5ICSA

Crystal structure of 17beta-hydroxysteroid dehydrogenase type 14 apoenzyme.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
261
structure length
259
Chain Sequence
ATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRASIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGASRSTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Insights into Human 17 beta-Hydroxysteroid Dehydrogenase Type 14: First Crystal Structures in Complex with a Steroidal Ligand and with a Potent Nonsteroidal Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 17-beta-hydroxysteroid dehydrogenase 14
total genus 96
structure length 259
sequence length 261
chains with identical sequence C, D, F
ec nomenclature ec 1.1.1.-:
pdb deposition date 2016-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5icsA00
2IODA 1IE3A 5CG2A 1LU9A 4W6ZA 1SAYA 4JGBA 3OF2A 2NQTA 2WSBA 2HK8A 2VRBA 5MDHA 1GCUA 3GH3A 4H3VA 4NBWA 1MLDA 5CDSA 1MG0A 1KVRA 4XGIA 4ZICA 5JDCA 4CMGA 1J6UA 5KVVA 3F47A 3L6EA 5C3MA 4BKRA 3IJPA 5DCWA 4DXHA 3FCOA 4YR9A 3Q2IA 4Z0TA 3IP1A 4OOFA 5B12A 3IMFA 3U3XA 1LDNA 5A04A 1CERA 3GVPA 3ZHZA 4B4VA 3G49A 1C0LA 1IUKA 2PZLA 5F1OA 2GYYA 5BNTA 1OOEA 3H4VA 1T2EA 1HDGO 4XJSA 4QSMA 1KEPA 3M6IA 3WQQA 1C14A 5JO9A 2A35A 3OA2A 4P8RA 2Y93A 5C7OO 4IINA 1JVSA 2QRLA 2HKIA 2YQ4A 3KYBA 5ADHA 2QRKA 3W8EA 4CQMB 1T24A 1ZJYA 1YVEI 2Y67A 3DTTA 5A02A 1I3KA 1PR9A 1DJQA 2P2SA 3OQ1A 3OQ6A 5IXYA 5DCUA 4GKVA 2RH4A 3QRWA 1T4DA 4JIGA 4CUJA 1VE9A 3VPSA 5KWEA 1ONPA 3DHEA 5I9NA 1OAAA 4XYMA 4CV1A 5G0SA 3WGIA 4FFPA 1J0XO 4EEZA 5TRTA 2AA3A 5DT9A 2FPGA 5JYEA 2BHLA 4IMRA 1CQJA 3KHUA 3NTRA 3DAPA 3GEGA 5BSGA 3W8DA 1K89A 1DDOA 3UAGA 8LDHA 3OJ0A 5I9LA 1I5RA 4UREA 2EP7A 4GLLA 3L4BC 1Y7TA 4Y9DA 1ULSA 3LT1A 4RLSA 4PGFA 4JK3A 4BNGA 1L7EA 2ZK7A 4ZA2A 5GZ1A 1UDAA 3CTMA 5HRUA 5T6BA 1AGNA 3MEQA 2D8AA 1X7GA 4QEDA 3Q3CA 5G0UA 1C1XB 3ADOA 3BMCA 1E3IA 2CDBA 3HFGA 1GL3A 4LGVA 1X7DA 3RWBA 1HF3A 4CR7A 4ZGWA 4Y67A 4TKMA 4KDFA 3DDNA 5KOIA 1DRUA 4CMEA 1U2GA 4GAEA 3AU8A 1DOHA 4CM8B 3RU7A 3VKVA 3B1JA 1ID1A 4XQEA 5FYDA 2O3JA 4XDZA 3AOEA 4IDEA 1T25A 1ZSNA 2EKQA 5DP2A 3ZNPA 4P4LA 3NJ4A 4WE3A 3S1LA 1ZMOA 3MOIA 1DFIA 4GWKA 1MB4A 1GYRA 3I6IA 4IGFA 5EPOA 2PNFA 3VH1A 3ONEA 1HDCA 4LMPA 3CUKA 4UUMA 4DUPA 4KOAA 1XQ1A 4PLCA 3B20A 3EMKA 3OMLA 2AW5A 2VYVA 5T67A 3JYPA 4ZQFA 3NAQA 1I2BA 2IYOA 2NU9A 3Q0EA 2YV2A 4ROSA 1XWFA 5K6AA 4CMEC 1EFKA 4D42A 3M1AA 4KTVE 1GTMA 3FPLA 4XYEA 3VH3A 1MXHA 4HX5A 3H5RA 1TT5A 2NACA 2QZZA 1O89A 6ADHA 2RH8A 3GRPA 3WXBA 2GSDA 2WYUA 3I9NA 3GT0A 4RV9A 2RBEA 1BW9A 3FR8A 4I5FA 4NQZA 5TSDA 5A03A 3SC4A 2Y05A 1PL7A 1ZK2A 4FB5A 1UR5A 1I24A 1FXSA 3D64A 4XKJA 1KC1A 5EERA 1A9ZA 4S3MA 5CEEA 2TMGA 1D1TA 1NPYA 4CV3A 1HZJA 1WPQA 2FSVA 4KUGA 4TMFA 3L6DA 3KLPX 4XA8A 3JQAB 1AUPA 1WDMA 3BMNB 2Y68A 3UHAA 4FS3A 4YB8A 4YT5A 1B8UA 1YE3A 2VWPA 2CVZA 3ROQA 4TVBA 5L7TA 4BNMA 5HM8A 1DEHA 5TS3A 4CR8A 5ES3A 3ZHBA 2RIRA 4BKPA 1ADGA 3RUIA 3GEMA 2ZCUA 4TZKA 3DZJA 4P4GA 5DZSA 3NDRA 3LDHA 2VNSA 1Y5MA 1YB5A 3AY3A 1SMKA 3BXXA 3DZHA 4E2ZA 4ZN6A 4UVEA 1HE2A 3RC2A 2V65A 1LC0A 3RUHA 2PKQO 2Q1UA 1U7HA 3D3EA 2ZYAA 1TT5B 1GCOA 4XQ9A 3UVEA 1C0KA 3VTZA 1I30A 5LDHA 1XSEA 3OFSA 4E12A 2GNAA 3AUUA 3KEOA 2BGLA 4MVJG 5JY1A 4BIIA 1NQAO 1U3UA 2WD7A 1EUCA 5L45A 5CG1A 4R5MA 4AFNA 2W90A 4I5DA 4AJ4A 1KEVA 2HK7A 5GY7A 4YYZA 4MP3A 4BO9A 3DBLA 4YJHA 4HFJA 4J6FA 3TSCA 4TQGA 5JO0A 1T2FA 1Y5RA 5LCXA 4R1NA 3T4XA 4YJFA 3WSWA 1G1AA 2B35A 3Q2KA 2OHXA 5AXAA 3AY7A 4MVJE 3OIFA 1B3BA 2YV3A 1MV8A 1E0DA 2X22A 3G1TA 4HNHA 3GHYA 1E3JA 3WGGA 4KZPA 3BHMA 1LDYA 1ZMTA 4FOOA 4BNZA 1M66A 4WEQA 1K2WA 2PK3A 1PU2A 3DZFA 4WEOA 3U62A 3ICPA 1GDHA 2VYND 1N9GA 3TRIA 1J4AA 3CKYA 4K26A 4Q9NA 4RO0A 3LT2A 1RPNA 1W73A 1ZK1A 4NFYA 4RPHA 3G1UA 4WLVA 1E3WB 3HQ4O 1HE3A 2FSSA 3WIDA 1XA0A 4PFJA 1QYCA 1YDEA 3CXRA 4PN3A 3JD1A 1ZSYA 5ER6A 3B1KA 2ZB7A 4KWHA 2RHCA 3H65A 4J1QA 5F1PA 1PGPA 5HS4A 1CF2O 4CLOB 4BNKA 4WUVA 4EUEA 2I99A 4INAA 4MDHA 3FR7A 2JJYA 2PGLA 3ZWYA 1ZKMA 4MVJI 4IXWA 2YV1A 2B4RO 1EQ2A 2X0JA 4FFLA 4BNWA 1Y9AA 1U9JA 2C29D 1QKIA 1ISFA 4BGEA 3PWSA 4GSKA 1ENPA 2Y1OA 4IQ0A 1U28A 1JKJA 3EDMA 2RHRA 3S2IA 3R1IA 4YJGB 3F4BA 4YVFA 4CMIB 1NHWA 1F06A 4XGNA 3DFZA 5BT9A 3U4DA 5CHEA 1UXGA 4LCJA 4OSOA 3H8VA 3GVXA 3CSDA 4RDIA 5HTOA 1HETA 1KVSA 4A7PA 5EN4A 1DRVA 1E6EA 5FWNA 3ZZNA 1U4OA 1R0LA 3IC5A 3ZWWA 3BHIA 4BMVA 1Y9EA 1CETA 2A92A 5JDIC 3ROKA 2IE0A 3PQDA 4B7UA 3W4IA 4B4OA 4YAIA 1Y8RA 3O8QB 4BO1A 4BUCA 3QSGA 1ADCA 2NU7A 4WKGA 2QHXA 3I9OA 4YJFB 3AM4A 2HRBA 5THKA 1B7GO 4M8SA 3VZQA 3VVBA 4HKTA 2Y66A 2UAGA 5CEFA 1DLIA 3FHLA 3EY4A 1BMDA 1RM4A 4H7PA 4PVCA 5JY6A 3JQ7A 4C4OA 2ZTVA 2I66A 3OQBA 1EUZA 2AHRA 4J0FA 3CH6A 3RUFA 2BFPA 2XPCA 1Y81A 4GBJA 1ZUD1 3WWYA 2PZMA 4E5YA 4MIEA 3E5MA 1W6UA 3HB4X 5TX7A 1BDBA 1E92A 3SLKA 4PG5A 4XR9A 1LBEA 4YPOA 2C0CA 4D3SA 3Q6IA 4FGSA 1BHSA 2YYYA 4GQAA 5LDGA 1LSSA 3JV7A 3JQAA 3PZRA 1OC2A 5JSFA 1JQBA 1ZNQO 3L6OO 1MG5A 2EJWA 3N74A 5C5IA 1LSOA 2PKRA 2UV8A 4OIMA 5TJHA 2ZKLA 4YT8A 1JA9A 4BV9A 5F1KA 1JKFA 4AJEA 3GNSA 2PGJA 3W6ZA 2HCTA 1SEPA 2Y0CA 2P91A 2EKLA 2ET6A 2P9EA 1E7YA 4RVSA 1DBVO 2CSUA 1ZSVA 3WICA 1LLUA 5DDIP 