5IDPB

Cdk8-cycc in complex with (3-amino-1h-indazol-5-yl)-[(s)-2-(4-fluoro-phenyl)-piperidin-1-yl]-methanone
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
268
structure length
268
Chain Sequence
DDKAMAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-dependent kinase 8
publication title Structure-Based Optimization of Potent, Selective, and Orally Bioavailable CDK8 Inhibitors Discovered by High-Throughput Screening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 93
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF16899 Cyclin_C_2 Cyclin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5idpB02
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 5idpB01
2IW6B 2W2HA 1XO2A 4ROCA 3M03A 1GUXB 4ELLA 1P5EB 3MY5B 5IDPB 1OGUB 1OL1B 3TN8B 1UNHD 2UZBB 3POMA 1FINB 2C5VB 2CCIB 4OR5B 4BCQB 1N4MA 1H26B 5HBEB 2B9RA 2C6TB 3O0GD 2I40B 1JKWA 3TNIB 4OGRB 2C4GB 1OIUB 5HBHB 1GUXA 4UN0A 2EUFA 4F70B 2C5XB 3DDQB 3BLRB 4CFVB 5HQ0B 3H4CA 4II5B 4BCHB 2R7GA 2G9XB 1UNGD 2PK9B 3MI9B 4I3ZB 2IW9B 2QDJA 4YOZA 2BPMB 4F7NB 2W9FA 2W9ZA 4BCJB 4F7SB 2IW8B 2WIPB 1H1QB 4RODA 4EOOB 1H28B 3BLQB 2V22B 5ICPB 5CYIB 2X1NB 4BCPB 5LQFB 4CFWB 1H25B 5ACBA 5HBJB 4F6UB 3DDPB 2I53A 1H1SB 2WXVB 2CCHB 4BCQD 1H1PB 4YC3B 1QMZB 4F6SB 1H24B 3BHUB 1GH6B 1URCB 1VOLA 1O9KB 1JSUB 2UZEB 3EJ1B 5CEIB 5HVYB 4G6LB 3RGFB 4EONB 1FVVB 4F7JB 1D3UB 4EOSB 1ZP2A 4BCFB 1H4LD 4BCGB 2PHGA 4IMYB 3MY1B 4EORB 1G3NC 2WHBB 5L2WB 1OIYB 1O9KA 1TFBA 2WPAB 4BCNB 4CFUB 3MIAB 5I5ZB 5IF1B 1OKVB 4EOJB 4BCND 2UZLB 4CFUD 4YOSA 4KRCB 1BU2A 4KRDB 1VINA 1H27B 1AD6A 3DOGB 1W98B 4EOKB 4EOQB 2JGZB 4CFMB 4CFXB 4BCKB 2F2CA 1OI9B 1OL2B 3EIDB 2UZDB 1KXUA 4YOOA 3BHTB 5FGKB 2WEVB 4BCOB 4EOLB 3BHVB 1AISB 4EOPB 4F6WB 3G33B 2CJMB 1UNLD 3TNHB 4EOIB 2UUEB 5BNJB 1JSTB 4ROEA 4F7LB 3TNWB 5IDNB 4CRLB 2BKZB 4NSTB 2WIHB 1E9HB 4EC8B 3QHWB 1H1RB 1VYWB 2C5NB 4FX3B 1F5QB 2WMBB 1PKDB 3F5XB 4BCIB 5LMKB 1GY3B 2C5OB 4CFNB 2PMIB 3QHRB 1JOWA 2IVXA 4EOMB 2WMAB 2W99A 2PK2A 2W96A 4BCMB 3BLHB 4EC9B 2WFYB 4TTHA 5EFQB 4BCMD 3K7AM 1OKWB 4ELJA 3EOCB 5HNBB 1C9BA 4Y72B 3LQ5B 4CXAB
chains in the Genus database with same CATH superfamily
