5IC7A

Structure of the wd domain of utp18
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
365
structure length
340
Chain Sequence
RKLRPETIDIQRTRDIPDTHKAAISSLAFHPRYPILLSSSTSSIMYLHKLDASAYPTPNPLLTSVHVKRTDLRRAAFVGPDGGEIIFAGRRRYFHCWNLSSGLVKKVSKIQGHQKEQRTMERFRVSPCGRYMALVASDKKGGGMLNIINVGTMQWIAQARIDGRHGVADFAWWSDGNGLTIAGRDGQVTEWSMITRRTVGIWRDEGTVMALGGRNGPAELGGDRWVAIGSNSGILNVYDRNDLIEIRIKKYPTPTRVFEQLTTSISVVAFSPDGQLLAFGSQHKKDALRLVHLPSCTVYRNWPTEQTPLGRVTAIAFSSKSDVLAVGNDVGRVRLWEIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Integrative structural analysis of the UTPB complex, an early assembly factor for eukaryotic small ribosomal subunits
pubmed doi rcsb
source organism Chaetomium thermophilum (strain dsm 1495 / cbs 144.50 / imi 039719)
molecule tags Structural protein
total genus 75
structure length 340
sequence length 365
ec nomenclature
pdb deposition date 2016-02-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5ic7A00
2TRCB 3SBQA 3RMZD 2CE9A 3IJ1A 4CY3A 3EI1A 4BUJC 4PC0A 5EALA 5HYNB 4GZ8A 5AJAA 4PBYA 3PXSD 3IIYA 3MKQA 4JXMA 5TF2A 3B7FA 5HE2B 1A0RB 3RFGA 3EWEA 4J73A 5GMKn 3SWSD 1MDAH 2H9MA 1ERJA 1L0QA 2AH1A 3OW8A 1K32A 4JSXC 1GG2B 2H68A 2P9LC 5AMSA 2I3TA 1S4UX 2I3SA 1RI6A 2XU7A 3CFSB 3IKOA 2OJYA 3AH8B 2HYEA 2H3XA 4GGDA 4CZVA 4JSNC 2BBKH 3IJCA 3OTTA 1U4CA 4O1QD 4OZUA 4CI8A 4U1EI 2YBAA 4FA1D 2W18A 3OKYB 4FA5D 3PVWB 4Y7RA 4GM8A 5EAPA 2I0RA 3C5MA 5IJ8E 5H14A 2BCJB 5A2Qg 3RN1D 2YB8B 4Z8LA 2GC7A 1NEXB 5FLXg 5FKQA 1P22A 4IMMA 5AFU3 5EMMB 3NVNA 2G9AA 4OWRA 4ZN4A 2P9NC 4PXWA 5C2WB 4GM3A 1NR0A 4GQBB 4JT5C 4FHLA 2HESX 4J82A 3CIKB 3AFCA 2H47A 3I7OA 3JB9L 3F3PA 4A0AA 4EWRA 5IC7A 4K3ID 3NVQA 2B5NA 4G56B 4L9OA 4IA9A 3E0CA 3L4OD 1OLZA 2AH0A 5CYKA 4PSWB 2CO0A 2HKMA 3IJ0A 4LGNA 2IUQA 3I7HA 4A08A 3EMHA 1MG3A 5K19A 3NVXA 5GXHA 4KFMB 2P9SC 4FAND 2B4EA 3I8EA 5CXBB 5CXCA 4UI9R 3I7KA 4H5JA 5EMLB 3UVKA 3V7DB 2H9NA 5FXYA 3AL8B 3SCYA 3BG1A 1K8KC 4ESGA 2Z2OA 5FQDA 2I0TA 5FKSA 3VGZA 4A0BA 2O9KA 2IURA 2H14A 5SXMA 4Y5RD 3I7NA 1OMWB 3SN6B 2H6QA 5I5JA 4D0KA 2PM9B 2H13A 3RFHA 2CO0C 5HE1B 1QNIA 3I7PA 4O9DA 3DM0A 3N0EA 4JSVC 3EI4B 4GM9A 4O3TB 2AGYA 2CE8A 5B4WA 3RLMD 3ORVD 3EG6A 1FWXA 3MZKA 4A09B 2QXVA 4E54A 3UKUC 2OK4A 4ERYA 1GOTB 3SHFA 2H6KA 5EMKB 3OL2B 4GQ1A 4PSXB 3DXMC 3RSEC 2CNXA 2XL3A 4ZOYA 4U7AA 2YNNA 3JZHA 3BG0A 3KRXB 3MZLA 3MKSB 4A2LA 2PM6B 4E5ZA 2OVPB 1PI6A 3DSMA 4FA9D 1PEVA 3JRPA 5EM2B 2UZYB 2HJBA 2YNPA 4J77A 4QQEA 4GMBA 4CZYA 4X60B 2AGWA 4JD2C 2HXCA 4L3GD 4FB1D 1N6DA 2UZXB 4J8BA 5JWZA 3RRMC 2P9KC 3BWSA 3EI2B 5HQGA 4A11B 1SHYB 1B9YA 2AGLA 5C2VB 5GSAA 1SQ9A 3EI3B 4O45A 5EARA 3PVUB 1TYQC 2H9PA 3FM0A 4X61B 3ZWLB 2YMUA 3KRWB 3PE7A 2MTAH 4GQ2P 5EMJB 1N6FA 5I5MA 3GREA 4LG9A 1XIPA 2B5MA 5H1MA 2PBIB 4CY1A 5TEEA 2CN3A 2OIZA 2XL2A 3OKYA 1VYHC 3RN0D 2OVQB 4QRJA 1XHMA 2I0SA 4AOWA 2YNOA 4J84A 3SLED 3EI1B 2EBSA 2J56H 4CY5A 1YFQA 2IUVA 1TBGA 4QT8A 4MK0B 3I7LA 5FKRA 2IAAA 3K26A 2IUPA 3ODTA 3PXWD 3PXTD 1JMXB 3JROA 4L3HD 3UVMA 4FAVD 3UVNA 3UKRC 5TEFA 4E54B 1JMZB 3UVOA 5EAMA 2GNQA 5H17A 3SVWD 3W15A 4CZXA 3V5WB 3P4FA 2G99A 4N14A 2P9PC 4FA4D 1B9XA 2AGZA 1XKSA 4JT6C 2Z2PA 3CFVA 2H6NA 4J81A 1SQJA 3MMYA 4PNKB 3GFCA 1PBYB 5IGQA 3L4MD 3C99A 1PGUA 4J87A 4GGAA 5CXBA 3K27A 4H5IA 3FRXA 2H9LA 2AGXA 3AL8A 2J55H 4CI1A 4A2MA 3N0DA 4BH6A 4TZ4A 3I2NA 1GXRA 1MG2A 3I89A 4NSXA 3C9CA 4ERQA 2Z2NA 4FWWA 4A0AB 2PM9A 5C9ZB 4ERZA 3VA6A 1U2VC 3J81g 4J78A 3JZNA 5IJ7E 4R7AB 2IWKA 5I5IA 