1HDRA 1UZLA 3N58A 3H7AA 1VPDA 4W4TA 4ALNA 1GAEO 5T64A 3VH2A 4B7XA 2DU8A 2HO5A 3ICCA 2R00A 3JQFC 1MFPA 3WDSA 3JD0A 3JCZA 3H9QA 4L4XA 3I9KA 5K0ZA 4E2WA 1IULA 4XQCA 2VQ3A 2WYVA 2EGGA 4L73A 3CZMA 1EE2A 1YQDA 1Y8QB 4TROA 3SVTA 1HDXA 3W4JA 4KMSA 4J7CA 2DUWA 3GGPA 3C7CB 4FW8A 3VPXA 1U1IA 3KYDB 3LLSA 1AN9A 4BQPA 4DTIA 3AI1A 3V1YA 1V3VA 1RYDA 1SOVA 1Y8RB 2GRAA 1LQUA 3O8QA 4ND3A 4XRRA 3AUSA 3DZBA 1X0XA 4CODB 1OC4A 2CDCA 5AYVA 4RVDA 2X5OA 3TPCA 3UKOA 1LDGA 4CV2A 4PLYA 3TNLA 3DBHA 1P45A 4R1UA 1I3LA 3ANMA 1B0AA 4IDBA 1QSGA 3TZ6A 1PGOA 2VT2A 4GWGA 3AOEC 2XXBA 4K6FA 3C24A 5KCZA 1FDTA 2O7QA 5JAQA 4RVUA 1HSZA 2DKNA 4EI2A 4G65A 1N9GB 3FPCA 1VC2A 1W0CA 5G4LA 1DIHA 4A10A 2WJPA 4NBVA 3QW2A 1DIGA 4U0KA 1IHXA 2PZKA 5IZCC 2G5CA 4AL4A 4XDYA 2A4KA 4MP6A 3P2YA 3E48A 4BKQA 4ZU3A 3T7EA 3U4IA 1VJTA 2P9CA 1P33A 3GQVA 2OP1A 3LC2O 2Y1CA 1K3TA 1VM6A 3JQ8A 4AVYA 4BNXA 3U4HA 1NAHA 3NV9A 3JYQA 4M55A 2C2YA 5A05A 2CD9A 3QLJA 1NFFA 4F45A 1QLHA 2A94A 3HUDA 3JTMA 4BNFA 4DPLA 1HDYA 2Y99A 3O26A 3WTCA 1HLPA 2FY8A 4DRYA 4JBIA 3ROMA 2X8LA 1T1RA 3CINA 3GVIA 3LYLA 5ICMA 1IPEA 3EK2A 2GZ2A 5G0WA 5ITVA 5B1YA 3MJCA 1F8FA 1RM0A 2G1UA 2VOEA 1BG6A 2X0IA 4L9RA 2IZZA 3ETGA 2HRZA 1F17A 3KM0A 4AG3A 3M2TA 4NG5A 3W6UA 4OKNA 1GZ6A 4ID9A 2I65A 1K6XA 4IIUA 5CDGA 3ZWCA 3WFIA 2NTVA 1NBOA 4BNVA 2EV9A 1E7RA 2J8ZA 2VYVD 2GERA 4R69A 2H1SA 3M1LA 4IDDA 4ZQBA 2GASA 3FRJA 1R15A 3CMCO 1I2ZA 3GEDA 3TWOA 4R1TA 2B0JA 1Z45A 2VN8A 4GMFA 2PH5A 3MWEB 1ARZA 2FMUA 1A5ZA 3PLRA 1A27A 1N5DA 4F46A 4YT2A 1Z6ZA 5U9CA 4RVGA 2VZ0A 1BXGA 3OJLA 2NLOA 4L76A 4CM3A 2DUUA 4BQRA 4D7AA 3B6ZA 4MO2A 4R51A 5JLAA 4UAGA 4W82A 5L4LA 4E6PA 3AI3A 3BTOA 3H2SA 2WE8A 4YT4A 1AXEA 4XIJA 4CL3A 3D5QA 4MVJP 2YW9A 5G4KB 1AE1A 5BNFA 3GF4A 3LZ6A 2CZCA 3F9IA 1Z75A 3IJRA 4FCCA 1TA4A 4RORA 2OMEA 2VUUA 1E7MA 2Z1NA 1YBMA 1PWZA 1UP7A 3DL2A 1LDEA 1D3AA 3QWBA 3C1AA 1Q0HA 3RC7A 3BMQA 1HEUA 1DJNA 1PJ2A 1QMGA 1BXKA 1XR3A 1LLQA 1Q7CA 1XU7A 4YDRA 1GEGA 4JJFA 4WLOA 1R4MA 3ZDFA 1R66A 7MDHA 5CP8A 1YONA 3TOZA 2JKVA 5HA5A 3WG9A 3JQAD 2D3TA 3ZW8A 1OI7A 4XGKA 1P1HA 3MTJA 1ZXLA 3G3EA 5I7EA 4EGFA 3OM9A 4DMLA 4Y8VA 2NTNA 3LK7A 1LRLA 4J1SA 3RI3A 3OSUA 2QZ9A 3BMCB 3E03A 4GL4A 2OO5A 3K6JA 1QV7A 4BO2A 4PLZA 1UXHA 4J7UA 1ADBA 3RD5A 2CFCA 1R6DA 4KTTE 3UCEA 3PGJA 4B8ZA 5L7YA 3QA9A 3GZ4A 4IS3A 1CRWG 1PGJA 3NGXA 5B4VA 4Z9YA 3PHHA 2EIHA 3KV3O 4DL9A 2OXIA 1UXIA 3VZPA 1M75A 5H81A 4WCDA 1K0UA 4J16A 2B4QA 3GG2A 3WLFA 2V6MA 3UGKA 1NPDA 1UP6A 3RSHA 1JAXA 2Z5LA 3V2HA 1GUYA 1P1RA 1P44A 4E5MA 2EKPA 2F00A 1LDBA 4I9HA 1QYVA 1M6WA 3B1FA 4ZJUA 4I5GA 5CAEA 1DC4A 2HMVA 4DVJA 1Q1NA 3D1LA 3ITDA 1T4BA 4KQWA 4RZIA 4NIMA 3O9ZA 3NTQA 5IDYA 4A73A 3WGOA 4J4TA 2HSDA 4NFSA 3NRCA 4CM9D 4CLEA 4IUYA 4OHUA 4NPCA 4Y6RA 3F1KA 4W9NC 4E2XA 1UUFA 3RC9A 1A4IA 2W98A 1D1SA 4C7JA 1C1XA 3F6YA 3PHIA 1XGKA 5JDIA 5DBFA 4RF4A 2WEKA 3LLVA 4GH5A 5JC8A 2AQHA 1PWXA 3AW9A 4MKRA 2VUSA 2WM3A 1QYXA 3BHJA 3HNPA 3MJ4A 4O6VA 2FHSA 4YEDA 1MX3A 2A9FA 1C3VA 1B15A 3C7DB 3PDUA 1U5AA 5A9TA 3TL3A 5KVSA 1EEHA 2GD1O 4D45A 2NV6A 4BVAA 1Q0LA 4W9NA 3PHLA 5A5FA 3WSVA 3UF0A 4II2A 3MCVA 4L4RA 1YBAA 5AXCA 2R2GA 2HMSA 3EYWA 4JCOA 4O0LA 4AJKA 3WGZA 2OORA 5KJCA 3HB5X 3GK3A 5JW6A 5L40A 1YQGA 5F5LA 3R0IA 2Q1WA 1VJ0A 1ISHA 2Q2WA 2G0TA 3AWDA 3DMTA 4Q3NA 3GRKA 3NTOA 4IJWA 4M54A 4BKOA 1QP8A 3SC6A 1E7SA 5EMHA 5EQFA 3QVXA 3NEPX 1BTOA 1KYQA 1DAPA 1NPTO 4UEKA 3STHA 2QYTA 4J1NA 2FR1A 3WQSB 5DP1A 4DIOA 4EJ6A 3MJSA 1G0NA 2D5AA 5A1TA 2O3TA 2BRUA 1LLCA 3ZWMA 5CDUA 1ZH8A 3TN7A 1AHHA 3PHGA 1DLJA 1RM3A 4R1SA 3BTVA 4OQYA 3GPDG 1RYEA 2O3UA 3OECA 2GN9A 4D41A 1I8TA 1TI7A 4NNJA 5IFLA 4PRKA 1O9BA 3E82A 3MTGA 1WWKA 3OIDA 4EW6A 3UUWA 1WZIA 3Q9UA 1H93A 4PG4A 1YB4A 1KERA 3QWIA 1PL8A 3WGYA 1NQTA 3A4VA 3OICA 4IQ8A 4DC0A 5IDWA 1YGYA 2VNAA 2VRCD 5AQ1A 5GMOA 1T2CA 2Y1GA 2DFVA 1Y8QA 1LQTA 1ZEMA 2YHUA 3EW7A 3L0DA 4B4WA 4R41A 2J6IA 4OQZA 4M49A 4LVCA 4M87A 3BZUA 2VZ8A 1Q7BA 3GNTA 3AM3A 2DPGA 1NYTA 3D3WA 2HUNA 2J3IA 2XAAA 1H2HA 1XIVA 2QYSA 3VC7A 5KJFA 4NBUA 4FQ8A 5U1PA 4IDGA 1HE4A 1PZHA 1BXZA 3K30A 4DGSA 1A7AA 1VL0A 5A9RA 2X86A 5KJEA 1GR0A 4R16A 4DREA 2V6BA 4QUKA 3UH1A 2ZATA 3BMQB 4BO3A 4U0JA 4J4HA 1NM5A 4RCVA 2BFMA 4W7HA 4BHTA 4DC1A 3WBFA 4BO0A 2NUAA 2YUTA 3K31A 4RZHA 1DAOA 4B7CA 4XJTA 3WWZA 1P0CA 3ZV4A 4LCEA 2DBZA 4BGVA 3PLNA 5IDXA 1IY8A 4WPGA 4YACA 4K9DA 4CQLB 3JQ6A 1B8VA 3RBXA 2BMAA 4NDNE 1X1TA 5CPBA 4FIZA 5KKAA 3RASA 2AEFA 3NDJA 1HYHA 5GZ6A 5IF3A 4RGBA 1FMCA 5IN5A 1UAYA 3ZW9A 4BO7A 2Q1TA 1KETA 2C54A 1WDLA 1EMDA 1YRLA 1Y1PA 4FD3A 4GKBA 2DFDA 4PZDA 3RUEA 1FJHA 3FD8A 4Z3DA 2ZIZA 4E5NA 4PLFA 1MGOA 1JLLA 4GMGA 3NKLA 4Q3AA 4OXKA 4CM4A 4HXYA 4OOEA 4UVDA 4CLDA 4GVLA 5KJ1A 3D4NA 1IOLA 2X9GA 1YL6A 4LK3A 3IKVA 3GY0A 1NASA 3GDGA 3E1KA 4WOKA 4D46A 2DC1A 1B26A 2P5YA 1PGQA 3EHEA 4NZ9A 2C07A 1EDOA 2X9NA 5U4QA 2HJRA 1FK8A 4TRRA 4BS9A 4FC6A 3ONDA 4E32A 3C1TA 4JP3A 1TXGA 1ZBQA 3RBVA 5IG2A 5EL0A 4R9RA 3L4BA 1GFSA 4WCFB 5ICSA 2Y1DA 1YJQA 3NDIA 5DBIA 3TFQA 4IXTA 3DHYA 4AJNA 3I9JA 3K92A 1CDOA 3F4LA 4N18A 1BW9B 5TT0A 2H5LA 2E6UX 3H5NA 2QQ5A 4ZRNA 4AJIA 4D0RA 4DIFA 5C37A 3HWRA 2IXBA 1OZAA 4FFNA 3SLGA 3L07A 1NFRA 4DLAA 3FNHA 3W8FA 1LDMA 