5ICSA

Crystal structure of 17beta-hydroxysteroid dehydrogenase type 14 apoenzyme.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
259
Chain Sequence
ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGASRSTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 96
structure length 259
sequence length 261
chains with identical sequence C, D, F
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5icsA00
2BMAA 2PD3A 4MPDA 2JJYA 5ENDA 1GFSA 4BGEA 3KEOA 1JVSA 3LT0A 3IJRA 2NTVA 5U1PA 4DTIA 3L4BC 1VC2A 3IP3A 3KLPX 3DHYA 2Y1EA 4E12A 1Y7TA 3VKUA 5DBFA 1JAXA 2DUWA 1T25A 1FDUA 1R4MA 4XZ3A 3UKOA 4B8ZA 1VI2A 2B4QA 3GUYA 3ZW8A 1ZXBA 3WICA 1PTJA 1XYGA 1PR3A 3BMNA 4LW8A 2IRWA 3HWRA 2HO5A 3JCZA 3JQ9A 3NTOA 4IIVA 4AJOA 1PL6A 4Q39A 5JE8A 3TZKA 1PJLA 1E1KA 1M6HA 3BTVA 1Y1PA 2EP7A 3CIFA 1BWSA 4HUJA 4YBZA 3DMTA 1DFIA 4L0QA 1T2AA 3KBOA 2X86A 3B1FA 4GQAA 2NVUA 4A0SA 3RKRA 1E77A 2HK9A 2YQ5A 1V3UA 4XRRA 4KQWA 4BNLA 1O95A 3MTGA 5K0ZA 3WQSB 3E03A 4WLUA 2VTEA 4PFJA 3RUIA 3FCOA 3HZZA 3H4VA 3I6IA 4ND1A 5A5FA 3WGTA 3BZUA 2VWQA 2PNFA 3RC1A 4CPDA 5THQA 1GQQA 1PL7A 1HDGO 2X58A 2VWGA 4BNHA 4RZIA 3X2FA 1ISHA 1RM5A 4KQXA 4AJ1A 3WNVA 1YDEA 1VRWA 1OI7A 2E49A 1DJQA 2O4CA 2Y1GA 5H82A 3TDKA 1Y5MA 2WD8A 2EJWA 3D4PA 3QWHA 5MGBA 4GMFA 3G0OA 5BSHA 1X15A 1DB3A 2J5RA 3CH6A 5I7VA 4DYVA 4FDAA 3UVEA 1NPDA 1LSOA 9LDTA 3RFXA 4FCCA 5JY1A 4O63O 1QXSA 2DC1A 5THKA 1LDBA 1VJTA 3VDRA 4GSKA 3ANMA 1NX6A 3SJUA 3BMCA 2QZ9A 4CLXA 1QYXA 3DWFA 3GNTA 4EJMA 3DQPA 1E6UA 1FK8A 4UUNA 3WGOA 1A4IA 1ZJYA 1FJHA 2YUTA 2AEMA 4FFPA 2GGSA 3PQDA 2FSVA 3DAFA 3WGQA 2AA3A 3LQFA 2ZYGA 4DPLA 4OYRA 3SJ7A 4D45A 3OETA 4NU6A 2NU7A 3MTJA 3DB2A 4WLOA 4PVCA 1EFKA 2Q45A 4DBZA 3IL2A 4RGBA 1U4OA 2O2YA 2DKNA 1LRKA 3I4CA 2WM3A 1IUKA 2IXBA 3PJGA 4U8GA 4L4SA 5B4UA 2OP1A 3GLQA 3DBLA 2PZLA 2OMEA 1YOVA 3JQAB 4E2WA 1ZEMA 3ADOA 3GMDA 5IFLA 2IEBA 1YBMA 2D1YA 4ZU3A 3WYBA 4AJNA 3ZWYA 4AJEA 3QE3A 2PD4A 1ISMA 1LLDA 4AJHA 4A73A 3MJVA 5BR7A 1O6ZA 4WASA 1XELA 4RPGA 2H9IA 4OXYA 2JKVA 1ZSYA 3EY4A 4UEJA 3ZWBA 4JBHA 4WNCA 5TIIA 1X7GA 3GRPA 3KEQA 3WFJA 3HFGA 5FF9A 4NNJA 1YOVB 1HDZA 3FWNA 5IZCC 4R16A 1P1KA 4CV1A 1NPYA 2WJPA 2HRZA 1HYEA 1NR1A 3DOJA 3OIGA 4Q3CA 5DNAA 2J8ZA 4FGSA 4FB5A 5KVVA 3MOGA 1JW9B 4NBWA 1M67A 2JFFA 3T4XA 3TNLA 2GERA 3JV7A 3VH1A 1VSVA 2V7PA 1IULA 3ZWXA 3I9LA 4UVEA 4EITA 2Q3EA 2VWHA 4TWRA 4OGWA 5KJ1A 1NVGA 4XCVA 4B4WA 3OQ6A 4BGIA 2BFAA 1D3AA 3BYZA 3H9QA 3UXYA 1IOLA 2NACA 5I8WA 1F14A 1HDRA 1ZK2A 3QVTA 3RBVA 3UGKA 4E31A 3PQFA 5DOZA 4EYEA 3AUTA 3VDQA 1CJCA 3EDMA 4BNVA 1QRRA 3JTMA 4Q3BA 3ANNA 4OSPA 4LRTB 2X5JO 1T4DA 5EL0A 1B7GO 1W6UA 4GLLA 1LUAA 5CDUA 1K3TA 3BMOB 1V8BA 4IGEA 3WGYA 3AUAA 1HF3A 1UXKA 5F5LA 4YWJA 4CM9D 2X0JA 3JQGB 2HMTA 1DLIA 4XGIA 4BL5A 4JX8A 4UEOA 2WTBA 3D5TA 3GNQA 1EVZA 1Z45A 4UAGA 1GUZA 3Q11A 1BW9A 2NVBA 1CETA 3K8ZA 5COAA 3R1IA 5LC1A 5JC1A 3Q2IA 1H2BA 2P5YA 3AM5A 3PEFA 1VJ0A 2YY7A 3GT0A 3E82A 4G2NA 1DPGA 4DL9A 1N5DA 4F46A 3FI9A 5L45A 3SX2A 2Z95A 4JIGA 1FXSA 1J4AA 3JQGA 4NI5A 2HK8A 4Z6KA 1O9BA 4BKQA 4RL6A 5I9LA 3VAZA 5BQFA 3DTYA 3AY3A 2GRAA 1P1IA 4ZJUA 3QVXA 1DOHA 1K6IA 4O1MA 4I9HA 1LSJA 4UUMA 3TF5A 4TROA 2Q2QA 2NM0A 5K6AC 3OA0A 1KC1A 2P9GA 3M2PA 5L53A 3VZSA 3LF1A 4KWIA 2Q2VA 5A9RA 1B15A 5T57A 4J2HA 2O4UX 1K0UA 4XX0A 2DU8A 4ALMA 5A03A 5A02A 2NU9A 4WK6A 1H9BA 1NAHA 2GASA 3AUSA 1PGNA 2HQ1A 1H94A 1YONA 3DBRB 3MJSA 4WLFA 4HV4A 2EWMA 5CG1A 5CG2A 4KTTE 2C59A 2VYVD 2WSBA 1HLPA 3DHEA 1T2CA 3ONDA 4O6VA 4PG6A 4GMGA 1YL6A 4GL4A 4OOEA 4D44A 1WMAA 4CM8A 1DAOA 4IDAA 2JCVA 3E8XA 4PN3A 1QKIA 1F17A 2X7HA 3INGA 3O8QA 4OXNA 3H5NA 1T26A 2DTEA 5EMHA 1R4NA 4OIMA 1QYCA 4CMBA 1I32A 4PLYA 3AUUA 5KJCA 3K2BA 2RH8A 1LQTA 4JNKA 2WEKA 4FS3A 3NTQA 2ZCUA 1HT0A 1LDEA 1P1FA 4HP8A 1UR5A 4N5MA 4BKOA 2JFHA 1IHXA 4GVXA 2OXIA 1BSVA 4R68A 1MUUA 2BFOA 1A7AA 5G4LA 3T7CA 1XA0A 4BVAA 1R4NB 3I9JA 4D42A 5JO9A 3W4KA 4IZHA 3KZVA 4AJLA 4NIMA 3PIIA 4RVUA 1LU9A 1PWXA 5A1TA 2Y1OA 3RWBA 5JAQA 4ND2A 4MO2A 4WE3A 4A03A 4EUEA 1I2BA 4YCAA 3EZYA 4AJ2A 2EXXA 4CM7A 1ZK1A 4NJMB 1ZEJA 2ZQZA 1A5ZA 1HDOA 2YFHA 1F12A 1SCUA 3FNHA 1UDBA 2D59A 4XGKA 2CNBA 5IXSA 1PEDA 1NBOA 1PJ2A 3IUPA 4OXKA 4J9VA 1SO8A 9LDBA 3W6ZA 4B3IA 3K73O 2GF2A 1JQBA 4XR4A 1QV7A 4KP7A 2VT3A 4R1UA 2QX7A 2ZYAA 1LRLA 2G82A 3GRKA 4R1SA 4ESOA 3TJRA 2F1KA 2I9PA 2EG9A 1GEGA 4OMUA 1GUFA 1JVBA 1K2WA 4E32A 1DBVO 1MXFA 1P0CA 3I9OA 4J1TA 1IZ0A 2I67A 3LT1A 5JDCC 4BV8A 5C7IO 1ZFNA 2AMFA 2C0CA 2PKQO 4FFLA 4RO0A 4XYBA 2NV6A 3S1LA 1O8CA 1TB4A 4QFDA 1DRUA 2Y0EA 4PVDA 2X23A 5H81A 3OQ1A 3OECA 2PR2A 4IJVA 3OBBA 3U4CA 4PLTA 4J1SA 3SLKA 3ZV3A 3CXRA 3WOHA 4GH5A 1G0OA 4YPOA 1ADCA 1E7MA 3PLRA 2FRDA 1DRWA 3KYDB 4BNNA 2SCUA 1QR6A 3VH3A 3IS3A 2Q4BA 1I3MA 3QIVA 5JXWA 4QSMA 5A06A 3EYWA 5T64A 5COBA 4BO8A 4CM1A 1PZGA 3H2ZA 4WLVA 3LC1O 2XF8A 3D1LA 3Q1LA 3ZWVA 3C8MA 5EESA 3WFIA 1VSUA 1KEWA 2FPPA 4J6FA 5G4KA 2ZTLA 3AK4A 3CZRA 1VJ1A 1GUYA 3HN2A 1YQXA 2VYNA 3FD8A 2QIOA 3V1YA 3ROMA 1UDCA 3PIDA 5G0TA 3PVZA 4U0KA 2VZ8A 2EW8A 4BHTA 4JJGA 4K1LA 8LDHA 1LLUA 4MVJM 5JMPA 1GYQA 4JBGA 5GZ6A 1ZSVA 1BDMA 1NWHA 1Y9EA 2VHVA 3LYLA 4TKLA 