5IDPB

Cdk8-cycc in complex with (3-amino-1h-indazol-5-yl)-[(s)-2-(4-fluoro-phenyl)-piperidin-1-yl]-methanone
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
b'DDKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-Based Optimization of Potent, Selective, and Orally Bioavailable CDK8 Inhibitors Discovered by High-Throughput Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5idpB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5idpB01
1JSTB 4CFUD 1E9HB 5ACBA 2IW8B 2PK2A 2IW9B 3BHVB 1UNLD 3MY1B 4ELLA 4EOQB 5CEIB 1P5EB 1H28B 2W9ZA 1KXUA 2WXVB 4CFXB 4ELJA 4OR5B 3TNHB 5BNJB 4BCOB 1H1SB 3LQ5B 2UZEB 2WMAB 3TNIB 2CCIB 4EC9B 3EJ1B 2QDJA 1H26B 3F5XB 3BHTB 5IDNB 4BCQB 2W96A 3EOCB 1H4LD 2C5OB 4Y72B 4FX3B 1G3NC 4BCPB 1ZP2A 3DOGB 4BCIB 5HNBB 1GUXA 2UUEB 3QHWB 2W99A 4CFNB 4EOJB 1URCB 4F70B 1H1PB 5HBJB 1FVVB 1BU2A 5L2WB 4BCQD 4EC8B 1AD6A 4BCNB 1O9KA 5IDPB 2CCHB 3BLQB 1H27B 2G9XB 1JSUB 2BKZB 2PHGA 3EIDB 3K7AM 4F7JB 1AISB 3QHRB 2WHBB 5I5ZB 1PKDB 1OKVB 1VOLA 3BLHB 2W9FA 2IW6B 2UZLB 2C5NB 2WEVB 2C4GB 4RODA 2C5VB 4OGRB 4BCND 1OL1B 1UNHD 3MY5B 4KRDB 4BCMD 2F2CA 1H1QB 5FGKB 2I53A 1OKWB 1OIUB 1OGUB 4YC3B 1QMZB 5LMKB 2PMIB 4CXAB 2JGZB 4BCHB 4F6SB 4II5B 2C6TB 4YOZA 2BPMB 3MIAB 4F6UB 1VINA 2WIHB 3O0GD 4ROCA 1UNGD 2WPAB 4UN0A 4IMYB 4BCMB 1H25B 4EOSB 1GUXB 2IVXA 4CFMB 3BLRB 1JKWA 5HBHB 1H1RB 1N4MA 1VYWB 1OL2B 5CYIB 3BHUB 2C5XB 3M03A 2B9RA 2EUFA 4EORB 3DDPB 5IF1B 4BCGB 4TTHA 1O9KB 4KRCB 1OI9B 2CJMB 5LQFB 4G6LB 4ROEA 4EOLB 1H24B 4EONB 5HVYB 4F6WB 5ICPB 1F5QB 3MI9B 4NSTB 3TN8B 5HQ0B 4YOOA 1OIYB 4EOMB 4EOOB 2V22B 3H4CA 4I3ZB 4BCKB 4EOKB 1JOWA 4CFVB 4F7NB 1XO2A 4EOIB 1C9BA 5EFQB 1W98B 2PK9B 4CFWB 5HBEB 3TNWB 2WFYB 4F7LB 4CFUB 1GH6B 3DDQB 4YOSA 1FINB 4CRLB 4BCFB 2R7GA 2W2HA 1D3UB 4EOPB 4F7SB 1TFBA 4BCJB 2UZBB 2WIPB 2X1NB 3G33B 3POMA 3RGFB 2I40B 2UZDB 2WMBB 1GY3B
chains in the Genus database with same CATH superfamily
