5ICPB

Cdk8-cycc in complex with [(s)-2-(4-chloro-phenyl)-pyrrolidin-1-yl]-(5-methyl-imidazo[5,1-b][1,3,4]thiadiazol-2-yl)-methanone
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
267
structure length
267
Chain Sequence
b'DKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-Based Optimization of Potent, Selective, and Orally Bioavailable CDK8 Inhibitors Discovered by High-Throughput Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5icpB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5icpB01
1OL1B 2C6TB 2EUFA 4F6WB 2IW8B 3EOCB 1H26B 2C4GB 4BCGB 4NSTB 1O9KA 2WIPB 4I3ZB 2B9RA 2G9XB 4ELJA 4BCMD 4F7JB 1FINB 2PK2A 3MIAB 5EFQB 4F7LB 5HVYB 4EC9B 2V22B 1H24B 2UUEB 2C5NB 4F6SB 1O9KB 4F6UB 5BNJB 1BU2A 4EC8B 1C9BA 1D3UB 4CFNB 1GUXA 3BHUB 4YOOA 1OKWB 1PKDB 2PK9B 4KRCB 1E9HB 1H25B 2PHGA 2IVXA 1QMZB 1H1SB 1GH6B 4KRDB 3MY1B 3BHTB 4CFWB 1GUXB 3RGFB 2UZEB 4EOQB 1OIYB 4EOPB 2QDJA 2BPMB 3BLQB 3M03A 1OI9B 4BCQD 1UNLD 2C5OB 2UZDB 2C5XB 1TFBA 3K7AM 1VYWB 5LMKB 1JSTB 2R7GA 3BHVB 3H4CA 4CFUB 2CCIB 3POMA 2CJMB 2WMAB 3MI9B 4F70B 2W96A 4BCFB 3DDQB 4CXAB 4EORB 4G6LB 5IF1B 4EOMB 1AD6A 2X1NB 4F7NB 2UZBB 3BLHB 1AISB 1OKVB 3DOGB 5LQFB 1FVVB 2IW6B 1ZP2A 4BCHB 4BCNB 2C5VB 4CFVB 3MY5B 2WMBB 4EOSB 2WHBB 1VOLA 4CFMB 5FGKB 4YC3B 4BCJB 2UZLB 4YOZA 2PMIB 2WPAB 2W9FA 1H28B 4YOSA 3LQ5B 1UNGD 5ACBA 2BKZB 4ROEA 4EONB 1H4LD 4BCND 1OIUB 2JGZB 4RODA 4CFXB 4IMYB 4BCMB 4II5B 5CYIB 1OGUB 5I5ZB 4OR5B 2I53A 1JSUB 4BCOB 4BCIB 1URCB 2WXVB 1XO2A 5CEIB 4UN0A 1H1PB 4FX3B 1JKWA 3TNWB 1H1RB 2WEVB 3EIDB 1JOWA 3O0GD 3DDPB 3QHRB 4CFUD 3QHWB 4EOIB 3TN8B 4CRLB 4EOOB 1KXUA 3TNIB 1W98B 2WFYB 2F2CA 2WIHB 5L2WB 3BLRB 4TTHA 1F5QB 1OL2B 3TNHB 4BCPB 1H1QB 4BCKB 1H27B 5HBHB 4EOJB 5HBEB 1G3NC 3F5XB 2W9ZA 2W99A 4BCQB 4Y72B 4EOKB 4ELLA 1N4MA 5IDPB 5HNBB 3EJ1B 2IW9B 4OGRB 1P5EB 4ROCA 2W2HA 4F7SB 1GY3B 4EOLB 1UNHD 5ICPB 5HQ0B 2I40B 5IDNB 2CCHB 3G33B 5HBJB 1VINA
chains in the Genus database with same CATH superfamily