4XYMA 2I66A 1I24A 4XEHA 1J49A 1PS0A 2HDHA 2OZPA 3JQAD 3DMTC 1ZKMA 4IQGA 1EQ2A 2XOXA 1DIAA 4XB2A 4A5OA 4R9SA 3OSUA 3VH4A 3L6DA 3PTZA 1JAYA 4HFNA 2HUNA 1RM3A 1LLQA 3PWSA 4NJOA 2DVMA 4NHEA 1WZEA 4L75A 3DO5A 2WMDA 3KO8A 4AICA 4DQXA 1IHYA 1CWUA 2FN7A 5HS6A 2LDBA 3NKLA 4GWGA 3ROPA 1SBYA 4LCEA 4MKZA 3TWOA 1VKNA 3VC7A 1WDMA 3JQBC 5F3RA 4GKVA 5AVOA 4W99A 1A9ZA 4ZVVA 4TRJA 2GO1A 2JHFA 2IZZA 3GA0A 5JDIA 3LC2O 2W8ZA 2X1HA 4A10A 3GG2A 5BNTA 3GVCA 2GPTA 1YL7A 1I36A 3DZGA 4JN6B 3RUEA 5JS6A 4JP2A 5B4VA 4IINA 4PG5A 1G6KA 3Q9UA 2BD0A 4QXMA 3O03A 4TRNA 4INAA 1D7OA 1TLTA 4M8SA 4P38A 4XDZA 2YW9A 1Q2XA 1GTMA 2W2LA 2VUTA 1EEHA 2ZTUA 1BTOA 2QQ5A 2JL1A 1VL0A 4OHUA 1BXKA 3DZFA 3OICA 4MVJD 4WGGA 2GYYA 3WGZA 3PP8A 3D4NA 3AOEA 1F0YA 3EUWA 1T4BA 5CFZA 4PLPA 4M54A 4CQLA 1HYGA 3GQVA 2CZCA 3ZHYA 3B1KA 3QWAA 3NT4A 1HE3A 3GGGA 4KOAA 1VM6A 4FPXA 4WJZA 4CR6A 1I3NA 4J4BA 5GZ3A 4Y67A 1I8TA 4YA6A 1XG5A 2A9FA 3F5SA 4E2YA 2DTDA 4ALKA 2GUGA 2RHCA 4ZHSA 4DYDA 1U5CA 2Q49A 3KVOA 5HA5A 5T67A 3UICA 3HQ4O 3NUGA 1NFFA 1BXGA 2YV3A 3M6IA 2B36A 2A92A 3D64A 3QWBA 2CSUA 2I76A 5DCUA 4J1QA 1FDSA 4CLEA 4NR0A 4XIYA 4OSOA 1SEVA 1IY8A 1E1LA 3DBLB 2ZJ1A 3IMFA 4N54A 3H9GA 1I3LA 1C1XB 2C5EA 3WLEA 4E2ZA 6LDHA 1HE4A 1CQIA 4MVJH 1A27A 1PIWA 2W4QA 3DBHB 1Q0QA 4CR7A 2RCYA 3QRWA 2DBQA 4GX2A 4XRGA 1RPNA 1PSDA 3GZNB 4QUKA 3RU7A 3DTTA 4LMRA 4R51A 4IIUA 3E9NA 4I1IA 2Q1SA 1ZBQA 2BH9A 4OM8A 1NASA 1Q7CA 1I5RA 5MDHA 3GDGA 1AXEA 1W8DA 3W8DA 4BMNA 3F4LA 4RVHA 2PGDA 4GKBA 1KVUA 1NFRA 2V6FA 4I5FA 4BV9A 5A5EA 4GVLA 2EHDA 3GPDG 4YAJA 4RF3A 1PX0A 4DIBA 1PWZA 3IKTA 2OP0A 5L4LA 2FHSA 3KETA 4HADA 1UP6A 3U0BA 3GVPA 5IDWA 4XB1A 2VCYA 2PGJA 3EC7A 4WCFB 5ICMA 1ONNA 5L4NA 3ZV4A 3IDSA 1Q7GA 4PG4A 2WE7A 4J4TA 3ZWWA 4W9NA 4NU5A 3I9MA 1E1MA 4ALIA 3E9MA 2EJVA 2XXBA 4M1QA 1X14A 3DFZA 1NWCA 1IYZA 3VZQA 4CMEA 3LF2A 1GY8A 4FJ0A 2AQHA 5GMOA 3U4DA 2UYYA 1B14A 5IG2A 5IN4A 1P1RA 4BGVA 1UP4A 2EGGA 2HAEA 8ADHA 3EAGA 4GAEA 1KVRA 4KZPA 1H93A 1M66A 5DP2A 3ROKA 4R54A 3ZHXA 2GZ1A 3WJ7A 1ZW1A 3R3SA 2PZMA 3ZU5A 1L7DA 3WDSA 3B1JA 2O48X 3AFNA 3BTUA 4PLHA 1D1TA 3OIFA 2FOIA 3KYBA 5TQVA 4CMHA 5CAEA 4BO5A 2OFPA 5AXAA 3VOSA 2EF1A 3BHJA 4TZTA 4J9UE 1SNYA 4CUJA 1JWBB 2O3QA 4E13A 1C0PA 1HL3A 4Z3KA 3K96A 5DBGA 1B8UA 5KJFA 3KUXA 3KXDA 2B37A 3PJDA 2AE1A 3QW2A 1LC3A 3IIEA 4E4YA 4W4TA 3TZQA 4DUPA 3Q9NA 3ENKA 1R0KA 3RUFA 3SXPA 2TMDA 4NBTA 4W7HA 1ZK3A 4NBRA 1IE3A 3M1AA 4DMLA 3KSZO 3ZCXA 1K6JA 4K6FA 4Q3DA 4W9NC 5KVQA 4XYGA 2BFMA 2OBNA 3GG9A 1YH3A 3IOYA 4FR5A 3ROQA 1YBVA 4R5MA 1E3WA 4PZEA 2G5CA 4KDEA 1BRMA 3UN1A 4P22A 4DQUA 7ADHA 2X5KO 3ASVA 4XQGA 1SB8A 1LQUA 4H16A 1ZIDA 4NBVA 3H3JA 3GH3A 3I4FA 5JYEA 2VN8A 1DJNA 3LU1A 3NRCA 4YB8A 2I5PO 2WD7A 1CIVA 4MP3A 1SB9A 5JBIA 1I30A 4RPJA 2Y0DA 3ZZNA 3RUCA 4YXFA 1VLLA 2YJZA 2C7VA 3G1TA 4NPCA 3RASA 4IS3A 1ISGA 1PJSA 4NBUA 4ZD6A 1T2DA 2BKAA 3PI7A 4IJWA 3WXBA 3B70A 1TA4A 4RVGA 5FFFA 1BG6A 3E5RA 3WYCA 5BSEA 3F9IA 4UUPA 1P1JA 4A7PA 1XR3A 5COQA 5ITWA 1UH5A 2OGUA 1B3RA 3FR8A 4OJNA 4AJPA 4OO3A 1ADFA 2DAPA 1OC4A 4WECA 4DC1A 4HX5A 4MIOA 1QYDA 4IGFA 2ET6A 3GN2A 3PWZA 1G1AA 4K6CA 3NT5A 1A9YA 4LRSB 3E1KA 2R6JA 3K92A 3JQBA 2JD0A 3BHIA 2P91A 4FGWA 3RSHA 3ASUA 3U4HA 3GGPA 1PQUA 5JCXA 2I3GA 1EDOA 2PA3A 1RM4A 3EVNA 1KYQA 3GPIA 1N1EA 3ZU3A 3VZPA 1P45A 4FOSA 1XWFA 4EUHA 4PLCA 1HSZA 2DBZA 4PLWA 4IDGA 1YKFA 2C2XA 3W4IA 1Z7EA 2BRUA 3U09A 1KERA 1S6YA 3AW9A 4F6LA 3A28A 4IDCA 4JJFA 3ZV6A 4X54A 2IYPA 1PQPA 1E1NA 4B79A 3HB5X 4Z9XA 3SEFA 1GL3A 3AM4A 3BA1A 2NQ8A 2H5LA 2CFCA 3PLNA 4I5GA 4J91A 3JD2A 4LVUA 2DTXA 1F8GA 4MINA 2FPIA 2CDBA 2IYOA 3FF4A 4M86A 5B1YA 2PV7A 4WEQA 1YVEI 1UZLA 5I9NA 3ZWCA 3OFSA 3DR3A 4IJKA 1P74A 3I9KA 3C1AA 4Y8VA 1EUDA 3H2SA 4YT8A 3JQ7B 4XIJA 4G5HA 4FD3A 4KWHA 2VZ9A 4GX0A 1V0JA 1NR7A 2Q1WA 2X4GA 4I9UA 2ZB4A 3RI3A 4OH1A 1H6DA 5B4TA 3RC2A 4ND4A 2PD6A 4RF2A 1C3VA 1HE5A 4DREA 5K6AA 1NPTO 1Z75A 3TFOA 3A4VA 1XEAA 1UXHA 3CUKA 4II3A 2WWRA 2DT5A 3L6OO 3H7AA 4WCDA 3WIDA 4BNZA 4GGOA 4GLOA 1OC2A 2YYYA 4DC0A 1PGPA 4TSKA 3FTPA 1AGNA 4MVJF 4D7AA 5F21A 5T8KA 2Z1MA 4UREA 1SAYA 1NFQA 4HNHA 4MIYA 3Q2KA 1Q0LA 4R69A 4YACA 2ZTMA 3AWDA 2Y99A 5JY6A 1GU7A 1QMGA 3MJ4A 1P1HA 1WMBA 4MP6A 4YQZA 3H9JA 2RHRA 4BO6A 3DZBA 1FDVA 1ENYA 3W8FA 4MVJI 5LCXA 2HLPA 2IE0A 1YJQA 1VL6A 1LTHR 3GAFA 3M1LA 1AN9A 1P0FA 2BELA 5EQDA 4J1NA 1H9AA 1ML3A 4J7CA 5CP8A 4RJTA 2JFGA 4FJ2A 4CLRB 3GVIA 5IN5A 3WB9A 1RKXA 4XYEA 1FDWA 1ONPA 3H8VA 3F1KA 3UW3A 5IZCA 3ZHBA 1X1EA 1N8KA 1D1SA 2CF6A 3LT4A 2QRKA 4BO3A 3IC5A 4GX5A 1V3TA 1J6UA 2VHYA 4CUZA 4TQGA 1J0XO 4U6SA 4CV3A 4CLOA 5A3JA 3U49A 4LGVA 2AEFA 1AHIA 3JQFA 4CM4A 2CDAA 4YRAA 2C54A 1ISFA 5A4DA 4BO7A 2PWZA 3GEDA 3MEQA 4JLWA 3RJ9A 1UZNA 1ZVMA 1KOLA 3NTRA 3ZWMA 2B35A 4ALJA 3DBHA 1MX3A 1WP4A 4HKTA 5IXYA 5BSGA 4BIIA 3I6QA 1HDYA 5KTKA 1X7HA 3AY6A 2DUUA 1MB4A 4Z0PA 2HRBA 3UFXA 1VKOA 2PKRA 3IKVA 4TVBA 2YHIA 3GHHA 4H3VA 2O3SA 2GN4A 2CUKA 4YRDA 5U4QA 1NVMB 3A14A 4YDRA 4DRYA 5TS3A 3DBRA 2D2IA 4GBJA 1ZXLA 4L4XA 3ONFA 4XQCA 3Q6IA 2W98A 3U9LA 5DBIA 4CMKA 4GI2A 2ZK7A 4AJJA 5BT9A 3FTNA 3PFFA 2QYSA 4ZRMA 2HJRA 2EW2A 3E18A 2Y93A 4YAEA 4AFNA 