2IW6B 1XO2A 4ELLA 1P5EB 4AKIA 1OL1B 2PJQA 4BCQB 2CYZB 1JKWA 3TNIB 2LW4A 1OIUB 5HBHB 1GUXA 4CFVB 5HQ0B 3H4CA 4HL4A 2G9XB 4HNTA 2IW9B 2BPMB 2W9FA 4EOOB 1H28B 2G77A 4CFWB 3QWLA 3KHIA 5HBJB 1H1SB 2CZ6B 4BCQD 3VYHB 1H24B 3X26B 1GH6B 4BXXX 3RGFB 4EONB 4Z6YA 1FVVB 3QYBA 4EOSB 3HHTB 2PHGA 4IMYB 2DD5B 3MY1B 1OIYB 3HZJA 1TFBA 4NC6A 3MIAB 5IF1B 4MFEA 4KRCB 4JX6A 3DJBA 2JGZB 1OI9B 3EIDB 1KXUA 3BHTB 3WVEB 4BCOB 3BG5A 4EOPB 4F6WB 2CJMB 2BKZB 3QHWB 1H1RB 4FX3B 3F5XB 3VKGA 1GY3B 2ZPHB 2PMIB 3NDQA 3QYEA 2QDYB 3A8HB 3K7AM 2DD4B 4ELJA 3TW6A 4BBSM 4Y72B 3LQ5B 3BG3A 3QXEB 2BS3A 2DXCB 1OGUB 3TN8B 1UNHD 3POMA 1FINB 2CCIB 4OR5B 2C6TB 2I40B 2C4GB 2EUFA 3BLRB 4ZGDB 2PK9B 3MI9B 2QDJA 3QYHB 4YOZA 4F7NB 4F7SB 2W9ZA 2IW8B 2ZZDB 2WIPB 1H1QB 1TD6A 4ZGJB 2V22B 5CYIB 3A8GB 2I53A 4YC3B 1QMZB 2ZPIB 2QGSA 2ZPBB 5DQVA 4F6SB 1O9KB 3EJ1B 5CEIB 3WVDB 4F7JB 1D3UB 1ZP2A 3QZ5B 4BCGB 1G3NC 2WHBB 2ZPFB 4FM4B 2IN3A 3X25B 2ZPEB 4YOSA 3TW7A 4KRDB 1AD6A 4CFMB 4BCKB 3BHVB 2WJ9A 4EOIB 2DMEA 4CRLB 5IDNB 1E9HB 2C5NB 1PKDB 4BCIB 5LMKB 2C5OB 3HB9A 3QHRB 1ENWA 3VYGB 2WMAB 2PK2A 3X28B 3BLHB 4EC9B 2WFYB 4QSHA 5EFQB 3B57A 1QLBA 4ROCA 3X24B 5IDPB 2UZBB 5HBEB 3O0GD 3GTMS 4OGRB 4UN0A 2C5XB 4AKGA 4BCHB 2R7GA 4I3ZB 4BY7X 1V29B 5EJCA 2DXBB 4RODA 2KMGA 4ZGEB 3BLQB 5LQFB 1H25B 5ACBA 2CZ7B 2DPPB 3DDPB 1H1PB 4HNVA 4BCFB 4EORB 1O9KA 3A8OB 4EOJB 4BCND 4CFUD 1BU2A 5IHYA 1UGQB 3DOGB 1W98B 2F2CA 1OL2B 2UZDB 2ZCFB 1FKMA 2WEVB 4EOLB 1AISB 3TNHB 2UUEB 5BNJB 4ROEA 3TNWB 4NSTB 5DQWA 1IREB 4EC8B 1VYWB 3QYGB 1F5QB 3HBLA 4MFDA 2IVXA 4EOMB 1UGRB 2W99A 2CZ1B 3QZ9B 2W96A 2D0QB 4TTHA 1UGSB 4BCMD 4MIMA 1OKWB 3EOCB 5HNBB 1C9BA 4BY1X 4AKHA 2W2HA 3M03A 1GUXB 3MY5B 2QFZA 2C5VB 3PO3S 1N4MA 1H26B 2B9RA 2QQ8A 1AHJB 4F70B 3DDQB 3BG9A 4II5B 1UNGD 4JX4A 4OB3B 2QF7A 4BBRM 4BCJB 1UGPB 2BS2A 4HLQA 5ICPB 2X1NB 4BCPB 2AHJB 2ZPGB 4HNUA 4F6UB 2WXVB 2CCHB 3HO8A 3BHUB 1URCB 1VOLA 1JSUB 2UZEB 5HVYB 4G6LB 1H4LD 4OB0B 2KR6A 5L2WB 2WPAB 4BCNB 4CFUB 5I5ZB 1OKVB 2UZLB 1VINA 1H27B 4M6VA 3DL1A 4EOQB 4EOKB 4CFXB 5FGKB 4YOOA 3A8LB 2CZ0B 4OB1B 3G33B 1UNLD 4JX5A 2BS4A 1JSTB 4F7LB 2WIHB 4OB2B 3X20B 3A8MB 2WMBB 4AI6A 3DTOA 4CFNB 1E7PA 1JOWA 4BCMB 4LOCA 3VKHA 4CXAB
chains in the Genus database with same CATH topology