3BG5A 4AI6A 1UGSB 2B9RA 1FINB 2PK2A 3MIAB 5EFQB 4EC9B 3A8GB 2PJQA 3BG9A 4F6UB 4CFNB 1GUXA 2ZPEB 1E9HB 2PHGA 1QMZB 2IVXA 1GH6B 3MY1B 4CFWB 3TW6A 4EOPB 1UNLD 2C5OB 2C5XB 3QYEA 1JSTB 4CFUB 4AKHA 3POMA 3X20B 4ZGJB 3DTOA 4BCFB 4CXAB 1TD6A 4G6LB 2ZZDB 2DXBB 3BLHB 4ZGEB 1AISB 5LQFB 2ZPGB 4MFEA 1ZP2A 4BCHB 3QWLA 2WHBB 5FGKB 4YC3B 4BCJB 3GTMS 2DPPB 3QZ9B 2WPAB 2W9FA 1ENWA 3LQ5B 2CYZB 5ACBA 4EONB 4OB0B 4CFXB 4IMYB 4BCMB 4II5B 5CYIB 2BS3A 4BBRM 3HB9A 1JSUB 4BCOB 1JKWA 3TNWB 4HLQA 5DQVA 3A8HB 1KXUA 2WFYB 4BCPB 4QSHA 2LW4A 1H27B 5HBEB 4BCQB 5IDPB 4ELLA 4OGRB 4ROCA 3QYHB 1OL1B 2C6TB 4BCGB 4NSTB 1O9KA 2WIPB 2G9XB 4MIMA 4M6VA 5HVYB 2CZ1B 3VKGA 3X24B 1BU2A 2ZPHB 3A8LB 1UGQB 1OKWB 1PKDB 1H1SB 3BHTB 3VYHB 3RGFB 3QYGB 1OIYB 3VKHA 2BPMB 3HZJA 1TFBA 1VYWB 2R7GA 1IREB 2CJMB 3MI9B 4F70B 2W96A 5IF1B 3DOGB 3QZ5B 1UGPB 4HL4A 4BY7X 4BCNB 2AHJB 2C5VB 3NDQA 2QDYB 2UZLB 3X26B 4JX5A 2IN3A 4ROEA 4BCND 2JGZB 4RODA 5I5ZB 4OR5B 2I53A 1URCB 1XO2A 4OB3B 4UN0A 4FX3B 1H1RB 2WEVB 3B57A 1JOWA 3O0GD 4CFUD 4CRLB 2BS2A 2QQ8A 1W98B 4TTHA 1OL2B 2W9ZA 4HNVA 2CZ6B 2ZCFB 1P5EB 4HNUA 2W2HA 4FM4B 1UNHD 5ICPB 2KR6A 5HQ0B 2KMGA 5IDNB 2CCHB 3G33B 2EUFA 4F6WB 3EOCB 1H26B 2C4GB 2ZPIB 4I3ZB 4ELJA 4BCMD 5DQWA 4F7LB 1E7PA 2UUEB 4F6SB 4ZGDB 1C9BA 4YOOA 2PK9B 1H25B 2DMEA 1GUXB 4EOQB 3QYBA 2QF7A 3M03A 1OI9B 4BCQD 2UZDB 4BBSM 3X25B 3BHVB 3H4CA 4JX6A 2WMAB 3HO8A 2CZ0B 2WJ9A 3DDQB 4EOMB 1AD6A 2X1NB 1V29B 2UZBB 4LOCA 1OKVB 1FVVB 4CFVB 3MY5B 2WMBB 3WVEB 3HHTB 4EOSB 3KHIA 1VOLA 4YOZA 2PMIB 1H28B 4YOSA 3BG3A 3PO3S 2G77A 1H4LD 1OIUB 2QGSA 4OB2B 4BCIB 2WXVB 3EIDB 3QXEB 4EOIB 3QHWB 2BS4A 3BLRB 3TNHB 5HBHB 3HBLA 5HNBB 5IHYA 1GY3B 4EOLB 4F7NB 1D3UB 1VINA 2ZPFB 2IW8B 2D0QB 4F7JB 2V22B 1H24B 2C5NB 1O9KB 4HNTA 5BNJB 4EC8B 3BHUB 2DXCB 3WVDB 4KRCB 4BXXX 2DD5B 4KRDB 3A8OB 4JX4A 2UZEB 2QDJA 3BLQB 3K7AM 5LMKB 2CCIB 4AKIA 4EORB 1QLBA 1UGRB 3TW7A 1AHJB 2IW6B 3DJBA 3DL1A 4NC6A 4CFMB 2DD4B 4Z6YA 1UNGD 2BKZB 2CZ7B 1OGUB 4MFDA 4OB1B 5CEIB 1H1PB 3X28B 3DDPB 3QHRB 4EOOB 3TN8B 3TNIB 4AKGA 4BY1X 3A8MB 2F2CA 2WIHB 5L2WB 1F5QB 5EJCA 2ZPBB 1H1QB 4BCKB 4EOJB 1G3NC 3F5XB 3VYGB 2W99A 4Y72B 4EOKB 1N4MA 3EJ1B 1FKMA 2IW9B 4F7SB 2QFZA 2I40B 5HBJB
chains in the Genus database with same CATH topology