2IW8B 3BHVB 5CEIB 1KXUA 4ELJA 4BCOB 2WJ9A 2DPPB 3VKHA 2ZPEB 1H4LD 2C5OB 3KHIA 4FX3B 3A8GB 3HHTB 2CZ1B 5DQWA 4BXXX 2W99A 1H1PB 4M6VA 5HBJB 1FVVB 5L2WB 4BY7X 4LOCA 3DJBA 3VYHB 2PHGA 2ZPGB 3EIDB 2AHJB 4FM4B 1VOLA 3BLHB 2W9FA 4QSHA 2ZCFB 4OGRB 2DMEA 4BCND 1OL1B 3MY5B 4BCMD 1H1QB 2I53A 1OGUB 3A8LB 4CXAB 3X25B 4II5B 3HB9A 4UN0A 2WPAB 2QQ8A 4ZGDB 3TW6A 1FKMA 3BLRB 1H1RB 3M03A 2B9RA 4EORB 3B57A 3A8HB 4BCGB 2KMGA 1OI9B 4OB1B 5LQFB 4ROEA 5ICPB 2DD4B 2V22B 2QDYB 4F7NB 1XO2A 3X28B 1W98B 2PK9B 5HBEB 4CFUB 1GH6B 1FINB 3BG9A 4CRLB 2W2HA 5DQVA 4EOPB 4BCJB 4BBRM 1GY3B 2DD5B 2PK2A 2IW9B 1UNLD 3X26B 3BG5A 2W9ZA 4CFXB 4OR5B 3TNHB 3QZ9B 2WMAB 3TNIB 4BCQB 4Y72B 1GUXA 2UUEB 1URCB 4EC8B 1H27B 4F7JB 1AISB 2WHBB 3DL1A 5I5ZB 1OKVB 4RODA 3QXEB 1UNHD 2F2CA 5FGKB 3HO8A 4YC3B 5LMKB 2PMIB 4BY1X 4F6SB 2CZ6B 2C6TB 4AKGA 4F6UB 4BBSM 4IMYB 4EOSB 1AHJB 2IVXA 1JKWA 2BS3A 2BS4A 3PO3S 3GTMS 1TD6A 1UGRB 3QYHB 5EJCA 4AKHA 2KR6A 5HVYB 4EOLB 4EONB 4F6WB 3MI9B 4NSTB 3VYGB 4YOOA 3H4CA 4BCKB 4NC6A 1JOWA 4CFVB 1C9BA 3X24B 5EFQB 4HNVA 3TNWB 4F7LB 3DDQB 2R7GA 1D3UB 4F7SB 4MIMA 2WIPB 2QGSA 2X1NB 3A8MB 5IHYA 1ENWA 1JSTB 2QFZA 1E9HB 3MY1B 4EOQB 1H28B 4JX6A 1UGQB 1V29B 5BNJB 3LQ5B 4AKIA 4EC9B 3EJ1B 2QDJA 3BHTB 5IDNB 3EOCB 4BCPB 3QHWB 4CFNB 3TW7A 4F70B 3X20B 4BCNB 1O9KA 3QYGB 3BLQB 2IN3A 2G9XB 3QZ5B 3K7AM 3QHRB 4ZGJB 4Z6YA 3QYBA 2CZ0B 2IW6B 2PJQA 2C4GB 2ZPBB 2D0QB 2C5VB 3QYEA 4OB3B 4KRDB 1OKWB 3HZJA 1OIUB 1QMZB 4YOZA 1GUXB 5HBHB 5CYIB 1OL2B 3BHUB 2C5XB 2EUFA 3DDPB 4TTHA 4KRCB 2CJMB 1H24B 4AI6A 1F5QB 4EOMB 3TN8B 3VKGA 1QLBA 4I3ZB 3A8OB 2ZPFB 4EOIB 3NDQA 2ZPIB 2DXBB 3DTOA 4YOSA 3WVEB 1TFBA 2UZBB 1UGSB 3RGFB 2I40B 2UZDB 2WMBB 4HL4A 2DXCB 4CFUD 2CZ7B 2G77A 5ACBA 3BG3A 4ELLA 4HLQA 1P5EB 2WXVB 4HNTA 1H1SB 2UZEB 2CCIB 1H26B 3F5XB 4OB2B 2W96A 1G3NC 1ZP2A 3DOGB 4BCIB 5HNBB 4HNUA 4EOJB 2QF7A 1BU2A 4BCQD 1AD6A 5IDPB 2CCHB 4JX5A 1JSUB 2BKZB 1PKDB 2UZLB 2C5NB 2WEVB 2BS2A 4OB0B 1IREB 2JGZB 4BCHB 2BPMB 3MIAB 1VINA 2WIHB 3O0GD 4ZGEB 4ROCA 1UNGD 4BCMB 1H25B 3HBLA 4CFMB 1N4MA 1VYWB 5IF1B 1O9KB 4G6LB 3QWLA 4JX4A 1UGPB 5HQ0B 4EOOB 1OIYB 4EOKB 2LW4A 4CFWB 4MFEA 2CYZB 2WFYB 4BCFB 1E7PA 3G33B 3POMA 2ZZDB 4MFDA 3WVDB 2ZPHB
chains in the Genus database with same CATH topology