4D6VA 2PM7B 3JAMg 5CYKB 5IGOA 2P9IC 3EI4A 4XYHA 3DXKC 4J0WA 2GC4A 3J80g 5GXIA 4J86A 4PBZA 3OKWA 3AL9A 4A08B 5K1CC 4X3EA 4ES0A 4K3JB 4A09A 3PSLA 1JJUB 4YVDA 3OKTA 4BL0A 3SBRA 2HJ4A 3I8CA 3OL2A 4LG8A 5CXCB 3SMRA 3A0FA 3UVLA 2Q7QA 2B5LA 4CC9A 2J57G 3C75H 3F3GA 4A0BB 3FGBA 4XEIC 3SBPA 5HE3B 4J0XA 2XYIA 5EM2A 5HE0B 3DWLC 3SJLD 3SXTD 5THAA 2IWFA 4X63B 4ZOXA 3VH0A 4O3UB 4I79A 2P9UC 4GGCA 4ZOZA 2AQ5A 3JZGA 5KDOB 3ULEC 4AEZA 2HKRA 3EI2A 4CI3A 4CY2A 4A11A 4A7JA 4ZOVA 1Q47A 1GP2B 4XYIA 3UR4A 4J79A 3EI3A 3V9FA 2OVRB 1JOFA 1N6EA 5FA5B 5FKTA 1R5MA 3HFQA 3JPXA 3SFZA 5IT9g 2CN2A 3PSCB 3U4YA 2OK6A 3F3FA 5TDHB 4HDJA 4E5ZB 4QL1A 4J8GA 3EU7A 4CI2A 2QC5A 3IIWA 3MXXA 4L1QD 4JSPC
chains in the Genus database with same CATH superfamily
3K72A 3GD1I 3ZE1A 2TRCB 3SBQA 3RMZD 5E6SA 1K3IA 2CE9A 3IJ1A 4CY3A 1VE6A 3EI1A 4BUJC 4PC0A 5EALA 5HYNB 4GZ8A 5AJAA 4PBYA 4NBMA 4L1MA 3PXSD 3IIYA 3MKQA 4JXMA 5TF2A 3B7FA 5HE2B 1A0RB 3RFGA 1VE7A 3EWEA 4J73A 4BCBA 3ZE0A 5GMKn 1GOFA 3SWSD 2XZGA 1MDAH 2H9MA 1ERJA 1L0QA 2AH1A 3OW8A 4JHNA 1K32A 4JSXC 1GG2B 2H68A 2P9LC 5AMSA 2I3TA 1S4UX 2I3SA 1RI6A 2XU7A 3CFSB 3ZDYA 3IKOA 2OJYA 3AH8B 2HYEA 3IUJA 4BP9A 2H3XA 4GGDA 4CZVA 4JSNC 2EIDA 2BBKH 3IJCA 3OTTA 1U4CA 4O1QD 4OZUA 3IJEA 3O4HA 4CI8A 1VZ2A 4U1EI 2YBAA 4FA1D 2W18A 3OKYB 4FA5D 3PVWB 2VDLA 4Y7RA 4GM8A 5EAPA 2I0RA 3C5MA 5IJ8E 5H14A 4BCDA 2BCJB 2JKXA 5A2Qg 5FFGA 3RN1D 2YB8B 4Z8LA 2EICA 2GC7A 1NEXB 5FLXg 5FKQA 1P22A 4IMMA 5AFU3 5EMMB 3NVNA 2G9AA 2VDQA 4OWRA 3IUNA 4ZN4A 2HU7A 2P9NC 4PXWA 5C2WB 1E8MA 4GM3A 1NR0A 4GQBB 4JT5C 4FHLA 2HESX 4J82A 3CIKB 3AFCA 2H47A 3I7OA 3JB9L 3F3PA 4A0AA 2VC2A 4EWRA 5IC7A 4K3ID 3NVQA 2B5NA 4G56B 4WK2A 4L9OA 4IA9A 2BKLA 3E0CA 3L4OD 1OLZA 2AH0A 5CYKA 4PSWB 2CO0A 2HKMA 3IJ0A 4LGNA 5HDBA 2IUQA 3I7HA 4A08A 3EMHA 1JTDB 1MG3A 5K19A 4WJKA 3NVXA 5GXHA 4KFMB 2P9SC 5M5TA 4FAND 2B4EA 3I8EA 5CXBB 5CXCA 4UI9R 2VDOA 4AMZA 4AN0A 3I7KA 4H5JA 5EMLB 3UVKA 4WK4A 3V7DB 2H9NA 5FXYA 3AL8B 3SCYA 3BG1A 1K8KC 4ESGA 2Z2OA 5FQDA 2I0TA 5FKSA 3VGZA 4A0BA 2O9KA 2IURA 2H14A 5SXMA 1M1XA 4Y5RD 3I7NA 1OMWB 3SN6B 2H6QA 5I5JA 4D0KA 2PM9B 2H13A 3RFHA 2VDNA 2CO0C 5HE1B 4IRZA 1QNIA 3I7PA 4O9DA 3DM0A 3N0EA 4JSVC 3EI4B 4GM9A 4O3TB 2AGYA 2CE8A 5B4WA 3RLMD 3ORVD 3EG6A 3VI4A 1FWXA 3MZKA 4BCCA 2QXVA 2EIBA 5M5VA 4A09B 2VDPA 5M61A 3UKUC 4E54A 2OK4A 4ERYA 1GOTB 3SHFA 2H6KA 5EMKB 3OL2B 4GQ1A 4PSXB 4UM9A 3DXMC 3RSEC 2CNXA 2XL3A 4ZOYA 4U7AA 3O4JA 1H2YA 2YNNA 3JZHA 3BG0A 3KRXB 3V4VA 3MZLA 3MKSB 1BPOA 1UOOA 4A2LA 2PM6B 4E5ZA 2OVPB 2VDRA 4AX4A 3O4IA 1PI6A 3DSMA 4FA9D 1PEVA 3JRPA 5EM2B 1GOGA 2UZYB 2HJBA 5C86A 2YNPA 4J77A 4QQEA 4GMBA 4CZYA 5E6RA 4X60B 3EQ7A 4MMYA 2AGWA 4JD2C 2HXCA 3ZDXA 4L3GD 4FB1D 1N6DA 2UZXB 4J8BA 5JWZA 4DNUA 3RRMC 2P9KC 3BWSA 3MVDK 3EI2B 5HQGA 3ZDZA 4A11B 1QFMA 2XDWA 4AN1A 1SHYB 2AGLA 1B9YA 3VI3A 5C2VB 5GSAA 1SQ9A 3EI3B 4O45A 5EARA 3PVUB 5FFOA 1TYQC 2H9PA 3FM0A 4X61B 1UTCA 3ZWLB 2YMUA 3KRWB 3PE7A 1H2WA 2MTAH 3IUQA 4GQ2P 5EMJB 1N6FA 5I5MA 3GREA 4LG9A 1C9LA 1XIPA 2B5MA 3QI0A 5H1MA 1H2ZA 2PBIB 4CY1A 4O2WA 3FCUA 5TEEA 1JV2A 2CN3A 2OIZA 2XL2A 3DDUA 3OKYA 1VYHC 3RN0D 2EIEA 1H2XA 1GOHA 1UOQA 4QRJA 2OVQB 1XHMA 2I0SA 4WK0A 2YNOA 3IVMA 4J84A 4AOWA 3SLED 3EI1B 1YR2A 2EBSA 2J56H 4CY5A 1YFQA 2IUVA 1TBGA 3IURA 4QT8A 4MK0B 3I7LA 5FKRA 2IAAA 3K26A 5M5SA 2IUPA 3EQ8A 3ODTA 3PXWD 3PXTD 1JMXB 3JROA 4L3HD 3UVMA 4FAVD 3UVNA 4BP8A 4D9SA 3UKRC 5TEFA 4E54B 1JMZB 3UVOA 5M5RA 5EAMA 2GNQA 5H17A 1O6GA 4G55A 2VDMA 3SVWD 