3JYLA 1GCOA 1N7HA 3BHMA 3ZV5A 2E4AA 4BMVA 5ENVA 1EQUA 3ZGYA 4CL8A 1C0LA 1P77A 1PL8A 5G4KB 4K9DA 4P4LA 4R5HA 1CF2O 1N2SA 5KCZA 3A1NA 3EK2A 2HMUA 2W2LD 1N7GA 1ZCJA 2E82A 2YQ4A 4IS2A 5I9MA 4CJXA 5DT9A 3HDYA 4IY1A 3VPSA 1LNQA 2AXQA 1PGOA 3PHJA 4FOOA 3RC7A 3CTMA 2ZYDA 1XDWA 4BOYA 5ILOA 2D3TA 2O7SA 3CZMA 4Q9NA 3VVCA 1Y81A 2Y0CA 1HYHA 1DC4A 5C37A 4UULA 3OMLA 1HWYA 3O4RA 3WSWA 4E30A 3AOGA 3JQFC 3RBXA 5FI5A 4PZDA 3CEAA 1PGJA 3JQCA 2IZ0A 3ZI0A 4CM5A 4ND3A 5JMWA 2ZJ0A 2JD1A 1NNUA 3ZNOA 3WBFA 5AXBA 1P31A 1B26A 1KETA 1ONOA 2O2SA 5C7LO 4KTVE 4U0JA 1C0KA 3L07A 4ZICA 5LDGA 3CMCO 1BVRA 4JCOA 3G1UA 5JDIC 3OA2A 1UJMA 5F5NA 1LXCA 4BNMA 4XYLA 4R1TA 1I3KA 1YRLA 4XQ9A 2D5CA 4YAGA 2FR0A 1ENOA 5TJ9A 2GCGA 3RAJA 4AJ4A 4D46A 4E3ZA 2Y68A 4MDHA 3CPSA 1EVJA 5JCJA 2AQKA 4J16A 1Z6ZA 4L9RA 4RLSA 3QVSA 3WTCA 1B16A 1GYPA 5A9TA 3RFVA 4PZCA 3C7AA 2ZIZA 4L8VA 4EJ6A 3F47A 4FIZA 2P5UA 1UAYA 3AY7A 3EVTA 3A06A 4QX6A 4WPGA 5DDIP 1QG6A 1MFPA 2NADA 3WMXA 4Z9YA 1GQYA 3HB4X 3FPCA 3PGXA 4U7WA 1H2HA 5KOIA 3RVDA 1NAIA 1H6CA 3CSDA 2WYVA 1ORRA 2C82A 5HTOA 4LSMA 3KYDA 4J7XA 3RIHA 4DPMA 3C7DB 3HG7A 1M6WA 4I08A 4B3JA 2D5AA 4EZBA 2XXJA 3FBTA 1JKIA 1U9JA 4FFNA 3GDFA 2PH5A 2VWPA 1HSOA 3HDQA 1GPJA 3OEYA 1OFGA 5F1KA 5B37A 2Z5LA 4BQPA 5BNIA 1YS4A 3BIOA 3KTDA 5JDCA 5L9AA 4YJFB 3WWYA 3FHLA 3NT2A 2WYWA 2W2KA 3PWKA 3QP9A 3LDHA 2DLDA 1I2ZA 2J5KA 3DC2A 2XAAA 5DCYA 1QYWA 1E6WA 3CINA 1DIGA 1XQ6A 3L9WA 5C5IA 1YB1A 3GF4A 3ZHZA 3S2GA 4AJIA 1PS8A 1GYRA 4FFMA 2QRLA 3BTSA 4BUCA 3PQEA 1PZHA 4D43A 3PFWO 5ICSA 2X22A 2J3HA 3GNSA 3QVWA 5I8ZA 5L3ZA 5K9ZA 2V6GA 4IDDA 1KEUA 1E7QA 1J5PA 1QP8A 1A72A 1TXGA 3E6AA 4B8WA 1AHHA 4E5YA 1ZJZA 3NYWA 3ZWNA 1MC5A 1BDBA 3IAHA 4NG5A 3ANLA 4PCVA 5KVCA 1LSSA 2CMDA 2Y1FA 3D4OA 4HY3A 2RH4A 5EQFA 1GV0A 1SOWA 3C85A 3ZNNA 4R9RA 4MVJA 2Q99A 3JQ7A 2P9EA 3CMMA 3QSGA 1R4MB 4CQMD 1NQAO 1PQWA 5ADHA 3OH8A 1DSSG 4GSLA 1EBUA 4R41A 4W82A 1JKJA 3RJ5A 5G0UA 3EGOA 1DIHA 2VUUA 2CF5A 3T7EA 2AQ8A 4GX1A 5G2OA 3GY0A 2O3RA 1E7YA 3RROA 5KKCA 2R00A 1UXJA 1BMDA 1O94A 1DFHA 1NTOA 2H1SA 2PZKA 5DF1A 1NXQA 3I5MA 4DVJA 3N58A 1PU2A 3OEWA 3Q3CA 3PZRA 1EVYA 4EUFA 1Z73A 3FN4A 3RKUA 4S3MA 1ADGA 1U28A 1LDYA 3JQDA 4KMSA 3HADA 5JYDA 3FNFA 2OL4A 4TZKA 1VPDA 1X0VA 4J43A 1LDNA 2HMVA 4J2OA 5KJEA 1C1DA 5T5QA 3S2EA 2B4TO 4CMJA 4YYZA 1MXHA 2H6EA 1BHSA 4YT2A 4NFYA 1YGYA 2PK3A 3VHRA 1ZNQO 2D4AA 4NJMA 5FEUA 3F6YA 1A4UA 2GR9A 4WNIA 2QRJA 4YQYA 1Y9AA 3OF2A 1TT5B 3WLFA 3K31A 5G0SA 3QHAA 1PR9A 1NHGA 2OBYA 1WDKA 3GN1A 3SBOA 4NFSA 1B3BA 1X13A 4PIVA 3DOOA 2O3UA 3JQ9C 2FZEA 4RPKA 4EW6A 3ZN2A 3GMSA 5CDSA 4YAKA 1D8AA 4BNUA 4CLRA 1Y8QB 2O23A 3QA9A 3HUDA 1C1XA 1ZK4A 1ISJA 3MZ0A 4PRLA 3DZKA 2B0JA 4K28A 4II2A 2UUOA 4QT0A 3JYOA 4GGPA 4EGFA 4IDBA 4RF5A 3JSAA 1H5QA 1YQDA 5TT0A 4RDIA 4YEDA 5CEEA 3K6JA 4ZQEA 5EERA 3EHEA 2B5WA 1U7TA 2AE2A 4L4RA 2VYVA 4I8XA 3R0IA 3PK0A 1ZMOA 4Y6SA 4E6PA 4TRMA 1DRVA 4UUOA 3RU9A 4CMIB 5IDXA 4B4UA 5JSFA 1Z7BA 1QORA 3LZ6A 3V1TC 3VTZA 2Q1UA 4TVOA 4IZIA 1PJQA 4YJGA 3VTFA 3L0DA 3DZJA 5DCWA 1I01A 3GGOA 3RBZA 3RD5A 4BB6A 2C5AA 1HTBA 3TFQA 1UXIA 4DIFA 1ZSNA 4HNGA 1HXHA 3AI1A 4N18A 4CQMB 3MJEA 3B6ZA 5AYVA 1E3JA 3TPCA 2W90A 1Z82A 4H15A 4DLLA 2X0NA 1U8FO 4C7KA 1WXDA 2DBRA 3E5MA 1NQOA 1HDXA 2J6IA 5L95A 4XD2A 1KVTA 2A94A 5JNLA 1E0DA 3F1LA 4G65A 3BXXA 1U4SA 5A9SA 3DOCA 1XSEA 3QY9A 3V2UA 5AXCA 1C14A 4PLGA 4U6QA 5DOVA 1C0IA 2NVWA 3NDRA 3GOHA 1HEUA 4HBGA 5ITVA 3F4BA 3JD1A 1JKFA 1P44A 4YVFA 3SLGA 3V5NA 2Y05A 1Y5RA 4OKIA 1Q7BA 4BO1A 3FR7A 2X0RA 3R6DA 1GCUA 1GR0A 2PGLA 1QYVA 3NJ8A 4FQ8A 1ZUD1 3INRA 2VHZA 3K9QO 4J3FA 4B4VA 2GN8A 5U9CA 2HU2A 4W7IA 3D3EA 2HJSA 3PYLA 2AHRA 2CDCA 2BGKA 4PRKA 3GAZA 2PZJA 3GHYA 3CKYA 1E7WA 1QLHA 4RPHA 2GSDA 4WKGA 1NP3A 1E3LA 2Q1TA 2GNAA 1X0XA 1WDLA 3V8BA 1TVEA 4CQLB 2VRCA 1XIVA 2BFPA 2UVDA 4TMFA 1U1IA 3U62A 5IF3A 2X9VA 2TMGA 2RIRA 2GN6A 1U5AA 2FPGA 3UHAA 1EVIA 4DLAA 4Z3DA 4KUHA 1R6DA 2YHUA 4LK3A 3DAGA 1HRDA 3OJOA 1YWGO 2POQX 3F3SA 1LI4A 1DHTA 3BMOA 2RBEA 4UEKA 3TZCA 5C3MA 4NH4A 3N74A 1W73A 3BAZA 1TT7A 3DDNA 1HLDA 3RUHA 2QHXA 2DFVA 3WMWA 1YE3A 3JQ8B 1VE9A 5C7OO 3L4SO 2P4QA 1V6AA 5H83A 3COSA 1N9GB 1YBAA 2DQ4A 4OQZA 1HZZA 4CL3A 4E5PA 3DONA 1PS9A 1GEEA 2BGMA 2EKLA 4D3SA 3MWEB 5AQ1A 4D41A 3MWDB 2NWQA 2J5QA 3U4IA 4OQYA 4CMAA 5I7FA 1YO6A 1MLDA 1NM5A 4MVJE 2CD9A 3GZNA 3PRJA 4RCVA 1RJWA 2YDYA 5JAIA 4EBFA 2BLLA 1I10A 3JQ8A 4BO9A 2I99A 1MA0A 2X9GA 3NDJA 1WW8A 3OJ0A 3VKVA 1LJ8A 4BMSA 3NDIA 2EERA 4RZHA 4OOFA 3W6UA 3D3WB 4B7UA 1XQ1A 3TZ6A 4QO8A 2X9NA 3P5SA 4WLEA 3TZHA 3VVBA 3GR6A 4QO7A 4JGBA 1CDOA 3KYCB 4E5NA 3VPXA 4CM3A 3H9EO 1BXGB 1KY5A 3OJFA 3PHGA 2VHWA 3BMQA 3ETEA 3TL2A 1SZJG 1DFGA 1U3UA 1Q1NA 1PJCA 1LSUA 2E6UX 3NEPX 2UDPA 3W1VA 1M76A 3WBBA 4RQUA 5G0VA 3RCBA 3WX0A 4ZA2A 5TSDA 2DPGA 4C4OA 1ENPA 4C7JA 4TKMA 2NU6A 5EN4A 4IXTA 3WG9A 1RWBA 3NAQA 1OMOA 2O3JA 1XKQA 1MGOA 2X6TA 1YB4A 1UZMA 2VOJA 2H63A 4JBIA 3H9UA 2NU8A 4AG3A 5TNXA 1TEHA 2QW8A 4ONEA 3F5QA 3S55A 2G0TA 3SC4A 5CDGA 4M89A 2HMWA 1G0NA 2IZ1A 4P8RA 3JYPA 4J49A 1XGKA 2YV1A 5KWEA 4NQZA 2ZATA 1E3IA 1K5HA 4Q3EA 3UOGA 5KVSA 4QQRA 2P68A 1CYDA 1JTVA 1SMKA 