5ICNB

Hdac1:mta1 in complex with inositol-6-phosphate and a novel peptide inhibitor based on histone h4
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
369
structure length
369
Chain Sequence
RRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGGGGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metastasis-associated protein MTA1
publication title Insights into the activation mechanism of class I HDAC complexes by inositol phosphates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 124
structure length 369
sequence length 369
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00850 Hist_deacetyl Histone deacetylase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.20 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Histone deacetylase domain 5icnB00
3MZ6A 2VQJA 5G0YA 1T67A 3F0RA 5G0JA 5ICNB 4BZ7A 1C3SA 5G3WA 4BKXB 5IX0A 1T64A 1VKGA 5DC6A 4CQFA 3C0ZA 5EF7A 4ZURA 5G0IA 5G0XA 3MAXA 4BZ6A 5G17A 4QA6A 2V5WA 4ZUMA 2GH6A 5EEIA 5EF8A 3SFHA 5D1BA 3Q9FA 2VCGA 5DC8A 2VQMA 5EFKB 5G10A 5G0GA 3Q9CA 5FCWA 2VQVA 3F07A 3EZPA 4RN0A 4A69A 4BZ9A 5G0HA 4QA1A 5G12A 1ZZ0A 3EW8A 4ZUPA 4QA4A 5THVA 5DC7A 5EFBD 4ZUOA 3MZ7A 5EEMA 5G1CA 3F06A 5D1DA 4QA3A 5THTA 5EENA 3EWFA 5BWZA 3MZ3A 3RQDA 4QA0A 4RN2A 4QA7A 5EFHA 4QA2A 4RN1A 4ZUQA 5G13A 3MZ4A 4QA5A 5EFGA 5G11A 3SFFA 5IWGA 5D1CA 5G1BA 5JI5A 5THUA 1T69A 3Q9EA 3EZTA 4LY1A 5EEFA 5EFNA 1C3PA 4CBTA 2VQQA 5A2SA 5FUEA 5EEKA 3ZNRA 5G1AA 4ZUNA 2VQWG 1ZZ1A 5DC5A 4BZ5A 5LI3A 3ZNSA 4BZ8A 1C3RA 5EFJD 1W22A 3C0YA 4CBYA 2V5XA 3C10A 3Q9BA 4LXZA 2VQOA 1ZZ3A 5THSA 3MENA
chains in the Genus database with same CATH superfamily
3MZ6A 2PHOA 4RHKA 1T4RA 2VQJA 4Q40A 5G0YA 4DZ4A 3SKKA 1T67A 1P8PA 3F0RA 5G0JA 3F80A 5ICNB 4HZEA 4BZ7A 3M1RA 1C3SA 5G3WA 4RLAA 4BKXB 4IE2A 5RLAA 5IX0A 1T64A 1VKGA 1P8MA 1WOGA 1ZPGA 4GWDA 5DC6A 4CQFA 2PLLA 3C0ZA 2ZAVA 1P8NA 3LHLA 5EF7A 4IXUA 3TH7A 3THJA 4ZURA 3THEA 5G0IA 3GN0A 5G0XA 3MAXA 4BZ6A 4GSVA 1T4PA 1RLAA 5G17A 1WVAA 3NIPA 1HQXA 2CEVA 4QA6A 2V5WA 2RLAA 2GH6A 4ZUMA 2AEBA 5EEIA 5EF8A 3SFHA 5D1BA 3Q9FA 3SL0A 2VCGA 2EF4A 4HXQA 2VQMA 4Q3VA 5DC8A 5EFKB 3KV2A 5G10A 1WOHA 3E8QA 4Q42A 1ZPEA 5G0GA 3Q9CA 2VQVA 3F07A 3EZPA 1TBLA 4I06A 1T5GA 4RN0A 5FCWA 4A69A 4BZ9A 4GSMA 4IU0A 