1OL1B 2C6TB 2EUFA 4F6WB 2IW8B 3EOCB 1H26B 2C4GB 4BCGB 4NSTB 1O9KA 2WIPB 4I3ZB 2B9RA 2G9XB 4ELJA 4BCMD 4F7JB 1FINB 2PK2A 3MIAB 5EFQB 4F7LB 5HVYB 4EC9B 2V22B 1H24B 2UUEB 2C5NB 4F6SB 1O9KB 4F6UB 5BNJB 1BU2A 4EC8B 1C9BA 1D3UB 4CFNB 1GUXA 3BHUB 4YOOA 1OKWB 1PKDB 2PK9B 4KRCB 1E9HB 1H25B 2PHGA 2IVXA 1QMZB 1H1SB 1GH6B 4KRDB 3MY1B 3BHTB 4CFWB 1GUXB 3RGFB 2UZEB 4EOQB 1OIYB 4EOPB 2QDJA 2BPMB 3BLQB 3M03A 1OI9B 4BCQD 1UNLD 2C5OB 2UZDB 2C5XB 1TFBA 3K7AM 1VYWB 5LMKB 1JSTB 2R7GA 3BHVB 3H4CA 4CFUB 2CCIB 3POMA 2CJMB 2WMAB 3MI9B 4F70B 2W96A 4BCFB 3DDQB 4CXAB 4EORB 4G6LB 5IF1B 4EOMB 1AD6A 2X1NB 4F7NB 2UZBB 3BLHB 1AISB 1OKVB 3DOGB 5LQFB 1FVVB 2IW6B 1ZP2A 4BCHB 4BCNB 2C5VB 4CFVB 3MY5B 2WMBB 4EOSB 2WHBB 1VOLA 4CFMB 5FGKB 4YC3B 4BCJB 2UZLB 4YOZA 2PMIB 2WPAB 2W9FA 1H28B 4YOSA 3LQ5B 1UNGD 5ACBA 2BKZB 4ROEA 4EONB 1H4LD 4BCND 1OIUB 2JGZB 4RODA 4CFXB 4IMYB 4BCMB 4II5B 5CYIB 1OGUB 5I5ZB 4OR5B 2I53A 1JSUB 4BCOB 4BCIB 1URCB 2WXVB 1XO2A 5CEIB 4UN0A 1H1PB 4FX3B 1JKWA 3TNWB 1H1RB 2WEVB 3EIDB 1JOWA 3O0GD 3DDPB 3QHRB 4CFUD 3QHWB 4EOIB 3TN8B 4CRLB 4EOOB 1KXUA 3TNIB 1W98B 2WFYB 2F2CA 2WIHB 5L2WB 3BLRB 4TTHA 1F5QB 1OL2B 3TNHB 4BCPB 1H1QB 4BCKB 1H27B 5HBHB 4EOJB 5HBEB 1G3NC 3F5XB 2W9ZA 2W99A 4BCQB 4Y72B 4EOKB 4ELLA 1N4MA 5IDPB 5HNBB 3EJ1B 2IW9B 4OGRB 1P5EB 4ROCA 2W2HA 4F7SB 1GY3B 4EOLB 1UNHD 5ICPB 5HQ0B 2I40B 5IDNB 2CCHB 3G33B 5HBJB 1VINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OL1 B;  2C6T B;  2EUF A;  4F6W B;  2IW8 B;  3EOC B;  1H26 B;  2C4G B;  4BCG B;  4NST B;  1O9K A;  2WIP B;  4I3Z B;  2B9R A;  2G9X B;  4ELJ A;  4BCM D;  4F7J B;  1FIN B;  2PK2 A;  3MIA B;  5EFQ B;  4F7L B;  5HVY B;  4EC9 B;  2V22 B;  1H24 B;  2UUE B;  2C5N B;  4F6S B;  1O9K B;  4F6U B;  5BNJ B;  1BU2 A;  4EC8 B;  1C9B A;  1D3U B;  4CFN B;  1GUX A;  3BHU B;  4YOO A;  1OKW B;  1PKD B;  2PK9 B;  4KRC B;  1E9H B;  1H25 B;  2PHG A;  2IVX A;  1QMZ B;  1H1S B;  1GH6 B;  4KRD B;  3MY1 B;  3BHT B;  4CFW B;  1GUX B;  3RGF B;  2UZE B;  4EOQ B;  1OIY B;  4EOP B;  2QDJ A;  2BPM B;  3BLQ B;  3M03 A;  1OI9 B;  4BCQ D;  1UNL D;  2C5O B;  2UZD B;  2C5X B;  1TFB A;  3K7A M;  1VYW B;  5LMK B;  1JST B;  2R7G A;  3BHV B;  3H4C A;  4CFU B;  2CCI B;  3POM A;  2CJM B;  2WMA B;  3MI9 B;  4F70 B;  2W96 A;  4BCF B;  3DDQ B;  4CXA B;  4EOR B;  4G6L B;  5IF1 B;  4EOM B;  1AD6 A;  2X1N B;  4F7N B;  2UZB B;  3BLH B;  1AIS B;  1OKV B;  3DOG