4M49A 4UVGA 4LN1A 1CEQA 5T6BA 2HSDA 4RORA 4LCJA 4E0BA 2X5OA 1P9LA 1IB6A 4I9NA 1QV6A 3AI3A 5IAAA 1U3VA 1YXMA 1XU9A 3DMYA 4IMPA 1GDHA 2OORA 4MKRA 3QLJA 4HFRA 2AG5A 3GC6A 3WGGA 3ZWOA 3KOUA 4O5OA 4BNFA 2QYTA 5L7YA 1JA9A 5TRTA 4B4OA 2VRBA 1ZK0A 1CQJA 2BI8A 3GFBA 1S7CA 3RFTA 2VZ0A 1ULSA 4P4GA 1BW9B 4MVJP 4QTZA 4K26A 2VHXA 3HFSA 4OAQA 1W0CA 4Y6RA 3O8QB 3RUAA 4DA9A 2NNLD 5EPOA 2Z1NA 1RM0A 4ILKA 4CV0A 3UCEA 3T4EA 4IPTA 3WQQA 3JQ6A 4BNXA 1UDAA 4BNIA 4YJDA 1U3WA 3AOEC 2B5VA 2C20A 2VT2A 2EKPA 1A71A 4XA8A 1I2CA 1UAGA 4E21A 1LRJA 3WR5A 5HRUA 3ADPA 3H3FA 4IM7A 1JDJA 3FNGA 3SC6A 5TLSA 4IDEA 4PG7A 3C7CB 1U8XX 4WOKA 1ADBA 4O0LA 3WS7A 2Q50A 1TI7A 4QFCA 1PJTA 4EJ0A 2Q2WA 2GD1O 4XR9A 3HDJA 3CE6A 4Y98A 3H5RA 4J4HA 1C1DB 3OP4A 2OUIA 1FF9A 2E48A 1HZJA 4DLBA 2ZQYA 3G49A 4KDFA 3C24A 4P4NA 4RDHA 4WOJA 5TF4A 4HFMA 3I83A 4BNYA 2LDXA 4BNWA 4NZ9A 3OJEA 1YQGA 3VPHA 1NQTA 4YJHA 3WIEA 2F00A 4CR8A 3KSDO 5DN9A 4BO4A 3IJPA 3QQPA 3GEMA 3MCVA 5TT1A 4BGUA 1ZO8A 4JJIA 4CMCA 3W8EA 2ZB7A 4EI2A 3OQBA 3RUDA 3N7UA 1Z74A 3DZIA 3WTBA 1KBZA 3KYCA 5G0WA 1OBFO 3HE3A 4NFHA 1NYTA 3QWFA 4ZQBA 4ZRNA 5T8KC 3W4JA 1OAAA 3WJAA 1FMCA 1EE2A 3DFUA 3ABIA 5I7SA 2WE8A 4DPKA 1BGVA 2Y1CA 1DXYA 3O38A 3LC7O 3PJFA 4J0EA 4JK3A 4ZN6A 3I23A 3LSYA 2GZ3A 2X8LA 3L9XA 1R12A 4FFOA 3NGXA 4FC7A 5IZ4A 1UXGA 4RVSA 2JCXA 3H65A 1KIFA 3FPLA 2EGHA 1O89A 1KVSA 2G76A 1KEVA 3PZBA 1T2FA 5ILGA 1X7DA 2VTDA 1E3WB 3ZU4A 2O50A 3HJAA 3FNEA 1MP0A 1RYDA 3H5AA 4YT5A 4BNKA 4QEDA 3P2YA 4XJTA 5KKAA 4CQMA 3VH2A 4CM9A 4WLNA 4E5MA 2YDXA 3FRJA 1K89A 5HWSA 3AJRA 3TN7A 3VPFA 3WWZA 2IDZA 5A9SB 5JFOA 1H0KA 3ICCA 3UAGA 2OO5A 3ONEA 1Y8RA 1EFLA 1XLTA 3S8MA 3E48A 5JPIA 3ZH2A 2D0IA 4B3HA 4PGFA 4IUYA 3NJ4A 2E37A 2JAPA 3LT2A 4WUVA 5CDTA 3ETGA 1GPDG 4DBVO 4ZQHA 4Y9DA 3I1JA 1U2DA 2DPHA 1WWKA 2WD7B 4O59O 2ILTA 4NMHA 5BNFA 5CPBA 1CRWG 5EIOA 1IZ9A 4R01A 2I6TA 4JQCA 4XQEA 3ZWPA 3NX4A 2NSDA 4FBGA 2Y1DA 4BNTA 4MP8A 4MIEA 1U3TA 3NGLA 2FR1A 3I3OA 4AJKA 4S1VA 3EW7A 1YJ8A 4XGNA 2NQTA 2BGLA 5L40A 5BSFA 3ON5A 1DEHA 3E9QA 4LISA 1R0SA 5CEJA 4I5EA 1WZIA 2IXAA 1LEHA 4AL4A 5I7EA 3IP1A 1SEPA 2GLXA 5DULA 1ZH8A 1WNTA 4HFJA 4L76A 1JN0A 4EDFA 3FBGA 4N5LA 4B7XA 3PYXA 1DDOA 4BKRA 1BXZA 3LLVA 4G81A 4R1NA 3WGIA 4BS9A 4EEXA 4ZGWA 4F6CA 1WVGA 2PKQP 4KUGA 3RQSA 3UF0A 7MDHA 1LC0A 2BI7A 4EEZA 1ZZEA 3KV3O 1DLJA 3LVFO 5TGDA 1B0AA 4BQRA 1F8FA 2G1UA 5FI3A 3PGJA 3VZRA 1R0LA 3JYNA 3PDJA 5TJHA 5DP1A 3LLSA 1EUZA 4F45A 3ZWAA 4IQ0A 2GN9A 1LBEA 3DZHA 2HK7A 2NTNA 2ZB3A 3ICPA 4ITUA 3MJTA 1CERA 5IJZA 1ENZA 1H6BA 4YJHB 2NTJA 2X0IA 3DHNA 2DFDA 3PJEA 1E5LA 3SVTA 3QV1A 4PLFA 1KY4A 4ALLA 3P2OA 3F46A 1V35A 2D8AA 2R00C 2XPCA 4FW8A 5EJ2A 5JW6A 5CHEA 5CDYA 5HS4A 4BNGA 3PPIA 1OOEA 3WQRA 2AEJA 1LDMA 1KS9A 4NK4A 2R2GA 2CVZA 4IBOA 4UVDA 1N1GA 4FN4A 1T24A 3GK3A 1EK6A 1LLCA 3GDOA 2HKIA 4CM8B 5CEFA 3D3WA 2ZKLA 1XHLA 1BVUA 1EBFA 4TRRA 2JAHA 5F1PA 4B7CA 3DEYX 1PJ3A 2NVUB 1Q0HA 2WYUA 4JXKA 1O5IA 2Q4EA 4DQVA 4XKJA 4RF4A 5L4SA 1K6XA 1KVQA 2OOSA 4Z0HO 4YAIA 1PZEA 1QLJA 1UP7A 1JU9A 3TOXA 2AG8A 4J7UA 5JAMA 1RYEA 5JLAA 4URFA 4A2CA 2Y67A 5IDYA 1V9LA 1ISIA 1YB5A 3QWIA 2IEDA 3HDHA 1IPFA 1GAEO 2VNSA 4IXWA 3WNQA 3DBVO 4ROSA 3TRIA 3DL2A 2J3JA 1EMDA 4WEOA 4IDFA 4KUEA 1MC4A 4YTEA 3JD0A 2A35A 5JO0A 2PTGA 1FDTA 3G3EA 2CVOA 5J23A 1UUFA 2PY6A 1X1TA 2FZWA 4PLZA 4YT4A 2YV2A 3S2IA 5HM8A 4IQ8A 2DBVO 3ITKA 5A05A 4CODB 4YRBA 1YDWA 4E2XA 1IPEA 1AUPA 4CUKA 3LK7A 2FWMX 1B2LA 3PYMA 3WSVA 3OJLA 1EDZA 3GVHA 2Y66A 4YJGB 4CMEC 1N92A 2C07A 5CPFA 2Q46A 1E6EA 1I33A 1E7RA 1NHWA 5FWNA 2VNAA 3GVXA 4M55A 4GPD1 3EZLA 4WCFC 2B4RO 5KNLA 4FFRA 1DHRA 1B8PA 5B12A 1GD1O 1SC6A 2P4HX 3ENNA 5HBRA 1HDCA 3MJCA 4A26A 1Y6JA 4D0RA 4Q3AA 3ZDFA 1E7SA 3L4BA 4BO0A 3Q0EA 4MVJG 1NVTA 3RC9A 2AQIA 5TC4A 1JWAB 3ORFA 3AU9A 3K2EA 2GDZA 4DGSA 2ZCVA 4H7PA 4DXHA 3KSUA 3STHA 4BKUA 1Y8QA 2VOEA 2O3TA 4IJUA 4DMMA 2I3AA 4CM4B 4RQTA 4L73A 5TX7A 1LX6A 4PLVA 4HXYA 3OM9A 2B83A 2C2YA 2FMUA 3PXXA 4MOWA 5EINA 1M75A 3ZNPA 3UUWA 1MG5A 4U5QA 4IMRA 3D7LA 1ULUA 1HETA 1DIBA 2G17A 1PJ4A 3OIDA 5AOVA 5AXDA 2FY8A 4JROA 4F3YA 2JHGA 3O9ZA 5JCJD 3ULKA 3KB6A 2NUAA 2AW5A 2CVQA 2WDZA 1H6AA 3C3XA 1ZMTA 1F06A 4GWKA 2JCYA 2I65A 3O26A 4CMIA 5ER9A 3K30A 2V6BA 4FJ1A 4D3DA 5DZSA 3D5QA 2YHIB 3V2GA 1M2WA 4RV9A 1GZ6A 5F1OA 3IUSA 3H6KA 1GZ3A 2J3KA 4ZQFA 1ARZA 2YZ7A 4UVHA 4UVIA 1SPXA 1R16A 2UAGA 4FSHA 1R15A 4LVCA 3JQEA 4RVFA 1PZFA 3PHIA 4ALNA 1D4FA 2UUPA 1KC3A 3V1UA 4N5NA 1YL5A 3UCFA 5LDHA 3ETDA 3WYEA 1W4ZA 3K5PA 1WAMA 4E5KA 3GUCA 3HNPA 4LSWA 3P19A 2QZZA 4D79A 1O0SA 3L6EA 5IDQA 1PGQA 4J90A 1SOVA 1EE9A 1V3VA 2EKQA 3PHLA 2HCTA 1XU7A 3EMKA 2CY0A 4WCFA 4XJSA 3U3XA 2C7GA 4JP3A 1MG0A 3JD4A 3INTA 1L1FA 2JD2A 1HE2A 3QVOA 3L77A 1ID1A 3HHPA 3DXFA 3I9NA 4MKXA 2VUSA 3KRTA 3AFMA 2ZTVA 3BMNB 4ZQGA 3TL3A 5A3VA 3ITDA 3KLMX 4DIOA 5GZ1A 5JAZA 1GQ2A 2VRCD 5L7WA 1E3EA 1NQ5A 1DO8A 1E3SA 3FSRA 3G17A 4R4JA 3UH1A 2EEZA 1R66A 1GV1A 3IQDB 4N7RA 3FWZA 4R3WA 3B20A 3KM0A 1GZ4A 4L74A 4R3NA 4XWYA 1T1RA 1P33A 4BO2A 1I0ZA 1XCBA 1GADO 3MOIA 5GY7A 1IL0A 2EIHA 1TT5A 4Z0TA 3KHUA 1A7KA 1DAPA 4OL9A 4PG8A 1E92A 2PH3A 4HWKA 2PFGA 3AM3A 