3W15A 4CZXA 3V5WB 3T3PA 1VZ3A 3P4FA 2G99A 4N14A 2P9PC 3NIFA 3K71A 4FA4D 1U8CA 1B9XA 2WQ8A 2AGZA 1XKSA 4JT6C 2Z2PA 3CFVA 2H6NA 4J81A 1SQJA 3MMYA 4PNKB 1E8NA 3GFCA 1PBYB 5IGQA 3ZE2A 3L4MD 4QAMA 3C99A 1PGUA 1QFSA 4J87A 3EQ9A 4GGAA 5CXBA 3K27A 4H5IA 3FRXA 2H9LA 2AGXA 1L5GA 2QR5A 3AL8A 2J55H 4CI1A 4A2MA 3N0DA 4BH6A 4TZ4A 3I2NA 2QZPA 1GXRA 1MG2A 3I89A 4NSXA 3C9CA 3K6SA 4ERQA 2Z2NA 4FWWA 4A0AB 2PM9A 5C9ZB 4ERZA 3VA6A 1U2VC 3J81g 4J78A 3JZNA 5IJ7E 4R7AB 4MMXA 2IWKA 4NAAA 4DNVA 5I5IA 1O6FA 4D6VA 2PM7B 4RE5A 3JAMg 5CYKB 5IGOA 1TYEA 2P9IC 3EI4A 4XYHA 4DNWA 3DXKC 4J0WA 2GC4A 2VZ1A 3J80g 5GXIA 3NIDA 4J86A 4PBZA 3OKWA 3AL9A 4A08B 1E5TA 5K1CC 4X3EA 4ES0A 4K3JB 4A09A 3PSLA 1JJUB 3O4GA 4YVDA 3OKTA 3GC3B 4BL0A 4Z7NA 3SBRA 2HJ4A 4NENA 3I8CA 3OL2A 4LG8A 5CXCB 3SMRA 3A0FA 3UVLA 2VDKA 2Q7QA 4G1EA 2B5LA 4CC9A 2J57G 3C75H 3NIGA 4UM8A 3F3GA 4A0BB 3FGBA 4XEIC 3SBPA 3KCIA 5C92A 5HE3B 4J0XA 4AMYA 2XYIA 3QHYB 5EM2A 5HE0B 2HU8A 4NC4A 3DWLC 3SJLD 3SXTD 3V4PA 3IUMA 3MUNA 5THAA 2IWFA 4X63B 4ZOXA 3VH0A 4O3UB 4I79A 4RE6A 2P9UC 4GGCA 1C9IA 4ZOZA 1T2XA 2AQ5A 3JZGA 5KDOB 3ULEC 4AEZA 3MUOA 2HKRA 4MMZA 3EI2A 4CI3A 4CY2A 3OF7A 4A11A 4A7JA 1UOPA 4JHPC 4ZOVA 1Q47A 1GP2B 5M5UA 4Z7OA 4XYIA 3UR4A 3IULA 4J79A 3EI3A 3V9FA 2OVRB 1JOFA 4G1MA 5E6UA 1N6EA 5FA5B 3T3MA 5FKTA 1R5MA 3HFQA 2HU5A 3JPXA 3SFZA 5IT9g 1I2MB 2CN2A 3PSCB 3U4YA 2OK6A 3F3FA 5TDHB 4Z7QA 3FCSA 4HDJA 4E5ZB 2XE4A 4QL1A 4J8GA 2VZ3A 3EU7A 4CI2A 2QC5A 1A12A 3IIWA 3MXXA 4L1QD 4O02A 4JSPC
chains in the Genus database with same CATH topology
2TRCB 3SBQA 3RMZD 2CE9A 3IJ1A 4CY3A 3EI1A 4BUJC 4PC0A 5EALA 5HYNB 4GZ8A 5AJAA 4PBYA 3PXSD 3IIYA 3MKQA 4JXMA 5TF2A 3B7FA 5HE2B 1A0RB 3RFGA 3EWEA 4J73A 5GMKn 3SWSD 1MDAH 2H9MA 1ERJA 1L0QA 2AH1A 3OW8A 1K32A 4JSXC 1GG2B 2H68A 2P9LC 5AMSA 2I3TA 1S4UX 2I3SA 1RI6A 2XU7A 3CFSB 3IKOA 2OJYA 3AH8B 2HYEA 2H3XA 4GGDA 4CZVA 4JSNC 2BBKH 3IJCA 3OTTA 1U4CA 4O1QD 4OZUA 4CI8A 4U1EI 2YBAA 4FA1D 2W18A 3OKYB 4FA5D 3PVWB 4Y7RA 4GM8A 5EAPA 2I0RA 3C5MA 5IJ8E 5H14A 2BCJB 5A2Qg 3RN1D 2YB8B 4Z8LA 2GC7A 1NEXB 5FLXg 5FKQA 1P22A 4IMMA 5AFU3 5EMMB 3NVNA 2G9AA 4OWRA 4ZN4A 2P9NC 4PXWA 5C2WB 4GM3A 1NR0A 4GQBB 4JT5C 4FHLA 2HESX 4J82A 3CIKB 3AFCA 2H47A 3I7OA 3JB9L 3F3PA 4A0AA 4EWRA 5IC7A 4K3ID 3NVQA 2B5NA 4G56B 4L9OA 4IA9A 3E0CA 3L4OD 1OLZA 2AH0A 5CYKA 4PSWB 2CO0A 2HKMA 3IJ0A 4LGNA 2IUQA 3I7HA 4A08A 3EMHA 1MG3A 5K19A 3NVXA 5GXHA 4KFMB 2P9SC 4FAND 2B4EA 3I8EA 5CXBB 5CXCA 4UI9R 3I7KA 4H5JA 5EMLB 3UVKA 3V7DB 2H9NA 5FXYA 3AL8B 3SCYA 3BG1A 1K8KC 4ESGA 2Z2OA 5FQDA 2I0TA 5FKSA 3VGZA 4A0BA 2O9KA 2IURA 2H14A 5SXMA 4Y5RD 3I7NA 1OMWB 3SN6B 2H6QA 5I5JA 4D0KA 2PM9B 2H13A 3RFHA 2CO0C 5HE1B 1QNIA 3I7PA 4O9DA 3DM0A 3N0EA 4JSVC 3EI4B 4GM9A 4O3TB 2AGYA 2CE8A 5B4WA 3RLMD 3ORVD 3EG6A 1FWXA 3MZKA 4A09B 2QXVA 4E54A 3UKUC 2OK4A 4ERYA 1GOTB 3SHFA 2H6KA 5EMKB 3OL2B 4GQ1A 4PSXB 3DXMC 3RSEC 2CNXA 2XL3A 4ZOYA 4U7AA 2YNNA 3JZHA 3BG0A 3KRXB 3MZLA 3MKSB 4A2LA 2PM6B 4E5ZA 2OVPB 1PI6A 3DSMA 4FA9D 1PEVA 3JRPA 5EM2B 2UZYB 2HJBA 2YNPA 4J77A 4QQEA 4GMBA 4CZYA 4X60B 2AGWA 4JD2C 2HXCA 4L3GD 4FB1D 1N6DA 2UZXB 4J8BA 5JWZA 3RRMC 2P9KC 3BWSA 3EI2B 5HQGA 4A11B 1SHYB 1B9YA 2AGLA 5C2VB 5GSAA 1SQ9A 3EI3B 4O45A 5EARA 3PVUB 1TYQC 2H9PA 3FM0A 4X61B 3ZWLB 2YMUA 3KRWB 3PE7A 2MTAH 4GQ2P 5EMJB 1N6FA 5I5MA 3GREA 4LG9A 1XIPA 2B5MA 5H1MA 2PBIB 4CY1A 5TEEA 2CN3A 2OIZA 2XL2A 3OKYA 1VYHC 3RN0D 2OVQB 4QRJA 1XHMA 2I0SA 4AOWA 2YNOA 4J84A 3SLED 3EI1B 2EBSA 2J56H 4CY5A 1YFQA 