4KWIA 4NFHA 4GX2A 2GLXA 2JCVA 4CM6A 3T7CA 1V35A 3W1VA 3U0BA 1I01A 4QO7A 2UYYA 1PJBA 1CYDA 3S2GA 4GLOA 3AM5A 3B70A 1PGNA 2JD2A 4LMRA 5EJ2A 1RJWA 2QRJA 3RROA 3WQRA 3JQEA 4WLFA 4CM9A 3DBRB 3BMOA 3S2EA 5B4TA 3HE3A 3DTYA 3X2FA 3QWFA 1UXJA 2D1YA 3DAFA 4G5HA 1P31A 3D4PA 1GYPA 1I3MA 2H6EA 4ND5A 2RCYA 3H3JA 3SXPA 1PJTA 1BRMA 3DO5A 4MKZA 3VAZA 5JAZA 1WVGA 2AQ8A 3EUWA 4H16A 3KRTA 4QTZA 2O23A 4YQYA 3HDYA 1I33A 1HXHA 4XIYA 2I67A 2ZB8A 1NQ5A 2DTDA 1H9AA 1X7HA 2Q46A 3GVHA 3V5NA 4E2YA 5IJZA 4N7RA 4ALKA 5T8KC 3RKRA 3PZBA 2Y1EA 4WASA 4IIVA 1EZ4A 3K2EA 1N92A 2GCGA 2GR9A 4CMKA 3OHSX 2D4AA 2VTDA 4NJMB 2Z95A 3KBOA 3PEFA 3PXXA 4ALLA 1ISJA 4BB5A 3FN4A 4A03A 3DOOA 4MVJA 3A06A 3JYOA 1KOLA 4QQRA 1MA0A 5TNXA 1GZ3A 4BNTA 4BO5A 2PTGA 1O0SA 2FR8A 3UCFA 3WJAA 3AU9A 3H6KA 2DAPA 2D59A 1CEQA 2JD1A 2VHYA 1CJCA 2YHIB 1ZO8A 3LVFO 3PGXA 1PJCA 2NVUB 1MC5A 1F14A 2CF5A 5JNLA 1EK6A 4C7KA 3DXFA 3KYCB 2HK9A 1UJMA 4CR6A 5L95A 5THQA 2YFHA 5L4SA 3ZV3A 4MOWA 3JQDA 3HDHA 1H6CA 1UZMA 4GSLA 4PRLA 3F46A 4DBVO 3NJ8A 1QORA 1TLTA 4O59O 4U7WA 2NSDA 3DMYA 3EVTA 1LA2A 1EFLA 3LF1A 3BMNA 4NMHA 5JC1A 3GN2A 1HYGA 5MGBA 2I3AA 3PWZA 1H2BA 2OOSA 2CNBA 3ABIA 4TWRA 4ONEA 1GQQA 2J5RA 2WE7A 4EITA 2D0IA 4R54A 4YRAA 1N1EA 2QIOA 5H83A 4QFDA 2BI8A 4ZQGA 1O94A 1YDWA 4OXNA 3DEYX 2EW8A 5DULA 3ULKA 1VI2A 3UOGA 2PWZA 2I5PO 4NR0A 4OSPA 3S2FA 4RQTA 1GZ4A 4R9SA 3ZU5A 2FZEA 1PJLA 4I5EA 3QWHA 3AJRA 1B16A 3VPHA 2YHIA 2C7VA 4Z6KA 5TQVA 3TZQA 3C1OA 3UICA 3ETDA 4FFMA 4Z9XA 2X0RA 3PFWO 4TRNA 1ORRA 5JPIA 3ZHXA 3DMTC 4IJKA 3SEFA 4CQLA 3C85A 4Z9FA 2OBNA 2VWHA 4BNJA 1QG6A 1SOWA 3GMSA 2NWQA 2RAFA 2X9VA 4N5NA 1XYGA 3HADA 4PVDA 2H9IA 1NQOA 1T1SA 2AEMA 3FNEA 1QR6A 4J2OA 3KYCA 2YZ7A 2E4AA 5EESA 3WR5A 4DQVA 4A26A 1XELA 3ZI0A 3UW3A 3GGGA 3JD4A 3TOXA 2Q4BA 1I32A 4IY1A 2PD4A 5L4NA 1PTJA 4AJHA 3AOGA 3DZKA 1DXYA 1I0ZA 1AHIA 1IPFA 4AJ2A 3ZWAA 3O03A 2O3SA 3WNQA 5COBA 3QV1A 3ZHYA 3WNVA 1XDWA 4CM8A 3OEWA 5G0TA 4CLOA 4UUNA 3E6AA 4L4SA 3PTZA 4L74A 1QYDA 3CIFA 1XCBA 1LUAA 3RVDA 3NT2A 4AJOA 2O3QA 3GUYA 3PYLA 4IPTA 4Q39A 5CFZA 3KYDA 4WCFC 3QE3A 2FPPA 1R16A 1E3EA 4IDFA 4ZHSA 1PJSA 4LRTB 1X13A 1G0OA 1J49A 4GX0A 4I9UA 4J3FA 1T2AA 2C82A 3NGLA 3T4EA 4DYDA 2VWGA 4MVJM 1NVGA 1R4NB 3DBHB 4Y6PA 1PS9A 3KB6A 1EDZA 1X15A 3I3OA 1DC3A 3PP8A 3MZ0A 4JXKA 2B36A 3ZU4A 2VRCA 4E31A 2JCXA 5TGDA 2P4HX 2GZ1A 1K5HA 3JQCA 4O1MA 2VHWA 1MXFA 3KEQA 3WBBA 3ENKA 2X7HA 3RKUA 1PEDA 1GV1A 4RPKA 3V2GA 1NWCA 3PWKA 4CLXA 1ZK0A 4HFNA 3ZN2A 4CLRA 2EW2A 2HU2A 4MP8A 5AOVA 4FBGA 3VZRA 2C20A 4YAJA 3AFMA 3GOHA 2JFFA 3DBRA 1I36A 3H9JA 4K6CA 1QXSA 1U4SA 4QFCA 4R5HA 1ML3A 1Y6JA 3HN2A 3F3SA 4FR5A 1T26A 3ST7A 7ADHA 4R3WA 2VHZA 1IZ0A 3IL2A 3COSA 3FTNA 3IOYA 1A72A 3ORFA 1D4FA 5B4UA 1IZ9A 1PQWA 2Q4EA 2Z1MA 1SO8A 5A3JA 3DOJA 2IZ1A 1NVTA 5K6AC 4FFOA 4MIYA 1EVZA 1U5CA 1PIWA 3OP4A 2NU8A 1LX6A 4AJ1A 4CUKA 4FPXA 3HFSA 5I7VA 1HDOA 3ADPA 1N1GA 3KUXA 4IMPA 3NUGA 4WLEA 3VTFA 3H9UA 2WDZA 1DB3A 2BI7A 3JYLA 1PZGA 2X5JO 1HT0A 1XEAA 3P19A 2W2KA 2OFPA 1W8DA 3GAFA 1OFGA 3JQ7B 1BVRA 4Q3BA 4CPDA 2Y0EA 2EERA 1T2DA 1XU9A 2AE1A 1M67A 4ILKA 4UVIA 2AQKA 1R0SA 2FWMX 3RU9A 3G0OA 4BNIA 3F5SA 1DIBA 3OEYA 5BNIA 4CLRB 5JCXA 3CZRA 4TSKA 4OO3A 2Q2QA 4FJ2A 1E5QA 4CM4B 3GA0A 3QP9A 4JQCA 3MJTA 3DZGA 4IGEA 1QV6A 3SX2A 1DIAA 3S55A 1KIFA 4B4UA 5L7WA 4PG8A 2J3JA 1YH3A 1NTOA 2P4QA 4I9NA 5TLSA 2WMDA 3LT4A 4J1TA 4BNHA 5A9SA 1M76A 2BKAA 4ALMA 4DQUA 3ZU3A 1HE5A 4HFRA 3R3JA 5IN4A 4YXFA 2NVBA 1H6DA 2XOXA 1HKUA 3AUAA 4U6QA 3JQ9A 5TC4A 4E5PA 3D7LA 3WGQA 2I9PA 4OXYA 4LSMA 3TF5A 1XQ6A 3PK0A 1P1FA 4MINA 1LEHA 2NTJA 3LC1O 4HV4A 3GNQA 3PRJA 5BR7A 2BELA 2NQ8A 3UCXA 3I9MA 4BNUA 1FF9A 3U09A 3KSZO 5ITWA 1CQIA 1PL6A 2EEZA 3E18A 4YBZA 3L9XA 4QO8A 4EJ0A 5EQDA 2Q99A 3KO8A 1WAMA 1BSVA 1GPDG 2UUOA 4GGPA 4UUPA 1ULUA 4A5OA 3LU1A 1O8CA 1RKXA 3TZCA 3DAGA 3LF2A 4HFMA 1JVBA 5F21A 2WWRA 2ZB4A 5T57A 1YL7A 4H15A 2E37A 3A1NA 6LDHA 5IZCA 4IBOA 2V7PA 4Y98A 1VL8A 4YTEA 1JDJA 3INTA 1SNYA 4PLGA 2NNLD 5DN9A 5JAMA 4D44A 2ZYDA 1HRDA 3FWNA 4XZ3A 2CF6A 2OZPA 2IEDA 3INGA 1UXKA 2BD0A 3CPSA 4NBTA 4I8XA 4UVGA 3VVCA 3I1JA 1I10A 4B79A 1Q0QA 4FC7A 4HADA 2CUKA 1Z7BA 5KVQA 3ASVA 2GN4A 4PZEA 2X4GA 3D3WB 4D43A 4PG7A 4MKXA 3ZWNA 4BGIA 3QWAA 2GO1A 4CUZA 1EBUA 2O2YA 1KVQA 2AQIA 4QECA 3RIHA 2QW8A 4YRBA 4MIOA 3A28A 3PIIA 1ZK3A 1NFQA 3GFBA 1BVUA 4ZQHA 5A5EA 1XKQA 4E4YA 5JFOA 2CVQA 3U4CA 1N7HA 2GPTA 3GN1A 1C1DB 2IYPA 1QYWA 1E5LA 3HHPA 3Q9NA 2P9GA 3ANLA 1NR7A 1DHTA 5C7IO 1O95A 1KY5A 2EXXA 4Z0PA 5HS6A 4R68A 4CQMD 3H2ZA 1HZZA 2DQ4A 5A4DA 2FZWA 3C8MA 3FF4A 4RPJA 2YQ5A 1O5IA 3SBOA 1MC4A 2O50A 4BOYA 1X1EA 3GZNA 1VJ1A 2X6TA 4WGGA 3VKUA 1Z74A 4E30A 5L9AA 4W99A 3WYBA 5A06A 1U3WA 3I5MA 2DBVO 2XXJA 2NVWA 2EWMA 2QG4A 1SZJG 2JAPA 4RF3A 2ILTA 1ENOA 1DIRA 3HG7A 1WMAA 2Q49A 5DNAA 1ONNA 1P74A 3E9NA 4NK4A 1K6IA 1JAYA 4E5KA 2GUGA 1A9YA 3F5QA 3WGTA 2BGMA 2ZCVA 1PS0A 2B37A 2I76A 3H9EO 1YWGO 4CJXA 2B5VA 2VOJA 1BXGB 1XG5A 4CMAA 2JL1A 2YY7A 3JD2A 1DSSG 4AICA 1JKIA 5IZ4A 3MWDB 1PJ3A 1YS4A 3RJ5A 1GQYA 5ILOA 1PR3A 4WNIA 1SBYA 4UULA 3RFTA 3ZNNA 4AJLA 1LJ8A 1NNUA 2G17A 4BL5A 4EBFA 4OJNA 3LQFA 1VKNA 2Q50A 1C1DA 1EUDA 1GUFA 3OA0A 4IZHA 3WS7A 2ZJ1A 