4QECA 3ZU2A 3UCXA 1EK5A 1DC6A 2BF7A 1WPQA 4RLHA 1MV8A 3TSCA 1VL8A 2BHLA 2FR8A 3BTOA 2UV8A 1E5QA 1QSGA 2O7QA 2V6MA 2IODA 3VPGA 4Z9FA 3S2FA 4I5DA 3TQHA 1LDGA 1U7HA 2QG4A 5KIAA 1Y8RB 4J0FA 3V2HA 4YR9A 1U2GA 2VQ3A 3X2EA 2FSSA 3HSKA 4CLHA 2DM6A 3DAPA 3HN7A 2V65A 5JC8A 3BMCB 2GZ2A 3U5TA 2A4KA 5ER6A 3WGHA 3C1TA 2RAFA 4Q3NA 4CM6A 4D3FA 4NK5A 4AVYA 4BKPA 4CLDA 1EZ4A 1KEPA 2EP5A 3AI2A 5FYDA 3PHHA 3R3JA 1LA2A 1OZAA 3I52A 3OHSX 2OHXA 2EV9A 1L7EA 3GFGA 1MFZA 2YFQA 4W6ZA 4CLOB 1WLYA 1DIRA 3P7MA 4A27A 2C29D 3JYQA 4MJLA 3A9WA 2P9CA 4FC6A 4RPLA 1DC5A 4RVDA 5ES3A 2HMSA 3ST7A 4CV2A 3ZNQA 4OKNA 4XDYA 5L7TA 5KJ6A 3D0OA 1HKUA 4NDNE 1P3DA 1T2EA 4M87A 3ZW9A 1PJBA 3NV9A 2NLOA 4DWVA 3M2TA 3AU8A 5A04A 4Y6PA 1N9GA 2VYND 3GEGA 3GZ4A 3TOZA 4D0SA 3C1OA 1T1SA 2PLAA 3G79A 2FP4A 3QJ5A 4ID9A 1DC3A 3JD3A 1EUCA 2B69A 1AXGA 2ZB8A 4BNJA 3BMQB 1B8VA 6ADHA 4ND5A 1AE1A 2P2SA 4YJFA 2J3IA 3JQAA 5L51A 1JLLA 2W2KB 4LMPA 4BB5A 4CMGA 1R37A 3PDUA 4E33A
chains in the Genus database with same CATH superfamily
1COWA 4CW7A 2FTKE 2GKGA 4JC8A 4CT5A 1KAGA 4MPDA 4E2FA 2FXVA 2JJYA 2ZYVX 4L5JA 4HYTA 3ZUGA 2OFXA 1YZNA 3Q8WA 1GFSA 2HGZA 2R4UA 4JAVC 5LDHA 4IV5A 3KQSA 3UATA 1KJJA 2JGDA 3L4BC 4BBZA 1S1CA 1FLNA 4QKQA 7GPBA 1NI3A 1FP4B 1S0UA 3FB4A 3KJZA 3IP3A 2VXYA 3UQYS 4BECA 5JRDS 2CL5A 4C0LA 4AF7A 4O2BB 4QQNA 2GOYA 3DC7A 4B6QA 3LY8A 1PW7A 2NZUG 5DBFA 1WU8A 1T25A 3RU2A 2B9EA 1DKUA 1R4MA 2Z98A 3OCCA 4B8ZA 1VI2A 2O0HA 3GUYA 4LZJA 4X61A 5C5DA 3OLVA 3ZXUB 4D25A 2Q9UA 3IEIA 4DUZB 3JCZA 3F8SA 3JQ9A 4UM5A 4X65B 3TVTA 3WMRA 1W76A 4PHTA 4BX9A 3AJ8A 3TQCA 3U4QB 4X71A 1PJLA 5AHWA 3D02A 3ETHA 4DIEA 2JI6A 2EP7A 3CIFA 1DU4A 1V7CA 1M8JA 1Q20A 2CCKA 3DMTA 4FEEA 2OHVA 3OZVA 2JI9A 3KBOA 4DSAA 3N2KB 4OMCA 1QG4A 1VHJA 3ANSA 3B1FA 3CYFA 3B8EA 4PZ9A 2VDOB 3CZCA 1DS6A 3RKRA 4A0SA 4CU5A 2HK9A 1V3UA 1O8BA 4RYDA 2CYCA 4EPYA 1USKA 4EF4A 3DWGA 5K3AA 4RZ3A 4G86A 1E9CA 4KFSA 4RIIA 1A9PA 1FB5A 3OM0A 4X24A 1Y3IA 1TF5A 2XUZA 1BN6A 2GARA 4LNUA 1DTEA 2W00A 1KDYA 4P1ZA 1XZBA 3PDHA 3EZFA 4CPDA 1GQQA 3N2IA 4X3OA 3F73A 4B3CA 1HI9A 2RJNA 5AI9A 4AECA 2YIDA 4QXRA 1ISHA 1WKVA 2IU4A 3GU3A 3LPNA 4M9ZA 4NTZA 5IUKC 4DE5A 1YDEA 2NUPA 4BUJA 2QGNA 3TDKA 3RWMB 3UJBA 5AM4A 2WD8A 3D4PA 2FG6C 3S3TA 4GMFA 4KRGA 2LNDA 2W22A 1X15A 4KLNA 9ATCA 1G64A 3CH6A 1PF7E 3LQQA 4CRWB 2AZXA 4FDAA 5HMLA 2IZOA 1CY4A 5FPKA 2IUYA 5JY1A 4CGZA 3IE1A 1Z0FA 4YLGA 2HLNA 3SCZA 3TW0A 3N9IA 2E5WA 4LEIA 4HATA 1VXRA 4HLCA 3LBYA 1OBCA 5AUOB 3VDRA 2M6RA 1SRQA 4TKVB 2QYHA 2WHEA 3SJUA 1M8FA 3INYA 3WGKA 3FOFC 1SC9A 2QZ9A 4DWWA 2FDCA 2XT6A 1C30B 1VIVA 2CWDA 1E6UA 4IZOA 2XOEA 4EGAA 1A4IA 2BDUA 5AFSA 2VJCA 1FJHA 2YUTA 2BZGA 2PZEA 3FCXA 3U7FB 1W9HA 4FE3A 2IGBA 2XGSA 2QLJA 2AA3A 3I58A 3LQFA 3USZA 1P4SA 4HH0A 2ATVA 3PUXA 2WMNB 4EKGA 2MSWA 4DC9A 2JFOA 2XUIA 1BA3A 2NU7A 4I3FA 2BJWA 4OHMA 4LE1A 3F90A 3H8JA 3DB2A 3MAJA 4WLOA 5K0NA 3S40A 4PVCA 1EFKA 4M9XA 2OPHA 4DBZA 3IL2A 1QCCA 5AKIA 3TGWA 2JFUA 4HXEB 4EB8A 1UKYA 4B35A 2QXTA 1XKTA 5IT4A 1Y3CE 1IUKA 4UOQA 3MERA 5D1HA 2QY9A 4KFTA 1RQNA 4GECA 2EBHX 2G5PA 3C1UA 4KMOA 3UXEA 2XB8A 4B0PA 1P73A 3DBLA 2JLBA 3OEED 2PZLA 1QTIA 2HWWA 2FPGB 3FVTA 3JQAB 4HR7A 1XAHA 2YN0A 4ETMA 3UUFA 1YDGA 2E1PA 3V4VB 2CV0A 1ZEMA 2HO4A 3N0TA 3GMDA 5FA8A 2AYXA 1YBMA 3KYJB 2Z6AA 1R3UA 4G5FA 4AJEA 2GCOA 2PD4A 3LQ2A 3QNWA 4G4JA 4AJHA 1OLUB 1Z3CA 4EA7A 1DAEA 4L5IA 2OBBA 1SUBA 3F6PA 3PR3A 2H9IA 5J9FA 2JKVA 5HYVA 3L2OB 3ZWBA 2AN1A 2WM8A 2GD0A 4ITRC 5TIIA 4KU4A 4F5ZA 1X7GA 4QPJC 5NULA 3WV5A 3I39X 1PHRA 2R1UA 2H3HA 4P2BA 3V4OA 5JVDF 3OT5A 4JL5A 2DR2A 4G1VA 1YA6A 3FWNA 4FR0A 4R16A 4NYMQ 4CV1A 2KHZA 3W2IA 1ZLXA 2HRZA 4A2WA 5HKOA 2IBMA 3OIGA 4YUZA 3GGSA 3EISA 4GPEA 2J8ZA 3FNIA 3KU4A 3SEQA 4RTRA 5KVVA 4UTPA 5IHXA 3MOGA 4A91A 1EHCA 2EZUA 3T4XA 3VH1A 1QX4A 1F4VA 1XQ9A 1IULA 3DLIA 5EHNA 5KWIA 4IVRA 3L6RA 3K71B 4EITA 3ND5A 2VWHA 4J0DA 4DT1B 5A0TA 2Q41A 3KSMA 4LNAA 1H2YA 3OF5A 4X7PA 3OQ6A 4B4WA 4BGIA 3EVDA 3EUFA 2B1GA 1D3AA 3FPSA 3L4KA 1RXYA 4QT4A 1SZCA 1F14A 1HDRA 2WJGA 5FULA 2UZ4A 1IRIA 2XUFA 4EYEA 2OV6A 3AUTA 3H2KA 1CJCA 1NONA 1K75A 4DMRA 2RGRA 3ESQA 3QBEA 4H1VA 2FMXA 3TLYA 4EW2A 4EEKA 1NRXA 5LOVF 1U0GA 3OFVA 4P3XA 3IPYA 3ORSA 3N8GA 1QF7A 2A1TS 5EL0A 4ZJYA 1B7GO 1M34A 3EZXA 3JYHA 3FUVA 1W6UA 4GLLA 5CDUA 5K0SA 3L1HA 4DSUA 4X94A 4MS3B 3A3YA 5ADVA 4CM9D 4FIDA 1PV1A 3AUXA 4C21A 1CQXA 1BWRA 5IKEA 3JQGB 4XW2A 3X1KA 2HMTA 4HO1X 1ZH4A 3GV0A 3W0LB 4QBGB 2R97A 3H0KA 4UEOA 2WTBA 3D5TA 3LDGA 3R7BA 3NFYA 2ZSAA 1DKMA 2XA1A 3CG4A 4UAGA 5H4GA 4RIEA 1NMEA 4QYIA 2FG7C 1GUAA 5FR1A 2WUWE 3IB3A 1JPNA 5CLJA 2P27A 4ZDWA 3I04M 4YHHB 5LD2B 1SD1A 4X1IB 3AF0A 1Z7WA 1BHO1 1POXA 4UTXA 3G8AA 3H87A 4G0QA 1TVMA 1YK0A 1H2BA 3AM5A 3CVOA 4X20A 1VJ0A 2YY7A 4JZKA 4YECA 5T4BA 3FVVA 5JNTA 3UT6A 2HA5A 2K5UA 3FI9A 5JIBA 5L45A 2QENA 5JS1A 2Z95A 3DEKA 3AVWA 1FBNA 1A9OA 1Z0DA 2QV0A 4E09A 1T29A 2QPOA 4EG1A 2GAFA 1UMDB 2PBRA 3GLGB 3SICE 2O07A 4RL6A 5AJVB 4YV1A 4CIAA 4KBGA 1ZP6A 2PVCA 1MJHA 4WY5A 2IPMA 1HR0B 2GRAA 1JDNA 4DAEA 1XEXB 2VSFA 1K6IA 3O94A 4ZZ3A 2I80A 4UU8A 1RBZA 5HF9A 3V8EA 4LY6A 3ZS8A 5E4TA 4PSAA 