2IUVA 1TBGA 4QT8A 4MK0B 3I7LA 5FKRA 2IAAA 3K26A 2IUPA 3ODTA 3PXWD 3PXTD 1JMXB 3JROA 4L3HD 3UVMA 4FAVD 3UVNA 3UKRC 5TEFA 4E54B 1JMZB 3UVOA 5EAMA 2GNQA 5H17A 3SVWD 3W15A 4CZXA 3V5WB 3P4FA 2G99A 4N14A 2P9PC 4FA4D 1B9XA 2AGZA 1XKSA 4JT6C 2Z2PA 3CFVA 2H6NA 4J81A 1SQJA 3MMYA 4PNKB 3GFCA 1PBYB 5IGQA 3L4MD 3C99A 1PGUA 4J87A 4GGAA 5CXBA 3K27A 4H5IA 3FRXA 2H9LA 2AGXA 3AL8A 2J55H 4CI1A 4A2MA 3N0DA 4BH6A 4TZ4A 3I2NA 1GXRA 1MG2A 3I89A 4NSXA 3C9CA 4ERQA 2Z2NA 4FWWA 4A0AB 2PM9A 5C9ZB 4ERZA 3VA6A 1U2VC 3J81g 4J78A 3JZNA 5IJ7E 4R7AB 2IWKA 5I5IA 4D6VA 2PM7B 3JAMg 5CYKB 5IGOA 2P9IC 3EI4A 4XYHA 3DXKC 4J0WA 2GC4A 3J80g 5GXIA 4J86A 4PBZA 3OKWA 3AL9A 4A08B 5K1CC 4X3EA 4ES0A 4K3JB 4A09A 3PSLA 1JJUB 4YVDA 3OKTA 4BL0A 3SBRA 2HJ4A 3I8CA 3OL2A 4LG8A 5CXCB 3SMRA 3A0FA 3UVLA 2Q7QA 2B5LA 4CC9A 2J57G 3C75H 3F3GA 4A0BB 3FGBA 4XEIC 3SBPA 5HE3B 4J0XA 2XYIA 5EM2A 5HE0B 3DWLC 3SJLD 3SXTD 5THAA 2IWFA 4X63B 4ZOXA 3VH0A 4O3UB 4I79A 2P9UC 4GGCA 4ZOZA 2AQ5A 3JZGA 5KDOB 3ULEC 4AEZA 2HKRA 3EI2A 4CI3A 4CY2A 4A11A 4A7JA 4ZOVA 1Q47A 1GP2B 4XYIA 3UR4A 4J79A 3EI3A 3V9FA 2OVRB 1JOFA 1N6EA 5FA5B 5FKTA 1R5MA 3HFQA 3JPXA 3SFZA 5IT9g 2CN2A 3PSCB 3U4YA 2OK6A 3F3FA 5TDHB 4HDJA 4E5ZB 4QL1A 4J8GA 3EU7A 4CI2A 2QC5A 3IIWA 3MXXA 4L1QD 4JSPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TRC B;  3SBQ A;  3RMZ D;  2CE9 A;  3IJ1 A;  4CY3 A;  3EI1 A;  4BUJ C;  4PC0 A;  5EAL A;  5HYN B;  4GZ8 A;  5AJA A;  4PBY A;  3PXS D;  3IIY A;  3MKQ A;  4JXM A;  5TF2 A;  3B7F A;  5HE2 B;  1A0R B;  3RFG A;  3EWE A;  4J73 A;  5GMK n;  3SWS D;  1MDA H;  2H9M A;  1ERJ A;  1L0Q A;  2AH1 A;  3OW8 A;  1K32 A;  4JSX C;  1GG2 B;  2H68 A;  2P9L C;  5AMS A;  2I3T A;  1S4U X;  2I3S A;  1RI6 A;  2XU7 A;  3CFS B;  3IKO A;  2OJY A;  3AH8 B;  2HYE A;  2H3X A;  4GGD A;  4CZV A;  4JSN C;  2BBK H;  3IJC A;  3OTT A;  1U4C A;  4O1Q D;  4OZU A;  4CI8 A;  4U1E I;  2YBA A;  4FA1 D;  2W18 A;  3OKY B;  4FA5 D;  3PVW B;  4Y7R A;  4GM8 A;  5EAP A;  2I0R A;  3C5M A;  5IJ8 E;  5H14 A;  2BCJ B;  5A2Q g;  3RN1 D;  2YB8 B;  4Z8L A;  2GC7 A;  1NEX B;  5FLX g;  5FKQ A;  1P22 A;  4IMM A;  5AFU 3;  5EMM B;  3NVN A;  2G9A A;  4OWR A;  4ZN4 A;  2P9N C;  4PXW A;  5C2W B;  4GM3 A;  1NR0 A;  4GQB B;  4JT5 C;  4FHL A;  2HES X;  4J82 A;  3CIK B;  3AFC A;  2H47 A;  3I7O A;  3JB9 L;  3F3P A;  4A0A A;  4EWR A;  5IC7 A;  4K3I D;  3NVQ A;  2B5N A;  4G56 B;  4L9O A;  4IA9 A;  3E0C A;  3L4O D;  1OLZ A;  2AH0 A;  5CYK A;  4PSW B;  2CO0 A;  2HKM A;  3IJ0 A;  4LGN A;  2IUQ A;  3I7H A;  4A08 A;  3EMH A;  1MG3 A;  5K19 A;  3NVX A;  5GXH A;  4KFM B;  2P9S C;  4FAN D;  2B4E A;  3I8E A;  5CXB B;  5CXC A;  4UI9 R;  3I7K A;  4H5J A;  5EML B;  3UVK A;  3V7D B;  2H9N A;  5FXY A;  3AL8 B;  3SCY A;  3BG1 A;  1K8K C;  4ESG A;  2Z2O A;  5FQD A;  2I0T A;  5FKS A;  3VGZ A;  4A0B A;  2O9K A;  2IUR A;  2H14 A;  5SXM A;  4Y5R D;  3I7N A;  1OMW B;  3SN6 B;  2H6Q A;  5I5J A;  4D0K A;  2PM9 B;  2H13 A;  3RFH A;  2CO0 C;  5HE1 B;  1QNI A;  3I7P A;  4O9D A;  3DM0 A;  3N0E A;  4JSV C;  3EI4 B;  4GM9 A;  4O3T B;  2AGY A;  2CE8 A;  5B4W A;  3RLM D;  3ORV D;  3EG6 A;  1FWX A;  3MZK A;  4A09 B;  2QXV A;  4E54 A;  3UKU C;  2OK4 A;  4ERY A;  1GOT B;  3SHF A;  2H6K A;  5EMK B;  3OL2 B;  4GQ1 A;  4PSX B;  3DXM C;  3RSE C;  2CNX A;  2XL3 A;  4ZOY A;  4U7A A;  2YNN A;  3JZH A;  3BG0 A;  3KRX B;  3MZL A;  3MKS B;  4A2L A;  2PM6 B;  4E5Z A;  2OVP B;  1PI6 A;  3DSM A;  4FA9 D;  1PEV