1E1KA 4M89A 4OAQA 1GV0A 4BKUA 1V8BA 4J43A 5JCJD 1F8GA 2DPHA 1SB9A 4AJPA 4EJMA 1YOVA 1SB8A 4WOJA 4JP2A 3VOSA 3OBBA 1EQUA 2E82A 2R6JA 4CLHA 3KVOA 1KVUA 4TZTA 1C0PA 2HQ1A 3K9QO 1R4MB 4Q3CA 4YAKA 3INRA 2JFHA 3W4KA 1YL5A 4JBHA 2W8ZA 4RPLA 1N7GA 2NADA 1WMBA 1E3SA 3U49A 3D5TA 3O4RA 4KDEA 5JCJA 1WW8A 1JN0A 3QHAA 5KVCA 3TFOA 5JMWA 1SEVA 4YRDA 3BMOB 4BB6A 3EVNA 3WLEA 3ZGYA 3ZNQA 3JQ9C 3L9WA 3VDRA 3KLMX 3GGOA 4PZCA 1B2LA 4ZD6A 5L51A 1HWYA 1DRWA 1GD1O 2VWQA 3HDJA 2OUIA 2W2LA 4PIVA 5CDYA 4B3JA 3RBZA 2HMWA 1H6BA 4CM5A 1E6WA 3CE6A 3G17A 1U2DA 3E9QA 3GMDA 3PFFA 4QX6A 1KS9A 3TL2A 4UEOA 1ENZA 5ENVA 1UZNA 4XYLA 3DC2A 1FDVA 1E3WA 3OIGA 3NT4A 1R37A 3ON5A 2D2IA 9LDTA 1YJ8A 1ZZEA 3HJAA 4WECA 3WFJA 4OH1A 5GZ3A 3H5AA 3KSUA 3I6QA 4DPKA 2YDYA 3IP3A 4LVUA 3KOUA 4CM1A 2ZB3A 3IUPA 2NU6A 1YB1A 1AXGA 2BGKA 4AJJA 1MUUA 2DBRA 4LSWA 4RF5A 4J91A 3ENNA 3ONFA 3FNGA 4FFRA 3V2UA 4FSHA 5FFFA 4EUHA 4E21A 5JBIA 4ND2A 1ZK4A 4N54A 1YBVA 2Q2VA 1JW9B 3ZV5A 3UXYA 5BSHA 3BYZA 1VKOA 1NAIA 3IUSA 3TZKA 4BNYA 4CQMA 4NH4A 1ISIA 2BFAA 5CEJA 1W4ZA 2LDBA 4R4JA 3WX0A 2DM6A 3RAJA 5JAIA 1V3TA 4HP8A 4E33A 3NYWA 3HSKA 5FF9A 1RM5A 4DIBA 1ZW1A 4ND1A 3RC1A 4NJOA 4B3IA 5J23A 4J9UE 4DPMA 4EEXA 4YQZA 3ANNA 2VYNA 1EVIA 1SC6A 2VCYA 3AUTA 4TKLA 2WD8A 2DTEA 2PFGA 2EGHA 2G76A 1YKFA 2O4UX 1OBFO 3SJ7A 2ZQYA 4ZQEA 4RQUA 2WTBA 3IAHA 3RCBA 3I4FA 3S8MA 4EUFA 3LSYA 4IJVA 4WCFA 5F3RA 4JN6B 1E3LA 2TMDA 1RWBA 2QX7A 1UDBA 3DB2A 1SCUA 4IDCA 5ENDA 4DYVA 5I7SA 3U9LA 1A7KA 2V6GA 4KQXA 2NVUA 4U5QA 5KIAA 2NM0A 4XB2A 1V9LA 4RDHA 3RUAA 5EIOA 1YXMA 1EE9A 2O2SA 3WYCA 2G82A 1GUZA 2VHXA 1Z82A 4WK6A 2IXAA 4TVOA 5I9MA 1DC6A 1WP4A 2X5KO 2X58A 3FBGA 1L1FA 3WMWA 3ZWOA 2Q1SA 1KY4A 1JTVA 4XD2A 4W7IA 4S1VA 3WMXA 1H5QA 3I4CA 4A2CA 1DPGA 4D3FA 2Q45A 3K73O 3KZVA 4G2NA 4PLVA 4N5MA 5AXBA 4D79A 5DCYA 1JU9A 2PD3A 2JCYA 3V1TC 1GEEA 4DMMA 4YAGA 5JYDA 4PG6A 2AE2A 4IS2A 1H94A 2IEBA 4P38A 3OH8A 3FI9A 2O4CA 3AY6A 3QVSA 4GVXA 4CM7A 2IZ0A 4KP7A 1D8AA 4MVJF 4BMNA 2P68A 2BF7A 2I3GA 2VUTA 3LT0A 3Q11A 1EVJA 4UEJA 1QRRA 3EZLA 4F6CA 1EBFA 1U8XX 4PLTA 1E6UA 1UH5A 3PJGA 3PJFA 4URFA 1QLJA 2VHVA 5B37A 4J90A 4RJTA 3PJDA 2GGSA 1J5PA 1ZJZA 2HAEA 3CMMA 2PD6A 3E5RA 4HUJA 4WLUA 2J5KA 1VRWA 5K9ZA 8ADHA 3QJ5A 1HDZA 4CV0A 4I1IA 3L77A 5H82A 1X0VA 3DHNA 1X14A 1EK5A 2EG9A 1A71A 2X0NA 4IM7A 4MVJD 1M6HA 3ZCXA 4D0SA 3ASUA 2HJSA 5TF4A 2F1KA 5TJ9A 5TT1A 2CY0A 1B14A 5JE8A 3VDQA 5FI3A 3P2OA 4U8GA 3IKTA 3RUCA 1Z7EA 3H9GA 2PY6A 1E7WA 1ZVMA 2C7GA 1V6AA 1YQXA 1DC5A 1SPXA 5G0VA 2FP4A 2IRWA 4YJDA 5C7LO 3GPIA 1E1MA 4RVHA 2B69A 2PH3A 4MPDA 1CIVA 4HY3A 2POQX 1R4NA 4XRGA 4RLHA 4IZIA 4A0SA 3JQGB 3K2BA 4BNNA 1TB4A 3IDSA 3OJFA 2JHGA 3GDFA 2OP0A 2GN6A 2VT3A 2WYWA 4PCVA 5COAA 2O7SA 5G2OA 3GVCA 4Z0HO 1LNQA 3C3XA 3DONA 3ZWBA 4UUOA 4GX5A 3Q1LA 2GDZA 4KUHA 3DFUA 1FDWA 1HYEA 2PZJA 2LDXA 2GN8A 1XHLA 3PVZA 4L75A 1H0KA 3V1UA 2GF2A 5DOVA 2YFQA 4EZBA 4DA9A 1DO8A 3TDKA 4XYGA 4PLPA 1E1NA 3PJEA 4RVFA 5IXSA 1P77A 1S6YA 3DR3A 1LLDA 4NU6A 1LRKA 2C2XA 4OMUA 1EVYA 4G81A 1PQUA 2GZ3A 5DBGA 1JWBB 4L0QA 3ZU2A 4EDFA 1UDCA 4F3YA 5I7FA 1TEHA 2C59A 1Q7GA 2BH9A 4BO8A 1R12A 2E48A 3DBLB 4FJ1A 2ZTUA 1YO6A 3NT5A 3EAGA 3E9MA 3RFXA 3KSDO 3WOHA 2EHDA 5AXDA 4CMHA 5I8ZA 3U5TA 3BAZA 2W2KB 3BA1A 2O48X 1WXDA 3CEAA 3HN7A 3JSAA 3QIVA 3VHRA 4B8WA 1K6JA 4QT0A 1PJ4A 4XR4A 2J5QA 1WLYA 4D3DA 1IHYA 4FOSA 2HMUA 4PLHA 1Q2XA 2DVMA 2FRDA 3QVOA 3GUCA 3DBVO 3IQDB 3BTSA 3FWZA 1ISGA 3R3SA 3C7AA 4FGWA 4YCAA 4CMJA 3KETA 2AXQA 4IJUA 1NX6A 4YAEA 4RL6A 4DLBA 4BMSA 3EZYA 1PS8A 4B3HA 3ETEA 1KEUA 2OGUA 3GLQA 5BQFA 3AK4A 1KEWA 3DZIA 3GR6A 3H3FA 3I52A 1GADO 1HTBA 1U8FO 2EF1A 4XEHA 4E13A 1GPJA 3WGHA 4A27A 1I2CA 1ZFNA 4HWKA 4P22A 5T5QA 4BNLA 3UFXA 1NVMB 4LISA 4XB1A 3JD3A 3JQGA 1P1IA 1P3DA 3ROPA 4ALIA 5CDTA 1ADFA 5KNLA 2UUPA 4XQGA 1V0JA 3JQ8B 3FSRA 2YDXA 4J9VA 2JFGA 2Y0DA 3FNFA 4O5OA 4EYEA 1ENYA 3QQPA 5ILGA 2PR2A 3X2EA 1OMOA 5T8KA 4J0EA 1NR1A 2BLLA 3GFGA 1GY8A 5I8WA 2PV7A 1JWAB 1R0KA 3L4SO 3P5SA 1KC3A 4JNKA 4NK5A 4XX0A 4JBGA 4CMIA 4ZRMA 1DFGA 2DLDA 1VLLA 2EP5A 3GHHA 2X23A 4KUEA 2IDZA 2HMTA 5LC1A 1HLDA 2DT5A 1LSJA 2PLAA 2E49A 5ER9A 3VH4A 3GDOA 1GYQA 3TZHA 4XYBA 4DLLA 4DQXA 2J3KA 4ZVVA 4OGWA 3KTDA 3VPGA 3ZH2A 4IDAA 1TT7A 2AEJA 3MOGA 4M86A 5HBRA 2AG8A 3PDJA 2W4QA 2AMFA 1NXQA 1KBZA 3G79A 4OM8A 2CDAA 1YOVB 3V8BA 1ZEJA 5DF1A 3MJVA 3PPIA 1D7OA 3ZNOA 3ZV6A 3JQBC 1DHRA 5DOZA 2ZJ0A 4JX8A 1NP3A 3E8XA 4QXMA 2BFOA 5JXWA 3K5PA 3VZSA 3WTBA 1TVEA 3MJEA 1UAGA 4NU5A 3QVWA 4E0BA 1E7QA 4Y6SA 4MJLA 4U6SA 5A9SB 3WJ7A 4J4BA 2UDPA 1P9LA 5EINA 3P7MA 3FTPA 1WNTA 2B4TO 3N7UA 1N8KA 1VSUA 1PZEA 3ZWXA 3A14A 5TIIA 3WYEA 3TQHA 4K1LA 2JAHA 4PLWA 3GC6A 4O63O 3JQFA 1BDMA 4OYRA 2C5AA 1C0IA 2WD7B 2V6FA 4IQGA 2C5EA 3DWFA 1B3RA 3EGOA 3A9WA 1NHGA 5COQA 3ITKA 3ZWVA 5IAAA 2HLPA 3I83A 4N5LA 4JJIA 2DBQA 4M1QA 3PIDA 3RJ9A 3NX4A 4Q3EA 1VSVA 3HZZA 4FN4A 4JJGA 5FEUA 2JHFA 1IL0A 4E3ZA 4CMBA 2Q3EA 3WIEA 1ZXBA 4GPD1 1UP4A 4BO4A 4YWJA 5HWSA 1GQ2A 3M2PA 4BGUA 1F0YA 4NHEA 1G6KA 2HDHA 4LW8A 2I6TA 4FDAA 1H6AA 1PX0A 4HNGA 3SJUA 3OJOA 1LI4A 1MFZA 3I23A 4GGOA 4WJZA 4MVJH 3D0OA 4X54A 1O6ZA 2CMDA 1P1KA 4NI5A 1PZFA 4GX1A 3BIOA 3D4OA 1ZCJA 1S7CA 