5IDQA

Crystal structure of a short-chain dehydrogenase/reductase (sdr)from burkholderia vietnamiensis at 1.55 a resolution
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
226
structure length
218
Chain Sequence
HMKTVLIVGASRGLGREFVRQYRRDGWNVIATARDDASLAALRAAGAHAHALDIAQPEQIAALGWKLDGERLDAAVLVSGVYGPRTEGVETIGNEDFDAVMHTNVRGPMQLLPIVLPLVEDARGVLAVVSSRMGSIADATGTTGWLYRASKAALNDVLRIASLQTRHAACISLHPGWVRAIDPETSVTGMRRVIAEAGADVSRANGRFLQYDGVELSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Short-chain dehydrogenase/reductase (SDR)from Burkholderia vietnamiensis at 1.55 A resolution
rcsb
source organism Burkholderia vietnamiensis (strain g4 / lmg 22486)
molecule tags Oxidoreductase
molecule keywords Short-chain dehydrogenase/reductase SDR
total genus 87
structure length 218
sequence length 226
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5idqA00
1B15A 4DTIA 4PLWA 2D0IA 4A26A 1NFRA 1TEHA 3FNHA 5AQ1A 1PQUA 2ZATA 4ESOA 4CUKA 1N1EA 2EJVA 3KB6A 2OBYA 4D3SA 3AUTA 5BNFA 1KETA 1EK6A 3D3WB 3ZWPA 2QW8A 1U8FO 4LGVA 3TZKA 1FDVA 3JQ6A 2R00C 3PGJA 4BV8A 4LCJA 2O3QA 5CPFA 3NEPX 1U7HA 3A1NA 1F17A 4JN6B 1HZJA 3DBVO 4PZDA 4D41A 2ZK7A 1W6UA 4DIFA 5IXYA 3A9WA 4RDIA 5K6AA 3WS7A 4YT8A 3QHAA 3BMCA 1XYGA 4XR9A 1WVGA 1WZEA 4GX1A 4BHTA 4ZGWA 2ZQYA 5G0VA 1EQ2A 3VH2A 2D2IA 1PL8A 3CE6A 3CH6A 1JDJA 1UDAA 3DOJA 3I6QA 1ZK0A 1PJTA 5KJ1A 4JGBA 1HE3A 3GZNA 4L74A 1BG6A 5TRTA 2PGLA 2ZJ1A 2PKQO 1NP3A 3BMCB 2NVUA 1E7RA 2BELA 2CDCA 3WXBA 2Z95A 1E0DA 3DTTA 3L6EA 4IIUA 3RUFA 3TZHA 2BLLA 4RVGA 3D5QA 1OZAA 4XIJA 4UUMA 3AM5A 3KV3O 1NTOA 3JQBA 4RVDA 4JP2A 2YUTA 1ENOA 1QYVA 3FD8A 1ZSNA 3JQ9A 4CMCA 5A9RA 4QXMA 5HS4A 1I30A 3LT1A 3DHEA 3WGQA 3U5TA 3JQ7B 1PGQA 3R0IA 1E3EA 4Z9XA 4HWKA 3U9LA 4MKZA 1ZJYA 2Y0DA 4XKJA 5HS6A 4N7RA 3C85A 4FW8A 1RM3A 3GQVA 3NT4A 4ZQHA 1ZO8A 2OL4A 2C2YA 4TVBA 1J0XO 1PJ2A 1LSOA 4EI2A 4UEJA 3DZBA 1Z73A 3GRPA 3ZHYA 3O26A 4EEXA 3ETEA 3GEMA 4MP8A 4PLTA 1C0KA 3BTVA 4XQCA 3L6DA 2P5YA 3AFMA 4OIMA 4EUEA 4O1MA 4GGPA 3ZWYA 4EUHA 2DBRA 2VYND 2HQ1A 5CFZA 3U4CA 1U28A 5HRUA 2WM3A 2EW8A 4YJGA 1ZVMA 3X2FA 2FSSA 1LLQA 3HG7A 3ZWAA 4AVYA 1ENYA 4Z0HO 2VOEA 3CPSA 1N7GA 1IZ9A 2WE7A 5T57A 3IAHA 2PWZA 3LT4A 1NM5A 3PJGA 3INGA 3PP8A 1HDXA 3PWZA 3VZPA 1H2BA 1EFLA 4R54A 2BFOA 3KSDO 4JXKA 3I9MA 4JBGA 2VYNA 4I5GA 4BV9A 2Q2VA 5CAEA 3LT0A 4DL9A 4K26A 4KUGA 3HNPA 1ZZEA 2BI7A 1BXGA 2X0IA 4J1TA 3RUHA 4ZVVA 2BH9A 4L76A 3V1TC 2NV6A 4E3ZA 1E5QA 3Q9UA 3WQRA 1BMDA 2ZTMA 4ILKA 4H16A 4NBUA 2Y1DA 3MJSA 2FP4A 1A7AA 4JX8A 5F3RA 3F1KA 1IYZA 1QR6A 5ILGA 5TGDA 3DC2A 2JAHA 1T24A 4W9NC 4DIBA 2C07A 4L75A 4NK4A 2IXAA 3DB2A 3ZV5A 5B12A 1E7WA 4E5MA 4MKXA 1LDEA 4JQCA 3QV1A 1LDNA 5EPOA 5JO9A 1QYCA 4OH1A 5CDSA 1O6ZA 1K2WA 1M6HA 5CDGA 4EJ0A 2VWPA 3OBBA 4BNLA 3HDHA 1PR3A 1KEVA 2E48A 5IN4A 1K89A 1HE4A 2PV7A 9LDTA 3BHIA 4PZCA 4L8VA 3HHPA 4ROSA 2TMGA 4Z6KA 2FPPA 5JCJD 2O50A 4Y9DA 1E1NA 2PD6A 3GZNB 2VWHA 4GVXA 2CZCA 2EIHA 4FGWA 4I8XA 3UUWA 4BNNA 5L9AA 3PQDA 5TX7A 3KLMX 2QX7A 4DYDA 5KJCA 4PLPA 3P19A 4II3A 4L4RA 1LBEA 1AXEA 3O9ZA 2X0JA 4CLOB 1I32A 3DBLA 3JYLA 4RZHA 1P0CA 3FHLA 1VM6A 2X1HA 3BZUA 2B37A 3H5NA 4K6CA 3GY0A 1KEPA 4KMSA 3ZWMA 4TRNA 1Y1PA 1F8GA 3QE3A 1D8AA 4NQZA 1DFHA 3H6KA 1Y8QA 1ZNQO 3UKOA 3PIIA 2FHSA 5F21A 1OC4A 3DAPA 4EUFA 4O63O 1DIRA 1NR7A 2VZ0A 2QRKA 5EMHA 3RCBA 4BO4A 4IY1A 2YZ7A 1EMDA 1XLTA 3GAFA 2PKQP 3LQFA 2VYVD 4W4TA 1JKJA 3JSAA 2YV3A 4CR6A 4BGUA 4AG3A 2X58A 3I6IA 1XA0A 4NMHA 4J4HA 4PG5A 4XD2A 4EJMA 1LU9A 2NSDA 5TJ9A 5K9ZA 1E3SA 1HDGO 1XU7A 3OH8A 2HO5A 2X9VA 5DP2A 1T1RA 3GG9A 1QYWA 2J5KA 3GRKA 1YQGA 2JD0A 4FOOA 3LU1A 1VPDA 4FR5A 4LISA 4P4GA 1V3VA 5L7YA 1CQJA 2HMWA 3PLNA 4O59O 1IL0A 4CL3A 5I9LA 1PR9A 3DFZA 1GPDG 1EBUA 4NFHA 1D3AA 2NNLD 3WGHA 4YAGA 2NVWA 2XF8A 2UDPA 3UN1A 2QQ5A 1TT7A 1C0LA 2FZEA 2LDXA 3IUPA 1R4MA 3ICPA 2OOSA 1R66A 4Y8VA 5COQA 2AE2A 2WYUA 2IDZA 3DZHA 5BSHA 5G4KA 4BNKA 1E6WA 3AOEA 1DLIA 2PH5A 2PK3A 4AJOA 2A35A 2ZB3A 4B4WA 2BKAA 3C8MA 4YEDA 3GR6A 3ZV6A 1UP4A 4GVLA 2I76A 1DIHA 5EQFA 4NFYA 1EDOA 4RPHA 4TWRA 1GYRA 1HEUA 2JCXA 3HB5X 4OSPA 1U4OA 3RJ5A 4GKVA 3GVHA 5JY1A 3ZU2A 4OM8A 3O8QA 4JJGA 1EVIA 5KJFA 4HFRA 3RUIA 3SXPA 3GG2A 2WDZA 3FSRA 1Y9AA 1TB4A 5FI5A 3WR5A 4W9NA 4LCEA 4RVFA 1DXYA 4RPLA 1ZXLA 4YJDA 3S55A 3VPGA 4BNXA 3HDQA 2HMTA 3B20A 1E7MA 3JQAB 1KVRA 4J4BA 4XGKA 4XZ3A 3AU8A 3V1YA 4ALKA 3PHHA 4G2NA 5DCYA 2RHCA 2GZ2A 3ZHZA 1SEPA 5H82A 5ENVA 1VI2A 4HP8A 3HUDA 5JYDA 2VYVA 3HDJA 2IEBA 1ZSYA 4IQ8A 4ALLA 4RLHA 5IDQA 4IJWA 1HDRA 5T67A 2NWQA 3FNEA 2YFQA 1EFKA 3ZWXA 5DF1A 2XXBA 5CEJA 1ZXBA 3AWDA 3F46A 1LJ8A 3MJCA 2PFGA 4ONEA 3KETA 4ZQGA 1YBVA 4GL4A 1A9YA 9LDBA 4J6FA 4YDRA 2YHIB 4OAQA 3AUUA 5CDYA 4W7IA 3TSCA 3A4VA 4RZIA 2GYYA 4G81A 1PS9A 4UUNA 4XGNA 5JAZA 3K9QO 3F6YA 5JPIA 3U4IA 3HN2A 3C3XA 4YQYA 2V6BA 5A9SB 3T4EA 4D42A 3RUEA 1Z7EA 2VUSA 1GR0A 1C1DB 1I3MA 3DEYX 3WNQA 2GCGA 