A;  3JRP A;  5EM2 B;  2UZY B;  2HJB A;  2YNP A;  4J77 A;  4QQE A;  4GMB A;  4CZY A;  4X60 B;  2AGW A;  4JD2 C;  2HXC A;  4L3G D;  4FB1 D;  1N6D A;  2UZX B;  4J8B A;  5JWZ A;  3RRM C;  2P9K C;  3BWS A;  3EI2 B;  5HQG A;  4A11 B;  1SHY B;  1B9Y A;  2AGL A;  5C2V B;  5GSA A;  1SQ9 A;  3EI3 B;  4O45 A;  5EAR A;  3PVU B;  1TYQ C;  2H9P A;  3FM0 A;  4X61 B;  3ZWL B;  2YMU A;  3KRW B;  3PE7 A;  2MTA H;  4GQ2 P;  5EMJ B;  1N6F A;  5I5M A;  3GRE A;  4LG9 A;  1XIP A;  2B5M A;  5H1M A;  2PBI B;  4CY1 A;  5TEE A;  2CN3 A;  2OIZ A;  2XL2 A;  3OKY A;  1VYH C;  3RN0 D;  2OVQ B;  4QRJ A;  1XHM A;  2I0S A;  4AOW A;  2YNO A;  4J84 A;  3SLE D;  3EI1 B;  2EBS A;  2J56 H;  4CY5 A;  1YFQ A;  2IUV A;  1TBG A;  4QT8 A;  4MK0 B;  3I7L A;  5FKR A;  2IAA A;  3K26 A;  2IUP A;  3ODT A;  3PXW D;  3PXT D;  1JMX B;  3JRO A;  4L3H D;  3UVM A;  4FAV D;  3UVN A;  3UKR C;  5TEF A;  4E54 B;  1JMZ B;  3UVO A;  5EAM A;  2GNQ A;  5H17 A;  3SVW D;  3W15 A;  4CZX A;  3V5W B;  3P4F A;  2G99 A;  4N14 A;  2P9P C;  4FA4 D;  1B9X A;  2AGZ A;  1XKS A;  4JT6 C;  2Z2P A;  3CFV A;  2H6N A;  4J81 A;  1SQJ A;  3MMY A;  4PNK B;  3GFC A;  1PBY B;  5IGQ A;  3L4M D;  3C99 A;  1PGU A;  4J87 A;  4GGA A;  5CXB A;  3K27 A;  4H5I A;  3FRX A;  2H9L A;  2AGX A;  3AL8 A;  2J55 H;  4CI1 A;  4A2M A;  3N0D A;  4BH6 A;  4TZ4 A;  3I2N A;  1GXR A;  1MG2 A;  3I89 A;  4NSX A;  3C9C A;  4ERQ A;  2Z2N A;  4FWW A;  4A0A B;  2PM9 A;  5C9Z B;  4ERZ A;  3VA6 A;  1U2V C;  3J81 g;  4J78 A;  3JZN A;  5IJ7 E;  4R7A B;  2IWK A;  5I5I A;  4D6V A;  2PM7 B;  3JAM g;  5CYK B;  5IGO A;  2P9I C;  3EI4 A;  4XYH A;  3DXK C;  4J0W A;  2GC4 A;  3J80 g;  5GXI A;  4J86 A;  4PBZ A;  3OKW A;  3AL9 A;  4A08 B;  5K1C C;  4X3E A;  4ES0 A;  4K3J B;  4A09 A;  3PSL A;  1JJU B;  4YVD A;  3OKT A;  4BL0 A;  3SBR A;  2HJ4 A;  3I8C A;  3OL2 A;  4LG8 A;  5CXC B;  3SMR A;  3A0F A;  3UVL A;  2Q7Q A;  2B5L A;  4CC9 A;  2J57 G;  3C75 H;  3F3G A;  4A0B B;  3FGB A;  4XEI C;  3SBP A;  5HE3 B;  4J0X A;  2XYI A;  5EM2 A;  5HE0 B;  3DWL C;  3SJL D;  3SXT D;  5THA A;  2IWF A;  4X63 B;  4ZOX A;  3VH0 A;  4O3U B;  4I79 A;  2P9U C;  4GGC A;  4ZOZ A;  2AQ5 A;  3JZG A;  5KDO B;  3ULE C;  4AEZ A;  2HKR A;  3EI2 A;  4CI3 A;  4CY2 A;  4A11 A;  4A7J A;  4ZOV A;  1Q47 A;  1GP2 B;  4XYI A;  3UR4 A;  4J79 A;  3EI3 A;  3V9F A;  2OVR B;  1JOF A;  1N6E A;  5FA5 B;  5FKT A;  1R5M A;  3HFQ A;  3JPX A;  3SFZ A;  5IT9 g;  2CN2 A;  3PSC B;  3U4Y A;  2OK6 A;  3F3F A;  5TDH B;  4HDJ A;  4E5Z B;  4QL1 A;  4J8G A;  3EU7 A;  4CI2 A;  2QC5 A;  3IIW A;  3MXX A;  4L1Q D;  4JSP C; 
#chains in the Genus database with same CATH topology
 3K72 A;  3GD1 I;  3ZE1 A;  2TRC B;  3SBQ A;  3RMZ D;  5E6S A;  1K3I A;  2CE9 A;  3IJ1 A;  4CY3 A;  1VE6 A;  3EI1 A;  4BUJ C;  4PC0 A;  5EAL A;  5HYN B;  4GZ8 A;  5AJA A;  4PBY A;  4NBM A;  4L1M A;  3PXS D;  3IIY A;  3MKQ A;  4JXM A;  5TF2 A;  3B7F A;  5HE2 B;  1A0R B;  3RFG A;  1VE7 A;  3EWE A;  4J73 A;  4BCB A;  3ZE0 A;  5GMK n;  1GOF A;  3SWS D;  2XZG A;  1MDA H;  2H9M A;  1ERJ A;  1L0Q A;  2AH1 A;  3OW8 A;  4JHN A;  1K32 A;  4JSX C;  1GG2 B;  2H68 A;  2P9L C;  5AMS A;  2I3T A;  1S4U X;  2I3S A;  1RI6 A;  2XU7 A;  3CFS B;  3ZDY A;  3IKO A;  2OJY A;  3AH8 B;  2HYE A;  3IUJ A;  4BP9 A;  2H3X A;  4GGD A;  4CZV A;  4JSN C;  2EID A;  2BBK H;  3IJC A;  3OTT A;  1U4C A;  4O1Q D;  4OZU A;  3IJE A;  3O4H A;  4CI8 A;  1VZ2 A;  4U1E I;  2YBA A;  