2ZDGA 3NDBB 2Q2QA 2INGX 5AVUA 3OA0A 1D07A 3M2PA 1M1YE 4L0MA 4MVCA 4ZXPA 3WQBA 2IOQA 2KJQA 2RBKA 4WOPA 3WK5A 5A9RA 3PC8C 5T57A 2I6UA 4IWYA 1X1SA 4HUQB 4IKEA 4XX0A 3C48A 3KWFA 4WK6A 1M8KA 2EL7A 2JDIA 4Q6WA 2JFYA 1H94A 3A6KA 1J0BA 1SCDA 2ZUTA 1XXLA 1U7ZA 2R66A 3QW4B 4WLFA 1KAOA 2WUVA 4YDHB 3V3TA 4KTTE 4LX0A 4EO7A 4FHCA 2VTBA 2R1TB 2OSVA 5KEIA 3TI7A 2EOAA 3EVGA 4FILA 4FP9A 3PE6A 4OOEA 5GADl 1Y7PA 1NLYA 2DULA 3SPXA 4IDAA 3E8XA 2LBPA 3KHSA 3DDWA 1U2GC 1QKIA 4J0QA 1FYFA 2LV8A 3INGA 1D09A 1Z5NA 2ECKA 5LLDA 4OIMA 2ZR7A 5HJ7A 4UJ3A 1WZCA 1EE1A 1I32A 3S8EA 4QYTA 1E2NA 2JGEA 4EECA 1WQ4A 2C1XA 4DCPA 5KJCA 2ATEA 1WW2A 1W5TA 5L3SA 3TD2A 3RB8A 4LVOA 2XB2A 3WAKA 5C1OA 1XMQB 2WEKA 1E9VA 4FS3A 3NHKA 4URZR 1QFXA 2BEVA 3H2JA 4GO1A 4L7VA 1HT0A 1ZXXA 2D13A 3CPHA 2QM8A 3PFIA 4MW1A 1Q0RA 5ALDA 5LBTA 3RYIA 2J9GA 2ADFA 3ME5A 1IHXA 4Y2XA 3ZQUA 4PFKA 2ID7A 3B53X 1AX9A 4LQ4A 4J76A 3RVKA 3ZVKA 1N77A 2IEGA 1J99A 1NIJA 3K8OE 2BFOA 2YUIA 3M49A 1VMEA 4F97A 4KR2A 4G0WA 3CWQA 1PZMA 1XA0A 3GP5A 1R4NB 2WJYA 2WNHA 1RHMA 2IYNA 4RKFA 4Y2HA 5EWLB 3V4ZA 3N1UA 3UWMA 1SN7A 2YZ2A 3AERB 4NIMA 1QGUB 3HY4A 4RVUA 5A1TA 3OKAA 1NUAA 3RWBA 1A9XB 5A4FS 4P80A 1QE0A 4QWMA 2CYAA 4TM7A 4WE3A 5K3OA 2W8BA 1XTQA 3LFTA 1OPXA 3EZYA 2OKGA 5EXSA 1PCXA 2WHYA 3LAWA 1MEEA 2Z5VA 2ZQZA 3PD0A 4MCJA 1VBNA 4HEHA 5ITZA 3AFOA 1F12A 1SCUA 3OMXA 1ETHA 2WF6A 3DV2A 3D8NA 4MO9A 2ZE8A 5DYNA 4DT1A 1T1EA 2OHOA 4Y6LA 1X87A 3SX0A 1CTQA 1RXUA 1O6FA 2VHCA 3ESYA 4GVPA 2BHNA 2R5WA 2ZCJA 3PC7A 3PNSA 2ATCA 1EWTA 1SO8A 4QFMA 3X43A 1Y5IA 1A77A 4I8IA 4B3IA 3K73O 1WQ1R 5TV2A 1PDOA 3EXHA 1JQBA 2D8MA 3TAXA 1ABBA 2EFJA 1AQNA 2VT3A 4WFKA 3V8PA 4ON9A 4YP0A 1HX7A 3NAGA 4P98A 4IUCS 2OYSA 3TJRA 2RONA 1XZKA 3ACBA 4FFDA 2E5FA 4TXJA 4AB1A 2EG9A 3PBKA 5BRAA 1WUKS 1YS9A 1JFLA 1JVBA 1K2WA 4PHCA 4EDHA 1DEOA 1P0CA 2VTKA 3G8YA 3U6BA 3L6BA 3LT1A 4BV8A 4Z51A 2C0CA 3GB9A 3RF7A 3SKVA 3VBEA 2EDAA 1J97A 4HGPA 2QEQA 2BGUA 4NCJA 5LQJA 4QFDA 4QYIB 3ADKA 3BZWA 2X23A 3QF4B 4FB4A 5H81A 4ENSA 3OQ1A 1V43A 4YRSA 5JNSA 5K45A 1QRDA 1WBJB 4LNUB 3D8TA 3TIIA 2H1HA 3V6LA 4OHBA 2O2XA 1JQAA 4M36A 1AO3A 3TO5A 4ZOBA 4G37A 1J0CA 2DKOA 4GH5A 2ZPAA 2FQYA 1ADCA 1XXHE 2HEIA 2NXCA 4YNBA 1R10A 3UBMA 4AMZA 1Z6GA 1DRWA 3BILA 1RRMA 3VSCA 4UD2A 4EG6A 5FV4A 3VH3A 3IS3A 2Q4BA 2WAXA 2E55A 3VBCA 2A1TR 2M1ZA 3JVVA 2TYSB 3FMOB 4PZUA 4QSMA 4C29A 1JL3A 3G2QA 5LDDC 3UBTA 1KK0A 1S4QA 2ACWA 5COBA 1PZGA 4WLVA 2PL1A 4YMSA 2JGNA 3D1LA 1XXHB 3F4KA 3TZLA 3R9XB 5EPEA 1OHHD 1Z4QA 2GPAA 2YASA 5EESA 3MWDA 1JQEA 2XUGA 4J6FA 1T4CA 3UC5A 1JSRA 1KU6A 2DMRA 4X1YB 3DO8A 2WIBA 3WB1A 4K9NA 5BSKA 1EP1B 1JMVA 2H00A 1F0PA 3ZBUA 1UDCA 1G291 3SHOA 3H05A 2UZ3A 2EW8A 1SD2A 4KIFA 4U6NA 2N1BA 3EDOA 3ER6A 1MNQA 8LDHA 4GW3A 4MVJM 5JMPA 4AUMA 5GZ6A 2OGZA 4HN2A 4GLJA 1WF6A 5FL7A 1P5ZB 4DJJA 1XRMA 1I24A 2CHFA 1J49A 2OZPA 2WUGA 1IRXA 1NA5A 3C8ZA 3JQAD 2C2KA 3IH5A 4LXHA 1Z8FA 2PO7A 2ZS9A 3C41J 2WJAA 4XB2A 3PUHA 4DV1B 2B9VA 2QVZX 1UJNA 3LP8A 4OV6B 1UWCA 4R9SA 5FPHA 3SHQA 4QJBA 4MEBA 1D9ZA 1GCAA 1QHEA 1AH2A 2CL7X 3H99A 3KG2A 2QJTA 4L75A 1IXZA 2Y1KA 3KO8A 3NC4A 4AICA 4P92A 2DLNA 5CYOA 1WSWA 4FGLA 5LBIA 3GP8A 3BWYA 2H4XA 3QKRB 1YA4A 3KELA 1U1EA 3AW8A 4G85A 3ZY3A 1RQ7A 4MVYA 4KIWA 3ROPA 5EY5B 3WLLA 2P2ZA 3C3JA 1GAXA 1AKWA 4YDQA 1OD6A 4MUEA 5BW6B 3IQWA 4XGRA 1KR5A 2DLCX 4XE5A 1EI9A 1WDMA 4MEJA 1SKYE 1VQ1A 3JQBC 4WOCA 5F3RA 2G72A 4W99A 3KEFA 1A9ZA 1SHUX 3ANYB 3NVAA 1A8SA 1CNFA 4YRJA 3K6RA 3JZMA 5JDIA 3FDXA 3GG2A 1V5EA 3AERA 5FJIA 2ZAGA 3UUGA 2A30A 1TQ4A 2QVYX 5DI3A 4B8YA 4OI0A 1YL7A 2G0AA 1I36A 3DZGA 4KDRA 4M37A 2GWRA 4JP2A 4KV9A 5PNTA 3RVNA 4P34A 2B34A 1XZMA 4KSCA 4QATA 3AEKA 4I1RA 2YW9A 2GTIA 3DFKA 2ZSFA 4NCNA 4Q24A 2P9BA 2F6RA 1ECPA 1Z6TA 3ABOB 5HOQA 5JUWA 1O2DA 2W2LA 2VUTA 4X63A 1SXJA 4M1WA 2J0UA 1EEHA 1BTOA 1MQSA 2JL1A 1DELA 2ZAYA 2AWNA 1ZU4A 1BXKA 3DZFA 1NU8A 1T0UA 1DWPA 4LHVA 1ES9A 3WGZA 1P7CA 4HXFB 3S4YA 1E9RA 4YPFA 4ENQA 2C4VA 2CZCA 2DFTA 2R1VB 4HRVA 4LPSA 3OIVA 4WTOA 3B1KA 4B3BA 3MTBA 3QWAA 4KOAA 5I9IA 1VM6A 5EXDA 3KJGA 3R6TA 1I3NA 3FNRA 5SZJA 4NCAA 4WXMA 1S3FA 1XG5A 2ZUCA 4E2YA 4W9MC 3IEVA 4ALKA 1QK5A 3HI6A 4ZHSA 4DYDA 4QFBA 3ILHA 1U5CA 4F6RB 4CI0B 1PNTA 1C3EA 2GSWA 5HA5A 4BMDA 4I4TA 3U3JA 4OU5A 2AF4C 3UICA 2EFEB 1FSFA 3CW9A 3KK0A 4P54A 1F38A 3KJIA 2R47A 4LHSA 3ZGLA 2XSZD 5GVSA 5LMNB 1UCFA 2B36A 2A92A 3D64A 3HKEB 2CSUA 5DCUA 4C0AC 1K5PA 4J1QA 2QKYA 2R60A 3AXTA 4L0CA 6CHYA 3Q3JB 3E4DA 2XV1A 3IBYA 2BN4A 3DBLB 3OCXA 3H9GA 1IOZA 1C1XB 4E2ZA 2VPQA 3IV6A 6LDHA 1BE8A 4ER5A 1CQIA 4UBKA 3R2JA 2W6PA 3OIUA 2FUG1 4RVOA 3ZKWA 2ZJYA 4RV5A 8OHMA 1GPBA 3QJYA 4EG3A 4QIHA 2B7LA 2RCYA 4L85A 3K8QA 5HDQA 2AZDA 4MICA 3W5DA 1Y1SA 1RPNA 3GZNB 1L5RA 4LYDA 3DTTA 4DV0B 2I33A 3I1IA 4IIUA 3ZD8A 3ESXA 5BUQA 3D6JA 3LKDA 3AVVA 4PC7A 1FIUA 4LXQA 2Y4NA 1HG1A 3SY8A 4BMNA 5FX2A 3R3WA 1LKZA 1BFDA 1Q0SA 3BL5A 4QBKA 4M1SA 2DBYA 1VMKA 1U9IA 4RF3A 4DIBA 4M98A 5LQCA 3GRFA 1UMDA 5L4LA 1YUMA 2AR0A 3D6HA 3EXIB 4L22A 4XB1A 4WCFB 3GJSA 4B2PA 1ONNA 5ICMA 2NZJA 3Q3EA 4D8WA 1G9SA 3HGMA 1AJEA 5LQKA 2FEOA 1Q7GA 2RG7A 1WUJS 2PZ8A 3DL7A 1KO4A 3ONVA 