1BRMA 1HDYA 3S2FA 4FSHA 4JLWA 5JYEA 1VL0A 1PSDA 4OXNA 3BMOA 1G0OA 3N7UA 1D1SA 1WWKA 1A71A 4KQXA 1XCBA 2HJRA 3KEOA 4IM7A 1DAPA 3H9JA 1Q7BA 3ENKA 4UREA 2W90A 4U6SA 2CVOA 3BMQA 3C1AA 3KM0A 2Y68A 3F47A 1Q0HA 4FC7A 4QT0A 3NV9A 4BKPA 3HN7A 3F5SA 3ZW8A 1E6UA 4DIOA 4GX0A 2W2KA 5HA5A 3HADA 3PHGA 3LSYA 4OL9A 4XWYA 1RM0A 2VCYA 5KIAA 4YT5A 2ZCUA 5IXSA 5T8KA 4HFJA 1O8CA 2DVMA 3DBHA 4KDFA 2J3JA 1F8FA 2CF5A 4GX2A 1Y8RB 3EZLA 2VNAA 5CPBA 5COBA 1S7CA 1YB4A 2J5QA 5EINA 2EWMA 2Y1OA 2PGDA 3Q11A 5TS3A 1PGPA 1LUAA 5A4DA 5DULA 5DCUA 4GMGA 1FDWA 1Y81A 4XDYA 4MOWA 2LDBA 3WBBA 3OETA 4DRYA 4QFDA 1VSUA 4F6LA 1NPYA 2UV8A 5IZ4A 3IJRA 1DRVA 4NFSA 4RPJA 5TJHA 3WYCA 5JDIA 4IGFA 2WJPA 1BXKA 2HRBA 4PG6A 3ZWBA 5G0UA 2NQTA 4BO5A 3TZCA 3NTRA 2C5AA 3TZQA 2BMAA 5JMPA 1P9LA 3GGGA 4MP3A 3VOSA 3WB9A 3GUCA 5BT9A 1Q2XA 3WGTA 3I9LA 1ONNA 3GVIA 2FZWA 1E1KA 2DQ4A 3DZJA 4M1QA 3DR3A 3AI2A 2JAPA 4RJTA 1IUKA 4YACA 3RFVA 4CODB 1NR1A 4CQMA 4XX0A 4R3NA 1DIAA 3JD2A 5F1KA 2Q45A 1LDBA 5DN9A 4FC6A 3FBGA 1MFZA 4JK3A 2AA3A 4NHEA 4OKNA 1E6EA 5DZSA 4DPMA 4J7CA 4E5PA 4F46A 1PJLA 1M67A 3AY3A 3IJPA 3EDMA 1IULA 1NPTO 1CF2O 1YJQA 1N2SA 5JCJA 3KRTA 3NDJA 1J5PA 3ULKA 1ULSA 4M49A 2JCYA 4CMEA 3ZDFA 1LTHR 2Q2WA 1QV6A 4EGFA 4CM8A 4ITUA 3R3SA 3QSGA 4MVJD 4NJMB 2E49A 5CDTA 3RIHA 2GN9A 2RH4A 1JKIA 3GVPA 3RKRA 2XOXA 4GI2A 3MJVA 4D7AA 2D1YA 3QWAA 4UVDA 4XYEA 2GERA 1ISGA 4BIIA 1CWUA 2CF6A 2GDZA 3FTPA 2PZMA 5TC4A 2DPGA 3M2PA 4R1TA 5THKA 1LDYA 1P1HA 4J2HA 3MEQA 2Q4EA 4BO2A 1QXSA 3GNTA 1VRWA 3LF1A 3KYDA 1HE5A 5T5QA 1M66A 5A3VA 3L4SO 4AJLA 2O48X 5DOVA 5ADHA 2DUWA 1A27A 3AI3A 3K5PA 3PDJA 2IEDA 4E33A 2P2SA 2PY6A 1X1TA 5IJZA 5IN5A 1HXHA 3HFGA 4NK5A 1QORA 1B16A 2X5OA 2YFHA 4BGIA 2DPHA 4CLXA 1W8DA 1WP4A 1XGKA 3BAZA 4CV3A 1MV8A 5C7OO 1YXMA 3SVTA 3PJDA 3G1TA 2ZB4A 1RYEA 3EMKA 8ADHA 3JYNA 1TA4A 5DNAA 1LEHA 1N5DA 4CV0A 1OI7A 2Z5LA 3ETDA 3WLFA 1HZZA 4UVIA 1A4UA 5A03A 1JW9B 1VE9A 4F45A 4R5HA 3BMOB 2C59A 2HRZA 3JQAD 1OC2A 4E32A 3V2GA 1ADBA 5JDCA 2H5LA 1DLJA 3LYLA 3BTUA 1ONOA 4U8GA 1U8XX 5JNLA 2G82A 4R69A 1OAAA 4PRLA 3I23A 1O89A 2IYOA 1DFIA 2IZ0A 2Q1TA 1CRWG 1ORRA 5C3MA 3WJ7A 4BL5A 3QA9A 4LW8A 3D4PA 1V35A 4R3WA 3OA2A 2B69A 1DRUA 3WIEA 4DLLA 1YB5A 3DZKA 1EDZA 4BNTA 4YAIA 3SC4A 1WMBA 3ASVA 3FPCA 3Q9NA 4MVJA 1MC4A 3GDOA 3GHHA 1BW9B 1UZMA 2NU8A 3RU7A 1XSEA 4BMSA 2AW5A 4ZRMA 5COAA 1XWFA 1YO6A 1Z7BA 2DC1A 1YGYA 5F1PA 3D64A 3E03A 4GSKA 4J7UA 3DTYA 3L4BC 4BB6A 3PGXA 3G49A 3IQDB 3NRCA 1U5CA 1W4ZA 1DOHA 2ZTLA 4IDFA 4WKGA 5JXWA 4KZPA 4J0EA 1EK5A 4NH4A 4E4YA 3ZHXA 4YRAA 2HJSA 4RL6A 3ETGA 2NU9A 2JJYA 3ZNOA 4CM4B 1F12A 1V6AA 4LK3A 1U1IA 2EP5A 1H6AA 4Q3NA 5JSFA 1PL7A 2FWMX 3OJ0A 4J90A 4ZRNA 5TT1A 2Q1WA 2UAGA 4BOYA 5BQFA 1EEHA 1T4BA 4TRRA 5JFOA 3EAGA 4E0BA 4Y6PA 3OJEA 1I3LA 3GPIA 3WTBA 4YB8A 3S8MA 5TSDA 1AHIA 1H6CA 2PZKA 4AJPA 4WGGA 3F3SA 5JC8A 3RD5A 1VSVA 3GHYA 3MOGA 1I33A 4NBVA 1EUZA 4CLEA 4B8WA 1I5RA 3DOCA 2H63A 2GPTA 2Y66A 3PHLA 4CL8A 3RWBA 2DT5A 1CYDA 4OO3A 3NTOA 4WLEA 4YAEA 1XQ6A 2FPGA 3D4NA 4MVJF 1JAXA 3U49A 4LN1A 2GF2A 4XYGA 2Z1MA 4DYVA 3GPDG 4WOJA 3DZFA 1Z75A 3H9UA 4XR4A 1HSZA 2P4HX 4JBHA 4WEQA 5G0SA 1XELA 5LDGA 1LLCA 4G65A 1NWCA 1RJWA 1E3LA 2E37A 3AM4A 3BHMA 4TKLA 4BNMA 4BUCA 4BKQA 3ITKA 4FJ1A 3TOXA 1C1XB 1FJHA 4WUVA 1U3TA 2ZB7A 2D4AA 3FI9A 1PEDA 3RBZA 4HXYA 1ZK4A 5TIIA 1QYXA 2EGHA 2CDBA 3OEWA 2C82A 2AQKA 2O3UA 3G3EA 3PRJA 4PLYA 4GLLA 1YWGO 3BYZA 3GGOA 3PFFA 5KNLA 3PWSA 3A28A 4IDEA 4NR0A 4IGEA 1DEHA 3WFJA 2CFCA 3LK7A 4CMIA 2VHVA 1GUFA 1RWBA 1B0AA 3FR8A 1SPXA 3E18A 3HFSA 2PD4A 1QG6A 3OIFA 2DTEA 1DC4A 4PCVA 1GFSA 4HUJA 4BQRA 3MJEA 1R6DA 3N58A 1GADO 4QTZA 4D0SA 1LRKA 1ISHA 1SO8A 2AE1A 5F5NA 4CUJA 1R0SA 3AU9A 1K5HA 4R1NA 1HTBA 1NQ5A 1R4NA 3OIDA 2B4TO 3H9EO 1BWSA 1T26A 1R15A 1PZFA 2FSVA 4MKRA 4BMNA 4YT4A 4FFRA 5HTOA 1PJ3A 3ROMA 1O9BA 3O4RA 4KOAA 4MVJH 1DC3A 3JQ8B 2JCVA 2FR8A 4CQLA 3GMSA 4QEDA 1T25A 3QWFA 3D4OA 3I9NA 4RORA 3RI3A 1GV1A 3DONA 1LRJA 2VOJA 3WMXA 3VC7A 1ADGA 3GFBA 4PVCA 3STHA 4HY3A 5KCZA 3WQSB 1HF3A 3OJOA 1HYEA 5G0WA 5A1TA 1NVTA 3IC5A 1IHYA 4E31A 4RDHA 1SNYA 2P9GA 1I2BA 3WNVA 3HJAA 5A04A 1KYQA 2RCYA 2GNAA 2V65A 3OHSX 4DVJA 4RPKA 3Q3CA 4PLGA 1MG5A 2FPIA 4L0QA 1ISIA 1FDUA 4NPCA 1G6KA 4IMRA 4ZD6A 1CEQA 2X9GA 3JQGB 1AN9A 1UZLA 3C1TA 4GX5A 4JNKA 4QFCA 2O3JA 3ZU4A 3WYBA 4ALNA 4D0RA 1GQYA 4CLRB 3ZU5A 2PLAA 4XGIA 1DC6A 1HDCA 4Z9YA 2Q99A 4HADA 1P1IA 1RM5A 3PXXA 3LC7O 4II2A 4K28A 3RQSA 4Q3AA 1P31A 1PJQA 4JROA 3WGYA 2YHUA 3RBXA 2QYSA 3L0DA 4XJSA 4DQXA 1KOLA 3AY6A 4BNYA 2J3IA 3S2EA 2I9PA 1XIVA 3PQFA 1ZIDA 3KYBA 1SZJG 2E6UX 3NYWA 3NGXA 4P8RA 3W6ZA 1N9GB 4QSMA 3ZU3A 3ZW9A 2X5KO 1QLJA 2ZYGA 1M76A 3TWOA 1I01A 3NGLA 2WWRA 1PL6A 3CEAA 3ZV4A 2BFPA 4CR8A 4FFLA 1DIBA 4A0SA 2A9FA 4ZN6A 3KTDA 2EW2A 2X8LA 2R6JA 3CKYA 1YQXA 1SEVA 2B5VA 5GZ6A 4J4TA 4D79A 2B4QA 1GEGA 1U5AA 5BSFA 1MGOA 4OXKA 4FFOA 5DP1A 3UOGA 1EE2A 4NNJA 4KDEA 