1JSTB 4CFUD 1E9HB 5ACBA 2IW8B 2PK2A 2IW9B 3BHVB 1UNLD 3MY1B 4ELLA 4EOQB 5CEIB 1P5EB 1H28B 2W9ZA 1KXUA 2WXVB 4CFXB 4ELJA 4OR5B 3TNHB 5BNJB 4BCOB 1H1SB 3LQ5B 2UZEB 2WMAB 3TNIB 2CCIB 4EC9B 3EJ1B 2QDJA 1H26B 3F5XB 3BHTB 5IDNB 4BCQB 2W96A 3EOCB 1H4LD 2C5OB 4Y72B 4FX3B 1G3NC 4BCPB 1ZP2A 3DOGB 4BCIB 5HNBB 1GUXA 2UUEB 3QHWB 2W99A 4CFNB 4EOJB 1URCB 4F70B 1H1PB 5HBJB 1FVVB 1BU2A 5L2WB 4BCQD 4EC8B 1AD6A 4BCNB 1O9KA 5IDPB 2CCHB 3BLQB 1H27B 2G9XB 1JSUB 2BKZB 2PHGA 3EIDB 3K7AM 4F7JB 1AISB 3QHRB 2WHBB 5I5ZB 1PKDB 1OKVB 1VOLA 3BLHB 2W9FA 2IW6B 2UZLB 2C5NB 2WEVB 2C4GB 4RODA 2C5VB 4OGRB 4BCND 1OL1B 1UNHD 3MY5B 4KRDB 4BCMD 2F2CA 1H1QB 5FGKB 2I53A 1OKWB 1OIUB 1OGUB 4YC3B 1QMZB 5LMKB 2PMIB 4CXAB 2JGZB 4BCHB 4F6SB 4II5B 2C6TB 4YOZA 2BPMB 3MIAB 4F6UB 1VINA 2WIHB 3O0GD 4ROCA 1UNGD 2WPAB 4UN0A 4IMYB 4BCMB 1H25B 4EOSB 1GUXB 2IVXA 4CFMB 3BLRB 1JKWA 5HBHB 1H1RB 1N4MA 1VYWB 1OL2B 5CYIB 3BHUB 2C5XB 3M03A 2B9RA 2EUFA 4EORB 3DDPB 5IF1B 4BCGB 4TTHA 1O9KB 4KRCB 1OI9B 2CJMB 5LQFB 4G6LB 4ROEA 4EOLB 1H24B 4EONB 5HVYB 4F6WB 5ICPB 1F5QB 3MI9B 4NSTB 3TN8B 5HQ0B 4YOOA 1OIYB 4EOMB 4EOOB 2V22B 3H4CA 4I3ZB 4BCKB 4EOKB 1JOWA 4CFVB 4F7NB 1XO2A 4EOIB 1C9BA 5EFQB 1W98B 2PK9B 4CFWB 5HBEB 3TNWB 2WFYB 4F7LB 4CFUB 1GH6B 3DDQB 4YOSA 1FINB 4CRLB 4BCFB 2R7GA 2W2HA 1D3UB 4EOPB 4F7SB 1TFBA 4BCJB 2UZBB 2WIPB 2X1NB 3G33B 3POMA 3RGFB 2I40B 2UZDB 2WMBB 1GY3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JST B;  4CFU D;  1E9H B;  5ACB A;  2IW8 B;  2PK2 A;  2IW9 B;  3BHV B;  1UNL D;  3MY1 B;  4ELL A;  4EOQ B;  5CEI B;  1P5E B;  1H28 B;  2W9Z A;  1KXU A;  2WXV B;  4CFX B;  4ELJ A;  4OR5 B;  3TNH B;  5BNJ B;  4BCO B;  1H1S B;  3LQ5 B;  2UZE B;  2WMA B;  3TNI B;  2CCI B;  4EC9 B;  3EJ1 B;  2QDJ A;  1H26 B;  3F5X B;  3BHT B;  5IDN B;  4BCQ B;  2W96 A;  3EOC B;  1H4L D;  2C5O B;  4Y72 B;  4FX3 B;  1G3N C;  4BCP B;  1ZP2 A;  3DOG B;  4BCI B;  5HNB B;  1GUX A;  2UUE B;  3QHW B;  2W99 A;  4CFN B;  4EOJ B;  1URC B;  4F70 B;  1H1P B;  5HBJ B;  1FVV B;  1BU2 A;  5L2W B;  4BCQ D;  4EC8 B;  1AD6 A;  4BCN B;  1O9K A;  5IDP B;  2CCH B;  3BLQ B;  1H27 B;  2G9X B;  1JSU B;  2BKZ B;  2PHG A;  3EID B;  3K7A M;  4F7J B;  1AIS B;  3QHR B;  2WHB B;  5I5Z B;  1PKD B;  1OKV B;  1VOL A;  3BLH B;  2W9F A;  2IW6 B;  2UZL B;  2C5N B;  2WEV B;  2C4G B;  4ROD A;  2C5V B;  4OGR B;  4BCN D;  1OL1 B;  1UNH D;  3MY5 B;  4KRD B;  4BCM D;  2F2C A;  1H1Q B;  5FGK B;  2I53 A;  