2IW6B 2W2HA 1XO2A 4ROCA 3M03A 1GUXB 4ELLA 1P5EB 3MY5B 5IDPB 1OGUB 1OL1B 3TN8B 1UNHD 2UZBB 3POMA 1FINB 2C5VB 2CCIB 4OR5B 4BCQB 1N4MA 1H26B 5HBEB 2B9RA 2C6TB 3O0GD 2I40B 1JKWA 3TNIB 4OGRB 2C4GB 1OIUB 5HBHB 1GUXA 4UN0A 2EUFA 4F70B 2C5XB 3DDQB 3BLRB 4CFVB 5HQ0B 3H4CA 4II5B 4BCHB 2R7GA 2G9XB 1UNGD 2PK9B 3MI9B 4I3ZB 2IW9B 2QDJA 4YOZA 2BPMB 4F7NB 2W9FA 2W9ZA 4BCJB 4F7SB 2IW8B 2WIPB 1H1QB 4RODA 4EOOB 1H28B 3BLQB 2V22B 5ICPB 5CYIB 2X1NB 4BCPB 5LQFB 4CFWB 1H25B 5ACBA 5HBJB 4F6UB 3DDPB 2I53A 1H1SB 2WXVB 2CCHB 4BCQD 1H1PB 4YC3B 1QMZB 4F6SB 1H24B 3BHUB 1GH6B 1URCB 1VOLA 1O9KB 1JSUB 2UZEB 3EJ1B 5CEIB 5HVYB 4G6LB 3RGFB 4EONB 1FVVB 4F7JB 1D3UB 4EOSB 1ZP2A 4BCFB 1H4LD 4BCGB 2PHGA 4IMYB 3MY1B 4EORB 1G3NC 2WHBB 5L2WB 1OIYB 1O9KA 1TFBA 2WPAB 4BCNB 4CFUB 3MIAB 5I5ZB 5IF1B 1OKVB 4EOJB 4BCND 2UZLB 4CFUD 4YOSA 4KRCB 1BU2A 4KRDB 1VINA 1H27B 1AD6A 3DOGB 1W98B 4EOKB 4EOQB 2JGZB 4CFMB 4CFXB 4BCKB 2F2CA 1OI9B 1OL2B 3EIDB 2UZDB 1KXUA 4YOOA 3BHTB 5FGKB 2WEVB 4BCOB 4EOLB 3BHVB 1AISB 4EOPB 4F6WB 3G33B 2CJMB 1UNLD 3TNHB 4EOIB 2UUEB 5BNJB 1JSTB 4ROEA 4F7LB 3TNWB 5IDNB 4CRLB 2BKZB 4NSTB 2WIHB 1E9HB 4EC8B 3QHWB 1H1RB 1VYWB 2C5NB 4FX3B 1F5QB 2WMBB 1PKDB 3F5XB 4BCIB 5LMKB 1GY3B 2C5OB 4CFNB 2PMIB 3QHRB 1JOWA 2IVXA 4EOMB 2WMAB 2W99A 2PK2A 2W96A 4BCMB 3BLHB 4EC9B 2WFYB 4TTHA 5EFQB 4BCMD 3K7AM 1OKWB 4ELJA 3EOCB 5HNBB 1C9BA 4Y72B 3LQ5B 4CXAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IW6 B;  2W2H A;  1XO2 A;  4ROC A;  3M03 A;  1GUX B;  4ELL A;  1P5E B;  3MY5 B;  5IDP B;  1OGU B;  1OL1 B;  3TN8 B;  1UNH D;  2UZB B;  3POM A;  1FIN B;  2C5V B;  2CCI B;  4OR5 B;  4BCQ B;  1N4M A;  1H26 B;  5HBE B;  2B9R A;  2C6T B;  3O0G D;  2I40 B;  1JKW A;  3TNI B;  4OGR B;  2C4G B;  1OIU B;  5HBH B;  1GUX A;  4UN0 A;  2EUF A;  4F70 B;  2C5X B;  3DDQ B;  3BLR B;  4CFV B;  5HQ0 B;  3H4C A;  4II5 B;  4BCH B;  2R7G A;  2G9X B;  1UNG D;  2PK9 B;  3MI9 B;  4I3Z B;  2IW9 B;  2QDJ A;  4YOZ A;  2BPM B;  4F7N B;  2W9F A;  2W9Z A;  4BCJ B;  4F7S B;  2IW8 B;  2WIP B;  1H1Q B;  4ROD A;  4EOO B;  1H28 B;  3BLQ B;  2V22 B;  5ICP B;  5CYI B;  2X1N B;  4BCP B;  5LQF B;  4CFW B;  1H25 B;  5ACB A;  5HBJ B;  4F6U B;  3DDP B;  2I53 A;  1H1S B;  2WXV B;  2CCH B;  4BCQ D;  1H1P B;  4YC3 B;  1QMZ B;  4F6S B;  1H24 B;  3BHU B;  1GH6 B;  1URC B;  