4XQEA 1AE1A 4FDAA 1SB8A 5T8KC 2C54A 2FRDA 4CV2A 1T2EA 3INRA 2PZJA 5A5EA 1JWAB 3UW3A 5B4TA 5KJ6A 3PQEA 2O4CA 4L4XA 3OP4A 4YXFA 3HB4X 2QIOA 1V3TA 1LDMA 3EC7A 2IZ1A 1GCOA 3BTSA 3ZWOA 3SJ7A 3UXYA 5BSEA 4FPXA 2OBNA 2YDYA 4FJ2A 1XR3A 3K73O 5T64A 4AJ1A 3NJ8A 4IXWA 2FR0A 1Z82A 4AJ2A 1NFQA 5AXAA 3U62A 3A14A 3RC9A 2X23A 4CMJA 1NXQA 3RAJA 1VLLA 3SLGA 4GSLA 4C4OA 2EKQA 1G1AA 2GGSA 4DQUA 3M1AA 3PFWO 2OORA 3AW9A 1VL6A 5DBFA 1PJBA 4URFA 4YQZA 3H65A 5I8WA 5IDYA 4PLHA 4JJFA 4OOFA 4DBVO 2V7PA 3E5MA 4YBZA 4PLCA 1JVSA 2WTBA 4MP6A 1T4DA 1B8PA 3B70A 1LC3A 3MCVA 4ND4A 3ZWNA 4NJMA 2F00A 4YJGB 3R3JA 3M1LA 3OFSA 3OJFA 4O5OA 1P77A 4PN3A 1KEWA 3WG9A 4J9UE 1HLPA 7ADHA 1H0KA 4Q39A 2NTVA 5A02A 1WDLA 3RUDA 1LC0A 1NYTA 3TDKA 1ENPA 3AFNA 1DJQA 4H7PA 4Y6SA 3RVDA 1AGNA 3PPIA 3EW7A 4CLDA 2Y67A 1DHRA 1AUPA 1EUCA 1ONPA 3JCZA 3PDUA 1YL7A 3ZNQA 1LQTA 1R37A 4JJIA 1HRDA 3R1IA 4E5KA 2DAPA 2I3AA 2O3SA 5KJEA 4J1SA 2VHZA 2WE8A 4CQMD 1G0NA 4OHUA 3SEFA 1J6UA 1BW9A 1NAIA 4CV1A 5L7TA 4I1IA 5G2OA 1DSSG 1ZMOA 1LLDA 2ZTUA 2B35A 1GYQA 1N92A 4IPTA 2X86A 3G17A 3H7AA 3WWYA 5EQDA 3T7EA 3OSUA 4BO9A 1R12A 4BB5A 4B3HA 1MLDA 4R4JA 1GCUA 1J4AA 2H1SA 3QVSA 4DXHA 2XPCA 4JCOA 4N5NA 4BNHA 4CM4A 4HKTA 4MIOA 4D44A 3I1JA 1UDBA 4RF2A 1E77A 2QRLA 1UZNA 4D3FA 1WZIA 3VPSA 2C2XA 3VPXA 1MXFA 3LC2O 1Y5RA 1LA2A 1O95A 4JP3A 4IUYA 1JTVA 1MUUA 1B26A 3Q2IA 1A5ZA 3WX0A 4YAKA 3Q2KA 4PVDA 3IP1A 4Q3CA 1SOWA 3JV7A 2OZPA 2ZJ0A 2AEFA 1QV7A 3LVFO 2VUTA 2GASA 1KBZA 1T1SA 1NNUA 1VKNA 4QUKA 3O38A 1NFFA 2EJWA 1GL3A 3EY4A 4CMKA 1GZ3A 3ON5A 3JYPA 1UJMA 4YJFB 2QZ9A 2IZZA 2RIRA 3JQ7A 4E5YA 1HDZA 1JVBA 3EZYA 4INAA 4RVSA 2SCUA 4HNGA 4KP7A 3L07A 2A94A 2JHFA 4DC1A 3DBHB 4PLFA 1VJTA 1CJCA 4Z3KA 1Y8RA 1NQTA 1X14A 5AVOA 3VZSA 3U3XA 2BGMA 3OJLA 3TL2A 2ZQZA 6ADHA 1KERA 2OHXA 3UHAA 1YVEI 5BR7A 4CQMB 1E1LA 3V5NA 4I08A 3RKUA 4BGVA 4L4SA 4MVJI 3EGOA 4ZJUA 1X1EA 1KIFA 1TT5A 2Q46A 2NU6A 3QWBA 4R01A 1SAYA 4DBZA 3JYOA 3E6AA 3E9QA 4N54A 4DQVA 1QMGA 4R41A 3O03A 2OUIA 3OECA 4RF3A 4E2WA 5BNTA 3VKUA 1B2LA 1X15A 3RUAA 3OMLA 4B4VA 3UCFA 1OMOA 1U2DA 2OP0A 3CTMA 1UXIA 1UP6A 1H9BA 4E13A 1UXHA 4XRRA 1TI7A 3DDNA 5KKAA 1X7DA 1NPDA 2OFPA 4IBOA 4DPKA 3ADPA 2DLDA 2QHXA 3SC6A 1ARZA 1P0FA 2EG9A 2JKVA 4AL4A 4EEZA 3F5QA 3HZZA 5C37A 4I9NA 1MA0A 1XKQA 1IHXA 1QSGA 1X0VA 3E8XA 1LQUA 1X0XA 3H8VA 3ONEA 4LRTB 3EVNA 5TQVA 5MDHA 4EJ6A 4KTTE 5G4KB 1IB6A 4YWJA 5THQA 4YT2A 1OBFO 4M8SA 4E21A 1KY5A 1ADFA 1IOLA 2EERA 3F4LA 4MJLA 4QO8A 3RC2A 1EUDA 4P4NA 1T2DA 4H3VA 2NVUB 3WSWA 4TZTA 5A06A 4J16A 2X0RA 3RUCA 4ZA2A 3WWZA 4E30A 4AJIA 4GKBA 2Z1NA 2NQ8A 2YDXA 3D3EA 4CMIB 1ZFNA 4UVEA 2RBEA 2Q2QA 3X2EA 1KVUA 1C0IA 3OA0A 1ZUD1 4HNHA 5HM8A 3AOEC 5ITVA 5ENDA 2PGJA 1QYDA 3DXFA 3KHUA 1XQ1A 4ZQFA 4PLVA 5JAIA 5GY7A 2YQ4A 5B4UA 1M6WA 1NHWA 1UAYA 2I5PO 5L4LA 2VZ8A 1I3KA 4JIGA 4BVAA 3V2HA 1KVQA 4GPD1 3WSVA 4LMPA 5ES3A 4DPLA 4MDHA 4J3FA 2I6TA 2W8ZA 3DZIA 3JQCA 4G5HA 1L7EA 1R4NB 1ID1A 5IG2A 3I4FA 5JAMA 3M2TA 4ND3A 3PWKA 4WJZA 2GSDA 2EV9A 4K6FA 4M54A 8LDHA 4LVUA 4TROA 4E2ZA 5IDXA 2HKIA 3MOIA 2G76A 4BNZA 3NDRA 1P74A 1HYGA 4P22A 1EE9A 1NHGA 2WD7B 3S1LA 3ADOA 1JWBB 1DB3A 4NU5A 4AJKA 1Y6JA 4AFNA 3ZH2A 3WDSA 2HSDA 4FN4A 3KVOA 5JDIC 1BHSA 3WGZA 2ZIZA 2BGLA 2Y99A 4WCFB 1EZ4A 4YYZA 6LDHA 4YA6A 4UULA 4AJJA 2TMDA 3VAZA 3KZVA 3JQ8A 4IINA 4CQLB 4HBGA 5DBIA 4BO6A 4RF5A 5AXBA 4E12A 4R51A 3FCOA 3UICA 2UUPA 4MVJP 4XB2A 3JD1A 1DO8A 3WGGA 2EXXA 3NAQA 3P2OA 4RO0A 3WOHA 3W4KA 3AI1A 3QVTA 3IIEA 2V6MA 3GLQA 3RASA 4BO1A 3FN4A 1M2WA 2C0CA 1SMKA 1WMAA 5AXCA 1JU9A 4NG5A 4UEKA 1K6IA 2CD9A 4R5MA 1VKOA 4NZ9A 2ZYAA 4XRGA 3HQ4O 3BHJA 3W8DA 4WLNA 4I5DA 3WBFA 2VRBA 1TT5B 2ET6A 3P2YA 1YL5A 2NTJA 2PH3A 5HBRA 3JQ9C 1PGOA 2HLPA 1OOEA 3K31A 1UDCA 3PYLA 4LRSB 2BF7A 2P5UA 5JBIA 4WOKA 2IYPA 2O3RA 1P1JA 4IDAA 2WYVA 4LSMA 1ZBQA 3Q6IA 1YB1A 2Q1UA 3ONFA 4E6PA 1LX6A 4S3MA 5IF3A 1D1TA 2V6FA 3CINA 2EKPA 4WE3A 1A7KA 3C7DB 4ND2A 4KQWA 3VPFA 1FK8A 2J3HA 5B37A 1ZK3A 5CG1A 2J5RA 3ZNPA 3GAZA 1HKUA 2O3TA 4WLOA 4BGEA 2DTXA 1E7SA 2JHGA 4GQAA 4E5NA 4ALJA 1KC1A 4FOSA 3F4BA 1Y5MA 2Q49A 3JTMA 4B3IA 1V8BA 3ZWWA 4DA9A 1YOVA 1T2CA 1YJ8A 2GN6A 4GH5A 4YRBA 1RPNA 5CP8A 5K6AC 3K30A 4BNVA 3SX2A 4YTEA 1J49A 1E5LA 3DHNA 1PZGA 3H4VA 4WASA 2V6GA 1I24A 3E82A 2P9EA 1A4IA 1LSSA 3VH3A 3IDSA 1KC3A 3ZGYA 1PS8A 4HFMA 1WW8A 3L77A 2DBQA 3ASUA 4CM5A 3I3OA 2UYYA 1O94A 4BO3A 3KEQA 1YOVB 3MZ0A 1K6JA 3GGPA 2Y1GA 3AK4A 3SLKA 4CM8B 3D0OA 2BI8A 4UEOA 2POQX 4M86A 4WLVA 2HCTA 2DM6A 1DFGA 3FWZA 5I7FA 4OKIA 5GZ1A 3ROQA 4TZKA 2Q3EA 3VDQA 3OIGA 2ZB8A 1C1XA 2WMDA 1R0KA 1WLYA 1YDWA 2P68A 4GLOA 3D7LA 3PVZA 2C7VA 1N9GA 2D5AA 4PG8A 3OICA 3ZCXA 2YYYA 2EP7A 3M6IA 4TVOA 5LDHA 1PZEA 3KYDB 5IZCC 4O0LA 5I7SA 2GRAA 3V2UA 4XYBA 3WGOA 4IIVA 2HAEA 3C7CB 4EBFA 3BMNB 2C7GA 1ZW1A 4RCVA 3QW2A 1PJSA 1YE3A 3KO8A 4B3JA 3UGKA 2NTNA 2VUUA 3W6UA 3C7AA 2O7SA 4UAGA 1A9ZA 2CDAA 3PJEA 3TF5A 3D1LA 