4FA1 D;  2W18 A;  3OKY B;  4FA5 D;  3PVW B;  2VDL A;  4Y7R A;  4GM8 A;  5EAP A;  2I0R A;  3C5M A;  5IJ8 E;  5H14 A;  4BCD A;  2BCJ B;  2JKX A;  5A2Q g;  5FFG A;  3RN1 D;  2YB8 B;  4Z8L A;  2EIC A;  2GC7 A;  1NEX B;  5FLX g;  5FKQ A;  1P22 A;  4IMM A;  5AFU 3;  5EMM B;  3NVN A;  2G9A A;  2VDQ A;  4OWR A;  3IUN A;  4ZN4 A;  2HU7 A;  2P9N C;  4PXW A;  5C2W B;  1E8M A;  4GM3 A;  1NR0 A;  4GQB B;  4JT5 C;  4FHL A;  2HES X;  4J82 A;  3CIK B;  3AFC A;  2H47 A;  3I7O A;  3JB9 L;  3F3P A;  4A0A A;  2VC2 A;  4EWR A;  5IC7 A;  4K3I D;  3NVQ A;  2B5N A;  4G56 B;  4WK2 A;  4L9O A;  4IA9 A;  2BKL A;  3E0C A;  3L4O D;  1OLZ A;  2AH0 A;  5CYK A;  4PSW B;  2CO0 A;  2HKM A;  3IJ0 A;  4LGN A;  5HDB A;  2IUQ A;  3I7H A;  4A08 A;  3EMH A;  1JTD B;  1MG3 A;  5K19 A;  4WJK A;  3NVX A;  5GXH A;  4KFM B;  2P9S C;  5M5T A;  4FAN D;  2B4E A;  3I8E A;  5CXB B;  5CXC A;  4UI9 R;  2VDO A;  4AMZ A;  4AN0 A;  3I7K A;  4H5J A;  5EML B;  3UVK A;  4WK4 A;  3V7D B;  2H9N A;  5FXY A;  3AL8 B;  3SCY A;  3BG1 A;  1K8K C;  4ESG A;  2Z2O A;  5FQD A;  2I0T A;  5FKS A;  3VGZ A;  4A0B A;  2O9K A;  2IUR A;  2H14 A;  5SXM A;  1M1X A;  4Y5R D;  3I7N A;  1OMW B;  3SN6 B;  2H6Q A;  5I5J A;  4D0K A;  2PM9 B;  2H13 A;  3RFH A;  2VDN A;  2CO0 C;  5HE1 B;  4IRZ A;  1QNI A;  3I7P A;  4O9D A;  3DM0 A;  3N0E A;  4JSV C;  3EI4 B;  4GM9 A;  4O3T B;  2AGY A;  2CE8 A;  5B4W A;  3RLM D;  3ORV D;  3EG6 A;  3VI4 A;  1FWX A;  3MZK A;  4BCC A;  2QXV A;  2EIB A;  5M5V A;  4A09 B;  2VDP A;  5M61 A;  3UKU C;  4E54 A;  2OK4 A;  4ERY A;  1GOT B;  3SHF A;  2H6K A;  5EMK B;  3OL2 B;  4GQ1 A;  4PSX B;  4UM9 A;  3DXM C;  3RSE C;  2CNX A;  2XL3 A;  4ZOY A;  4U7A A;  3O4J A;  1H2Y A;  2YNN A;  3JZH A;  3BG0 A;  3KRX B;  3V4V A;  3MZL A;  3MKS B;  1BPO A;  1UOO A;  4A2L A;  2PM6 B;  4E5Z A;  2OVP B;  2VDR A;  4AX4 A;  3O4I A;  1PI6 A;  3DSM A;  4FA9 D;  1PEV A;  3JRP A;  5EM2 B;  1GOG A;  2UZY B;  2HJB A;  5C86 A;  2YNP A;  4J77 A;  4QQE A;  4GMB A;  4CZY A;  5E6R A;  4X60 B;  3EQ7 A;  4MMY A;  2AGW A;  4JD2 C;  2HXC A;  3ZDX A;  4L3G D;  4FB1 D;  1N6D A;  2UZX B;  4J8B A;  5JWZ A;  4DNU A;  3RRM C;  2P9K C;  3BWS A;  3MVD K;  3EI2 B;  5HQG A;  3ZDZ A;  4A11 B;  1QFM A;  2XDW A;  4AN1 A;  1SHY B;  2AGL A;  1B9Y A;  3VI3 A;  5C2V B;  5GSA A;  1SQ9 A;  3EI3 B;  4O45 A;  5EAR A;  3PVU B;  5FFO A;  1TYQ C;  2H9P A;  3FM0 A;  4X61 B;  1UTC A;  3ZWL B;  2YMU A;  3KRW B;  3PE7 A;  1H2W A;  2MTA H;  3IUQ A;  4GQ2 P;  5EMJ B;  1N6F A;  5I5M A;  3GRE A;  4LG9 A;  1C9L A;  1XIP A;  2B5M A;  3QI0 A;  5H1M A;  1H2Z A;  2PBI B;  4CY1 A;  4O2W A;  3FCU A;  5TEE A;  1JV2 A;  2CN3 A;  2OIZ A;  2XL2 A;  3DDU A;  3OKY A;  1VYH C;  3RN0 D;  2EIE A;  1H2X A;  1GOH A;  1UOQ A;  4QRJ A;  2OVQ B;  1XHM A;  2I0S A;  4WK0 A;  2YNO A;  3IVM A;  4J84 A;  4AOW A;  3SLE D;  3EI1 B;  1YR2 A;  2EBS A;  2J56 H;  4CY5 A;  1YFQ A;  2IUV A;  1TBG A;  3IUR A;  4QT8 A;  4MK0 B;  3I7L A;  5FKR A;  2IAA A;  3K26 A;  5M5S A;  2IUP A;  3EQ8 A;  3ODT A;  3PXW D;  3PXT D;  1JMX B;  3JRO A;  4L3H D;  3UVM A;  4FAV D;  3UVN A;  4BP8 A;  4D9S A;  3UKR C;  5TEF A;  4E54 B;  1JMZ B;  3UVO A;  5M5R A;  5EAM A;  2GNQ A;  5H17 A;  1O6G A;  4G55 A;  2VDM A;  3SVW D;  3W15 A;  4CZX A;  3V5W B;  3T3P A;  1VZ3 A;  3P4F A;  2G99 A;  4N14 A;  2P9P C;  3NIF A;  3K71 A;  4FA4 D;  1U8C A;  1B9X A;  2WQ8 A;  2AGZ A;  1XKS A;  4JT6 C;  2Z2P A;  3CFV A;  2H6N