1XPUA 5BMVB 3JS5A 2O20A 1N0WA 2EJVA 2NXJA 2RGWA 2G4LA 3GLHB 1QDUA 4L8FA 1ZD4A 3GI1A 4AYTA 3ZJVA 1QBGA 5EMJA 2JIZD 3GYBA 3LF2A 4K9RA 2VATA 1EFCA 3Q7TA 2AQHA 4HG2A 4Q18A 1PFKA 5GMOA 4L9AA 4JDPA 1P1RA 1U1DA 3O4GA 1Y37A 2HAEA 1XTVA 8ADHA 3EAGA 4GAEA 3VKGA 3RTBA 1I3OA 1KVRA 1KFCB 1ZI8A 2ZJ2A 3MUFA 3P2MA 4HK4A 2EQAA 4KZPA 4Q00A 4RIFA 5DP2A 3I9V6 5IW8A 2JZOA 3ROKA 4BJ5A 1JA1A 3FAKA 2XF2A 3K53A 3R3SA 5E1DA 1KAEA 2BL4A 3ACCA 3WDSA 1Q7TA 2IELA 2O48X 1L5QA 1QHHA 2WTXA 3M4JA 2Q9BA 2A0UA 1D1TA 2FW6A 3FFXA 4KB5A 4M60A 4OXIA 3RK1A 2BBWA 1MOZA 2FOIA 3UA3A 3ZY2A 1M7HA 4TUYA 5TQVA 4CMHA 2DWCA 2FEKA 2O8DB 1GN8A 3AV0B 3D8RA 4TV8B 3SBEA 5DHFA 3VOSA 1LI7A 2EF1A 3BHJA 3OZXA 4J9UE 3OLYA 4CUJA 4W63A 2WF5A 1JWBB 5CBKA 2C61A 2C8LA 2DG2A 3OJCA 2WZDA 3K96A 1Y42X 1B8UA 4MYUA 5DBGA 1BMQA 1VLJA 4EZIA 1JF8A 2OZLB 2B37A 2GK6A 4N6GA 5JBNA 5LQDA 1U0TA 2NX2A 3HJHA 4C4SA 3QXHA 2WWVD 3TZQA 1DOZA 1KRHA 1VRCA 3K0HA 3MT8A 4EUNA 3ENKA 3AESB 3LVBA 4XWWA 4ZARA 5AVRA 4QPNA 1JDTA 3A2MA 3GROA 4QVIA 1QBKC 5JU6A 3A31A 4NBRA 3KSZO 3LXUX 2FRDC 2NIPA 2WJZB 4I55A 4K6FA 3IOEA 1DC8A 2ZAIA 4TN5A 4BC1A 1V5WA 3GP3A 4XYGA 2BFMA 5C18A 4JVSB 4MR8B 4NABA 1T5TA 2V45A 4L50A 1YH3A 4MQFB 4O2BA 1J24A 2ZLBA 3ROQA 4MWZA 3F9RA 4EG5A 4KSYA 1AMNA 3GLGA 3SG0A 1E3WA 2G5CA 1HT3A 2Y9PB 3A10A 1P9NA 4PCLA 1Y4AE 2D1FA 2YZKA 1CIPA 4MCIA 3T5AA 1OB5A 5IAKA 4XJVA 5FBLB 2CBXA 4P22A 3T5PA 4XQGA 1GTZA 5DHQA 5TMBA 4ZDKA 4MPJA 3M6VA 1LQUA 4GOLD 2GXUA 2Q3HA 4LBZA 4OQDA 2QQGA 2LIVA 3GD5A 3GH3A 3NC1C 3ZNPA 3N2ZB 1SKQA 2FH5B 4YV7A 3WZMA 3ZBPA 1JWLA 2H31A 4QRHA 2D7JA 3LU1A 4D80A 4DV7B 2G1PA 1F1BA 4DWJA 3N2GA 4CKBA 3BD6A 2V7VA 3QVLA 2B92A 1GQFA 3W7AA 2MSDB 5JBIA 2IIPA 1LH0A 4IH1A 1I30A 1NNI1 1N32B 1JR2A 2C9MA 4UDXX 2GFHA 3G7NA 3HM2A 3OX2A 4INPA 5FNVA 1JV2B 3RUCA 2ZIEA 5DM60 1VLLA 2YJZA 5CA0A 4FFSA 2C7VA 2B3DA 3G1TA 5BYAA 3PQ4A 1AN0A 1FUKA 2Q6VA 3CF0A 1GNVA 1J0DA 3OWHA 4Q1VA 1SVOA 4RVGA 5FFFA 1BG6A 4U7HA 4MS4A 4UUPA 4F12A 4CGYA 2C7QA 2KI5A 1XD9A 1M8GA 2BYTA 1KA9H 3ZE1B 4C4TA 3OIWA 4KHPB 5G1OA 3M4ZA 2OGUA 3NOVA 1L8AA 4FZ3A 2QB5A 4TYQA 3EGEA 5A7HA 4Q3OA 3DFMA 4HX5A 1FFBA 2ID4A 1G16A 1ESEA 1L5ZA 2WU8A 1OXBB 1QRSA 3LO5A 4CYMA 3GN2A 3QGMA 4WVFA 2O54A 2JAOA 4UBNA 1SC4A 1BRTA 3GRVA 1WD7A 2GBIA 2JD0A 3BHIA 4UU0A 2OXFA 1RZRD 3U4HA 4EL0A 2FU5C 1XNRB 2YFKA 3ICVA 4QXAA 1FNCA 3HXPA 4ESHA 1JXMA 3LUGA 1NBEA 4LDQA 1ZM2A 2L82A 4TKVA 3VZPA 1P45A 1ZJJA 2FPIB 1XWFA 1VB3A 4PLCA 1HSZA 2Z4TA 4X3PA 4RSHA 1YKFA 4LOIA 3WL7A 4X8MA 3LHDA 4K5QA 4ARAA 1Z7EA 4HMPA 3C74A 1KERA 3CC8A 3U09A 3AW9A 4H2DA 4F6LA 1G2PA 3A28A 1RIIA 2JIDA 1GLNA 3E3AA 2BM1A 2QK4A 3MCUA 1TM1E 1XZDA 2WG0A 5JYBA 2JLWA 4KIUA 1E1NA 1L5GB 5D51S 4Z9XA 1GL3A 1SCIA 3AFIA 2NQ8A 3EARA 4J91A 4QULA 4LVUA 3OT1A 3L01A 4N9WA 4B3XA 2W48A 2REOA 1YQQA 4FOTA 5BPHA 1NG9A 3ZI7A 2FI1A 3I1FA 4KQKA 1UJCA 4RK4A 4EFMA 1OV4A 3I6YA 3OJXA 3TUZC 3AR5A 5BP7A 4WEQA 1L5HB 1NOKA 1TLLA 2X0EA 2BUAA 3ZWCA 4JBYA 4GZ6A 5GZ3A 2O8EA 5A5DA 2ZROA 3DUWA 3I9KA 2EJTA 4BBPA 3WISA 4EVIA 1PQ4A 1D03A 1C3OB 3H2SA 1CUWA 4XIJA 2LD4A 1AG9A 4KWHA 3ZY4A 2VZ9A 3CW2A 1V0JA 3V97A 2PNJA 1CJUC 3CUUA 2CLDX 3R0JA 5C4IA 3FZQA 4DR7B 4JJAA 1SCJA 1CE8B 2CHVA 2HADA 3KALA 3PUJA 4NICA 1FFSA 1ZM3A 4ER3A 5LMCA 1C1HA 3PXAA 5ELLA 1U0LA 2JVKA 2V96A 3EQ6A 1FMLA 1J7KA 1GKUB 2FW9A 1NPTO 1Q0UA 2NU6B 2PL5A 4I6GA 3GLIE 4NYIR 1R8JA 3U3KA 3CUKA 4FDVA 1FS4A 4B7AA 5ES4B 2A1UA 4B9EA 3LQ1A 3T9DA 5A0FA 3L6OO 3CVXA 3WGNA 4K05A 1OFHA 2ZT5A 1V45E 5KWEA 1SZPA 4NBKA 4WCDA 4IVPA 1LLFA 3WIDA 1Z34A 2QJFA 4FXPA 4AW9A 2B8WA 4LDPA 4BZWA 4TSKA 2WV9A 1Q1BA 1DDIA 5F21A 2GRUA 2HCRA 4UREA 5JS8A 3F9CA 1SAYA 4X20B 4F2GA 4HNAB 3QUCA 3RSSA 4DHWA 4KXNA 3Q2KA 1P61B 2ODBA 4PF1A 2OG1A 4JUDX 2Y99A 3D6VA 2X2PA 1HM5A 4E07A 1P60A 2PQ2A 4YQZA 1FDVA 1ENYA 2OBMA 1UZUA 3K1TA 1HY3A 3W8FA 4NCBA 3U7JA 4P33A 4PBTA 5K3SA 1VL6A 4JI1B 3M1LA 3W2TA 4J1NA 1LK7A 2CMKA 5AVSA 5CP8A 2NXNA 2RHGB 2JFGA 3CUEF 3NBQA 3WB9A 4E88A 4F1KA 2AGVA 1FDWA 1KI8A 3C45A 2EZTA 1AGXA 5DSXA 1QS0A 1VYVA 1W1UA 1Y1QA 3P9KA 1G8SA 3UOWA 2JJMA 1VE6A 5B3KA 5GTDA 4EM6A 4BO3A 4KXFB 1PLJA 4JY7A 5EMKA 4C43A 1V3TA 2A9OA 2E4XA 3EY9A 4DY4A 4AQYB 2DX7A 2GPBA 1JE1A 1SVUA 2L69A 4PNHA 3L41A 4AN4A 3H1PA 1BH2A 4I19A 2BDTA 2NO5A 3LNCA 4HDRB 3W8NA 3ZLTA 1XZIA 4CFZA 3VTAA 3K0SA 1GN9A 1AHIA 3CUWA 1K08A 2ZDQA 4ARIA 3JQFA 1AHPA 1F0KA 2CDAA 3K94A 4UXIA 5CNJA 4DA4A 3IOCA 1GOTA 5EUCA 1IIBA 2W6ZA 4HEJA 2XRMA 1ISFA 5KX5A 1MZPA 2XYQA 2ORWA 2WWXA 4UFPA 2ZRPA 4KCGA 1D2EA 2Q3FA 1TYCA 5DYYA 3EZNA 4JLWA 4LA4A 5FTWA 1A7UA 1CIJA 3VR4D 2ZJZA 2HBYA 2B35A 4ZCSA 1SA0B 3IDAA 4N8DA 1WP4A 3RYIB 2OMKA 4C05A 4MV5A 5DWQA 1L3BA 2B8EA 4ECAA 1WETA 3K35A 3M9WA 3I6QA 4P4SA 2H48A 2MMGA 3AY6A 5B1DA 2Q5QA 4Z0PA 1RCTE 4ANFA 4H4CA 2HRBA 3GT3A 3T3HA 3UFXA 5A7FA 3SXUB 4TVBA 1DX4A 3EBOA 1A8QA 1D9XA 1N0UA 2PH7A 3WB2A 2PWBA 3SNKA 5IMBA 5JNWA 2PMBA 4N7BA 2BR5A 4YRDA 1XVVA 4UHEA 3OC6A 3WL6A 3QTLA 3VO1A 1S4MA 4DRYA 5TS3A 1JEEA 2D2IA 3G2LA 4GBJA 2JLQA 4K7JA 4PSVA 1OKKA 3ONFA 3PKIA 1N5KA 1OKKD 1PT6A 3WIBA 2W98A 3HLYA 4MQLA 3T12A 3U9LA 5LWQA 1ICIA 1WPGA 2QRGA 3EG9A 1ND5A 4NV1A 1B8NA 