3A06A 3QWHA 3RC1A 4BNIA 3DWFA 1MB4A 4WCDA 2AG8A 3OQ6A 3ZZNA 4YCAA 2YW9A 5EESA 3LC1O 2DFDA 3KLPX 2H9IA 4UVHA 1A72A 3VH1A 5ER6A 5DDIP 1ISMA 2QYTA 4IQGA 2X5JO 4NBRA 3GEDA 1H5QA 1ZJZA 2X6TA 1QRRA 3UF0A 5CG2A 5ICMA 2UVDA 2FMUA 1IPFA 4XA8A 1N7HA 3BTOA 4PFJA 2A92A 4BNFA 2DUUA 2GR9A 2VHYA 2VWGA 1VL8A 2AQHA 2D3TA 3W4IA 3N74A 1XDWA 1PJCA 3I9JA 1EVJA 1I3NA 4CMHA 4Y67A 1ZSVA 3WQQA 1JQBA 4PRKA 1H2HA 4IS2A 4IZHA 1ZH8A 1NBOA 3PYMA 5CHEA 2OO5A 1I2CA 3IS3A 4BO8A 4OSOA 3S2IA 3D5TA 2GD1O 1T2FA 4MVJE 4QX6A 3TRIA 2VRCD 1F14A 3GC6A 1GEEA 4F3YA 2HMUA 1JN0A 3CZMA 1XEAA 1S6YA 1YQDA 5U9CA 3JQGA 3RJ9A 2JD1A 4A7PA 1IZ0A 1EVYA 1LRLA 1MC5A 1N8KA 1SB9A 1D7OA 4GMFA 4IDBA 3OM9A 4BKUA 5JY6A 2OGUA 4L73A 3C24A 4IMPA 4FS3A 2VHXA 2D8AA 5F5LA 4B79A 4U5QA 1WAMA 5H81A 1HWYA 4CM9D 3L4BA 3VTFA 3NKLA 1I10A 3FF4A 4MO2A 2W2KB 3PTZA 3QJ5A 4ID9A 1SC6A 3ROPA 4XYLA 2EHDA 3F9IA 3GVXA 3WMWA 1U2GA 4W6ZA 1K0UA 3UH1A 5CEFA 4IDGA 2NLOA 3PHIA 4P38A 2GN4A 1BVUA 3SBOA 4I9HA 1E3WA 4WPGA 1E3JA 1LLUA 3GA0A 4ND1A 3PIDA 1HYHA 1EQUA 1DRWA 1E1MA 1Y8QB 2Q4BA 3PZBA 4RQTA 3AJRA 4DUPA 1H6DA 4I9UA 2VNSA 2CNBA 2O7QA 2WSBA 3TFOA 1X13A 5FWNA 3KOUA 1E3IA 3AUAA 5A5FA 4TRMA 4XQGA 4YAJA 4DWVA 4N5LA 1I36A 3GN1A 3MJTA 3DBRA 3E1KA 1KVTA 3E9NA 1FDSA 3GEGA 3GT0A 4CLOA 1TVEA 2PKRA 4KWIA 4XQ9A 1W0CA 2OP1A 2X22A 5JDCC 2W4QA 3V1UA 4DMMA 2I99A 4BQPA 2Q1SA 2J3KA 3TPCA 3VZQA 4EITA 1VJ1A 5H83A 1DDOA 2RAFA 1Q1NA 4ZICA 1U9JA 3GFGA 2RH8A 2P4QA 4Q3DA 1YL6A 1NASA 4ZU3A 4DMLA 4FGSA 3LZ6A 1MXHA 2R2GA 3H3FA 2JL1A 3DAGA 4UUPA 3B1FA 3WJAA 2JFFA 2HK8A 1DJNA 3IL2A 3E5RA 1LXCA 3H2ZA 2VWQA 3P7MA 3PK0A 4Y98A 4C7JA 3ZI0A 1X7GA 2G0TA 1D4FA 5AOVA 3GVCA 4X54A 2OXIA 4BKRA 1U7TA 5KTKA 3LT2A 1MFPA 3AOGA 5KOIA 3QY9A 2E4AA 4PLZA 7MDHA 1JLLA 1U4SA 2OMEA 4WLFA 4WECA 3VDRA 4XCVA 4CJXA 3VTZA 2BFAA 4B4UA 2BRUA 3OF2A 1PTJA 4GBJA 4Q3EA 1WXDA 2X0NA 1H94A 4J0FA 5L4NA 2PD3A 4MINA 4FFNA 5L40A 1Q0QA 3GUYA 1GUYA 3G0OA 5B4VA 1SBYA 5IAAA 2ZYDA 3DL2A 3ROKA 1ZMTA 1V0JA 4U0JA 3K2EA 5HWSA 1NVGA 4PZEA 3RROA 3H3JA 3Q0EA 4O6VA 3ZWVA 3L9XA 3WIDA 3WTCA 1K6XA 3L9WA 3NX4A 5I9MA 3RC7A 2G17A 2EEZA 3I5MA 4AJNA 4Q3BA 2AG5A 1V3UA 4J91A 5EN4A 1TXGA 2BGKA 1MP0A 2GLXA 1H6BA 4MVJG 3TOZA 4FFMA 4XYMA 4IQ0A 2NADA 3EVTA 1BGVA 2W98A 3B1JA 3GDFA 5CDUA 1H9AA 4TKMA 4MPDA 3EK2A 3DFUA 4W7HA 4PGFA 5GMOA 2O2SA 5TLSA 4U7WA 2RHRA 4R68A 4S1VA 1HE2A 3I52A 4B7UA 2NM0A 4BNUA 2HK9A 4TSKA 2EF1A 3CUKA 1R16A 4NBWA 3ITDA 3FPLA 3MWEB 4DGSA 2X9NA 1MG0A 3PYXA 3H2SA 4HV4A 4XJTA 3GDGA 4WCFC 5ER9A 2ZKLA 3JD3A 1YBAA 3I9OA 2XXJA 3JQAA 4CMGA 1DIGA 4WCFA 4BS9A 1I8TA 2IE0A 4H15A 5G4LA 3ANMA 1PIWA 3QRWA 1PWXA 4TMFA 3DMTC 1PWZA 5KWEA 1JA9A 5CEEA 1B14A 5DBGA 2UUOA 4WLUA 1SCUA 5DCWA 5A9SA 5L3ZA 1PGJA 2J8ZA 3D3WA 5JLAA 4IDDA 1BDBA 3IKVA 4UVGA 3GNQA 4J43A 4EYEA 3PEFA 2YHIA 4YRDA 4RLSA 1BVRA 4R9SA 3GH3A 5EJ2A 2NVBA 2R00A 4RVUA 3I9KA 4J1NA 3DQPA 1P1FA 1NQOA 3OQBA 4U0KA 3U09A 5KVSA 2QRJA 4OXYA 3ORFA 3TFQA 3H9GA 3NUGA 3TL3A 1JKFA 1GQ2A 4CR7A 1B8UA 2Y1CA 4D3DA 1BXGB 5AXDA 5C7IO 1DC5A 4I5EA 1BXZA 1E7QA 4C7KA 1FDTA 5TT0A 1DBVO 3B1KA 4I5FA 1PU2A 2B36A 1EVZA 5DOZA 5JC1A 5ILOA 1PX0A 3K92A 2AEJA 3QIVA 4WNIA 3DZGA 3ONDA 4A5OA 3ABIA 1P33A 4EW6A 2IXBA 4EZBA 4CM1A 1BTOA 3BXXA 3VHRA 3VVBA 2BD0A 3FNFA 2FOIA 3AM3A 1GQQA 1UXGA 3COSA 1GZ6A 4OOEA 5GZ3A 1PQWA 2Y0EA 2ZCVA 5JE8A 4MVJM 2PNFA 3ZNNA 3U4HA 2D5CA 3LLSA 1GTMA 1GY8A 3ZN2A 1KS9A 4TQGA 1YS4A 1Q0LA 1CDOA 1FMCA 2HMSA 1DPGA 1YH3A 1GDHA 2VZ9A 4FFPA 1QLHA 3JQFC 4ZQEA 3K96A 3L6OO 3DO5A 2O23A 3VH4A 4HFNA 1HETA 3CSDA 3KXDA 1ZEMA 4LMRA 1P3DA 4PG7A 4XB1A 4DLBA 1E92A 4FQ8A 1IPEA 3ST7A 3BMNA 4YR9A 2AQ8A 1E7YA 5LC1A 2VT3A 2X4GA 3GZ4A 4J49A 2P9CA 1YONA 1KY4A 1U3VA 2GUGA 3T7CA 3HWRA 3ANNA 1ZK1A 2JFGA 3MTGA 1T2AA 4FBGA 2EKLA 1MX3A 3PLRA 3VVCA 5A05A 3JD0A 5U1PA 3RFTA 1ML3A 5A9TA 5IDWA 4DLAA 1PGNA 5ICSA 2AXQA 5J23A 4J9VA 1GAEO 1P1KA 2Y93A 1VJ0A 3W4JA 2O4UX 4NI5A 2CMDA 3CXRA 5JW6A 4CMAA 4GGOA 3FNGA 1UXJA 4PG4A 1YDEA 2QG4A 1Y9EA 4NBTA 4A2CA 5L95A 3AUSA 4CMEC 4Z0TA 4B4OA 4LVCA 3QVOA 4P4LA 4NIMA 4HX5A 1LDGA 2CY0A 3EUWA 3MJ4A 4KUHA 2DBZA 4D46A 3TN7A 5KKCA 1GD1O 4BNJA 1NQAO 5FFFA 1ZKMA 1DAOA 3FRJA 4XDZA 3I4CA 4AJEA 1RM4A 5TNXA 3AY7A 4A03A 3MTJA 4IZIA 4OQYA 5BNIA 1HT0A 3G79A 2NACA 4CLRA 2BFMA 1YKFA 4CM3A 5ITWA 4J2OA 1GPJA 5IFLA 1HL3A 3NJ4A 2HMVA 4OQZA 1PQPA 4OMUA 3OQ1A 3F1LA 1HDOA 3CIFA 5C5IA 5JO0A 1KEUA 1V9LA 4L9RA 1CERA 3JQDA 3JD4A 3CZRA 5KVQA 2I66A 1B3RA 1PZHA 2DFVA 2IODA 4Z9FA 2AQIA 2GZ3A 2PR2A 3MWDB 4YJHA 1K3TA 4OGWA 2GO1A 1P45A 4XIYA 2B5WA 4DC0A 3W8EA 2G1UA 2GZ1A 4N5MA 3P5SA 3NTQA 2I67A 2W2LA 2PTGA 2YV2A 1KVSA 2ZTVA 3K8ZA 2X7HA 4CUZA 3QVWA 4OJNA 4AJ4A 4GWKA 2G5CA 4YJHB 4KTVE 3V8BA 1GYPA 1W73A 2QZZA 1UH5A 1BDMA 2CVZA 3DHYA 4RV9A 3I83A 3H5AA 1LSJA 3T4XA 2PZLA 5A3JA 4E2YA 1Q7CA 3ENNA 3VKVA 3JQFA 4FJ0A 2HUNA 5JAQA 2IRWA 2CUKA 3KBOA 5K0ZA 2VHWA 1Z74A 4CMBA 3S2GA 2BHLA 4IS3A 4N18A 