1OKW B;  1OIU B;  1OGU B;  4YC3 B;  1QMZ B;  5LMK B;  2PMI B;  4CXA B;  2JGZ B;  4BCH B;  4F6S B;  4II5 B;  2C6T B;  4YOZ A;  2BPM B;  3MIA B;  4F6U B;  1VIN A;  2WIH B;  3O0G D;  4ROC A;  1UNG D;  2WPA B;  4UN0 A;  4IMY B;  4BCM B;  1H25 B;  4EOS B;  1GUX B;  2IVX A;  4CFM B;  3BLR B;  1JKW A;  5HBH B;  1H1R B;  1N4M A;  1VYW B;  1OL2 B;  5CYI B;  3BHU B;  2C5X B;  3M03 A;  2B9R A;  2EUF A;  4EOR B;  3DDP B;  5IF1 B;  4BCG B;  4TTH A;  1O9K B;  4KRC B;  1OI9 B;  2CJM B;  5LQF B;  4G6L B;  4ROE A;  4EOL B;  1H24 B;  4EON B;  5HVY B;  4F6W B;  5ICP B;  1F5Q B;  3MI9 B;  4NST B;  3TN8 B;  5HQ0 B;  4YOO A;  1OIY B;  4EOM B;  4EOO B;  2V22 B;  3H4C A;  4I3Z B;  4BCK B;  4EOK B;  1JOW A;  4CFV B;  4F7N B;  1XO2 A;  4EOI B;  1C9B A;  5EFQ B;  1W98 B;  2PK9 B;  4CFW B;  5HBE B;  3TNW B;  2WFY B;  4F7L B;  4CFU B;  1GH6 B;  3DDQ B;  4YOS A;  1FIN B;  4CRL B;  4BCF B;  2R7G A;  2W2H A;  1D3U B;  4EOP B;  4F7S B;  1TFB A;  4BCJ B;  2UZB B;  2WIP B;  2X1N B;  3G33 B;  3POM A;  3RGF B;  2I40 B;  2UZD B;  2WMB B;  1GY3 B; 
#chains in the Genus database with same CATH topology
 2IW8 B;  3BHV B;  5CEI B;  1KXU A;  4ELJ A;  4BCO B;  2WJ9 A;  2DPP B;  3VKH A;  2ZPE B;  1H4L D;  2C5O B;  3KHI A;  4FX3 B;  3A8G B;  3HHT B;  2CZ1 B;  5DQW A;  4BXX X;  2W99 A;  1H1P B;  4M6V A;  5HBJ B;  1FVV B;  5L2W B;  4BY7 X;  4LOC A;  3DJB A;  3VYH B;  2PHG A;  2ZPG B;  3EID B;  2AHJ B;  4FM4 B;  1VOL A;  3BLH B;  2W9F A;  4QSH A;  2ZCF B;  4OGR B;  2DME A;  4BCN D;  1OL1 B;  3MY5 B;  4BCM D;  1H1Q B;  2I53 A;  1OGU B;  3A8L B;  4CXA B;  3X25 B;  4II5 B;  3HB9 A;  4UN0 A;  2WPA B;  2QQ8 A;  4ZGD B;  3TW6 A;  1FKM A;  3BLR B;  1H1R B;  3M03 A;  2B9R A;  4EOR B;  3B57 A;  3A8H B;  4BCG B;  2KMG A;  1OI9 B;  4OB1 B;  5LQF B;  4ROE A;  5ICP B;  2DD4 B;  2V22 B;  2QDY B;  4F7N B;  1XO2 A;  3X28 B;  1W98 B;  2PK9 B;  5HBE B;  4CFU B;  1GH6 B;  1FIN B;  3BG9 A;  4CRL B;  2W2H A;  5DQV A;  4EOP B;  4BCJ B;  4BBR M;  1GY3 B;  2DD5 B;  2PK2 A;  2IW9 B;  1UNL D;  3X26 B;  3BG5 A;  2W9Z A;  4CFX B;  4OR5 B;  3TNH B;  3QZ9 B;  2WMA B;  3TNI B;  4BCQ B;  4Y72 B;  1GUX A;  2UUE B;  1URC B;  4EC8 B;  1H27 B;  