4Q3UA 5G0HA 1WVBA 4QA1A 5G12A 3THHA 1T5FA 1HQFA 3SL1A 1ZZ0A 1R1OA 3MFWA 4RHJA 5CEVA 1TBJA 3MFVA 3EW8A 3NIOA 3SJTA 4ZUPA 2EIVA 3DJ8A 4GWCA 4QA4A 5HJ9A 5THVA 5DC7A 5EFBD 4ZUOA 3MZ7A 5EEMA 4Q3SA 1PQ3A 5G1CA 5HJAA 3F06A 4ITYA 5D1DA 3CEVA 2EF5A 4MYKA 4QA3A 4HWWA 1GQ6A 5EENA 3EWFA 5THTA 5BWZA 4IU5A 3MZ3A 4IE1A 3RQDA 4QA0A 1TBHA 4FCIA 4GSZA 2A0MA 4RN2A 4QA7A 5EFHA 4QA2A 4IU1A 4RN1A 4ZUQA 5G13A 3MMRA 3MZ4A 4QA5A 4Q3QA 1WOIA 5EFGA 5G11A 3SFFA 4Q3PA 1P8QA 3E8ZA 5IWGA 5D1CA 5G1BA 5JI5A 4RHLA 1XFKA 1TA1A 1T4TA 3GMZA 3LP4A 3NIQA 4RHIA 5THUA 1T69A 3Q9EA 3EZTA 4LY1A 1P8SA 5EFNA 5EEFA 4CEVA 1C3PA 4IU4A 3TF3A 1T4SA 1GQ7A 1HQGA 4IXVA 4CBTA 2VQQA 5A2SA 5FUEA 5EEKA 4G3HA 1CEVA 4Q3RC 4RHMA 3ZNRA 5G1AA 3E6KA 4ZUNA 2VQWG 3PZLA 1P8OA 4Q3RA 1HQHA 1ZZ1A 4MYLA 1P8RA 4RHQA 5DC5A 4BZ5A 4FCKA 5LI3A 3ZNSA 4BZ8A 1C3RA 3MJLA 5EFJD 4Q41A 1W22A 3C0YA 4MYFA 4CBYA 4Q3TA 2V5XA 3C10A 3Q9BA 4LXZA 1HQ5A 3LP7A 4MYNA 1D3VA 2PHAA 3E6VA 2VQOA 1ZZ3A 4IE3A 5THSA 3RLAA 3MENA 4MXRA 3E9BA
chains in the Genus database with same CATH topology
3MZ6A 2VQJA 5G0YA 1T67A 3F0RA 5G0JA 5ICNB 4BZ7A 1C3SA 5G3WA 4BKXB 5IX0A 1T64A 1VKGA 5DC6A 4CQFA 3C0ZA 5EF7A 4ZURA 5G0IA 5G0XA 3MAXA 4BZ6A 5G17A 4QA6A 2V5WA 4ZUMA 2GH6A 5EEIA 5EF8A 3SFHA 5D1BA 3Q9FA 2VCGA 5DC8A 2VQMA 5EFKB 5G10A 5G0GA 3Q9CA 5FCWA 2VQVA 3F07A 3EZPA 4RN0A 4A69A 4BZ9A 5G0HA 4QA1A 5G12A 1ZZ0A 3EW8A 4ZUPA 4QA4A 5THVA 5DC7A 5EFBD 4ZUOA 3MZ7A 5EEMA 5G1CA 3F06A 5D1DA 4QA3A 5THTA 5EENA 3EWFA 5BWZA 3MZ3A 3RQDA 4QA0A 4RN2A 4QA7A 5EFHA 4QA2A 4RN1A 4ZUQA 5G13A 3MZ4A 4QA5A 5EFGA 5G11A 3SFFA 5IWGA 5D1CA 5G1BA 5JI5A 5THUA 1T69A 3Q9EA 3EZTA 4LY1A 5EEFA 5EFNA 1C3PA 4CBTA 2VQQA 5A2SA 5FUEA 5EEKA 3ZNRA 5G1AA 4ZUNA 2VQWG 1ZZ1A 5DC5A 4BZ5A 5LI3A 3ZNSA 4BZ8A 1C3RA 5EFJD 1W22A 3C0YA 4CBYA 2V5XA 3C10A 3Q9BA 4LXZA 2VQOA 1ZZ3A 5THSA 3MENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ6 A;  2VQJ A;  5G0Y A;  1T67 A;  3F0R A;  5G0J A;  5ICN B;  4BZ7 A;  1C3S A;  5G3W A;  4BKX B;  5IX0 A;  1T64 A;  1VKG A;  5DC6 A;  4CQF A;  3C0Z A;  5EF7 A;  4ZUR A;  5G0I A;  5G0X A;  3MAX A;  4BZ6 A;  5G17 A;  4QA6 A;  2V5W A;  4ZUM A;  2GH6 A;  5EEI A;  5EF8 A;  3SFH A;  5D1B A;  3Q9F A;  2VCG A;  5DC8 A;  2VQM A;  5EFK B;  5G10 A;  5G0G A;  3Q9C A;  