4IJVA 3NT2A 4Q9NA 4PIVA 4E2XA 5G0TA 3UAGA 1LNQA 1UR5A 4IXTA 5C7LO 3IMFA 2JFHA 5IZCA 3DMYA 3TZ6A 4D43A 1IE3A 4B8ZA 4YVFA 1P1RA 2J6IA 1RKXA 4J7XA 4FCCA 3QVXA 3RSHA 1I0ZA 2XAAA 3FBTA 5L4SA 4R1SA 3IOYA 1WDKA 4IJUA 1GUZA 4LSWA 1WPQA 2DBVO 3ICCA 4FIZA 2VTEA 2HK7A 2CVQA 4OYRA 3PJFA 4KWHA 5B1YA 3GMDA 1CETA 3VPHA 2CSUA 4QO7A 5EERA 4GWGA 2C20A 3KSZO 4IDCA 5JCXA 2DKNA 3DBLB 3SJUA 5L53A 4RF4A 1E3WB 3DOOA 4W99A 2C29D 4FB5A 3QP9A 3WFIA 1Z45A 5AYVA 2YY7A 2P91A 2VRCA 4Y6RA 4B7XA 4TRJA 1LI4A 1WNTA 1HSOA 2GN8A 3IUSA 3ZV3A 2H6EA 1PS0A 1M75A 3KSUA 3K6JA 1BSVA 1B8VA 1C1DA 1XG5A 2F1KA 4M89A 5FEUA 1UAGA 3W8FA 2Y1FA 1EBFA 2E82A 1QKIA 1UUFA 1XU9A 1U3WA 4M55A 5FYDA 1I2ZA 5I7VA 4NDNE 3H9QA 3KUXA 2Y05A 4FD3A 5DT9A 2AMFA 4RVHA 1Q7GA 3UFXA 3UVEA 3KYCA 3QWIA 1DHTA 1GU7A 4AICA 1ISFA 2B0JA 1B3BA 4NU6A 1VC2A 5L45A 3LLVA 5U4QA 2HDHA 3HSKA 1NVMB 3C1OA 1F0YA 2NU7A 2AHRA 3TNLA 3DMTA 2WD8A 3DAFA 3HE3A 4BNGA 4QQRA 4A27A 4U6QA 1ADCA 3UCEA 3O8QB 1O0SA 3PZRA 4EDFA 5KVCA 4R16A 4B7CA 1U3UA 1UP7A 2VN8A 3KYCB 1UXKA 2Q50A 3EYWA 4JBIA 4WNCA 4D45A 1YBMA 3DBRB 3GF4A 4CM7A 2WYWA 2YJZA 3LDHA 3JYQA 1AXGA 2VQ3A 3CMMA 4MIEA 1ULUA 1X7HA 4CM9A 3ZHBA 1XHLA 5MGBA 2C5EA 4AJHA 1CQIA 4W82A 2DU8A 2YV1A 1F06A 3LF2A 3FR7A 3TQHA 3EHEA 1HLDA 2FY8A 3IP3A 5EIOA 4WK6A 3U0BA 1ZK2A 4A10A 1R4MB 3GNSA 4Z3DA 3VZRA 3WYEA 4CLHA 3PHJA 2NUAA 5L7WA 2ILTA 2AEMA 3OEYA 2VT2A 1QP8A 4KUEA 1L1FA 1TLTA 3E9MA 3GN2A 3QLJA 2WD7A 4Z0PA 4WEOA 1NX6A 1ZCJA 2EGGA 5I7EA 1H93A 1OFGA 2Y0CA 2Y1EA 3HDYA 1R0LA 4RQUA 3IKTA 3TJRA 3JQBC 4CM6A 2HU2A 3PI7A 5EL0A 3R6DA 1GZ4A 3Q1LA 2B83A 3GOHA 5T6BA 5I9NA 1WDMA 3FWNA 4M87A 2PA3A 1O5IA 5JS6A 4BNWA 5KVVA 1CIVA 1AHHA 2B4RO 1LSUA 4ND5A 4UUOA 4ALIA 4YJFA 1YRLA 4GAEA 4BMVA 4RPGA 2JD2A 4XEHA 1GV0A 2FN7A 5JMWA 1N1GA 2I3GA 2I65A 1C0PA 1SOVA 1NWHA 3E48A 1RYDA 5FI3A 1PJ4A 3RU9A 3GK3A 2DTDA 4R1UA 3QQPA 2VTDA 3NDIA 4YPOA 3W1VA 1C14A 1L7DA 1Z6ZA 3RBVA 3BA1A 4RGBA 4K1LA 1P44A 5TF4A 2FR1A 4R9RA 1FF9A 3ZWCA 5F1OA 4ZHSA 4A73A 3U4DA 1Y7TA 2D59A 3B6ZA 4IJKA 5I8ZA 3RFXA 3WLEA 2WEKA 4BKOA 1FXSA 4ZQBA 3NT5A 3FTNA 3H5RA 4DREA 4BO0A 2W2LD 4MIYA 3WICA 4K9DA 3ANLA 1ZEJA 3BMQB 3UCXA 2YQ5A 1JAYA 1ENZA 5BSGA 1ISJA 3BIOA 2A4KA 4J1QA 2O2YA 3CMCO 3INTA 5LCXA 4QECA 5FF9A 4CPDA 3WGIA 5L51A 1IY8A 4F6CA 3K2BA 3G1UA 3JQEA 4ALMA 1NAHA 4BO7A 4NJOA 1B7GO 1C3VA
chains in the Genus database with same CATH superfamily
2MINA 3QH4A 1O87A 4TXNA 4MVYA 4G1FA 2JVIA 4CE6A 2IUFA 1J1ZA 4Q1VA 1FBTA 1MABA 3TPFA 3EXFB 10MHA 2A2ZA 4MS3B 1E9FA 4B82A 1FS5A 3QBTA 2HCBA 3NI2A 4J0HA 4ESOA 5JSZA 1N1EA 3BB1A 2EJVA 4BFUA 3ZJTA 3ZVMA 5CH3A 5E9AA 2CMGA 2P5SA 1A76A 3LA8A 4AY4A 2M6LA 3JAWB 3OM1A 2XTMA 8GPBA 3EPLA 3MTBA 3PGJA 4BV8A 2GEUA 2QJFA 3ZVNA 4YALA 1XN1A 5J2TA 2P9TA 3A1NA 3D7MA 2G9ZA 5FOTA 4J1TC 5DBEX 5IJWA 2ZUCA 3R24A 5BP7A 4AZVA 1Z0JA 4F5YA 4BDTA 1ML4A 3P0FA 3ZKWA 3B1YA 2PH1A 3IKLA 1LBQA 1OVMA 2CZQA 4ZP1A 1WMDA 2YZ2A 2CXPA 4NMXB 1L7NA 2YUIA 4NYIR 1CY6A 1FRVA 1KNQA 1Q95A 1F1JA 1U2ZA 5DTEA 3K71B 1QGAA 1XC7A 2IZ5A 2CV0A 3I6QA 1GNQA 3DOJA 2IWHA 1K2VN 1I7PA 1BFDA 2WTXA 4UMVA 5KJ1A 1RKUA 3B53X 1BG6A 2JAWA 1VE7A 3TFWA 3A9SA 2R87A 4B3MB 2PKQO 3ZDYB 3K53A 1E7RA 4D99A 2BELA 1T15A 3IMEA 3QELA 2GJSA 3SQLA 2JLYA 4IIUA 4N3CA 2O59A 3RM3A 2PJUA 4IF6A 2XDAA 1LPPA 4BGDA 2EJBA 2BLLA 7GPBA 4XIJA 1GT91 1EP9A 1HI9A 2HI0A 1NTOA 2ISSD 3A3PA 3KKNA 4JP2A 1WDTA 1WCWA 4NEGA 4MHTA 2R6CA 1SK8A 3FDIA 1QYVA 3ILHA 1MOSA 4GM4A 4HYEA 4I3FA 2WKQA 4ZOEA 1NYRA 1P7WA 4NZZA 1ZSNA 2Q8QA 3UJAA 3A9VA 1JG1A 1QP0A 4LZJA 1NMQA 2XXAA 1FTSA 3LWDA 2JCBA 3MAGA 4MEAA 1KI9A 2AFHE 3R0IA 4TTPA 4UUBA 3U5TA 1TF7A 1VMKA 1O3YA 1WLSA 3M1IA 4Z9XA 3T9CA 2H1FA 2QIPA 2OYSA 1SU4A 1FSZA 3KQQA 3WB1A 5JQGF 3WZMA 3PNLA 1GAWA 4YUWA 3A2NA 4PPGA 1CB0A 1CSEE 3SQXA 4DLSA 1N6LA 3QKIA 2BFWA 3NT4A 1SBCA 4PYNA 3IUNA 1W35A 1ZO8A 1JHMA 2C2YA 2WNSA 4TVBA 1N3LA 3SSAA 1XZ8A 1PJ2A 2AFIA 3SSMA 3WO0A 4G5XA 1VHQA 4AMUA 5ABPA 1S3FA 2Y27A 3C3CA 4PO8A 4GVPA 1GLNA 2ZFUA 4BTLA 1QF9A 2JHCA 4L0DA 3ZHYA 2VBGA 1M1YB 3ZJ4A 2CLIB 4C0HA 4MP8A 4C03A 4IG4A 3VZBA 3AFMA 4OIMA 1DWQA 4EYQA 1IDOA 1OE0A 4J94A 2IKSA 4L95C 3P2MA 3DDCA 3ISVA 1H2AS 3ELWA 1C9YA 4L6AA 4J2TA 2DBRA 1RW4A 4HDQB 4RTJA 5CFZA 1B76A 2W2QA 2QUIA 1L5KA 4IKOA 3X2FA 3ZQUA 2FWNA 2VSFA 3D6TB 4JJ4A 4AVYA 3QPVA 2B78A 1FZQA 2IV3A 3LKVA 1N7GA 4IV0A 5E1DA 4DJDC 1ZM7A 2WE7A 3IAHA 3OIVA 5IANA 1YFZA 5KC8A 3LT4A 4DCVA 2B20A 4KIGA 3C4VA 3CR7A 4M0MA 4ZWNA 3I5UA 3PP8A 3R7BA 2QOEA 2J30A 2ZSHA 2JHAA 4MMZB 1U2RA 1P7ZA 3I9MA 1JG6A 1EP2B 4JBGA 5THXA 4JB2A 5CAEA 4YN3A 3WBKA 4DJFC 3C3JA 4WHMA 3KSAC 2M9MA 4F9EA 2GN0A 4PM4A 5DX0A 4LI0A 3RUHA 2FFBA 2R84A 1QJ4A 3YASA 5KPJA 3AVYA 1YRBA 4ZVVA 2BH9A 2NUTA 1U8ZA 1IH8A 4E3ZA 2XUOA 2XTJA 3WQRA 2C3YA 2V4MA 2EGUA 3QHQA 4B74A 2CV1A 2BM0A 3O4VA 1OZHA 4H16A 4UAVA 1UQRA 4NBUA 3MJSA 2BZSA 1T36A 1JSRA 2Y0PA 3I01A 5E7QA 2P1ZA 3AZQA 4MGKR 4RSRA 4B31A 4ZZ0A 1R6BX 3K0AB 4G63A 4PQRA 5DTMA 1T24A 2D13A 4W9NC 1SVWA 1GNLA 4L75A 1U2PA 3J81k 1AKEA 4EJSB 1LS6A 2ZI9A 2CB0A 4P3KA 3ZUGA 5GONF 1IWPB 5IP5A 3ZWKA 4EHFA 1FJ2A 2QVLA 5B12A 3ANXA 2Q6IA 1LDEA 3UJHA 2WU0A 5LJLA 4XWAA 2J1LA 4OH1A 3TNDA 1QHIA 3EDOA 1BMQA 2IW3A 2PL3A 2Z1DA 4PF1A 4QLOA 1H5NA 5EEGA 5EZYA 1K2WA 5GAJA 3SFVA 4AN1A 3ORHA 4BQIA 5CDGA 3CPEA 3HV0A 3OBBA 4BNLA 1GGEA 2W2NA 4RFLA 5E9JA 3E9EA 2ZJ4A 2I8AA 3SVZA 9LDTA 4UTRA 1S5PA 3BHIA 1M2VB 4J75A 3TNFA 3F49S 3V3TA 4AKSA 5JCJD 2A1IA 4J7AA 4Y9DA 4E5UA 2MOKA 2VWHA 5GOZA 4FGWA 2WT9A 4U3JB 5DLYA 1DAGA 1INLA 2FKAA 1D0VA 3Q5EA 1FX0A 4HGOA 4PXSA 5I4KA 1FJXA 2XNJA 2BEJA 2WIGA 1ESMA 2ORVA 1Y4SA 3QVMA 4L4RA 4V0MA 3C70A 5EZ6B 2X0JA 2L69A 4H7KA 1HNNA 4AY5A 3FHLA 1KMCA 4RKEA 5ALYA 2A9RA 1VM6A 3PC6A 4HGPA 4HQOA 3P2KA 4LHXA 4TM8A 5FNVA 2B37A 2VJAA 4NEQA 1HTTA 1AS0A 2E3JA 4HQRA 4OI4A 1KEPA 2QPOA 3ZWMA 3FOAA 1ZD5A 3O47A 2GM9A 4G4JA 4QU0A 1Y1PA 1R1DA 4PO9A 4BP3A 3MB5A 2O2XA 4OI0A 3QE3A 3DE4X 3SJZA 3H6KA 1UWVA 3O9MA 2IBSA 1S2DA 1ZNQO 3BICA 4HRAA 5FA8A 3IV6A 3PIIA 1T91A 1YK1A 2FDXA 3JASB 3M6UA 3MCTA 3N7AA 1MC1A 3AR5A 4HX2A 2WIKA 3DYBA 3IP7A 4ZQIA 3NOQA 4JLSA 5EKDA 4F5DA 2FQXA 4GP6A 4PTLA 2QRKA 1CVRA 2YWXA 5EMHA 1LTKA 3LQFA 4Q4CA 5K45A 3TOCA 1WSBA 1JKJA 2QL7A 5HTKA 1SG9A 1XL0A 2OFXA 2WI8A 2YV3A 2ZWAA 4K9PA 4O4JB 1BJRE 3ESAA 2B1JA 2R7LA 1XA0A 5AJXA 4J4HA 1F0KA 2PUWA 3E8MA 4UBKA 2PMBA 4RIIA 3X1YA 4S1WA 3WNBA 5K9ZA 1HDGO 4LZAA 4UD6A 2BL4A 2HO5A 3PDCA 2PAAA 3NBQA 4E51A 5EHXA 2X9VA 3T7AA 4D25A 3VX4A 3GROA 5DHSA 4CKXA 4D92A 2NZYA 1FQOA 1L7XA 1QYWA 2VPYA 3C3EA 5IKOA 2IYFA 2WSLA 4FOOA 3ITEA 4OGKA 2IV7A 2AD1A 5L7YA 5AVJA 2OESA 3KQKA 3Q9SA 1CQJA 1E8DA 2V9PA 5EHQA 1II8B 1C7FA 2GQ0A 2VA9A 1FU4A 1L7BA 1YR2A 1DEOA 3AILA 1CR4A 3NASA 4MKFA 2VSXA 4WI1A 4CKBA 1AUVA 2C8LA 1YB7A 3V97A 2BKVA 4FFWA 3RRBA 3D7KA 2IYWA 2EKDA 2FPLA 3N39C 1C0LA 2FZEA 3P9YA 4PZLA 3ZX4A 3KZKA 4JLPA 3V8NA 3QPBA 3U7QA 2CEKA 2AE2A 2WYUA 5FWXA 3OLXA 4OHBA 5BV2P 5AJWA 4FYVA 3GLGA 4QNNA 4IHJA 1W19A 5J59A 1YC5A 2JGLA 3U3DA 4BNKA 4WOPA 1E6WA 2PH5A 2PRSA 3IQFA 3C3YA 4QJIA 2DHCA 2A35A 2EC5A 5JXIA 2O8NA 4B4WA 1GXSA 4YEDA 3MGBA 3MMXA 3GR6A 2P6MA 2BGWA 1GTG1 4GVLA 5BR4A 5LQKA 3CVYA 4LNUA 4TWRA 2JDID 3V34A 1GYRA 1HEUA 3HB5X 1JMVA 1GZVA 1Z62A 3AJ9A 4QBGB 3VV3A 3N2KA 3OF3A 1K3FA 4MHSA 3WMEA 3ZU2A 4Q4LA 1BCSA 3CN7A 3FGNA 1A2BA 3RUIA 3SXPA 2GWHA 2J32A 4XPIA 3FSRA 3QPDA 4EFMA 3UPUA 1SHJA 3PUVA 3MSXA 2PXXA 4QGHA 2GK4A 1ECFA 1CUCA 3VPGA 4BNXA 1TKAA 2HMTA 3B20A 4KRXA 4J4BA 3V1YA 4XZ3A 4ALKA 2XRZA 1QHGA 4RM2A 1XU4A 1IN7A 3KWJA 2RHCA 3RVRA 3ZHZA 5KOJB 5F98A 3AKCA 3A4MA 5ENVA 2R60A 3I04M 3TSWA 5HIIA 3LH5A 3O1LA 2VYVA 3HDJA 3WLNA 5JYDA 4MR8A 1ZSYA 4R7GA 1T9GR 1X7ZB 3GQBA 5IDQA 3M0EA 2GCNA 2V98A 3DMRA 4B35A 2VJBA 1EG2A 2XGSA 5T67A 4UM7A 3PNOA 1JXAA 3T3DA 3G2NA 1EFKA 1PYGA 1N77A 2YRXA 2H16A 3DCIA 4N5IX 3FDZA 4ONEA 1GNVA 1TJ4A 2YVQA 2HHAA 1L7OA 3LPAA 1F7UA 1EFHA 2ADFA 2AZTA 1R0CA 2G70A 3P8ZA 4I4TB 4PFKA 2J5BA 2YHIB 3NHKA 2FPUA 3CUVA 4JITA 4Q01A 5CGQB 2AG1A 2C4UA 1XQWA 4FE7A 3UTCA 2Y2UA 3D5EA 1NNEA 1NW5A 2XEXA 4FBMA 2AG6A 4DSAA 1KYWA 4L4ZA 5KKNB 3BPSA 2R3SA 3MMSA 2J46A 1A04A 1NDHA 2JFWA 3QLTA 4MRNA 4UUNA 4Z1MA 1GU0A 3OF5A 1U0JA 3N6RA 5TDHA 4RGVA 1JU3A 2RJOA 1G55A 3M3HA 2CD7A 1GQSA 4FP9A 3WLLA 1H2EA 1ORDA 1WMEA 1R6XA 3D02A 2DHDA 2ZS9A 3RUEA 5LQNA 3NDBB 2HWWA 3DEYX 1C1DB 3KOZA 5CJPA 1BXRA 4D5GA 3ENWA 4LJSA 1P39A 3DVLA 4MQBA 1BRMA 1HDYA 2IX9A 3K1JA 3P9CA 4FSHA 3E3MA 3S2FA 1XXHA 2CDNA 1VL0A 2FPPB 5TEVA 1BMFD 2OECA 4HDNB 1WVIA 4LXTA 2HZBA 5KYXA 1A71A 4B32A 2IEIA 1N6HA 1DAPA 1R6VA 2HZ7A 3IULA 2FWIA 5F2OA 3ENKA 4UREA 5K6TA 4RTOA 1IBLB 2W90A 4NDZA 3ZQKA 3BMQA 4FC7A 1RWKA 3F47A 3LBYA 2XIJA 3O4JA 2XUQA 4V0ME 5ICGA 3HY3A 1QB7A 4TYNA 1XVTA 2JLZA 1XRLA 4PSVA 1JE0A 4BKPA 3ZD7A 1XD9A 2HBRA 1OI3A 5D01A 2CZGA 1F38A 1BWPA 4BBPA 1FSPA 4E4TA 5E2AA 2BWJA 2W2KA 1Q5PA 2C03A 2GAAA 4LYDA 5K0CA 3B6MA 5IARA 4R2KA 1G6HA 4XWYA 3U6BA 4YT5A 4DA4A 3WK5A 1O8CA 2DVMA 4KDFA 1QOQB 2O19A 5FUMA 3PXDA 1FCJA 2H5IA 2ZSBA 1EDBA 3C2QA 3EZLA 3MWFA 4KQ2A 4TXHA 4BECA 1FE8A 1YVDA 1U2QA 3P9KA 4ZC1A 4KAXA 4KLZA 3KB2A 4YMGA 2N75A 1C3JA 4EPTA 5E3JA 1TVMA 4IQ4A 4G4SO 3Q11A 3AV0B 3O2JA 4F7WA 2G5PA 1D03A 2Q3LA 3V32A 4ARAA 1W85B 5KBYA 2A78A 3IT3A 1O5OA 3MHPA 4H3HB 1OXSC 2WTMA 1OB2A 1Y81A 4XDYA 2MYUA 3GFTA 2E4UA 3EQ7A 5FLKA 1BWQA 4DRYA 1A77A 1NPYA 5IZ4A 2GA8A 1USWA 2GVNA 5B3JC 4CW7A 2V0CA 3HUEA 1XWWA 1C7EA 1SKBA 2AXPA 2WJPA 4IGFA 4PG6A 2GZAA 5DNUA 1SG6A 2KQUA 2G4VA 5G0UA 2X3YA 4PPFA 2C5AA 1JJVA 1HNWB 3LL7A 1P9LA 3KLBA 5FBLB 1EFPA 1TW2A 3WB9A 4Q9IA 1I6LA 2HTEA 3EE6A 4MUNA 1WB4A 1XTIA 1OA1A 1V11A 4WCVA 3AI2A 3H2IA 4YV1A 4IIFA 2JAPA 2R8XA 4U2CA 3RFVA 4CODB 4F11A 4DQDA 5M2QA 2O0MA 1M2NA 1UZAA 2YHBA 1W48A 1UKBA 4WXHA 3CN9A 1S8OA 3WMRA 1QTNA 1Z0ZA 2EKBA 3I2JA 1Z2DA 4DLWA 3A6FA 1R5NA 3EDMA 1IULA 1NPTO 3K6SB 