4F7J B;  1AIS B;  2WHB B;  3DL1 A;  5I5Z B;  1OKV B;  4ROD A;  3QXE B;  1UNH D;  2F2C A;  5FGK B;  3HO8 A;  4YC3 B;  5LMK B;  2PMI B;  4BY1 X;  4F6S B;  2CZ6 B;  2C6T B;  4AKG A;  4F6U B;  4BBS M;  4IMY B;  4EOS B;  1AHJ B;  2IVX A;  1JKW A;  2BS3 A;  2BS4 A;  3PO3 S;  3GTM S;  1TD6 A;  1UGR B;  3QYH B;  5EJC A;  4AKH A;  2KR6 A;  5HVY B;  4EOL B;  4EON B;  4F6W B;  3MI9 B;  4NST B;  3VYG B;  4YOO A;  3H4C A;  4BCK B;  4NC6 A;  1JOW A;  4CFV B;  1C9B A;  3X24 B;  5EFQ B;  4HNV A;  3TNW B;  4F7L B;  3DDQ B;  2R7G A;  1D3U B;  4F7S B;  4MIM A;  2WIP B;  2QGS A;  2X1N B;  3A8M B;  5IHY A;  1ENW A;  1JST B;  2QFZ A;  1E9H B;  3MY1 B;  4EOQ B;  1H28 B;  4JX6 A;  1UGQ B;  1V29 B;  5BNJ B;  3LQ5 B;  4AKI A;  4EC9 B;  3EJ1 B;  2QDJ A;  3BHT B;  5IDN B;  3EOC B;  4BCP B;  3QHW B;  4CFN B;  3TW7 A;  4F70 B;  3X20 B;  4BCN B;  1O9K A;  3QYG B;  3BLQ B;  2IN3 A;  2G9X B;  3QZ5 B;  3K7A M;  3QHR B;  4ZGJ B;  4Z6Y A;  3QYB A;  2CZ0 B;  2IW6 B;  2PJQ A;  2C4G B;  2ZPB B;  2D0Q B;  2C5V B;  3QYE A;  4OB3 B;  4KRD B;  1OKW B;  3HZJ A;  1OIU B;  1QMZ B;  4YOZ A;  1GUX B;  5HBH B;  5CYI B;  1OL2 B;  3BHU B;  2C5X B;  2EUF A;  3DDP B;  4TTH A;  4KRC B;  2CJM B;  1H24 B;  4AI6 A;  1F5Q B;  4EOM B;  3TN8 B;  3VKG A;  1QLB A;  4I3Z B;  3A8O B;  2ZPF B;  4EOI B;  3NDQ A;  2ZPI B;  2DXB B;  3DTO A;  4YOS A;  3WVE B;  1TFB A;  2UZB B;  1UGS B;  3RGF B;  2I40 B;  2UZD B;  2WMB B;  4HL4 A;  2DXC B;  4CFU D;  2CZ7 B;  2G77 A;  5ACB A;  3BG3 A;  4ELL A;  4HLQ A;  1P5E B;  2WXV B;  4HNT A;  1H1S B;  2UZE B;  2CCI B;  1H26 B;  3F5X B;  4OB2 B;  2W96 A;  1G3N C;  1ZP2 A;  3DOG B;  4BCI B;  5HNB B;  4HNU A;  4EOJ B;  2QF7 A;  1BU2 A;  4BCQ D;  1AD6 A;  5IDP B;  2CCH B;  4JX5 A;  1JSU B;  2BKZ B;  1PKD B;  2UZL B;  2C5N B;  2WEV B;  2BS2 A;  4OB0 B;  1IRE B;  2JGZ B;  4BCH B;  2BPM B;  3MIA B;  1VIN A;  2WIH B;  3O0G D;  4ZGE B;  4ROC A;  1UNG D;  4BCM B;  1H25 B;  3HBL A;  4CFM B;  1N4M A;  1VYW B;  5IF1 B;  1O9K B;  4G6L B;  3QWL A;  4JX4 A;  1UGP B;  5HQ0 B;  4EOO B;  1OIY B;  4EOK B;  2LW4 A;  4CFW B;  4MFE A;  2CYZ B;  2WFY B;  4BCF B;  1E7P A;  3G33 B;  3POM A;  2ZZD B;  4MFD A;  3WVD B;  2ZPH B; 