B;  5LQF B;  1FVV B;  2IW6 B;  1ZP2 A;  4BCH B;  4BCN B;  2C5V B;  4CFV B;  3MY5 B;  2WMB B;  4EOS B;  2WHB B;  1VOL A;  4CFM B;  5FGK B;  4YC3 B;  4BCJ B;  2UZL B;  4YOZ A;  2PMI B;  2WPA B;  2W9F A;  1H28 B;  4YOS A;  3LQ5 B;  1UNG D;  5ACB A;  2BKZ B;  4ROE A;  4EON B;  1H4L D;  4BCN D;  1OIU B;  2JGZ B;  4ROD A;  4CFX B;  4IMY B;  4BCM B;  4II5 B;  5CYI B;  1OGU B;  5I5Z B;  4OR5 B;  2I53 A;  1JSU B;  4BCO B;  4BCI B;  1URC B;  2WXV B;  1XO2 A;  5CEI B;  4UN0 A;  1H1P B;  4FX3 B;  1JKW A;  3TNW B;  1H1R B;  2WEV B;  3EID B;  1JOW A;  3O0G D;  3DDP B;  3QHR B;  4CFU D;  3QHW B;  4EOI B;  3TN8 B;  4CRL B;  4EOO B;  1KXU A;  3TNI B;  1W98 B;  2WFY B;  2F2C A;  2WIH B;  5L2W B;  3BLR B;  4TTH A;  1F5Q B;  1OL2 B;  3TNH B;  4BCP B;  1H1Q B;  4BCK B;  1H27 B;  5HBH B;  4EOJ B;  5HBE B;  1G3N C;  3F5X B;  2W9Z A;  2W99 A;  4BCQ B;  4Y72 B;  4EOK B;  4ELL A;  1N4M A;  5IDP B;  5HNB B;  3EJ1 B;  2IW9 B;  4OGR B;  1P5E B;  4ROC A;  2W2H A;  4F7S B;  1GY3 B;  4EOL B;  1UNH D;  5ICP B;  5HQ0 B;  2I40 B;  5IDN B;  2CCH B;  3G33 B;  5HBJ B;  1VIN A; 
#chains in the Genus database with same CATH topology
 3BG5 A;  4AI6 A;  1UGS B;  2B9R A;  1FIN B;  2PK2 A;  3MIA B;  5EFQ B;  4EC9 B;  3A8G B;  2PJQ A;  3BG9 A;  4F6U B;  4CFN B;  1GUX A;  2ZPE B;  1E9H B;  2PHG A;  1QMZ B;  2IVX A;  1GH6 B;  3MY1 B;  4CFW B;  3TW6 A;  4EOP B;  1UNL D;  2C5O B;  2C5X B;  3QYE A;  1JST B;  4CFU B;  4AKH A;  3POM A;  3X20 B;  4ZGJ B;  3DTO A;  4BCF B;  4CXA B;  1TD6 A;  4G6L B;  2ZZD B;  2DXB B;  3BLH B;  4ZGE B;  1AIS B;  5LQF B;  2ZPG B;  4MFE A;  1ZP2 A;  4BCH B;  3QWL A;  2WHB B;  5FGK B;  4YC3 B;  4BCJ B;  3GTM S;  2DPP B;  3QZ9 B;  2WPA B;  2W9F A;  1ENW A;  3LQ5 B;  2CYZ B;  5ACB A;  4EON B;  4OB0 B;  4CFX B;  4IMY B;  4BCM B;  4II5 B;  5CYI B;  2BS3 A;  4BBR M;  3HB9 A;  1JSU B;  4BCO B;  1JKW A;  3TNW B;  4HLQ A;  5DQV A;  3A8H B;  1KXU A;  2WFY B;  4BCP B;  4QSH A;  2LW4 A;  1H27 B;  5HBE B;  4BCQ B;  5IDP B;  4ELL A;  4OGR B;  4ROC A;  3QYH B;  1OL1 B;  2C6T B;  4BCG B;  4NST B;  1O9K A;  2WIP B;  2G9X B;  4MIM A;  4M6V A;  5HVY B;  2CZ1 B;  3VKG A;  3X24 B;  1BU2 A;  2ZPH B;  3A8L B;  1UGQ B;  1OKW B;  1PKD B;  1H1S B;  3BHT B;  3VYH B;  3RGF B;  3QYG B;  1OIY B;  3VKH A;  2BPM B;  3HZJ A;  1TFB A;  1VYW B;  2R7G A;  1IRE B;  2CJM B;  3MI9 B;  4F70 B;  2W96 A;  5IF1 B;  3DOG B;  3QZ5 B;  1UGP B;  4HL4 A;  4BY7 X;  4BCN B;  2AHJ B;  2C5V B;  3NDQ A;  2QDY B;  2UZL B;  3X26 B;  4JX5 A;  2IN3 A;  4ROE A;  4BCN D;  2JGZ B;  4ROD A;  5I5Z B;  4OR5 B;  2I53 A;  1URC B;  1XO2 A;  4OB3 B;  4UN0 A;  4FX3 B;  1H1R B;  2WEV B;  3B57 A;  1JOW A;  3O0G D;  4CFU D;  4CRL B;  2BS2 A;  2QQ8 A;  1W98 B;  4TTH A;  1OL2 B;  2W9Z A;  4HNV A;  2CZ6 B;  2ZCF B;  1P5E B;  4HNU A;  2W2H A;  4FM4 B;  1UNH D;  5ICP B;  2KR6 A;  5HQ0 B;  2KMG A;  5IDN B;  2CCH B;  3G33 B;  2EUF A;  4F6W B;  3EOC B;  1H26 B;  2C4G B;  2ZPI B;  4I3Z B;  4ELJ A;  4BCM D;  5DQW A;  4F7L B;  1E7P A;  2UUE B;  4F6S B;  4ZGD B;  1C9B A;  4YOO A;  2PK9 B;  1H25 B;  2DME A;  1GUX B;  4EOQ B;  3QYB A;  2QF7 A;  3M03 A;  1OI9 B;  4BCQ D;  2UZD B;  4BBS M;  3X25 B;  3BHV B;  3H4C A;  4JX6 A;  2WMA B;  3HO8 A;  2CZ0 B;  2WJ9 A;  3DDQ B;  4EOM B;  1AD6 A;  2X1N B;  1V29 B;  2UZB B;  4LOC A;  1OKV B;  1FVV B;  4CFV B;  3MY5 B;  2WMB B;  3WVE B;  3HHT B;  4EOS B;  3KHI A;  1VOL A;  4YOZ A;  2PMI B;  1H28 B;  4YOS A;  3BG3 A;  3PO3 S;  2G77 A;  1H4L D;  1OIU B;  2QGS A;  4OB2 B;  4BCI B;  2WXV B;  3EID B;  3QXE B;  4EOI B;  3QHW B;  2BS4 A;  3BLR B;  3TNH B;  5HBH B;  3HBL A;  5HNB B;  5IHY A;  1GY3 B;  4EOL B;  4F7N B;  1D3U B;  1VIN A;  2ZPF B;  2IW8 B;  2D0Q B;  4F7J B;  2V22 B;  1H24 B;  2C5N B;  1O9K B;  4HNT A;  5BNJ B;  4EC8 B;  3BHU B;  2DXC B;  3WVD B;  4KRC B;  4BXX X;  2DD5 B;  4KRD B;  3A8O B;  4JX4 A;  2UZE B;  2QDJ A;  3BLQ B;  3K7A M;  5LMK B;  2CCI B;  4AKI A;  4EOR B;  1QLB A;  1UGR B;  3TW7 A;  1AHJ B;  2IW6 B;  3DJB A;  3DL1 A;  4NC6 A;  4CFM B;  2DD4 B;  4Z6Y A;  1UNG D;  2BKZ B;  2CZ7 B;  1OGU B;  4MFD A;  4OB1 B;  5CEI B;  1H1P B;  3X28 B;  3DDP B;  3QHR B;  4EOO B;  3TN8 B;  3TNI B;  4AKG A;  4BY1 X;  3A8M B;  2F2C A;  2WIH B;  5L2W B;  1F5Q B;  5EJC A;  2ZPB B;  1H1Q B;  4BCK B;  4EOJ B;  1G3N C;  3F5X B;  3VYG B;  2W99 A;  4Y72 B;  4EOK B;  1N4M A;  3EJ1 B;  1FKM A;  2IW9 B;  4F7S B;  2QFZ A;  2I40 B;  5HBJ B; 
