  3V4V A;  2AQ5 A;  3CIK B;  3PSL A;  2H9M A;  2XU7 A;  4PSW B;  1QFM A;  1GG2 B;  4ES0 A;  3RFG A;  3V4P A;  1ERJ A;  4E54 A;  4ZOZ A;  1H2Y A;  5IJ8 E;  2WQ8 A;  5EM2 B;  2H47 A;  2OK4 A;  3CFV A;  3MKS B;  4AX4 A;  4O2W A;  1FWX A;  3KRX B;  4H5I A;  3SFZ A;  2HU7 A;  3VI4 A;  2HXC A;  3B7F A;  5EM2 A;  1VE6 A;  4CZX A;  3ULE C;  3A0F A;  1GOT B;  5M5V A;  3W15 A;  2VZ1 A;  5FA5 B;  2IUQ A;  4K3I D;  4FAV D;  4Y5R D;  3SLE D;  2CNX A;  3QI0 A;  4L3G D;  4N14 A;  2AGY A;  5AMS A;  4A08 B;  5CXC B;  4PBZ A;  3K26 A;  2I0T A;  4GM9 A;  4UM8 A;  5KDO B;  4ZOV A;  3C99 A;  3SBQ A;  5HQG A;  3N0E A;  3VI3 A;  3NID A;  3I7P A;  2H6K A;  4J0X A;  3ZDZ A;  3EI2 B;  3IUJ A;  4J0W A;  3SVW D;  4J84 A;  4DNU A;  3MZK A;  3P4F A;  2J56 H;  4U1E I;  4Z7Q A;  4A09 A;  5JWZ A;  2OVP B;  4E5Z A;  5M61 A;  2H9P A;  3I7H A;  1UTC A;  1K32 A;  4A0A B;  3IUQ A;  5TEF A;  2BBK H;  4J87 A;  5SXM A;  4E54 B;  3J81 g;  3T3P A;  3EWE A;  3I2N A;  1U4C A;  3MXX A;  4J79 A; 
#chains in the Genus database with same CATH homology
 2GC4 A;  5EAP A;  2O9K A;  4QL1 A;  2CN2 A;  3EI3 A;  4XYI A;  3FM0 A;  3OKY B;  1JMX B;  3UVO A;  2AGL A;  2YBA A;  4CI1 A;  4K3J B;  4OWR A;  2PBI B;  2CO0 A;  2OIZ A;  3AL8 A;  5HYN B;  5HE1 B;  4X60 B;  4XEI C;  1JMZ B;  1B9Y A;  4GQ2 P;  3NVN A;  4UI9 R;  4L3H D;  5CXC A;  3ORV D;  3EI3 B;  3J80 g;  1JJU B;  2TRC B;  2P9N C;  3I7K A;  4PC0 A;  3AH8 B;  4O3U B;  1YFQ A;  3F3P A;  3ZWL B;  3MKQ A;  4G56 B;  2PM9 A;  4CI2 A;  2IUR A;  2P9U C;  5CXB A;  2I0R A;  4J82 A;  2XL3 A;  5EMK B;  2QXV A;  3SBR A;  2G9A A;  5K1C C;  3RMZ D;  4A2L A;  2Z2N A;  4E5Z B;  2HJ4 A;  2IWK A;  5GSA A;  4GGA A;  4J8B A;  3V5W B;  1B9X A;  3BWS A;  5EMM B;  4GQ1 A;  4J81 A;  5FKR A;  5AJA A;  2XYI A;  2OJY A;  2YNN A;  5HE0 B;  2HKM A;  4A7J A;  4J77 A;  4CY3 A;  5H17 A;  5IGQ A;  2UZX B;  4YVD A;  3SN6 B;  4QRJ A;  5EAL A;  1P22 A;  3CFS B;  3EG6 A;  1N6E A;  4JSX C;  1SHY B;  3F3G A;  1MG3 A;  5EMJ B;  4CY1 A;  4JSP C;  2B5M A;  3DM0 A;  3E0C A;  1NR0 A;  3MZL A;  2GNQ A;  4JT5 C;  3C75 H;  2I0S A;  4A0B B;  4JSN C;  3DXK C;  3MMY A;  2PM9 B;  3OTT A;  5C9Z B;  4D6V A;  1XHM A;  4IA9 A;  4CI3 A;  5C2W B;  3C9C A;  2Z2O A;  2P9I C;  4J78 A;  4JD2 C;  3VGZ A;  2IAA A;  4L1Q D;  5FXY A;  2CE9 A;  5I5J A;  5GXI A;  3IKO A;  3EU7 A;  5EML B;  4CZV A;  5C2V B;  5THA A;  3EI4 B;  4BH6 A;  5IJ7 E;  4JT6 C;  3JZN A;  2B5N A;  4CY5 A;  3OKY A;  4GM3 A;  1U2V C;  3DXM C;  3SBP A;  4HDJ A;  3ODT A;  2P9L C;  4O45 A;  3IJ1 A;  4PBY A;  4QT8 A;  1MG2 A;  4GGD A;  3IIW A;  3NVX A;  4I79 A;  2YNP A;  3OKT A;  5I5I A;  5FKS A;  2H6Q A;  2HJB A;  3V7D B;  3VA6 A;  5HE3 B;  1PBY B;  2AGW A;  3C5M A;  3EI4 A;  2XL2 A;  1SQ9 A;  4R7A B;  2AGX A;  4X61 B;  2H9N A;  1L0Q A;  3I7O A;  3BG1 A;  3UKR C;  4FHL A;  3GRE A;  4FA1 D;  4FWW A;  3SHF A;  3I8C A;  3GFC A;  3V9F A;  4ERQ A;  4J86 A;  3AL9 A;  3UVK A;  3EI1 A;  5IC7 A;  3EMH A;  4O9D A;  2GC7 A;  2H13 A;  4LG8 A;  2W18 A;  3SXT D;  4CY2 A;  2I3S A;  4FAN D;  2H3X A;  1QNI A;  4JXM A;  3UVM A;  2BCJ B;  1OLZ A;  5CYK B;  3RSE C;  2AH0 A;  3JRO A;  2IWF A;  3NVQ A;  2CE8 A;  2YB8 B;  1GP2 B;  4KFM B;  3FGB A;  3PXT D;  4X63 B;  4XYH A;  2G99 A;  1MDA H;  5FLX g;  1XIP A;  3I8E A;  5FKT A;  3PE7 A;  3K27 A;  1TYQ C;  3JRP A;  5EAR A;  4Y7R A;  4GGC A;  5GXH A;  4PXW A;  3SMR A;  4A11 A;  3HFQ A;  2B5L A;  3AL8 B;  2H6N A;  5H1M A;  2P9P C;  2IUV A;  4A11 B;  2I3T A;  3JZH A;  4GQB B;  5AFU 3;  3JZG A;  4ZOX A;  4U7A A;  3U4Y A;  4CI8 A;  3DSM A;  2UZY B;  1A0R B;  1PI6 A;  4BL0 A;  3SJL D;  3I7L A;  4PSX B;  3JB9 L;  1VYH C;  4A0B A;  2AH1 A;  5CYK A;  4AEZ A;  3I7N A;  4ZOY A;  4AOW A;  4ZN4 A;  2OVR B;  3JPX A;  1XKS A;  5EAM A;  3IJ0 A;  3EI1 B;  3OKW A;  4QQE A;  1K8K C;  3KRW B;  5I5M A;  3EI2 A;  3PVU B;  4EWR A;  2H14 A;  3PVW B;  4JSV C;  2MTA H;  4OZU A;  1SQJ A;  3FRX A;  3RN0 D;  4O3T B;  2HYE A;  4X3E A;  4FA5 D;  1Q47 A;  2CO0 C;  5HE2 B;  4L9O A;  1N6D A;  1GXR A;  1PGU A;  5TEE A;  3UR4 A;  3AFC A;  5GMK n;  3RLM D;  1R5M A;  3RRM C;  5K19 A;  4CZY A;  4ESG A;  1OMW B;  4IMM A;  4A09 B;  4H5J A;  2P9K C;  3RFH A;  1PEV A;  1S4U X;  5CXB B;  3RN1 D;  2Q7Q A;  3PXS D;  4ERZ A;  5TF2 A;  4A2M A;  2HES X;  1RI6 A;  2Z2P A;  4A08 A;  3DWL C;  4ERY A;  4LG9 A;  2YMU A;  4O1Q D;  2YNO A;  3L4O D;  4LGN A;  5TDH B;  4J8G A;  5H14 A;  3UVN A;  4CC9 A;  4FA4 D;  3SCY A;  3UVL A;  2QC5 A;  4PNK B;  3PXW D;  4GMB A;  4MK0 B;  5B4W A;  2IUP A;  4Z8L A;  4GZ8 A;  2HKR A;  3IIY A;  3SWS D;  2H9L A;  3I89 A;  1NEX B;  3PSC B;  4FA9 D;  5FKQ A;  4A0A A;  3IJC A;  2EBS A;  3N0D A;  2CN3 A;  1JOF A;  3VH0 A;  2P9S C;  4NSX A;  5A2Q g;  5FQD A;  2B4E A;  3OW8 A;  1N6F A;  2OK6 A;  5IGO A;  4D0K A;  3OL2 B;  2J57 G;  3JAM g;  1TBG A;  4GM8 A;  3OL2 A;  4FB1 D;  3UKU C;  2OVQ B;  2H68 A;  3L4M D;  3BG0 A;  4J73 A;  4BUJ C;  2AGZ A;  2J55 H;  4TZ4 A;  3F3F A;  2PM6 B;  2PM7 B;  5IT9 g;  2AQ5 A;  3CIK B;  3PSL A;  2H9M A;  2XU7 A;  4PSW B;  1GG2 B;  4ES0 A;  3RFG A;  1ERJ A;  4E54 A;  4ZOZ A;  5IJ8 E;  5EM2 B;  2H47 A;  2OK4 A;  3CFV A;  3MKS B;  1FWX A;  3KRX B;  4H5I A;  3SFZ A;  2HXC A;  3B7F A;  5EM2 A;  4CZX A;  3ULE C;  3A0F A;  1GOT B;  3W15 A;  5FA5 B;  2IUQ A;  4K3I D;  4FAV D;  4Y5R D;  3SLE D;  2CNX A;  4L3G D;  4N14 A;  2AGY A;  5AMS A;  4A08 B;  5CXC B;  4PBZ A;  3K26 A;  2I0T A;  4GM9 A;  5KDO B;  4ZOV A;  3C99 A;  3SBQ A;  5HQG A;  3N0E A;  3I7P A;  2H6K A;  4J0X A;  3EI2 B;  4J0W A;  3SVW D;  4J84 A;  3MZK A;  3P4F A;  2J56 H;  4U1E I;  4A09 A;  5JWZ A;  2OVP B;  4E5Z A;  2H9P A;  3I7H A;  1K32 A;  4A0A B;  5TEF A;  2BBK H;  4J87 A;  5SXM A;  4E54 B;  3J81 g;  3EWE A;  3I2N A;  1U4C A;  3MXX A;  4J79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...