3GRAA 1CF2O 1YJQA 1Y63A 2VTKA 2EQ5A 2IZ6A 1FFXB 3R5TA 5JCJA 1LK7A 3M3DA 4RELA 5JS1A 1PL0A 4EJSC 4K9SA 2HYDA 3ZDFA 4CMEA 2GN1A 3DT9A 1WZ2A 1S2LA 4Q34A 2CLMB 4ITUA 3R3SA 2Z9CA 2RH5A 4QPZA 4X8OA 5HDQA 2CXUA 4P1ZA 4N3AA 2GK7A 2ZRLA 4IGAA 3RIHA 3GVPA 5HBGA 4C43A 5DISB 5CNMA 4BCDA 2CLKB 2CKDA 4GYYA 2PNJA 3CKMA 4O33A 4N7BA 4UUQA 2P6UA 1ISGA 1SU8A 1ZN9A 4ARVA 3D4LA 5BN4B 1SHLA 1P60A 2VP0A 3QVJA 2CF6A 2G72A 4BIIA 3IPYA 4TGLA 2C4HA 1T29A 4XIGS 2Z2ZA 4IUDS 4LYEA 4P5PA 2MSKA 2QR3A 1F2DA 2HWXA 2Q4EA 3MEQA 4C06A 1VRWA 4NARA 3WYAA 1OLXB 3JY6A 1DBQA 3LBAA 4KKXB 2IXDA 4RTQA 2VQSA 2ARKA 3KR1A 3U7RA 4DKXA 1PCXA 1SXIA 5DOVA 1HPLA 3PUXA 2DUWA 2CMKA 4YUYA 2IS1A 3AI3A 5L3VA 2L42A 4RKQA 5ERYA 4S05A 1Y6GA 3A6KA 1CDDA 2YHAA 1OKKA 4Z54A 1HXHA 1EGQA 2WF9A 3ZJVA 2UZ3A 2FEAA 3GLHE 4DMRA 1W1IA 3CLVA 4A0QA 4QYXA 5CA0F 3ZDCA 2YFHA 3D6NB 2DPHA 2QT1A 1QRAA 1W8DA 3KVRA 3PNPA 4GECA 3RU2A 4YXWD 2H85A 4R9NA 1XGKA 2V58A 1MV8A 1KDYA 4CDGA 5C7OO 1AZTA 3SYLA 3RT7A 1CP3A 1AKYA 1CB7A 1X8LA 3EMKA 3H97A 3M4NA 2XE8A 4IHJF 2H0AA 4F60A 3ZBUA 3RBAA 5I3CA 2CL7X 1HZZA 3ZCSA 5A03A 1JW9B 1IXZA 1VE9A 2ZUDA 1SKYE 2GRJA 3RDPA 1V41E 3U1TA 1DJOA 4F45A 4ENVA 1OC2A 1HQKA 1ADBA 3H5LA 5JDCA 5K05A 4ZJPA 1YDHA 1J8MF 1DLJA 2GVDC 3LYLA 4M9CA 2XA2A 5DHTA 3B7GA 2QUHA 4HH1A 3F5DA 3LY8A 1OAAA 3MAJA 3L05A 3L7JA 3QPCA 4B4KA 2J67A 1N3YA 1HEYA 3OY2A 2ERXA 4K88A 2CK3D 1J8DA 5E2BA 2XWBF 2PMEA 5B30A 5C3MA 5KQGA 1PJ8A 4LY0A 3SZUA 3O7WA 3KE9A 1N0UA 3ND7A 1PV2A 5GP1A 2FPRA 1J0AA 1N2EA 2QN6A 4KXVA 1PN3A 1PR6A 2BR3A 2VSQA 4E6EA 3DZKA 2YY6A 4PAGA 1AB6A 1T36B 3FPCA 2X15A 3VXKA 1ULZA 1YGPA 2NU8A 4I1PA 3OEEA 4HLCA 4MW4A 4J76A 2XH8A 3V8EA 2DKFA 4BMSA 4PC7A 3MILA 1TZMA 3ZCPA 1WL8A 5COAA 3NETA 1XWFA 1YO6A 1U6IA 2OGZA 3NOOA 1B1CA 3H2BA 5F1PA 1YGYA 5TVGA 1WG8A 3OBIA 4YJ2A 1C30A 3E03A 3H6GA 5EHIA 2ATCA 3N87A 2FW6A 5D84A 5AWFC 2Z2KA 3LBIA 3PGXA 3CRRA 1Z18A 3IR6A 3G49A 2BGRA 1U5CA 1W4ZA 1DOHA 3LCMA 2NTYC 1OV6A 1QO7A 2BTQA 4UW9A 2AIRA 1P7YA 1AHNA 4TLAA 3USES 2AEEA 5DM1A 3ETGA 4KBFA 4MAAA 3I04A 4NJEA 5EIFA 4CM4B 1F12A 3AP1A 3NOXA 1NY6A 4YO7A 3C5VA 4XW2A 1RBYA 5HK8A 1U1IA 2K4MA 3PF8A 5FNVB 4J90A 4ZRNA 5TT1A 1XZJA 2XT9A 2OM6A 2VRWA 1Q0SA 2BJWA 3D3QA 3KQTA 4IDNA 4LNAA 4BOYA 4MEBA 1EEHA 3W5DA 3AERB 4TRRA 5FPYA 3TXYA 1ZQ1A 3EAQA 3SF8A 4E0BA 1F7VA 5A4MS 4RVCA 3R9IA 5BN1A 3ZE2B 1RWPA 1Z2NX 2RGDA 3HY6A 4KQ9A 2PZKA 5LMNB 2DCMA 3FFAA 4AJPA 4PXYA 3WL4A 5B1EA 3HJFA 5JC8A 3LECA 4CVNA 1WKCA 1I33A 2BHSA 3KT0A 4CCYA 5BNZA 4CLEA 2IH5A 3PHLA 1LW6E 1OWLA 4UJ3A 2TMKA 4KGZA 1CYDA 1EKXA 4OO3A 3DVQX 4WLEA 1XQ6A 2XRYA 3U49A 4S04A 2WFAA 1JB1A 1Q15A 1VCMA 1TQHA 3FMVA 2GF2A 3L6RA 4XYGA 4AO6A 1TO2E 1KMNA 3GPDG 5K03A 3DZFA 2XVAA 2H2HA 3H9UA 2F62A 4QC2A 2ZYHA 3AL2A 2P4HX 4CNBA 2ODNA 5DFAA 3VVLA 1NW8A 1W30A 1GL6A 2A5JA 3HKDA 4G4SP 5LDGA 4YQEA 1NVFA 3VJLA 2QMYA 1CR6A 2J4CA 2QYOA 3N28A 4X1KA 1EM6A 3SKYA 1NWCA 2PKCA 1RJWA 2E37A 1SXJC 4IKPA 4P9NA 3SHOA 4GC9A 1PZXA 4Y2YA 4Q7MB 1ZN7A 1E59A 4BCCA 1FJHA 3F7OA 1U3TA 3JATA 2UZIR 3LGXA 5IVIA 2ZB7A 2D4AA 1PEDA 1HGXA 2FFRA 1ZK4A 5JWRA 4C2TA 4E70A 2ALJA 2ZVPX 3OEWA 2C82A 2AQKA 2O3UA 2X19A 1II0A 3ZR4B 2VL7A 4KG7A 4BEWA 3U80A 5JD4A 4V24A 4MCJA 4C0KA 4I50B 4YRAA 5KEIA 4FU0A 4KPUA 4Z5XA 1KTVA 4QULA 3PWSA 3F0TA 4FNAA 4R1LA 3DNPA 4L0CA 3LCRA 2QJRA 1BJKA 4FGUA 4IGEA 2ZJYA 3LUPA 4IHJB 4NR0A 5LNK1 4INOA 5EIXA 2EDCA 3LK7A 4CMIA 4F2DA 1PTJC 3OQMA 1RWBA 3DE5X 1JTFA 1OKKD 3BGDA 3NC4A 2HHJA 3AGPA 4IRMA 4AX4A 3W5UA 3TR5A 5AW7A 4X95A 4KLRA 4DR1B 3HFSA 4IR7A 2PD4A 4BQOA 1QG6A 1T8RA 5J5VA 2C5HA 2QQFA 3OE5A 5CFRA 4WQMA 1J1UA 4LF6B 1YE5A 2ZJ2A 3MJEA 4F5WA 1RMQA 4I0WB 3L1KA 1XJCA 3FPSA 3RV4A 3V7WA 1JRLA 1PWYE 2PL5A 3D1VA 1OASA 3EXHA 1LRKA 1YZVA 3LX4A 3MOSA 2OOKA 1SO8A 4RSGA 4UCWA 2HDWA 3HWSA 2XQJA 3NHMA 2B8TA 1NQ5A 1HV8A 1PK9A 1Z8HA 3DWGA 3EOBI 4PPQA 1BWSA 4QA9A 1A1VA 3PX2A 4C7MA 4IQFA 1F4PA 1KZ7B 4FT4A 3RVLA 3LFTA 3AR3A 3PPYA 1O9BA 2FFQA 1S2OA 1SH7A 4KOAA 1W9HA 1NF9A 4R40A 4TQAA 3W9UA 4F9FA 4JR1A 4W5WA 3PC4A 2JIQA 3PWTA 4ON9A 1GR1A 3QWFA 3HA2A 4RMNA 3I9NA 5A62A 1FP4B 4RA6A 3SZRA 2FH5B 4FYMA 4JYMA 4W63A 4E2FA 4P31A 2ZJBA 1XXHB 2Q5CA 1J21A 3GV0A 4F2WA 4PSCA 1URPA 4PIPA 5KU1A 4A15A 1EFAA 3OJOA 4DC9A 1NR5A 1NVTA 5CX1A 4S1TA 5HKKD 4RDHA 3WNVA 3T61A 3HJAA 5BQ5A 1ZOLA 4P93A 3DHWC 1KYQA 1OYYA 1YUBA 3GXOA 1QAOA 3OHSX 4DVJA 5A04A 1ECCA 3DKIA 3CF0A 2ZRIA 3QFRA 4H2DA 4H6VA 1RTTA 3PR2B 4PLGA 1MG5A 2NZXA 3MINA 4DYHA 5D51S 4L0QA 1MOZA 2IYEA 2GBCA 5DGTA 3OTQA 5IAOA 4F7DA 2I7CA 3X1XA 4IMRA 3W3AH 1E9AA 1O77A 1CEQA 1G7SA 4ZD6A 1PFUA 4F3TA 2KLHA 4JNKA 2Q9CA 4R05A 4U02A 3VV2A 1Z4KA 2O3JA 3H1FA 3N9IA 5K0TA 5KC9A 4D0RA 3WMGA 5BN5A 3UFXB 1BKSB 4W5NA 3KXLA 2FG5A 4ZVTA 3GGSA 3EWNA 4UZSA 3SSNA 1HDCA 4MYHA 4ENUA 5DKFA 4IXNA 2ICAA 4HDSB 4DJEC 1KRXA 3PXXA 3NV7A 4MTCA 1OCEA 1ADYA 4NYJR 4ML3A 3I32A 2MCFA 4LF8B 4WFIA 3KTAB 3LWNA 4OB7A 3DAHA 1BN7A 