1NBWB 2A1IA 2JK1A 2O2HA 3PFFA 4IDHA 3R4CA 3QVGB 3E18A 3I3SR 4AFNA 3RABA 2F9MA 2WAOA 2YY6A 4DCMA 4I7EA 4F4JA 5FTJA 3RDPA 3ZV5A 4CFYA 3UANA 3PENA 2P79A 3ZGYA 4CL8A 3N8HA 4XB6B 2JJ1D 2FUCA 1JEDA 2PRYA 3C8HA 2IITA 1B6SA 2AOXA 1Y7LA 2PRKA 3EIEA 3HCBA 5AVVA 5KCZA 3KQLA 1J1ZA 1I14A 2VJYA 1U11A 3SE0A 1QIIA 2HXGA 1N7GA 2YINC 4M0UA 4HC4A 1II8B 3OD5A 3E5HA 5DT9A 3VPSA 4R2IA 1TZ2A 3PHJA 4TWJA 1G8GA 2ZYDA 1E1CB 1DBSA 1XDWA 1HURA 3JRNA 1RRFA 4TUYB 3TFWA 2Q4OA 5IVHA 1UPTA 2Z6QA 4LRXA 5GONF 4FMCF 4F3KA 3F78A 1OI2A 2YIJA 1Y81A 1DV2A 2XUQA 2PX8A 3MBOA 4XSHA 3WAJA 3AB3A 4Y2TA 1G3UA 3OMLA 4LY3A 4OYLA 4UULA 1A9XA 3A0UA 1HWYA 3O4RA 1JZQA 1OY1A 3R23A 2A0YA 3EOZA 3OZUA 2WTEA 4LV6A 1V6CA 3JQFC 3WSWA 3V6MA 1KWKA 1SKAA 2VT6A 4DIUA 5GPBA 2QQ0A 3WA6A 2XX3A 2F4NA 2FJUA 4D4JA 2FOLA 1T9GR 3AWIA 3FY4A 4WXYB 4ND3A 3ZCUA 2Y71A 4BQSA 5AUPB 5TF0A 4L72A 3VR6D 3ZNOA 5LYJB 1IEQA 5KPDA 1ZHFA 4US1R 1YZGA 5AXBA 3WBFA 1LI5A 3C3KA 4D9CA 4PQGA 3E15A 3S2UA 1ONOA 2JG3A 4D82A 1AY0A 5C7LO 3BKWA 3CIOA 2KQUA 4U0JA 1XAJA 3L07A 2IYVA 1KBQA 1BVRA 1M10A 1NVAA 2WPDD 1KY2A 3PQ2A 5F5NA 1X9GA 4R31A 5M29A 2FSIA 2WDPA 1ATIA 1Z2DA 4XYLA 4MWTA 1EJ0A 1I3KA 4LX8A 1ZZGA 4V1CI 5KYYA 3EASA 4YAGA 5TJ9A 1TK9A 2BONA 2DE0X 4MDHA 3CPSA 1E63A 2QAIA 4D9NA 5JCJA 1YULA 1NI5A 4J16A 4H27A 2XZDA 3PNMA 3GLHA 1YJXA 4IEFB 1RHUA 1ZAYA 1B16A 1YSCA 1SBCA 2A2ZA 1J9EA 3KHTA 4RD1A 2PRZA 4RL4A 2IW1A 4TGLA 5FBVB 2FUG6 2Z09A 2QQEA 1Q2UA 2ZIZA 2J87A 2AVNA 3S68A 3TE7A 1UAYA 3K72B 2Z8ZA 1XALA 2GEDA 3KT6A 4QX6A 4YN3A 4CKWA 5AKZA 1MFPA 2FK7A 2C5LA 4GQBA 1D0SA 1RMYA 3WMXA 2ECQA 2X5XA 4QYSA 1S96A 3HB4X 1Y34E 2CW5A 1JLHA 1H2HA 2GX6A 3NU1A 4TTTS 5DB4A 4OYYA 3KB8A 4QUBA 1QHHB 1ZOIA 2ISCA 2RKOA 5JZBA 3MSXA 4L78A 3F74A 4XAQA 1K6MA 4O2LA 1CY8A 3ZY5A 5AVTA 1EFHA 3TQSA 4YJ2A 1KHTA 2WYVA 4TV8A 4ZZ1A 2C82A 3MELA 4J0IA 1XWWA 1L7AA 4LSMA 3TQOA 5K6RA 2QTWB 4WBNF 3RIHA 3K1AA 1QU3A 3A2LA 3OLQA 4HNQA 3OU7A 5AW9A 1WU7A 1YCHA 1GSOA 2XXJA 3FBTA 3HCRA 1JKIA 1T3SA 4PANA 2JFNA 2Q5HA 5CVCA 3I09A 4RD2A 1ST2A 5F1KA 1Z0KA 2Z5LA 5J63A 3TRHA 4J1TC 2XR1A 3O8RA 2FPLA 2WV7A 1NXWA 3KTDA 3UA4A 4CETA 1UBCA 2JF0A 3G0BA 4UAVA 4YJFB 4XFKA 3EA4A 3G0CA 3THWA 1RC0A 4O4HF 4NNOA 1D8TA 3QP9A 4PX3A 3LDHA 1Y9DA 2DLDA 1I2ZA 3MOSA 1OJ7A 3DC2A 4PYJA 3KUDA 1PRYA 1DIGA 1RI4A 1XQ6A 1NVEA 3B36A 1UC5B 3UJHA 2QIPA 3ZHZA 4G01B 4A92A 3T9FA 1E89A 1PD0A 3AEKB 3W06A 1KMNA 1EX1A 2OM2A 4EHDA 2JIOA 1JHPA 1TYEB 5B6PA 5C53B 5ICSA 1PT7A 4TLDA 5LKRA 4JVLA 2NUAB 4U9HS 3LA6A 3IHTA 4MROA 4D9EA 1U8TA 3DKPA 3T41A 4C0WA 1DBWA 1YHZA 5KWVA 2AZMA 1TCUA 5EJAA 4IDDA 1KEUA 1NVVR 1Z28A 4EKDA 3KE8A 3E6AA 2W9XA 2AOTA 3WRYC 4B09A 3AETB 1ZJZA 3ZWNA 1TUBA 1BDBA 2FFHA 5C7IO 4P32A 1GZDA 2YWEA 3FA2A 3P27A 1U04A 3W9BA 4E1BA 1F1JA 3QBTA 2JKYA 5KDOA 2CMDA 3BIWA 2OAQ1 2Q3DA 4HNUA 2P8JA 1KZ4A 2Q5EA 5EQFA 4EOGA 4TQAA 1QH1A 1YU6A 4GKAA 1FXUA 5JD4A 2C99A 1L8XA 3EWIA 3ZNNA 2ODPA 5HJ2A 1ZD5A 4OHCA 2GXQA 1TKRA 4V3BA 3Q3GE 3WL3A 2PSFA 3Q7PA 3QVUA 1NQAO 3VVLA 1PQWA 4KL8S 4M0PA 5EIXA 2BM0A 2C88A 3P0EA 1MW8X 1EBUA 4Y2RA 1NXOA 4P36A 1JKJA 1CS0B 1JE0A 2IT1A 2PBFA 3WZ2A 3LIIA 2XXAA 4GP9A 1DQRA 2JJ1A 3WLRA 2AQ8A 2ZIXB 1HFWA 5G2OA 3V4FA 5BV2P 2ZRAA 1E61A 3ZZ0A 1K1EA 2EC5A 1UXJA 3KD2A 1G8AA 4EKEA 2YN2A 5CVJA 4KXUA 5KHOC 2OHHA 3FIJA 2V7QA 4JA2A 4BE4A 3TRJA 1NTOA 3UAZA 3S2ZA 1IWPB 1UODA 3EMVA 4YQEA 2CGEA 2ZXUA 5A3SA 5DF1A 4DVJA 1UBGA 1KTIA 1K7CA 4GOXA 4AP9A 2JA2A 4L95C 4FYKA 4Y9SA 1KPIA 2FGJA 4LECA 1EVYA 1E3MA 4EUFA 1Z73A 1QUFA 3FN4A 2B98A 1Y98A 3ZU6A 2NUPB 1FP7A 5JYDA 3GIWA 4A4DA 3W5UA 1KYVA 3M89A 1ST3A 1ZUHA 2RHWA 3GFVA 1X0VA 4J43A 3FLBA 5BWLA 1LDNA 2HMVA 4J2OA 4BMYA 2FFRA 1BU8A 3EPLA 4PGAA 3EFEA 2B4TO 2LVBA 3I2GA 4PHHA 4AZVA 2H6EA 4YYZA 2FWNA 4YT2A 1SIOA 5K4HA 1YGYA 4KWCA 5B58C 1ZNQO 3VOBA 2GEBA 2N46A 1A4UA 2GR9A 4WNIA 3E7FA 2UYQA 1BMFD 4DIKA 3IAXA 3IUMA 1TT5B 3P0RA 2VF7A 1FP4A 3RPEA 4PIVA 1XVIA 2KLHA 2FZEA 3FUXA 2GF0A 1JIUA 2X6RA 4XOUA 5EWJA 4EK9A 5EXEA 1O54A 1XNHA 1OCEA 4YMHA 1MA3A 1QIDA 1XD2B 3CZQA 4BVEA 1NVDA 2Q1XA 2WU1A 1KO8A 3T7TA 2PWAA 4IGKA 4JLAA 2NUBA 4MX8A 2I55A 3G9TA 4XARA 3UWKA 3WKDA 3ZZTA 5IMSA 5JISA 5AKYA 2BOVA 2PXCA 1M6VB 3HUDA 1C1XA 4RCYA 5FBQB 1ZK4A 5KSPA 3T54A 4PRLA 3DZKA 3KP1A 4F5YA 2UUOA 4RTLA 3O75A 3JYOA 3EVFA 1J1UA 3BSYA 5ICCA 3OCVA 4IDBA 5LFAA 5KQSA 1US8A 3EPKA 1H5QA 1YQDA 3C3CA 2GN1A 2FPMA 1V5FA 1N2ZA 1NVVQ 5TT0A 4RDIA 3AVYA 2W58A 2XCRB 1KYTA 1BJKA 1D1PA 2PSHA 2BCJQ 1P9OA 4XUGB 2HWXA 5CTJA 3AUFA 3EHEA 4ZQEA 5EERA 2AE2A 4RKWA 5A1JA 4ZYWA 2F9LA 3R0IA 3PK0A 4MA4A 4RUKA 2OUKA 4Y6SA 5CXSA 5CB4A 1AMOA 4E6PA 5GM1A 4TRMA 3FW1A 1DRVA 3BXHA 4UNPA 3RU9A 2WP0A 4L8GA 5JTUA 5JZ9A 1KZYC 2J6CA 3DZ8A 1YUNA 5FWYA 1Z7BA 3TG2A 5DHSA 2XT0A 5JJBA 3X2SA 1M0WA 2ZUBA 3L0DA 1X3SA 2R8YA 5DCWA 3L8DA 1AD2A 3WLSA 4E4RA 2C5AA 4DIFA 3TFQA 1UXIA 4G2TA 3TEMA 4EB6A 4W5TA 2HEGA 1JAHA 2XVXA 3BRWA 5BN1A 1HXHA 3AI1A 3FGOA 3VQTA 2ZU0C 4REOA 4CNBA 4F72A 4WXRA 3VV2A 2W90A 3O6VA 5J2TA 1IJKA 1KJNA 2X0NA 5TDHA 1U8FO 4C7KA 5TQ0A 1OBVA 2AV6A 2PS1A 2OO5C 5LUBA 1PNRA 4KFCA 2A9PA 5BMVA 1HDXA 2J6IA 2VF2A 4MDEA 2DERA 2P3OA 4XD2A 1KVTA 5HEKA