#chains in the Genus database with same CATH homology
 1JST B;  4CFU D;  1E9H B;  5ACB A;  2IW8 B;  2PK2 A;  2IW9 B;  3BHV B;  1UNL D;  3MY1 B;  4ELL A;  4EOQ B;  5CEI B;  1P5E B;  1H28 B;  2W9Z A;  1KXU A;  2WXV B;  4CFX B;  4ELJ A;  4OR5 B;  3TNH B;  5BNJ B;  4BCO B;  1H1S B;  3LQ5 B;  2UZE B;  2WMA B;  3TNI B;  2CCI B;  4EC9 B;  3EJ1 B;  2QDJ A;  1H26 B;  3F5X B;  3BHT B;  5IDN B;  4BCQ B;  2W96 A;  3EOC B;  1H4L D;  2C5O B;  4Y72 B;  4FX3 B;  1G3N C;  4BCP B;  1ZP2 A;  3DOG B;  4BCI B;  5HNB B;  1GUX A;  2UUE B;  3QHW B;  2W99 A;  4CFN B;  4EOJ B;  1URC B;  4F70 B;  1H1P B;  5HBJ B;  1FVV B;  1BU2 A;  5L2W B;  4BCQ D;  4EC8 B;  1AD6 A;  4BCN B;  1O9K A;  5IDP B;  2CCH B;  3BLQ B;  1H27 B;  2G9X B;  1JSU B;  2BKZ B;  2PHG A;  3EID B;  3K7A M;  4F7J B;  1AIS B;  3QHR B;  2WHB B;  5I5Z B;  1PKD B;  1OKV B;  1VOL A;  3BLH B;  2W9F A;  2IW6 B;  2UZL B;  2C5N B;  2WEV B;  2C4G B;  4ROD A;  2C5V B;  4OGR B;  4BCN D;  1OL1 B;  1UNH D;  3MY5 B;  4KRD B;  4BCM D;  2F2C A;  1H1Q B;  5FGK B;  2I53 A;  1OKW B;  1OIU B;  1OGU B;  4YC3 B;  1QMZ B;  5LMK B;  2PMI B;  4CXA B;  2JGZ B;  4BCH B;  4F6S B;  4II5 B;  2C6T B;  4YOZ A;  2BPM B;  3MIA B;  4F6U B;  1VIN A;  2WIH B;  3O0G D;  4ROC A;  1UNG D;  2WPA B;  4UN0 A;  4IMY B;  4BCM B;  1H25 B;  4EOS B;  1GUX B;  2IVX A;  4CFM B;  3BLR B;  1JKW A;  5HBH B;  1H1R B;  1N4M A;  1VYW B;  1OL2 B;  5CYI B;  3BHU B;  2C5X B;  3M03 A;  2B9R A;  2EUF A;  4EOR B;  3DDP B;  5IF1 B;  4BCG B;  4TTH A;  1O9K B;  4KRC B;  1OI9 B;  2CJM B;  5LQF B;  4G6L B;  4ROE A;  4EOL B;  1H24 B;  4EON B;  5HVY B;  4F6W B;  5ICP B;  1F5Q B;  3MI9 B;  4NST B;  3TN8 B;  5HQ0 B;  4YOO A;  1OIY B;  4EOM B;  4EOO B;  2V22 B;  3H4C A;  4I3Z B;  4BCK B;  4EOK B;  1JOW A;  4CFV B;  4F7N B;  1XO2 A;  4EOI B;  1C9B A;  5EFQ B;  1W98 B;  2PK9 B;  4CFW B;  5HBE B;  3TNW B;  2WFY B;  4F7L B;  4CFU B;  1GH6 B;  3DDQ B;  4YOS A;  1FIN B;  4CRL B;  4BCF B;  2R7G A;  2W2H A;  1D3U B;  4EOP B;  4F7S B;  1TFB A;  4BCJ B;  2UZB B;  2WIP B;  2X1N B;  3G33 B;  3POM A;  3RGF B;  2I40 B;  2UZD B;  2WMB B;  1GY3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...