1VOL A;  1O9K B;  1JSU B;  2UZE B;  3EJ1 B;  5CEI B;  5HVY B;  4G6L B;  3RGF B;  4EON B;  1FVV B;  4F7J B;  1D3U B;  4EOS B;  1ZP2 A;  4BCF B;  1H4L D;  4BCG B;  2PHG A;  4IMY B;  3MY1 B;  4EOR B;  1G3N C;  2WHB B;  5L2W B;  1OIY B;  1O9K A;  1TFB A;  2WPA B;  4BCN B;  4CFU B;  3MIA B;  5I5Z B;  5IF1 B;  1OKV B;  4EOJ B;  4BCN D;  2UZL B;  4CFU D;  4YOS A;  4KRC B;  1BU2 A;  4KRD B;  1VIN A;  1H27 B;  1AD6 A;  3DOG B;  1W98 B;  4EOK B;  4EOQ B;  2JGZ B;  4CFM B;  4CFX B;  4BCK B;  2F2C A;  1OI9 B;  1OL2 B;  3EID B;  2UZD B;  1KXU A;  4YOO A;  3BHT B;  5FGK B;  2WEV B;  4BCO B;  4EOL B;  3BHV B;  1AIS B;  4EOP B;  4F6W B;  3G33 B;  2CJM B;  1UNL D;  3TNH B;  4EOI B;  2UUE B;  5BNJ B;  1JST B;  4ROE A;  4F7L B;  3TNW B;  5IDN B;  4CRL B;  2BKZ B;  4NST B;  2WIH B;  1E9H B;  4EC8 B;  3QHW B;  1H1R B;  1VYW B;  2C5N B;  4FX3 B;  1F5Q B;  2WMB B;  1PKD B;  3F5X B;  4BCI B;  5LMK B;  1GY3 B;  2C5O B;  4CFN B;  2PMI B;  3QHR B;  1JOW A;  2IVX A;  4EOM B;  2WMA B;  2W99 A;  2PK2 A;  2W96 A;  4BCM B;  3BLH B;  4EC9 B;  2WFY B;  4TTH A;  5EFQ B;  4BCM D;  3K7A M;  1OKW B;  4ELJ A;  3EOC B;  5HNB B;  1C9B A;  4Y72 B;  3LQ5 B;  4CXA B; 
#chains in the Genus database with same CATH topology
 2IW6 B;  1XO2 A;  4ELL A;  1P5E B;  4AKI A;  1OL1 B;  2PJQ A;  4BCQ B;  2CYZ B;  1JKW A;  3TNI B;  2LW4 A;  1OIU B;  5HBH B;  1GUX A;  4CFV B;  5HQ0 B;  3H4C A;  4HL4 A;  2G9X B;  4HNT A;  2IW9 B;  2BPM B;  2W9F A;  4EOO B;  1H28 B;  2G77 A;  4CFW B;  3QWL A;  3KHI A;  5HBJ B;  1H1S B;  2CZ6 B;  4BCQ D;  3VYH B;  1H24 B;  3X26 B;  1GH6 B;  4BXX X;  3RGF B;  4EON B;  4Z6Y A;  1FVV B;  3QYB A;  4EOS B;  3HHT B;  2PHG A;  4IMY B;  2DD5 B;  3MY1 B;  1OIY B;  3HZJ A;  1TFB A;  4NC6 A;  3MIA B;  5IF1 B;  4MFE A;  4KRC B;  4JX6 A;  3DJB A;  2JGZ B;  1OI9 B;  3EID B;  1KXU A;  3BHT B;  3WVE B;  4BCO B;  3BG5 A;  4EOP B;  4F6W B;  2CJM B;  2BKZ B;  3QHW B;  1H1R B;  4FX3 B;  3F5X B;  3VKG A;  1GY3 B;  2ZPH B;  2PMI B;  3NDQ A;  3QYE A;  2QDY B;  3A8H B;  3K7A M;  2DD4 B;  4ELJ A;  3TW6 A;  4BBS M;  4Y72 B;  3LQ5 B;  3BG3 A;  3QXE B;  2BS3 A;  2DXC B;  1OGU B;  3TN8 B;  1UNH D;  3POM A;  1FIN B;  2CCI B;  4OR5 B;  2C6T B;  2I40 B;  