5FCW A;  2VQV A;  3F07 A;  3EZP A;  4RN0 A;  4A69 A;  4BZ9 A;  5G0H A;  4QA1 A;  5G12 A;  1ZZ0 A;  3EW8 A;  4ZUP A;  4QA4 A;  5THV A;  5DC7 A;  5EFB D;  4ZUO A;  3MZ7 A;  5EEM A;  5G1C A;  3F06 A;  5D1D A;  4QA3 A;  5THT A;  5EEN A;  3EWF A;  5BWZ A;  3MZ3 A;  3RQD A;  4QA0 A;  4RN2 A;  4QA7 A;  5EFH A;  4QA2 A;  4RN1 A;  4ZUQ A;  5G13 A;  3MZ4 A;  4QA5 A;  5EFG A;  5G11 A;  3SFF A;  5IWG A;  5D1C A;  5G1B A;  5JI5 A;  5THU A;  1T69 A;  3Q9E A;  3EZT A;  4LY1 A;  5EEF A;  5EFN A;  1C3P A;  4CBT A;  2VQQ A;  5A2S A;  5FUE A;  5EEK A;  3ZNR A;  5G1A A;  4ZUN A;  2VQW G;  1ZZ1 A;  5DC5 A;  4BZ5 A;  5LI3 A;  3ZNS A;  4BZ8 A;  1C3R A;  5EFJ D;  1W22 A;  3C0Y A;  4CBY A;  2V5X A;  3C10 A;  3Q9B A;  4LXZ A;  2VQO A;  1ZZ3 A;  5THS A;  3MEN A; 
#chains in the Genus database with same CATH topology
 3MZ6 A;  2PHO A;  4RHK A;  1T4R A;  2VQJ A;  4Q40 A;  5G0Y A;  4DZ4 A;  3SKK A;  1T67 A;  1P8P A;  3F0R A;  5G0J A;  3F80 A;  5ICN B;  4HZE A;  4BZ7 A;  3M1R A;  1C3S A;  5G3W A;  4RLA A;  4BKX B;  4IE2 A;  5RLA A;  5IX0 A;  1T64 A;  1VKG A;  1P8M A;  1WOG A;  1ZPG A;  4GWD A;  5DC6 A;  4CQF A;  2PLL A;  3C0Z A;  2ZAV A;  1P8N A;  3LHL A;  5EF7 A;  4IXU A;  3TH7 A;  3THJ A;  4ZUR A;  3THE A;  5G0I A;  3GN0 A;  5G0X A;  3MAX A;  4BZ6 A;  4GSV A;  1T4P A;  1RLA A;  5G17 A;  1WVA A;  3NIP A;  1HQX A;  2CEV A;  4QA6 A;  2V5W A;  2RLA A;  2GH6 A;  4ZUM A;  2AEB A;  5EEI A;  5EF8 A;  3SFH A;  5D1B A;  3Q9F A;  3SL0 A;  2VCG A;  2EF4 A;  4HXQ A;  2VQM A;  4Q3V A;  5DC8 A;  5EFK B;  3KV2 A;  5G10 A;  1WOH A;  3E8Q A;  4Q42 A;  1ZPE A;  5G0G A;  3Q9C A;  2VQV A;  3F07 A;  3EZP A;  1TBL A;  4I06 A;  1T5G A;  4RN0 A;  5FCW A;  4A69 A;  4BZ9 A;  4GSM A;  4IU0 A;  4Q3U A;  5G0H A;  1WVB A;  4QA1 A;  5G12 A;  3THH A;  1T5F A;  1HQF A;  3SL1 A;  1ZZ0 A;  1R1O A;  3MFW A;  4RHJ A;  5CEV A;  1TBJ A;  3MFV A;  3EW8 A;  3NIO A;  3SJT A;  4ZUP A;  2EIV A;  3DJ8 A;  4GWC A;  4QA4 A;  5HJ9 A;  5THV A;  5DC7 A;  5EFB D;  4ZUO A;  3MZ7 A;  5EEM A;  4Q3S A;  1PQ3 A;  5G1C A;  5HJA A;  3F06 A;  4ITY A;  5D1D A;  3CEV A;  2EF5 A;  4MYK A;  4QA3 A;  4HWW A;  1GQ6 A;  5EEN A;  3EWF A;  5THT A;  5BWZ A;  4IU5 A;  3MZ3 A;  4IE1 A;  3RQD A;  4QA0 A;  1TBH A;  