A;  4J81 A;  1SQJ A;  3MMY A;  4PNK B;  1E8N A;  3GFC A;  1PBY B;  5IGQ A;  3ZE2 A;  3L4M D;  4QAM A;  3C99 A;  1PGU A;  1QFS A;  4J87 A;  3EQ9 A;  4GGA A;  5CXB A;  3K27 A;  4H5I A;  3FRX A;  2H9L A;  2AGX A;  1L5G A;  2QR5 A;  3AL8 A;  2J55 H;  4CI1 A;  4A2M A;  3N0D A;  4BH6 A;  4TZ4 A;  3I2N A;  2QZP A;  1GXR A;  1MG2 A;  3I89 A;  4NSX A;  3C9C A;  3K6S A;  4ERQ A;  2Z2N A;  4FWW A;  4A0A B;  2PM9 A;  5C9Z B;  4ERZ A;  3VA6 A;  1U2V C;  3J81 g;  4J78 A;  3JZN A;  5IJ7 E;  4R7A B;  4MMX A;  2IWK A;  4NAA A;  4DNV A;  5I5I A;  1O6F A;  4D6V A;  2PM7 B;  4RE5 A;  3JAM g;  5CYK B;  5IGO A;  1TYE A;  2P9I C;  3EI4 A;  4XYH A;  4DNW A;  3DXK C;  4J0W A;  2GC4 A;  2VZ1 A;  3J80 g;  5GXI A;  3NID A;  4J86 A;  4PBZ A;  3OKW A;  3AL9 A;  4A08 B;  1E5T A;  5K1C C;  4X3E A;  4ES0 A;  4K3J B;  4A09 A;  3PSL A;  1JJU B;  3O4G A;  4YVD A;  3OKT A;  3GC3 B;  4BL0 A;  4Z7N A;  3SBR A;  2HJ4 A;  4NEN A;  3I8C A;  3OL2 A;  4LG8 A;  5CXC B;  3SMR A;  3A0F A;  3UVL A;  2VDK A;  2Q7Q A;  4G1E A;  2B5L A;  4CC9 A;  2J57 G;  3C75 H;  3NIG A;  4UM8 A;  3F3G A;  4A0B B;  3FGB A;  4XEI C;  3SBP A;  3KCI A;  5C92 A;  5HE3 B;  4J0X A;  4AMY A;  2XYI A;  3QHY B;  5EM2 A;  5HE0 B;  2HU8 A;  4NC4 A;  3DWL C;  3SJL D;  3SXT D;  3V4P A;  3IUM A;  3MUN A;  5THA A;  2IWF A;  4X63 B;  4ZOX A;  3VH0 A;  4O3U B;  4I79 A;  4RE6 A;  2P9U C;  4GGC A;  1C9I A;  4ZOZ A;  1T2X A;  2AQ5 A;  3JZG A;  5KDO B;  3ULE C;  4AEZ A;  3MUO A;  2HKR A;  4MMZ A;  3EI2 A;  4CI3 A;  4CY2 A;  3OF7 A;  4A11 A;  4A7J A;  1UOP A;  4JHP C;  4ZOV A;  1Q47 A;  1GP2 B;  5M5U A;  4Z7O A;  4XYI A;  3UR4 A;  3IUL A;  4J79 A;  3EI3 A;  3V9F A;  2OVR B;  1JOF A;  4G1M A;  5E6U A;  1N6E A;  5FA5 B;  3T3M A;  5FKT A;  1R5M A;  3HFQ A;  2HU5 A;  3JPX A;  3SFZ A;  5IT9 g;  1I2M B;  2CN2 A;  3PSC B;  3U4Y A;  2OK6 A;  3F3F A;  5TDH B;  4Z7Q A;  3FCS A;  4HDJ A;  4E5Z B;  2XE4 A;  4QL1 A;  4J8G A;  2VZ3 A;  3EU7 A;  4CI2 A;  2QC5 A;  1A12 A;  3IIW A;  3MXX A;  4L1Q D;  4O02 A;  4JSP C; 
#chains in the Genus database with same CATH homology
 2TRC B;  3SBQ A;  3RMZ D;  2CE9 A;  3IJ1 A;  4CY3 A;  3EI1 A;  4BUJ C;  4PC0 A;  5EAL A;  5HYN B;  4GZ8 A;  5AJA A;  4PBY A;  3PXS D;  3IIY A;  3MKQ A;  4JXM A;  5TF2 A;  3B7F A;  5HE2 B;  1A0R B;  3RFG A;  3EWE A;  4J73 A;  5GMK n;  3SWS D;  1MDA H;  2H9M A;  1ERJ A;  1L0Q A;  2AH1 A;  3OW8 A;  1K32 A;  4JSX C;  1GG2 B;  2H68 A;  2P9L C;  5AMS A;  2I3T A;  1S4U X;  2I3S A;  1RI6 A;  2XU7 A;  3CFS B;  3IKO A;  2OJY A;  3AH8 B;  2HYE A;  2H3X A;  4GGD A;  4CZV A;  4JSN C;  2BBK H;  3IJC A;  3OTT A;  1U4C A;  4O1Q D;  4OZU A;  4CI8 A;  4U1E I;  2YBA A;  4FA1 D;  2W18 A;  3OKY B;  4FA5 D;  3PVW B;  4Y7R A;  4GM8 A;  5EAP A;  2I0R A;  3C5M A;  5IJ8 E;  5H14 A;  2BCJ B;  5A2Q g;  3RN1 D;  2YB8 B;  4Z8L A;  2GC7 A;  1NEX B;  5FLX g;  5FKQ A;  1P22 A;  4IMM A;  5AFU 3;  5EMM B;  3NVN A;  2G9A A;  4OWR A;  4ZN4 A;  2P9N C;  4PXW A;  5C2W B;  4GM3 A;  1NR0 A;  4GQB B;  4JT5 C;  4FHL A;  2HES X;  4J82 A;  3CIK B;  3AFC A;  2H47 A;  3I7O A;  3JB9 L;  3F3P A;  4A0A A;  4EWR A;  5IC7 A;  4K3I D;  3NVQ A;  2B5N A;  4G56 B;  4L9O A;  4IA9 A;  3E0C A;  3L4O D;  1OLZ A;  2AH0 A;  5CYK A;  4PSW B;  2CO0 A;  2HKM A;  3IJ0 A;  4LGN A;  2IUQ A;  3I7H A;  4A08 A;  3EMH A;  1MG3 A;  5K19 A;  3NVX A;  5GXH A;  4KFM B;  2P9S C;  4FAN D;  2B4E A;  3I8E A;  5CXB B;  5CXC A;  4UI9 R;  