3OJEA 4J49A 3DQPA 1ONOA 1PJQA 1BWSA 4JROA 1LTHR 2SCUA 3EC7A 1L7DA 5JS6A 4LRSB 1P1JA 1ZIDA 1KVTA 4YA6A 4FJ0A 1FDUA 4XWYA 1P0FA 3K96A 1E1LA 3RFVA 1F12A 5AVOA 2ZYGA 4WNCA 3QVTA 3GZNB 5CPFA 5BSEA 1M2WA 1VL6A 1ISMA 5F5NA 3TJRA 1MP0A 2H63A 3PQEA 2AG5A 4DBZA 2OL4A 3K8ZA 3R6DA 5BSFA 1B8PA 1HL3A 3QY9A 4JLWA 4TRJA 2B5WA 5FI5A 2FOIA 4K28A 3PQFA 1GU7A 3F1LA 1V3UA 4XCVA 4ITUA 1BGVA 3BTUA 4BV8A 1LSUA 1U3VA 4LN1A 1IB6A 4R01A 4CL8A 3HDQA 5KTKA 5L53A 2Y1FA 5IDQA 1A4UA 3OETA 1U3TA 1FDSA 3LC7O 3IIEA 3DOCA 3O38A 4HBGA 1XLTA 2P5UA 4YJGA 1DFHA 1CWUA 3RQSA 1N2SA 4ALJA 3WB9A 1PSDA 2FPIA 4J2HA 4RF2A 3ZWPA 4UVHA 2EJVA 2VTEA 3I9LA 4P4NA 2CVOA 4Q3DA 4CMCA 1IYZA 3KXDA 4TRMA 4OL9A 5L3ZA 4II3A 2ZTLA 1HSOA 1LC3A 1PQPA 2XF8A 2PGDA 3AFNA 1LRJA 4WLNA 2X1HA 5JMPA 3PI7A 3PYXA 3FBTA 3JYNA 3UN1A 4ESOA 2YJZA 2ZTMA 4NBRA 2D5CA 2J3HA 4L8VA 2UVDA 4NJMA 2O3RA 1Z73A 5A3VA 4Z3KA 4ND4A 4RPGA 2JD0A 1NWHA 2W2LD 2DTXA 3PHJA 4OKIA 4BO6A 4GI2A 2B83A 5JDCC 2PKQP 3RUDA 1U7TA 2PA3A 2ZQZA 3GAZA 4YJHB 5KJ6A 9LDBA 5KKCA 2VZ9A 3GG9A 1I3NA 4J7XA 1WZEA 2FR0A 1WDKA 2R00C 4F6LA 2FN7A 3JQBA 3PYMA 1LXCA 4R3NA 1H9BA 3VPFA 3IS3A 3AI2A 1E77A 4I08A 5G4KA 2OBYA 4DWVA
chains in the Genus database with same CATH superfamily
1G2OA 2CHQA 5F5XA 5JS1A 3NOQA 2NQTA 2WSBA 4RZ2A 1NL3A 2ODBA 2VRBA 4DCGA 4ROTA 4ZVSA 4H3VA 1KSJA 3KTFA 5CDSA 3OCJA 3KCNA 3AVQA 4DV5B 1PYDA 1KVRA 4ZICA 4K9LA 1ND5A 1ACLA 4HAYA 1M0WA 2JGFA 3L6EA 5EGSA 4BKRA 4QM6A 4XPIA 1TO6A 3I28A 5DGIA 2QAGA 3IP1A 1KYTA 3GV0A 3M49A 3U3XA 2FW9A 1SUFA 3I30X 1CERA 4TT8A 1GDDA 2G9QA 4B4VA 3NC4A 1C0LA 4N3BA 4PHFA 3WIUA 2PZLA 4CG3A 1U0TA 1E0JA 2GYYA 5AJZA 3WBKA 3T1HB 2ZBUA 1T2EA 1E5VA 1RADA 1Z5UA 2B2NA 4IH4A 3ET4A 4QE3A 3HRHA 2EQ5A 1PE0A 1YHYA 4UHKA 1XEWY 4HGYA 3RV3A 5K0FA 4AURA 4UQPA 2A35A 1QGED 3PNPA 4IINA 1P9WA 4Y2UA 4V0MA 3FBWA 2QRLA 3BJMA 2HKIA 2O1SA 3TBHA 2UYCA 3DEIA 4X62B 1AC5A 1A3CA 1GAJA 2RJOA 4ZHQB 3ZHVA 2NYAA 4RFSA 5JCOC 2BUCA 1T24A 2H06A 2BFEA 2M9MA 4EP1A 4CKBA 4E14A 4D9JA 1AGRA 1DJQA 1MO2A 2BF4A 4HC4A 3W9SA 1SG6A 1TCUA 2W6OA 1VGVA 1NJSA 5DNEA 3N8KA 5H68A 5FKJA 3ROXA 3VPSA 1YGPA 4EPYA 4JP5A 2H2HA 1ONPA 2C7QA 3P2JA 4DAOA 4Y6QA 3SX0A 4Q6WA 3KKPA 4XDHA 4XYMA 3Q15C 2CMFA 2PHZA 1RHJA 3H5LA 5A2GA 2AA3A 5JPIA 2PH1A 2R7MA 3IULA 2BHLA 3REGA 2GPNA 3NOXA 1QO0A 1TMGE 4D9HA 3DAPA 5BSRA 3FAZA 4MQ5A 5BSGA 4YP6A 4Q00A 5E9JA 4DIKA 1DDOA 1FY2A 4Z1MD 1OGYA 2Y0BA 4Y9DA 1ULSA 5SYNA 1OFVA 3GGSA 1MTOA 4P86A 4RLSA 2J4DA 1B00A 1LV8A 4JU9A 4PGFA 3DT8A 4E46A 2OCYC 2RHGB 2ZK7A 3DHVA 1RLIA 4ZVOA 4F4CA 1XDSA 2ZBRA 3DLIA 3SQNA 2NPFA 2XLBA 4U2DA 1DAHA 1P4AA 2E87A 3D8HA 1AZTA 4NMXB 5T6BA 1QO0D 3MCWA 3THSA 4EA6A 1I4TD 3H5TA 1LQ2A 1Y1TA 3ADOA 3BMCA 4LGVA 3HFGA 1GL3A 3T0GA 1X7DA 4CR7A 1HF3A 1OZGA 4ZARA 2B9EA 2VK1A 4TKMA 5KOIA 2P3QA 3AKEA 1D03A 3A6PC 1MENA 4M1TA 4F56A 4X1KA 4FNMA 2CN1A 3DAHA 1DOHA 2VF4X 1CY7A 1EP9A 3QI2A 5HBGA 5AM2A 3EPHA 1U28C 1ID1A 4XQEA 3A4TA 5FYDA 4JIMA 4XDZA 821PA 3AOEA 3NHMA 2AIRA 2BKLA 1V1RA 1P0QA 1MD9A 2ZIEA 1UBUS 2BSQA 5DP2A 2FW0A 2G28A 5LZ9A 3NJ4A 4RANA 5LA6F 1EAMA 3VC3A 3DE4X 1SUSA 1H0HA 3MOIA 1R6XA 4TV9F 1DP4A 3MB5A 3ZY2A 4IGFA 2VPXA 5EPOA 2PNFA 1NLZA 3ONEA 3THRA 1JEYA 2G88A 3CUKA 1UAAA 4XUCA 5JAHA 5K09A 2Y6VA 2AW5A 3ROZA 5AKEA 1PQ4A 2D0PB 2QTCA 1WUKS 2YFKA 3TNDA 2YCBA 2A1IA 1WSDA 3DZ8A 4H27A 4QEKA 4AY5A 1EG7A 4F8JA 5HGJA 4DW8A 5JRDS 4ROSA 1N9ZA 1E3QA 4CG2A 5K0CA 1KO8A 2HHCA 4P6VF 4XYEA 2QVGA 5FJJA 2X7JA 4HX5A 4DQDA 4HWGA 4DARA 5K6RA 4ILEA 1G7TA 4ENTA 2RH8A 6ADHA 4BZZA 2GSDA 1YTUA 2QYOA 3I9NA 3MQ4A 1M0TA 4PZYA 1AMUA 4EW2A 4K0RA 2AXEA 2V9ZA 3FR8A 3L8HA 4NQZA 5F4BA 4YONB 4DA0A 3SC4A 4DS3A 5A03A 3PX2A 2XA1A 2F43A 3IVGA 4XKJA 5EFZA 4Z4CA 1KYWA 1R18A 2TYSB 4JP1A 5I9TA 2PUCA 3DPSA 4ZCLA 4MCJA 1D1TA 1NPYA 4ZALA 4R7ZA 1RWXA 1WPQA 2Q0XA 3P0EA 3WGJA 5DTJA 3DMDA 4EHIA 4ZVLA 1E2FA 3BMNB 2Y68A 3KEGA 3CNBA 2VPPA 1B8UA 1YE3A 3ZXYA 3FCEA 2CVZA 4U7TB 3R5SA 3TSYA 1PLLA 3H0KA 3QOFA 4C0SA 1FTQA 1DEHA 2XV1A 2W8BB 1NBAA 4G41A 1OR8A 3KR2A 2Z30A 4F5WA 2AYXA 1ADGA 4BKPA 4C4XA 3GEMA 4GPBA 3OKCA 4REOA 5D87A 1BZYA 2RHBA 4S0XA 3W5AA 5F2OA 1AD2A 5DZSA 3NDRA 1Q22A 2IYXA 4CIYA 1F20A 4JLAA 3WFZA 1VA5A 1G20B 1TUBA 2PX8A 1UOPA 3MNFA 1L2TA 2BI4A 3IOBA 4JXZA 2PKQO 3T54A 1NBME 4OJYA 3D3EA 3E53A 4UBJA 1GCOA 4R8VA 3MTBA 4XQ9A 1FPQA 3UVEA 3ZXSA 1CY8A 5K7SA 3QFSA 1Y80A 3UNXA 5DX8A 4DV3B 2EZ9A 3OFSA 4HTFB 3VBEA 4E12A 3KEOA 2VQFB 5JY1A 3PVSA 4XAQA 2PGIA 1Q6YA 4OVKA 5ALNA 4K81B 5AHKA 2WD7A 1RQGA 3TMYA 3PXEA 3QBTA 2EX0A 5CG1A 1FFSA 1ODTC 4QARA 4QXOA 1R0CA 4HZUA 5D84A 4AFNA 2ECFA 3UJ6A 4AJ4A 3O74A 2HK7A 3DW3X 3FKQA 3FZYA 4IWXA 5JZVA 3SC3A 4S2EA 1I6LA 4Z4QA 4UEWA 1Y7IA 4TMXA 1T2FA 4YS6A 1OLUB 3CVJA 2NX2A 5B6IA 5JV5A 1FOEB 1BU5A 3HY4A 1J0CA 4YASA 4OQLA 1C2TA 2REXB 4BXOA 2RI6A 3EPJA 4LDPA 3OIFA 4HXGA 4KQHA 3P9ZA 1VMEA 5CCDA 3UAVA 3F71A 3RG8A 4RMIA 4J29A 2EATA 2NSYA 2XB9A 3C6YA 5H8WA 1E3JA 4UFOA 1VPEA 3BHMA 4ZCPA 1ZMTA 4EY3A 2AJBA 2BHSA 2YY6A 1Q21A 3QVMA 1CZRA 1SU4A 2JJ2A 5AHXA 4FOOA 4C5BA 4BNZA 1QO9A 2WB2A 1YCGA 1SQ0A 1YA6A 1FMFA 4CU5A 2PK3A 5HP4A 3PUIA 2J4CA 1Y34E 1BQ4A 2JCGA 3QQ5A 3U62A 3CZCA 3V55A 1MA3A 1GDHA 1W47A 3CRRA 3GLIA 