2C4G B;  2EUF A;  3BLR B;  4ZGD B;  2PK9 B;  3MI9 B;  2QDJ A;  3QYH B;  4YOZ A;  4F7N B;  4F7S B;  2W9Z A;  2IW8 B;  2ZZD B;  2WIP B;  1H1Q B;  1TD6 A;  4ZGJ B;  2V22 B;  5CYI B;  3A8G B;  2I53 A;  4YC3 B;  1QMZ B;  2ZPI B;  2QGS A;  2ZPB B;  5DQV A;  4F6S B;  1O9K B;  3EJ1 B;  5CEI B;  3WVD B;  4F7J B;  1D3U B;  1ZP2 A;  3QZ5 B;  4BCG B;  1G3N C;  2WHB B;  2ZPF B;  4FM4 B;  2IN3 A;  3X25 B;  2ZPE B;  4YOS A;  3TW7 A;  4KRD B;  1AD6 A;  4CFM B;  4BCK B;  3BHV B;  2WJ9 A;  4EOI B;  2DME A;  4CRL B;  5IDN B;  1E9H B;  2C5N B;  1PKD B;  4BCI B;  5LMK B;  2C5O B;  3HB9 A;  3QHR B;  1ENW A;  3VYG B;  2WMA B;  2PK2 A;  3X28 B;  3BLH B;  4EC9 B;  2WFY B;  4QSH A;  5EFQ B;  3B57 A;  1QLB A;  4ROC A;  3X24 B;  5IDP B;  2UZB B;  5HBE B;  3O0G D;  3GTM S;  4OGR B;  4UN0 A;  2C5X B;  4AKG A;  4BCH B;  2R7G A;  4I3Z B;  4BY7 X;  1V29 B;  5EJC A;  2DXB B;  4ROD A;  2KMG A;  4ZGE B;  3BLQ B;  5LQF B;  1H25 B;  5ACB A;  2CZ7 B;  2DPP B;  3DDP B;  1H1P B;  4HNV A;  4BCF B;  4EOR B;  1O9K A;  3A8O B;  4EOJ B;  4BCN D;  4CFU D;  1BU2 A;  5IHY A;  1UGQ B;  3DOG B;  1W98 B;  2F2C A;  1OL2 B;  2UZD B;  2ZCF B;  1FKM A;  2WEV B;  4EOL B;  1AIS B;  3TNH B;  2UUE B;  5BNJ B;  4ROE A;  3TNW B;  4NST B;  5DQW A;  1IRE B;  4EC8 B;  1VYW B;  3QYG B;  1F5Q B;  3HBL A;  4MFD A;  2IVX A;  4EOM B;  1UGR B;  2W99 A;  2CZ1 B;  3QZ9 B;  2W96 A;  2D0Q B;  4TTH A;  1UGS B;  4BCM D;  4MIM A;  1OKW B;  3EOC B;  5HNB B;  1C9B A;  4BY1 X;  4AKH A;  2W2H A;  3M03 A;  1GUX B;  3MY5 B;  2QFZ A;  2C5V B;  3PO3 S;  1N4M A;  1H26 B;  2B9R A;  2QQ8 A;  1AHJ B;  4F70 B;  3DDQ B;  3BG9 A;  4II5 B;  1UNG D;  4JX4 A;  4OB3 B;  2QF7 A;  4BBR M;  4BCJ B;  1UGP B;  2BS2 A;  4HLQ A;  5ICP B;  2X1N B;  4BCP B;  2AHJ B;  2ZPG B;  4HNU A;  4F6U B;  2WXV B;  2CCH B;  3HO8 A;  3BHU B;  1URC B;  1VOL A;  1JSU B;  2UZE B;  5HVY B;  4G6L B;  1H4L D;  4OB0 B;  2KR6 A;  5L2W B;  2WPA B;  4BCN B;  4CFU B;  5I5Z B;  1OKV B;  2UZL B;  1VIN A;  1H27 B;  4M6V A;  3DL1 A;  4EOQ B;  4EOK B;  4CFX B;  5FGK B;  4YOO A;  3A8L B;  2CZ0 B;  4OB1 B;  3G33 B;  1UNL D;  4JX5 A;  2BS4 A;  1JST B;  4F7L B;  2WIH B;  4OB2 B;  3X20 B;  3A8M B;  2WMB B;  4AI6 A;  3DTO A;  4CFN B;  1E7P A;  1JOW A;  4BCM B;  4LOC A;  3VKH A;  4CXA B; 