#chains in the Genus database with same CATH homology
 1OL1 B;  2C6T B;  2EUF A;  4F6W B;  2IW8 B;  3EOC B;  1H26 B;  2C4G B;  4BCG B;  4NST B;  1O9K A;  2WIP B;  4I3Z B;  2B9R A;  2G9X B;  4ELJ A;  4BCM D;  4F7J B;  1FIN B;  2PK2 A;  3MIA B;  5EFQ B;  4F7L B;  5HVY B;  4EC9 B;  2V22 B;  1H24 B;  2UUE B;  2C5N B;  4F6S B;  1O9K B;  4F6U B;  5BNJ B;  1BU2 A;  4EC8 B;  1C9B A;  1D3U B;  4CFN B;  1GUX A;  3BHU B;  4YOO A;  1OKW B;  1PKD B;  2PK9 B;  4KRC B;  1E9H B;  1H25 B;  2PHG A;  2IVX A;  1QMZ B;  1H1S B;  1GH6 B;  4KRD B;  3MY1 B;  3BHT B;  4CFW B;  1GUX B;  3RGF B;  2UZE B;  4EOQ B;  1OIY B;  4EOP B;  2QDJ A;  2BPM B;  3BLQ B;  3M03 A;  1OI9 B;  4BCQ D;  1UNL D;  2C5O B;  2UZD B;  2C5X B;  1TFB A;  3K7A M;  1VYW B;  5LMK B;  1JST B;  2R7G A;  3BHV B;  3H4C A;  4CFU B;  2CCI B;  3POM A;  2CJM B;  2WMA B;  3MI9 B;  4F70 B;  2W96 A;  4BCF B;  3DDQ B;  4CXA B;  4EOR B;  4G6L B;  5IF1 B;  4EOM B;  1AD6 A;  2X1N B;  4F7N B;  2UZB B;  3BLH B;  1AIS B;  1OKV B;  3DOG B;  5LQF B;  1FVV B;  2IW6 B;  1ZP2 A;  4BCH B;  4BCN B;  2C5V B;  4CFV B;  3MY5 B;  2WMB B;  4EOS B;  2WHB B;  1VOL A;  4CFM B;  5FGK B;  4YC3 B;  4BCJ B;  2UZL B;  4YOZ A;  2PMI B;  2WPA B;  2W9F A;  1H28 B;  4YOS A;  3LQ5 B;  1UNG D;  5ACB A;  2BKZ B;  4ROE A;  4EON B;  1H4L D;  4BCN D;  1OIU B;  2JGZ B;  4ROD A;  4CFX B;  4IMY B;  4BCM B;  4II5 B;  5CYI B;  1OGU B;  5I5Z B;  4OR5 B;  2I53 A;  1JSU B;  4BCO B;  4BCI B;  1URC B;  2WXV B;  1XO2 A;  5CEI B;  4UN0 A;  1H1P B;  4FX3 B;  1JKW A;  3TNW B;  1H1R B;  2WEV B;  3EID B;  1JOW A;  3O0G D;  3DDP B;  3QHR B;  4CFU D;  3QHW B;  4EOI B;  3TN8 B;  4CRL B;  4EOO B;  1KXU A;  3TNI B;  1W98 B;  2WFY B;  2F2C A;  2WIH B;  5L2W B;  3BLR B;  4TTH A;  1F5Q B;  1OL2 B;  3TNH B;  4BCP B;  1H1Q B;  4BCK B;  1H27 B;  5HBH B;  4EOJ B;  5HBE B;  1G3N C;  3F5X B;  2W9Z A;  2W99 A;  4BCQ B;  4Y72 B;  4EOK B;  4ELL A;  1N4M A;  5IDP B;  5HNB B;  3EJ1 B;  2IW9 B;  4OGR B;  1P5E B;  4ROC A;  2W2H A;  4F7S B;  1GY3 B;  4EOL B;  1UNH D;  5ICP B;  5HQ0 B;  2I40 B;  5IDN B;  2CCH B;  3G33 B;  5HBJ B;  1VIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...