1J4AA 4OHWA 1OZFA 4NFYA 1P2DA 4AZVA 4RPHA 3D6AA 1ZA2A 1V8OA 3A1CA 4LXUA 4G1VA 1VHTA 1YZHA 2ONCA 5C4GB 3P8ZA 5L3SA 5E2BA 1NUAA 4Z51A 3KJNA 1NVVR 3AL2A 3FHJA 3IMCA 4PFJA 4M0CA 2X0EA 3D59A 2CYBA 1P17A 3OX4A 1HEYA 1GN8A 4TS1A 1CXZA 5ER6A 1PTJC 4DKJA 3B1KA 4WD3A 5AKIA 1FW8A 2ZVQX 2AG0A 5JS2A 5BRJA 1NUUA 1CF2O 5CW1A 3WQHA 3R4CA 4TQAA 4HPWA 3FX2A 3ZWYA 1SBTA 1M72A 4CT5A 3NATA 5FR2A 1ZKMA 2XWQA 4M0PA 4BNWA 2X0JA 3NHYA 1Y9AA 3QW4B 2C29D 1IVYA 2XVMA 3QELB 5EIOA 5BSWA 4GSKA 5FO1A 1ENPA 2ZJ5A 4UMEA 4AMVA 5I3CA 4J0JA 1M5TA 1GU1A 1JKJA 3GX1A 4DSAA 3QXGA 3S2IA 4KG7A 1QGZA 1JIQA 1WUYA 2IPOA 3ADKA 3BGOS 3JATA 3ZCUA 2FMTA 3CHYA 5DCLA 2D1RA 3FFXA 4OGKA 4FW9A 4CMIB 2OFFA 1ZCBA 4PNZA 4TKVB 1PDOA 1PT5A 1IOWA 1JG7A 3DVLA 3SX4A 1Z0UA 2WMOB 5BT9A 1AV6A 4CDRA 1IU9A 1U2TA 1REQA 2Y76A 4RFLA 4LCJA 4ABYA 3H8VA 1GIAA 1Q50A 4RDIA 3KQQA 4Q7EA 1DU4A 2REBA 4GFDA 4X5OA 3TS1A 3JPWA 1KKLA 3EZ6A 1UM8A 3VA7A 5FOSA 3AHCA 5F64A 4B6QA 4ME6A 1U4OA 1VJDA 4L4YA 3ZWWA 1WJGA 3BHIA 1OFIA 3T5GA 5A0TA 2R68A 1FRNA 4RIIA 3DE1X 4CG0A 3B8HA 4MVWA 1DAGA 4B4OA 3R6GA 1K8YB 4M38A 4BUCA 5DEOA 1XNGA 2GAIA 1K86A 1EJ0A 4WKGA 3SYKA 4WX2B 5DIZA 1UM9A 3I9OA 5F77A 4K6KA 2J6CA 3LW7A 1IUPA 3ABRB 4YJFB 4X84A 5JH7A 1JFFB 3O31A 4C30A 3PGMA 2ZIWB 5AHWA 5THKA 1B7GO 3VZQA 1EFDN 4HKTA 2H7YA 2Y66A 2G9VA 2VJDA 5F7ZA 3EY4A 2IY8A 3ILHA 2QENA 4H7PA 1MCZA 4G56A 4NULA 1TA9A 3SHFA 2R25B 2ZTVA 4N1AA 3CVUA 4QPZA 3HJNA 3KKNA 3OQBA 2AHRA 3CH6A 3RUFA 4UJ3A 2WWWA 3TXXA 1H8HD 5EIBD 3PT5A 3HCAA 1ZUD1 3F3KA 5IX8A 2PZMA 5LXTB 1ECFA 2GBLA 4BY9E 1LBEA 3LYHA 2C0CA 1QVWA 1JFRA 4IJ6A 4GQAA 5K99A 3DLTA 1T5LA 2V54A 4G4IA 1LSSA 2AFIE 4X8HA 2ZIXA 3OJXA 4PIPA 2QY6A 2R5FA 5JSFA 5K3CA 3EASA 2Y4NA 3L6OO 3IQZA 1DTWB 2A1TR 2PGAA 3M4NA 4H7KA 2Q1YA 2O8CB 1QZ3A 1L4EA 2P1ZA 1FQJA 1GR1A 1T4GA 2DHQA 1LSOA 2UV8A 1MH9A 4U00A 3W90A 3IB6A 4DMLA 5KC8A 2QVYX 2XHZA 1G8PA 4N0QA 1JKFA 1G3UA 1VI6A 3R4VA 2PGJA 3W6ZA 5JZMA 4MUKA 3QLVA 3UPTA 2O8VA 1F2UB 2EKLA 2ET6A 4I55A 5IVKA 5C51B 1WCIB 4GDMA 1GXSB 1DBVO 1V6CA 2HPAA 3PHBE 3B2QA 2GEDA 5JSYA 1LLUA 4H6PA 5B3JC 4JOQA 2CUZA 3UTCA 2ASVA 2OCKA 2Q7OE 3BC1A 3H7AA 1ABEA 1VPDA 4UUAA 3NNDA 2A59A 4FHDA 4W4TA 1DG1G 4ZZ1A 2GPJA 3TQSA 5B53A 2HO5A 1CY2A 3VH2A 1GKYA 1FS4A 2HPVA 2IPLA 5CYOA 4ZAXA 1XCGB 3HL4A 1UIRA 1MFPA 4V0KA 2DKOA 3DDHA 3DE3X 4GBED 1QQTA 2FVXA 3H9QA 1XVAA 2JFZA 3HMQA 1IULA 1JA1A 2WFLA 2VQ3A 3HJGA 5BW5A 3IP8A 5GWXA 4TTSA 2RB4A 5HIIA 1FSFA 4PTZA 1EE2A 1YQDA 5EMMA 4DR3B 3EF1A 2OKGA 4WESA 1Y8QB 1F6DA 3FCSB 2QZ4A 2VH1A 4PYKA 1RYHA 1OF1A 3WL7A 4FGKA 1MT0A 3N2KB 3QM1A 4QUIA 3GGPA 1KDZA 3IPXA 2WG2A 2HNKA 2D54A 2OY0A 2P4EA 3GU3A 3LLSA 3RS7A 4TM7A 4BQPA 4ZZ3A 1SUAA 4X44A 3V1YA 1V3VA 2JH8A 3SIRA 5EP4A 5CB0A 1LQUA 4INJA 1YFJA 4R8LA 1CZNA 1ZN9A 4EG5A 3V4SA 4QDKA 4MNTA 2HA5A 2SKDA 5AKKA 2X5OA 3PBKA 3R6TA 4N3NA 2C5GA 4TV9A 5ADWA 1CEYA 4QYMA 3BQMB 1E1QA 2FQWA 1KHTA 1UK8A 4G0PA 4EJFA 4EKDA 2DYKA 3RIMA 2E4UA 3ID6C 4W8GA 2FW1A 3TZ6A 3W2EA 4TXLA 3OZAA 3N7AA 2HT1A 4DVGA 2CCJA 5EHZA 5IK2D 2HCRA 2CUTA 4RSGA 5DB4A 5LOVF 3B6JA 5LZ4A 2J3QA 1NJGA 3CNLA 2O7QA 2WQ7A 1HSZA 1M8PA 1VIVA 1TW2A 3NC0C 3HBNA 3CH7A 1N9GB 4G65A 1VC2A 1W0CA 3DLAA 5MGNA 1X7XA 3AZQA 3IVAA 4DCTA 1OLUA 1WXIA 1YJ5A 3OU2A 1ZH2A 1JHZA 1Z26A 4Y2HA 4AW9A 4RZQA 1AK1A 2IYRA 2PZKA 2R2AA 1W0JD 2WAMA 1JTEA 3RRBA 4ECEA 2X3UA 4D8VA 2A4KA 3DSRA 3P2YA 3E48A 4MP6A 4NYIR 1EYZA 3VDMA 4KH1A 3RWMB 3LJKA 1JDBC 4U39A 1VJTA 1QHIA 3AI7A 5HHTA 5ALOA 4HEQA 2G9RA 1GUBA 2PWYA 2V4MA 3BT7A 1U7XA 2VP2A 2WFAA 1NAHA 3NV9A 2PPVA 3JYQA 3LY7A 3UHOA 1P8AA 2YNMD 3T5DA 3DL4A 1BH6A 3SY8A 2KLHA 3JTMA 4GRAA 4BQNA 3O26A 3WTCA 1GG2A 1HLPA 1YJAA 3IGFA 3MINB 4D6PA 3GQBA 3EUFA 2Z9DA 2ZJBA 1TF2A 1DADA 1JLMA 3MMPA 4D9BA 4DRYA 1VLQA 4F5DA 3KQWA 4RJJA 1IPEA 1W59A 3KVNA 2RIPA 3AQIA 3BGIA 3DDCA 3EA4A 1E59A 3VSBA 2WUEA 3NBUA 1BX3A 1A7UA 2X15A 1RM0A 2PS3A 1F6BA 2ZYIA 5F9MA 2OCXA 3AERA 4C14A 4PV7A 4F9GA 4Q48A 1G16A 1DPFA 1ORIA 2BSXA 3ZVRA 5LPNA 4KPUB 2QGFA 4OKNA 5M5BA 2CXPA 2VXYA 1EGVB 3M6WA 1XJCA 3G8CA 3NH6A 4NYMR 3CRNA 3F7TA 4UDXX 5GM1A 3WFIA 2XYHA 621PA 3GXBA 5F2KA 2V5UA 3ZBTA 2WYHA 4BNVA 3UXHA 3OX3A 3NVDA 4CVNA 4JKOA 3CR7A 4R69A 4GD3Q 1RQPA 4IDDA 4ZQBA 1V5EA 5J4HA 1OT3A 4NYJQ 5KAPA 2ZT7A 1Q1QA 1QYRA 3FRJA 3RTGA 3BXOA 3WLIA 2YYZA 5BRAA 4Y2XA 3TWOA 3WL6A 1GKKA 1Z45A 4GMFA 1U90A 5A62A 1CR4A 4EGJA 3FIUA 1M54A 1MB9A 1XP8A 3QZUA 3VHLB 3SVLA 4EX6A 4YCSA 2JC3A 2R9VA 4MK4A 2GBLC 3FTCA 2SICE 4CM3A 4MDFA 2UXCB 2CXHA 2K5UA 3CG0A 2FN8A 1IQUA 1S5PA 1QHSA 4MO2A 5A5GA 2GPYA 1X8LA 4W82A 1T10A 2JI8A 4MRMB 1W0KA 2OXFA 4JSYA 1SKYB 1YJCA 4CHTA 2YW9A 4QRHA 5G4KB 5ED0A 4DLRA 2AFVA 2SKCA 2GHQA 3GJZA 3UEOA 2VCEA 1Z75A 1L8QA 3IJRA 1XKLA 3O73A 1I7LA 3UHFA 1DKLA 2JFNA 2FUCA 2FW6A 2QG9A 3IAAA 4XFJA 4JC8A 3IBGA 5HR5A 2I3ZA 4CZ2A 1E58A 1P2TA 4NS4A 2OA0A 1Q0HA 3GLSA 5HDQA 2V7UA 3BMQA 2X14A 5FADA 3QLUC 5BXYA 2TMYA 3S2ZA 3UGJA 1PJ2A 4RD4A 4X1IA 4LZZA 2I2CA 4AUKA 1JB1A 1SJ9A 4LE0A 2NO4A 4AMZA 1I6WA 4JDPA 3ZDFA 1JH8A 1F3LA 3UUFA 1SVLA 1YONA 4TL8A 5EWMA 3SJZA 4URXR 4HGQA 1WUTA 1N2CE 2RBGA 4GZ5A 3WG9A 2GBGA 2PUGA 4MI1A 3I04M 3MBOA 3F8SA 3ZW8A 4Y9UA 4KQEA 2XNKA 5AWFC 2V7EA 3RF7A 