3I7K A;  4H5J A;  5EML B;  3UVK A;  3V7D B;  2H9N A;  5FXY A;  3AL8 B;  3SCY A;  3BG1 A;  1K8K C;  4ESG A;  2Z2O A;  5FQD A;  2I0T A;  5FKS A;  3VGZ A;  4A0B A;  2O9K A;  2IUR A;  2H14 A;  5SXM A;  4Y5R D;  3I7N A;  1OMW B;  3SN6 B;  2H6Q A;  5I5J A;  4D0K A;  2PM9 B;  2H13 A;  3RFH A;  2CO0 C;  5HE1 B;  1QNI A;  3I7P A;  4O9D A;  3DM0 A;  3N0E A;  4JSV C;  3EI4 B;  4GM9 A;  4O3T B;  2AGY A;  2CE8 A;  5B4W A;  3RLM D;  3ORV D;  3EG6 A;  1FWX A;  3MZK A;  4A09 B;  2QXV A;  4E54 A;  3UKU C;  2OK4 A;  4ERY A;  1GOT B;  3SHF A;  2H6K A;  5EMK B;  3OL2 B;  4GQ1 A;  4PSX B;  3DXM C;  3RSE C;  2CNX A;  2XL3 A;  4ZOY A;  4U7A A;  2YNN A;  3JZH A;  3BG0 A;  3KRX B;  3MZL A;  3MKS B;  4A2L A;  2PM6 B;  4E5Z A;  2OVP B;  1PI6 A;  3DSM A;  4FA9 D;  1PEV A;  3JRP A;  5EM2 B;  2UZY B;  2HJB A;  2YNP A;  4J77 A;  4QQE A;  4GMB A;  4CZY A;  4X60 B;  2AGW A;  4JD2 C;  2HXC A;  4L3G D;  4FB1 D;  1N6D A;  2UZX B;  4J8B A;  5JWZ A;  3RRM C;  2P9K C;  3BWS A;  3EI2 B;  5HQG A;  4A11 B;  1SHY B;  1B9Y A;  2AGL A;  5C2V B;  5GSA A;  1SQ9 A;  3EI3 B;  4O45 A;  5EAR A;  3PVU B;  1TYQ C;  2H9P A;  3FM0 A;  4X61 B;  3ZWL B;  2YMU A;  3KRW B;  3PE7 A;  2MTA H;  4GQ2 P;  5EMJ B;  1N6F A;  5I5M A;  3GRE A;  4LG9 A;  1XIP A;  2B5M A;  5H1M A;  2PBI B;  4CY1 A;  5TEE A;  2CN3 A;  2OIZ A;  2XL2 A;  3OKY A;  1VYH C;  3RN0 D;  2OVQ B;  4QRJ A;  1XHM A;  2I0S A;  4AOW A;  2YNO A;  4J84 A;  3SLE D;  3EI1 B;  2EBS A;  2J56 H;  4CY5 A;  1YFQ A;  2IUV A;  1TBG A;  4QT8 A;  4MK0 B;  3I7L A;  5FKR A;  2IAA A;  3K26 A;  2IUP A;  3ODT A;  3PXW D;  3PXT D;  1JMX B;  3JRO A;  4L3H D;  3UVM A;  4FAV D;  3UVN A;  3UKR C;  5TEF A;  4E54 B;  1JMZ B;  3UVO A;  5EAM A;  2GNQ A;  5H17 A;  3SVW D;  3W15 A;  4CZX A;  3V5W B;  3P4F A;  2G99 A;  4N14 A;  2P9P C;  4FA4 D;  1B9X A;  2AGZ A;  1XKS A;  4JT6 C;  2Z2P A;  3CFV A;  2H6N A;  4J81 A;  1SQJ A;  3MMY A;  4PNK B;  3GFC A;  1PBY B;  5IGQ A;  3L4M D;  3C99 A;  1PGU A;  4J87 A;  4GGA A;  5CXB A;  3K27 A;  4H5I A;  3FRX A;  2H9L A;  2AGX A;  3AL8 A;  2J55 H;  4CI1 A;  4A2M A;  3N0D A;  4BH6 A;  4TZ4 A;  3I2N A;  1GXR A;  1MG2 A;  3I89 A;  4NSX A;  3C9C A;  4ERQ A;  2Z2N A;  4FWW A;  4A0A B;  2PM9 A;  5C9Z B;  4ERZ A;  3VA6 A;  1U2V C;  3J81 g;  4J78 A;  3JZN A;  5IJ7 E;  4R7A B;  2IWK A;  5I5I A;  4D6V A;  2PM7 B;  3JAM g;  5CYK B;  5IGO A;  2P9I C;  3EI4 A;  4XYH A;  3DXK C;  4J0W A;  2GC4 A;  3J80 g;  5GXI A;  4J86 A;  4PBZ A;  3OKW A;  3AL9 A;  4A08 B;  5K1C C;  4X3E A;  4ES0 A;  4K3J B;  4A09 A;  3PSL A;  1JJU B;  4YVD A;  3OKT A;  4BL0 A;  3SBR A;  2HJ4 A;  3I8C A;  3OL2 A;  4LG8 A;  5CXC B;  3SMR A;  3A0F A;  3UVL A;  2Q7Q A;  2B5L A;  4CC9 A;  2J57 G;  3C75 H;  3F3G A;  4A0B B;  3FGB A;  4XEI C;  3SBP A;  5HE3 B;  4J0X A;  2XYI A;  5EM2 A;  5HE0 B;  3DWL C;  3SJL D;  3SXT D;  5THA A;  2IWF A;  4X63 B;  4ZOX A;  3VH0 A;  4O3U B;  4I79 A;  2P9U C;  4GGC A;  4ZOZ A;  2AQ5 A;  3JZG A;  5KDO B;  3ULE C;  4AEZ A;  2HKR A;  3EI2 A;  4CI3 A;  4CY2 A;  4A11 A;  4A7J A;  4ZOV A;  1Q47 A;  1GP2 B;  4XYI A;  3UR4 A;  4J79 A;  3EI3 A;  3V9F A;  2OVR B;  1JOF A;  1N6E A;  5FA5 B;  5FKT A;  1R5M A;  3HFQ A;  3JPX A;  3SFZ A;  5IT9 g;  2CN2 A;  3PSC B;  3U4Y A;  2OK6 A;  3F3F A;  5TDH B;  4HDJ A;  4E5Z B;  4QL1 A;  4J8G A;  3EU7 A;  4CI2 A;  2QC5 A;  3IIW A;  3MXX A;  4L1Q D;  4JSP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...