#chains in the Genus database with same CATH homology
 2IW6 B;  2W2H A;  1XO2 A;  4ROC A;  3M03 A;  1GUX B;  4ELL A;  1P5E B;  3MY5 B;  5IDP B;  1OGU B;  1OL1 B;  3TN8 B;  1UNH D;  2UZB B;  3POM A;  1FIN B;  2C5V B;  2CCI B;  4OR5 B;  4BCQ B;  1N4M A;  1H26 B;  5HBE B;  2B9R A;  2C6T B;  3O0G D;  2I40 B;  1JKW A;  3TNI B;  4OGR B;  2C4G B;  1OIU B;  5HBH B;  1GUX A;  4UN0 A;  2EUF A;  4F70 B;  2C5X B;  3DDQ B;  3BLR B;  4CFV B;  5HQ0 B;  3H4C A;  4II5 B;  4BCH B;  2R7G A;  2G9X B;  1UNG D;  2PK9 B;  3MI9 B;  4I3Z B;  2IW9 B;  2QDJ A;  4YOZ A;  2BPM B;  4F7N B;  2W9F A;  2W9Z A;  4BCJ B;  4F7S B;  2IW8 B;  2WIP B;  1H1Q B;  4ROD A;  4EOO B;  1H28 B;  3BLQ B;  2V22 B;  5ICP B;  5CYI B;  2X1N B;  4BCP B;  5LQF B;  4CFW B;  1H25 B;  5ACB A;  5HBJ B;  4F6U B;  3DDP B;  2I53 A;  1H1S B;  2WXV B;  2CCH B;  4BCQ D;  1H1P B;  4YC3 B;  1QMZ B;  4F6S B;  1H24 B;  3BHU B;  1GH6 B;  1URC B;  1VOL A;  1O9K B;  1JSU B;  2UZE B;  3EJ1 B;  5CEI B;  5HVY B;  4G6L B;  3RGF B;  4EON B;  1FVV B;  4F7J B;  1D3U B;  4EOS B;  1ZP2 A;  4BCF B;  1H4L D;  4BCG B;  2PHG A;  4IMY B;  3MY1 B;  4EOR B;  1G3N C;  2WHB B;  5L2W B;  1OIY B;  1O9K A;  1TFB A;  2WPA B;  4BCN B;  4CFU B;  3MIA B;  5I5Z B;  5IF1 B;  1OKV B;  4EOJ B;  4BCN D;  2UZL B;  4CFU D;  4YOS A;  4KRC B;  1BU2 A;  4KRD B;  1VIN A;  1H27 B;  1AD6 A;  3DOG B;  1W98 B;  4EOK B;  4EOQ B;  2JGZ B;  4CFM B;  4CFX B;  4BCK B;  2F2C A;  1OI9 B;  1OL2 B;  3EID B;  2UZD B;  1KXU A;  4YOO A;  3BHT B;  5FGK B;  2WEV B;  4BCO B;  4EOL B;  3BHV B;  1AIS B;  4EOP B;  4F6W B;  3G33 B;  2CJM B;  1UNL D;  3TNH B;  4EOI B;  2UUE B;  5BNJ B;  1JST B;  4ROE A;  4F7L B;  3TNW B;  5IDN B;  4CRL B;  2BKZ B;  4NST B;  2WIH B;  1E9H B;  4EC8 B;  3QHW B;  1H1R B;  1VYW B;  2C5N B;  4FX3 B;  1F5Q B;  2WMB B;  1PKD B;  3F5X B;  4BCI B;  5LMK B;  1GY3 B;  2C5O B;  4CFN B;  2PMI B;  3QHR B;  1JOW A;  2IVX A;  4EOM B;  2WMA B;  2W99 A;  2PK2 A;  2W96 A;  4BCM B;  3BLH B;  4EC9 B;  2WFY B;  4TTH A;  5EFQ B;  4BCM D;  3K7A M;  1OKW B;  4ELJ A;  3EOC B;  5HNB B;  1C9B A;  4Y72 B;  3LQ5 B;  4CXA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...