1XRJA 4Z4GA 3STYA 3HKEB 4EM6A 1O2DA 4MB2A 5H16A 5GINE 3MS7A 3I64A 1QWOA 3UG6A 1C9YA 2QJTA 2XWPA 3SNHA 1COZA 4C0LA 1Q7EA 5KOHB 4Q5IA 3URKA 3RTEA 3RI3A 1ZIPA 4GL4A 1N36B 1C8VB 3E03A 2XDYA 3R2JA 2Q5IA 4OB7A 1ZH0A 5E6RB 4BAGA 4EPTA 1HT3A 4DE5A 3QYPA 4EMSA 1VBMA 2DCUA 2OFWA 4MQEA 2IPMA 3BB3A 4IXDA 5JNVA 3SVZA 3IKJA 4UAUA 4C3VA 1R6DA 4KTTE 3FHCB 3KIPA 4ZT7A 3UCEA 4EDHA 4PYLA 5KEIA 2QU8A 4L8GA 2ZP1A 2ALJA 4BWYA 1XRMA 5CX1B 2XUHA 4IS3A 4YGYA 5CDHA 5KC9A 5EKTA 3JX9A 1XTUA 4B3TB 3SN6A 1ICIA 1CJSA 5CB4B 2YR0A 4DL9A 1XPJA 3NM5A 4Y2TA 5DGCA 3VYVA 4I1OA 3A3KA 4V0OA 7ABPA 1K0UA 3HLYA 2C03A 5EWJA 1CR6A 2OE2A 3IDZA 2B4QA 3B6EA 4M1MA 1XFDA 2FWJA 5FXMA 3HXTA 1IBLB 2JGKA 1W8IA 1N5LA 3FETA 3FMGA 3UT6A 1OH5A 1OIWA 5LQUA 4I9HA 5A0FA 2J9XB 3TQFA 2PYDA 4ZJUA 4AQYB 1DC4A 2FFBA 4GZ3A 3D1LA 4I6GA 2VAVA 3D4LA 3HUFA 3ITDA 1OE0A 2GAJA 5IUKC 1ZUWA 4FI3C 4RQBA 2ZBPA 3EDOA 1BKYA 3T12A 1Z4JA 1ZM7A 4PE5B 1UMDA 5F3DA 1OTXA 1I1HA 4NPCA 3R7DA 3SE7A 5IJAA 4W9NC 4Y9SA 2Z4RA 5DO9A 3L0BA 4DIDA 1IDN1 2DJ5A 3JYHA 1JLHA 1DUIA 3FLEA 3HS3A 3T1YB 2QTAA 2Q2OA 1XGKA 1Z2PX 2OGTA 3F6YA 2VP3A 4N5DA 3LLVA 4IH1A 5G1PA 3O8DA 2FRVA 1AKYA 1BS2A 1GGKA 2O1EA 2QRQA 4KO1S 2BTOA 2G7MC 2A3RA 3AW9A 4MKRA 5HF9A 3D2BA 3ZVLA 3VJKA 4AYWA 3FDZA 1ESEA 1IN8A 5BOSB 1MX3A 2A9FA 2MSEB 1LVGA 1B15A 1T0HB 3RABA 3B6IA 5JSKA 1ZHHA 3T3OA 3MFYA 3MTDA 1OW3B 1A9PA 3AV0B 1NF3A 1EEHA 1JR4A 2XDQA 1CLUA 4E5DA 1CJTC 1TAHA 3PHLA 2ONZA 1Y3FE 3MCVA 5IF9A 1ZOSA 5CH3A 2B7BA 4ZREA 3AJ8A 1QIGA 1M1ZA 2DPMA 2FE4A 2WTNA 2VS1A 4JCOA 1W4RA 2COEA 2QTVA 3EJWA 4A3SA 1UK9A 4F4IA 1EUYA 2OORA 1L8OA 2FUNB 1TM2A 5DHQA 3TE7A 5KJCA 2UYHA 5AW6A 2QPOA 3SZUA 2BM1A 3W6PA 1CUZA 5L40A 3EWSA 1YQGA 5F5LA 3P71T 1P3Y1 3R0IA 1VJ0A 3ABSB 3BKXA 3PC7A 3ZI4A 4BUJA 3DMTA 2WF9A 3EVAA 3TLXA 1BH2A 2D8MA 3B9BA 1E7SA 1I2DA 5EQFA 2LVBA 4KJZA 1RKUA 4W5JA 5DHRA 5EIFA 2QI9C 4POAA 2G1PA 4EB0A 2AK3A 1BTOA 3ZE2B 1KYQA 3OCYA 4UEKA 2PPLA 3INNA 2QORA 1EFRD 4KAFA 4RSHA 2PWBA 3GQBB 1RYFA 1ZD2P 4ETWA 2PUHA 5F9HA 4MEBA 4KE7A 5DP1A 4QU0A 2YRWA 2NN3C 4DIOA 4EJ6A 2D5AA 5JNTA 3TAUA 1QRAA 3HU5A 4OA5A 1ITZA 1IAQA 3W8NA 4QUDA 1DCFA 1R27A 3I9V1 2FSIA 1P5HA 2H2IA 3PS9A 5IH3A 1IOZA 4D97A 1TIPA 3KQNA 1QZZA 2XRYA 1VTKA 2EBFX 3IV7A 4KITB 4OQYA 3KWMA 2P41A 4IYRA 5JI2E 1N6PA 1OWNA 4Z54A 2ZAYA 4BX0A 4CTOA 1DQPA 2HRDA 5FAKA 2JGIA 2WU0A 2O3UA 1Z4LA 1OXVA 1USIA 3OECA 5AKXA 4D41A 1RWPA 4HPJB 3TGLA 2MYPA 2I1QA 4X7RA 4PSKA 5A1JA 1NR5A 2W58A 3EOZA 5KTRA 3E82A 1UF9A 1OFTA 4IXMA 5BW6B 3Q9UA 4DMRA 1XNQB 1CPYA 1IAVA 4QICA 3OLXA 1RXSA 1PL8A 4ZAGA 2EBWA 1PQYA 3JVIA 4DC0A 4GOKA 1YGYA 5F1YA 3Q1KA 2N46A 1G38A 4JELA 5AQ1A 1MTZA 5D3QA 2DFVA 1TADA 2JJMA 1Y89A 3PL1A 2VJAA 1ECBA 3EW7A 3H19A 3L0DA 5LQCA 1XO1A 1XZ8A 1S1CA 4O1HA 1W1IA 3C6BA 4UUBA 4Q9DA 2EP8A 4M49A 4WY8A 2O1XA 1OH7A 1O6BA 3SHWA 1ZUNA 4ZOCA 5D1NA 4NJEA 4RD6A 5TMPA 1GM5A 1W36C 2DPGA 2PE5A 1NYTA 2J7PD 3TBKA 2HUNA 2J3IA 2XAAA 2QYSA 3RGWS 5K3DA 1DQNA 3VC7A 4NG4A 2HJ9A 3KKLA 4QATA 3LGSA 4NBUA 3NTXA 5F35A 3TVDA 5FWYA 1WV1A 3QKSA 4JOBA 4DGSA 5M34A 1M6EX 1KK1A 3WXMA 1GZUA 1F2UA 5ALRA 3L1HA 4YAWA 1IBMB 3I32A 1WCIA 3AEKA 2V6BA 1X87A 1Z6GA 4C4YA 2ZATA 1QLWA 1E6LA 3BMQB 4RSRA 4WJKB 1PWEA 4J4HA 4CCYB 1JECA 1I14A 3PKZA 4QOHA 4RCVA 4DC1A 4F4DA 2PQMA 2YUTA 4D25A 2OZLB 4MUJA 3WWZA 1DKUA 5K8LA 4ER5A 1KAQA 3PQ2A 1P8JA 2AFIB 3F4KA 4B3GA 1NBEA 3PLNA 1N6KA 1G6HA 1X7YB 3GEBA 4PHGA 4WPGA 4CQLB 1QRSA 3ZDBA 1IIBA 1Z2AA 3F0TA 1D4AA 5AW9A 4EFDA 4O4LA 1D8TA 1FVHA 5DK6A 5D8DA 2X8WA 3EQ7A 4FIZA 3WVNA 4EAAA 5H59A 2AEFA 1X70A 3CB4A 1LF5A 3B6MA 1DEOA 2FSHA 3NDJA 4OAOA 3W5SA 4PZZA 1OV6A 1KI1A 5IN5A 4GE3A 2CL6X 4TMVA 2VAPA 1Z8HA 2D2VA 1JAHA 2XY4A 2GBFA 1G60A 2RJNA 3BK1A 3K09A 3WRWA 4QBKA 4FD3A 1Y1PA 4GKBA 1ZZGA 2ZRAA 3RUEA 1KNXA 3VKFA 5LXTF 4ZHQA 2ZIZA 1X3SA 3JWJA 4IUDS 1KBOA 3RFCA 1CIPA 3LD9A 2X7XA 4ZOAA 3WLPA 3U6KA 4MV7A 4MLPA 4ZV7A 5KYWB 4A2QA 2HXSA 2PBLA 2A14A 5J5VA 4GVLA 4CLDA 1QO7A 3M1YA 2EDCA 1IOLA 4CN8A 3A04A 4EK9A 4URWR 5JVDB 1JDPA 2X9GA 1UC5B 4LA4A 3IKVA 5K03A 3BJRA 1EINA 1BROA 3GY0A 5IJWA 3V4LA 1CX9B 3LP8A 4D46A 1B26A 1BFDA 1OWLA 1FDOA 2PSDA 2X9NA 3L1JA 4DDKA 2O8CA 4A0RA 3KWJA 3H13A 1AQIA 1JG6A 3I53A 3O8LA 3BL6A 4U63A 2J09A 1L5OA 3W06A 2LNDA 2OCIA 2WM9B 4FC6A 4OV6B 3H5OA 1T2NA 3NHJA 1K66A 1WRBA 2OZLA 3BDIA 3R5KA 4ZAVA 4EL5A 5AKGA 1L5GB 5EL0A 1TRKA 2GJAA 3KKOA 2GK7A 3NDIA 2NZYA 4IF6A 5EKUA 1IQRA 4LWOA 4CDGA 2P3LA 4IXTA 2Q4DA 3DHYA 4AJNA 3I9JA 1XHFA 3K92A 1CDOA 1UBGA 5CH5A 1GNQA 3IVXA 1L7OA 3F4LA 3FVTA 1FUKA 5EKDA 5TT0A 1N75A 4FWIB 1T6YA 3D7RA 4XWGA 4ZRNA 1IWBB 1P75A 1X74A 2QNIA 3ZJTA 3U3JA 3IBCA 4DIFA 1RE1A 1FXUA 2BBSA 1OWMA 2IXBA 1QB7A 5KI6A 5J2UA 3ESAA 5IVDA 3IP9A 3HJBA 4KWIA 4W1QA 5DH9A 5KSZA 4M9ZA 5EFOA 5GIPE 2I1VB 2QTNA 3T7CA 3W1VA 1TUBB 2ZB2A 1WXQA 3HGQA 4EFKA 3U16A 5KQPA 1SBCA 3TIXB 4ZMSA 4GRIA 1PGNA 3WLSA 4LMRA 2QRJA 1QS0B 1Z37A 3ICVA 3UC9A 1RZRA 5ERGB 3RKSA 4QQKA 2XVZA 3DBRB 3AR8A 3FE2A 4EHJA 3NVKI 3CX6A 3X2FA 1EHYA 1QC5B 3DAFA 2QRMA 1T15A 2YICA 1P31A 2QA5A 1GYPA 3D4PA 5TE9A 3L01A 1I3MA 2H6EA 3F6SA 2VR1A 3E23A 3LO5A 4QPJC 5G41A 3TIFA 4QVIA 1U0OC 2V1UA 1WR8A 1Y1RA 2J48A 2QX4A 2GAFA 5DM4A 5JSZB 