4FCI A;  4GSZ A;  2A0M A;  4RN2 A;  4QA7 A;  5EFH A;  4QA2 A;  4IU1 A;  4RN1 A;  4ZUQ A;  5G13 A;  3MMR A;  3MZ4 A;  4QA5 A;  4Q3Q A;  1WOI A;  5EFG A;  5G11 A;  3SFF A;  4Q3P A;  1P8Q A;  3E8Z A;  5IWG A;  5D1C A;  5G1B A;  5JI5 A;  4RHL A;  1XFK A;  1TA1 A;  1T4T A;  3GMZ A;  3LP4 A;  3NIQ A;  4RHI A;  5THU A;  1T69 A;  3Q9E A;  3EZT A;  4LY1 A;  1P8S A;  5EFN A;  5EEF A;  4CEV A;  1C3P A;  4IU4 A;  3TF3 A;  1T4S A;  1GQ7 A;  1HQG A;  4IXV A;  4CBT A;  2VQQ A;  5A2S A;  5FUE A;  5EEK A;  4G3H A;  1CEV A;  4Q3R C;  4RHM A;  3ZNR A;  5G1A A;  3E6K A;  4ZUN A;  2VQW G;  3PZL A;  1P8O A;  4Q3R A;  1HQH A;  1ZZ1 A;  4MYL A;  1P8R A;  4RHQ A;  5DC5 A;  4BZ5 A;  4FCK A;  5LI3 A;  3ZNS A;  4BZ8 A;  1C3R A;  3MJL A;  5EFJ D;  4Q41 A;  1W22 A;  3C0Y A;  4MYF A;  4CBY A;  4Q3T A;  2V5X A;  3C10 A;  3Q9B A;  4LXZ A;  1HQ5 A;  3LP7 A;  4MYN A;  1D3V A;  2PHA A;  3E6V A;  2VQO A;  1ZZ3 A;  4IE3 A;  5THS A;  3RLA A;  3MEN A;  4MXR A;  3E9B A; 
#chains in the Genus database with same CATH homology
 3MZ6 A;  2VQJ A;  5G0Y A;  1T67 A;  3F0R A;  5G0J A;  5ICN B;  4BZ7 A;  1C3S A;  5G3W A;  4BKX B;  5IX0 A;  1T64 A;  1VKG A;  5DC6 A;  4CQF A;  3C0Z A;  5EF7 A;  4ZUR A;  5G0I A;  5G0X A;  3MAX A;  4BZ6 A;  5G17 A;  4QA6 A;  2V5W A;  4ZUM A;  2GH6 A;  5EEI A;  5EF8 A;  3SFH A;  5D1B A;  3Q9F A;  2VCG A;  5DC8 A;  2VQM A;  5EFK B;  5G10 A;  5G0G A;  3Q9C A;  5FCW A;  2VQV A;  3F07 A;  3EZP A;  4RN0 A;  4A69 A;  4BZ9 A;  5G0H A;  4QA1 A;  5G12 A;  1ZZ0 A;  3EW8 A;  4ZUP A;  4QA4 A;  5THV A;  5DC7 A;  5EFB D;  4ZUO A;  3MZ7 A;  5EEM A;  5G1C A;  3F06 A;  5D1D A;  4QA3 A;  5THT A;  5EEN A;  3EWF A;  5BWZ A;  3MZ3 A;  3RQD A;  4QA0 A;  4RN2 A;  4QA7 A;  5EFH A;  4QA2 A;  4RN1 A;  4ZUQ A;  5G13 A;  3MZ4 A;  4QA5 A;  5EFG A;  5G11 A;  3SFF A;  5IWG A;  5D1C A;  5G1B A;  5JI5 A;  5THU A;  1T69 A;  3Q9E A;  3EZT A;  4LY1 A;  5EEF A;  5EFN A;  1C3P A;  4CBT A;  2VQQ A;  5A2S A;  5FUE A;  5EEK A;  3ZNR A;  5G1A A;  4ZUN A;  2VQW G;  1ZZ1 A;  5DC5 A;  4BZ5 A;  5LI3 A;  3ZNS A;  4BZ8 A;  1C3R A;  5EFJ D;  1W22 A;  3C0Y A;  4CBY A;  2V5X A;  3C10 A;  3Q9B A;  4LXZ A;  2VQO A;  1ZZ3 A;  5THS A;  3MEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...