2PSHA 4FEEA 4XPZA 3V9AA 4G9GA 1KMIY 1L5KA 4KV9A 5JISA 1VA4A 4KIWA 2H1FA 3KRTA 4QTZA 3AF3A 4AK9A 5BMVF 4LMBA 4Z5XA 1M34B 1N9KA 3HDYA 1YA8A 3TEMA 2ZS9A 2ZB8A 1NQ5A 5IKXA 2DTDA 4B9EA 1X7HA 2Q46A 1H69A 4BEWA 2GPBA 4Q34A 4Q0MA 2BM9A 1Y33E 4QSHA 3SYLA 1ESDA 3SK0A 4EVIA 1Y8ZA 1PTKA 5AOBA 4I3GA 4ALKA 5H1YA 5CK4A 4J03A 3TTWA 3IEKA 1VPLA 1IG0A 4IIVA 3K2EA 2XDWA 4ZYXA 1J5EB 4JI7B 1N92A 2GCGA 2GR9A 3IB3A 4CMKA 5FOQA 2H3HA 1T3LA 4ZYUA 2OB2A 5BR4A 4NJMB 2Z95A 3KBOA 3L6RA 1Z0KA 2IEYA 3H97A 3PXXA 1R5JA 2CLFB 3LHDA 4IIJF 4R9VA 2B0CA 3Q7EA 4FTWA 1O6GA 1YOBA 1XJ5A 1FU8A 3DOOA 4A03A 4MVJA 3HN6A 4EKNB 5JJ5A 5T41A 2CJYA 2PEYA 1R1DA 1MQ9A 1K06A 3U19A 2VEDA 2FR8A 4B2LA 5DXJA 5FBZA 5EKXA 3UCFA 4ERXA 1JEQA 1XVVA 2DRIA 3I1IA 1NVDA 1LD3A 4ZI7B 1BVHA 2QR2A 1P9OA 3VR1A 4P0QB 2P62A 2BBOA 5T4EA 3MLBA 4F4HA 4LZPA 3KC2A 2VHYA 3ZQUA 4C0KA 4DCCA 4K5QA 3UMMA 3UMYA 1SELA 3PGXA 2AMVA 3CURA 1UPFA 1X92A 4G1MB 4C0JA 1FJ2A 1EK6A 3HKDA 4PANA 4EI8A 1I13A 4EKIA 1TX4B 1XZAA 3TJMA 1HDIA 4C7KA 4B45A 4M9XA 4AD8A 1KTIA 3NWBA 1E3MA 1C7JA 2VHJA 3L46A 4MJ3A 1F51E 4MOWA 2VPYA 1ZGBA 2ZBFA 3HDHA 2J33A 1H6CA 2YHBA 3K9HA 4L16A 3DE6X 4PRLA 4YROA 2GFQA 3H6HA 1TLTA 1X9IA 4QBTA 4HWOA 5EJGA 4FE4A 3T1QA 1MOPA 1BXRB 1Y4AE 4BVJA 2A86A 1EFLA 1ETUA 1WQ4A 2LTAA 2QTMA 4QWWA 2B4AA 4XLZA 4KPEC 3NTVA 3H2YA 5G02A 4KFUA 4C0WA 4B75A 4TWRA 2CNBA 3EUAA 4KYUA 2DY1A 2R8PA 2GAAA 1HE1C 2WE7A 3E5NA 3LPAA 5KDLA 4CKEA 3AINA 5JIBA 4UATA 4O33A 1SC3A 3UJAA 3EVEA 4NEHB 2BI8A 2FPMA 4ZQGA 4MS1A 3K20A 5K6TA 1JBEA 5SZKB 3FMOB 1VI2A 4YAOA 2AJTA 2PMWB 3VNAA 3KNZA 3RNOA 1M83A 3S2FA 4KQ1A 5HEKA 1GZ4A 2XXAB 1SQFA 2EKDA 3T6KA 1L3IA 5HCUA 3NYIA 8AT1A 3KSMA 2JI7A 2YY5A 2NU7B 3SE0A 4N82A 5JH7B 3QWHA 3AJRA 3QHPA 1NW7A 2FFHA 3N7TA 2HT6A 4QULA 3SZMA 3VPHA 2C7VA 4E5UA 4Q37A 5TQVA 3TZQA 3UICA 3ETDA 4FFMA 3GEIA 3UT5A 3C3JA 4BWVA 1KFCB 1EFVA 1MJGM 1RLUA 3F90A 4K9OA 1KJNA 3C85A 4CQLA 3T7TA 4BNJA 4HHEA 1QG6A 4BP3A 1W93A 3GMSA 2NWQA 3E2MA 5JG7A 5LQAA 1LWNA 1FX0B 1M2VB 4M98A 1VIMA 1QONA 1JP7A 3DMGA 2Z8ZA 4ITVA 1OQAA 3FNEA 1E2GA 3QUCA 5KB3A 1Y63A 4JI1B 4DV1B 1GJRA 2YZ7A 4RULA 5EJ4A 1W4CA 2GPWA 4ZU6X 4NCXA 1BEEA 3K0SA 5C8VA 1PP4A 3T5TA 3UW3A 2ZSDA 4U2FA 4OFWA 4QUBA 5BUSA 2PUTA 1W88B 2Z04A 4N3GA 4JI0B 2CNDA 4FMDF 2C1XA 2PD4A 2EC5A 1DXHA 5L4NA 2CW5A 4AJHA 4YREA 2X13A 1NXSA 3DZKA 4DR7B 1X9GA 1QCZA 3GUUA 2OEPA 2PUBA 1AHIA 2REQB 3U2QA 4UD2A 3UW1A 3O03A 2O3SA 3WNQA 2PBFA 1AU9A 3IH5A 3OAAA 3WNVA 2EYQA 3QUSA 4L51A 2CXRA 4EI7A 4RZ3A 4F2GA 3CVYA 4JQYA 1VYUA 5FUBA 4UUNA 3E6AA 1AHPA 3GDHA 4WIAA 3UJBA 3B2EA 3KYIB 1GO2A 3TLCA 4AP5A 2R7LA 1RFLA 2QS9A 5AW8A 4L74A 3W5CA 2GHIA 3H9BA 2BMVA 3V8MA 4LF5B 1Z38A 4Q1CA 1VIYA 1LUAA 5LMNB 4R2HA 1TIKA 3NT2A 2O3QA 4ZYTA 3PYLA 3SIXA 2J67A 2G4VA 3KYDA 1GU0A 1XLTC 1Z88A 4WCFC 3S6JA 4XX0B 1U7ZA 3AJDA 1ZKDA 1R16A 3IPRA 4ALIA 1T9BA 4TTJA 3BEOA 7MHTA 3U7IA 4R2IA 2QXYA 4I9UA 2IWHA 4ZCQA 2C82A 3R77A 5KMGA 4ZI5A 4DYDA 2XCSB 1YU9A 1R4NB 1EXDA 1E9DA 4OU5A 1IZZA 1OBHA 2K6GA 4EF6A 3HCPA 4WFJA 2M6LA 1B42A 1DC3A 2CJFA 3A7EA 3Q3EA 1DIOB 3R09A 5AK6A 3ZU4A 2HF8A 2FEPA 2JCXA 5TGDA 2P4HX 2CCKA 4A15A 2YWXA 4EHAA 4HEJA 1L5WA 3UFBA 1I5OA 1HI9A 2C61A 3EGXA 3K8YA 3I09A 5DM70 2OZEA 1MRZA 3JQCA 3BE6A 4Q1FA 3X0DA 2ZJ6A 2ZJOA 3ILYA 1T0BA 1C41A 2X7HA 3RKUA 3QX7A 5HRCA 4RTPA 2PMFA 1M8FA 4RPKA 5EZYA 1M74A 1NWCA 1DE0A 5FA6A 3ZN2A 5EHXA 2DWOA 5HE8A 2CXSA 4FBGA 3ETJA 3IQEA 5ALLA 5IWCA 2UXBB 3DBRA 3SKVA 4K6CA 4E5VA 4R5HA 1ML3A 2ZUDA 4RE6A 4KWCA 1T26A 1SHTX 3DDOA 1JR3D 1CYEA 1F7UA 5EJEA 1WXXA 5HNKA 3I2JA 3FTNA 3UK7A 1A72A 1RMTA 3O7WA 4U2CA 4CHGA 1Q0TA 1D4FA 1RLMA 3OPNA 5B4UA 1Z39A 2Q4EA 3NBAA 3HU3A 3VUEA 3WL8A 1SO8A 3WZMA 4D9IA 2PZEA 4C29A 5KYNA 5E1MA 4CTKA 4QNMA 3W3AD 3EIXA 5FOTA 1PR1A 4D9KA 1BHJA 1U5CA 1PIWA 3OP4A 3JAWA 1QIKA 4MS4A 2ZUVA 4FPXA 3C74A 3MC1A 3CH4B 4YAFA 4ZV9A 3GUHA 4F84A 4YCMA 3ADPA 1N1GA 5I7VA 3M0EA 3LGAA 5T7BA 2WDZA 2FPRA 1PHPA 1WF3A 3JYLA 1PZGA 3F6RA 1XEAA 4TL6A 2CE2X 3WNDA 3P19A 2OFPA 4LYYA 1TZBA 4MKHA 3VGPA 1AKVA 1W8DA 2G09A 3ACCA 3BRCA 2A67A 4CEIB 2OGWA 3GAFA 5JATA 5FV7A 3JQ7B 2H52A 1YQEA 4MIKA 1A98A 3UANA 1KRHA 1YBHA 3GDWA 2EERA 1SA0B 1T2DA 1XU9A 3KX2A 2X0DA 3TCKA 5M04A 1NBMA 1ZVJA 1M67A 4KN6A 1QNFA 3D6VA 3PC2A 5GVRA 4ZCIA 1QTRA 3RU9A 3ROTA 2WILA 4I3FA 3EQ8A 2N3ZA 3KPYA 3TRFA 3F5SA 4YLYA 4P7JA 3A70A 3K1YA 1H2FA 3WLOA 2HB6A 2O2HA 3CF4G 4CLRB 2JEOA 3T7SA 2WAYA 1KEEA 2JK1A 4OO3A 2B34A 3JASB 3GA0A 3RVKA 4B43A 1H8ED 1HLFA 4BFSA 3E3LA 4ZOLA 3DZGA 5HTKA 3LXRA 4D9GA 1TJ3A 2JK0A 2RI1A 1AMNA 2QTBA 5FQNA 1FS5A 1EI9A 2F9LA 5K4AA 2TMKA 3S55A 1YQTA 1P7YA 1A8IA 1N3IA 1T0JB 2I7CA 2PLNA 4V0SA 3N8DA 3WB0A 3AKZA 1YH3A 4QUEA 1NTOA 3M5PA 4GXQA 4L57A 4P98A 4PC2A 2V4ZA 5LWQA 2JZCA 2N47A 3L8YA 1FC0A 1K63A 4BNHA 1F8UA 2I91A 4NHOA 2OQVA 1BKSB 3ZU3A 1XMXA 6Q21A 3LUBA 4HFRA 5IN4A 2NVBA 3HJUA 3RS0A 1OLOA 4Z2AA 1R2QA 3NBYC 1ZI8A 2R86A 4XSGA 5TC4A 2Z56A 4RD0A 4OXYA 3DDUA 4LSMA 4YMLA 2F1RA 1IC6A 1VPVA 1S3SA 5GP1A 1XQ6A 4HDNA 1ZINA 2FDCA 4MINA 2VXCA 2VHCA 4HVAA 1W48A 4FYKA 5HF8A 2AF3C 1AQ6A 2PZAA 4KXFB 5FL7A 1Q5PA 3PRJA 5BR7A 2GZAA 2BELA 3KOXA 4L7QA 3UCXA 2IZ6A 2BFFA 2FQYA 3L41A 3R5TA 2NU6B 1JYSA