4HDKA 1XPRA 1TAHA 2OCBA 2VKQA 2XNKA 1Y7LA 3QXJA 4QVGA 4JROA 2BSQA 1NOKA 3MWKA 3UATA 1GTJ1 3M6VA 1P9RA 5H9WA 3GA7A 5IJAA 4PYKA 1Q6ZA 1KH3A 4DA7A 1E79A 2AF4C 3VSDA 2FW9A 4DV7B 1ONBA 5C4GB 1M5UA 4TMZA 2I1VB 5IK2D 3NGXA 2R11A 2WJIA 4P8RA 4RWZA 1Z13A 3O21A 2WUVA 1N9GB 4QSMA 2GYUA 3ZW9A 2X5KO 3VJKA 4BLPA 1QLJA 1OH7A 1I01A 2A0XA 5D7NA 3T1YB 1PL6A 3MYRA 5A0FA 1JFSA 1FFAA 4Q3OA 4TS4A 1UANA 4CR8A 2J7KA 3REOA 4EF5A 2NPFA 2A9FA 3P4YA 4TMXA 1SZDA 5D1HA 2O5CA 2EW2A 4IUCS 2C8JA 3TQFA 4GLJA 1CLEA 1OVGA 5AW6A 1SEVA 4M38A 3BD8A 1BAPA 2QSUA 3DM9B 3F6SA 3KOWA 5GZ6A 3VNAA 4D79A 3EPJA 1EUQA 5LLTA 1U5AA 5E2IA 3UOAB 4UXHA 4H3SA 1RLIA 1ZPDA 4FDAA 4R2MA 5T8KC 2DQYA 1NUUA 1MB9A 1Q1GA 3MC1A 1T2EA 1U7OA 3AEKB 3HO6A 3PC8C 1VMEA 3AT1A 5ESWA 1KS2A 3K0FA 4PX5A 1J06A 3UW3A 2PRKA 5KJ6A 2YWRA 4D02A 4F3NA 2O4CA 4NV3A 1JEYB 2JJ2A 4CTMA 3PRYA 4M1YA 3DKKA 5ALDA 2QIOA 1V3TA 1LDMA 3EC7A 3EODA 1QZUA 3LHFA 4HN2A 2AUNA 5EE3A 1DQPA 1GCOA 3BTSA 1TW3A 3ZWOA 2ORYA 3X3HA 4QXRA 2XNCA 4ZDIA 4YCLA 3JPYA 5KTYA 5H1YA 3K05A 2PVSA 3KTFA 4Q47A 4KBGA 521PA 1XR3A 3K73O 4ZREA 3LBFA 3R74A 4AJ1A 4DCSA 5IJ9A 2O6HA 2FR0A 1Z82A 3NFRA 2WJAA 1DKPA 3QY0A 4AJ2A 1NFQA 1IB0A 1VHWA 3U62A 1JILA 3A14A 2DCUA 5MN6A 5D86A 2X23A 3H1GA 3MRTA 4F91B 4Q0MA 1RAAA 1TECE 4OVKA 4UAUA 5LQRA 1C29B 2NN3C 3RAJA 3THYA 2NAPA 2MSWA 4ENTA 4C4OA 1A8SA 1XZKA 1G1AA 1Z0DA 3IILA 2GGSA 3L6CA 2HF2A 4DQUA 3HJNA 2BAGA 2JVKA 3AW9A 2FXIA 4PC3A 5AD1A 1PJBA 2GM3A 2ZWMA 2QN7A 5I8WA 1QF7A 2W6NA 5CFQA 4PLHA 4D80A 2YWHA 3H3XA 3Q85A 4QDTA 4B87A 1GSAA 2J31A 1H1DA 3M6LA 3OOHA 4D8UA 2V7PA 1QTIA 1BGWA 5BUSA 1QF6A 3KALA 1OXKB 2R8ZA 4UTOA 3UWPA 1JVSA 2WIJA 4MIKA 5KYNA 1U1DA 2XUGA 5FAXA 3DTVA 1RQ2A 2WW8A 4WV3A 5A2GA 4YMLA 2HQRA 4RLQA 2NPOA 4ND4A 4BP9A 2ZI3A 4EYGA 4DWOA 3GEIA 3M1LA 3LYAA 1E8NA 5LQCA 2B1RA 4PN3A 1ZKDA 1Z33A 2YH2A 2AZ4A 4LOHA 2PX6A 2BC9A 2NTVA 3BDVA 2Q27A 4EQZA 1WDLA 2R0QC 2D7JA 1Q6YA 4JLNA 1NYTA 2HWYA 2YZGA 3AFNA 3TDKA 1SKQA 4H7PA 4Y6SA 3RVDA 1A7UA 2RCNA 5IC5A 3DLCA 4OB8A 3R41A 1W4BA 2P90A 1UMKA 5CLJA 1DHRA 1AUPA 1ONPA 3BMXA 3FUTA 4WERA 1J2JA 5ICCA 3I9V6 2RGNC 1LQTA 2GYVA 4JJIA 3W7BA 1RRCA 5HK9A 4E5KA 2I3AA 1WPRA 5KJEA 2PS0A 2NV0A 4CQMD 3KJIA 3EEFA 3O8NA 4NATA 4PHHA 4AZ3A 3DEFA 3MN1A 1RPAA 4X93A 2QTTA 1YQEA 4K9KA 5EQJB 1DAIA 2HU7A 4CV1A 3DVRX 1I9CA 4RESA 1B41A 2ASVA 3DLHA 2ZTUA 4DT1A 2XUAA 4DUGA 2B35A 2J9GA 2XZTA 5KOHB 3I4LA 2NXWA 3P0EA 5KNBH 2QE7A 2JGIA 3PQCA 4CWAA 4JVSB 3WJ2A 5JR3A 3EQ9A 3V4LA 5EA2A 3F78A 1ZGJA 1MLDA 4OMDA 5FJJA 3CSSA 1MO4A 3H83A 1Q12A 5HQTA 4LXIA 1KO8A 2H1SA 4DXHA 2XPCA 1T10A 2WQ7A 4ZEMA 4ZVKA 4CM4A 4MIOA 3B82A 1ISRA 3N75A 1UDBA 4RF2A 5LSAA 1E77A 2E5LB 4PBRA 3TLYA 4MJXA 4D3FA 3CXUA 4EQ6B 4EVIA 1T8WA 2FGKA 1Y5RA 3IAS1 3LC2O 3W5IA 4YX9A 5JHGB 3HYLA 5LOVF 1ZGZA 3TW8B 1D1QA 2PPLA 4JJ8A 4PTYA 1A5ZA 1Y8AA 3Q2KA 4PVDA 1QJCA 3PRHA 3LXXA 4CBVA 5J5CA 3JV7A 1JPNA 4L9WA 4RUKA 1DKLA 3UIEA 2AEFA 4JGGA 1QV7A 4RIGA 2PKWA 2VDNB 1J7JA 3F4KA 4HXFB 2EJWA 1DJPA 1TPYA 2B30A 2I2FA 3U16A 4HXEB 4LOIA 2M1ZA 3RRYA 1V71A 2GCEA 4EPVA 4JL5A 4GS5A 3ZYZA 2Q6LA 2QX6A 1CV2A 4BFWA 4PPYA 2IZZA 4E5YA 3JQ7A 3AMVA 1HDZA 1JVBA 1UK6A 4JAVC 4YP5A 3VGJA 2J0VA 1Z07A 2FF5A 1O4VA 1JBEA 4GUAA 4HNGA 3LPDA 1E3MA 2D8MA 3OPNA 1Z4PX 2J59A 4DC1A 5ADVA 4HLNA 1CJCA 3DPIA 5LIRA 2YC2C 1M2KA 2ZU0C 1NQTA 3CX3A 3DPSA 1X14A 4YRLA 3RANA 5IULC 3GAAA 3E4CA 1NE7A 1YVRA 3IEXA 3FDXA 5EEHA 1G1MA 1NXWA 1WW2A 1UODA 1J2UA 2HA6A 1JDVA 4H1TA 3UAOA 3V8MA 5BOSB 2BTQB 4HHEA 1RZRA 3FJYA 1XMXA 4L4SA 5UKDA 4EPWA 1AKTA 4M2LA 1CIJA 1UKEA 4ICIA 1TT5A 2Y6UA 1KDVA 3FRHA 5FPSA 1WB6A 4Y9SA 3JYOA 1VFPA 3DTVD 3E6AA 1K4MA 2GB4A 4DQVA 5MFPA 2L18A 3TMAA 3OECA 4KR0A 4E2WA 1X87A 3QU4A 3Q0TA 1ETUA 1FNBA 3C6XA 4DQ0A 4JUFA 1D2HA 5FIUA 3OMLA 4B4VA 5K09A 1SZPA 3SNKA 1JIVA 4PQEA 1R18A 3GFVA 4OGLA 3NKVA 1MQAA 2G6BA 4FKMA 4TTAA 2JH8A 2I22A 2HIGA 3QZUA 1SHKA 3SBXA 1NRWA 4JUCA 3UV6A 5AVYA 1H9BA 1A2QA 1SG0A 1UXHA 2JEZA 4J0KA 3VR3A 5DNEA 1GNTA 2Q1YA 1VLMA 1W5SA 2A9OA 1X7DA 1F6DA 2IEAA 1Q7TA 2G88A 3PUYA 3ADPA 4L3WA 3UG7A 2A67A 4DPKA 3HZOA 1ARZA 1GTL1 5DN6D 1GILA 1P0FA 3CX7A 4EEZA 5JJ5A 3T54A 4FINA 2W6PA 1DBPA 4P2GA 4TXLA 3V8RA 1P9WA 2ZTHA 4ITRC 3ONEA 1LQUA 4LRTB 1BVYF 4R9VA 5TQVA 1NJ5A 2P75A 3H13A 4UTZA 3UXHA 1YRHA 3IUBA 2EKZA 1I0LA 3SJCA 4YWJA 4HLUA 2WJ3A 4YT2A 2VF8A 1IK4A 3HABA 2XV1A 4WXPA 4YNBA 3HDVA 2EERA 1E9VA 3F4LA 1J9EA 4HDRA 4JOQA 2FMHA 4MJLA 4JT9A 1T2DA 4N49A 1JQAA 2IVZA 4HEJA 1XJ0A 4NCHA 3WSWA 1MRSA 3JARA 3U7EB 5BMOA 1IDN1 2YN2A 4HH3C 4KXUA 2VHJA 3DG9A 5ECYA 3TAXA 4DV5B 4I8DA 1KDTA 3DFFA 1J20A 2YDXA 2JIDA 4HLUC 3BQNB 2JLAA 1ZFNA 4KFTA 2J9FB 4U9HS 3ZE9A 4B6PA 4CMIB 2Q2QA 1TO1E 3MRXA 2YBDA 4KPGA 4LGCA 4DR7B 1XXLA 1ZUD1 1BYUA 2FW8A 5ENDA 3H2KA 1MJGM 4YFVA 3VU9B 2C7BA 1Y1QA 2YQZA 4PLVA 1F48A 2FZKA 3CSUA 3G0BA 1VIDA 2HMYB 5GY7A 5F3DA 4TWBA 5L4LA 1V9CA 2VZ8A 3TSOA 4BVAA 3IKMB 2P4EA 3L7MA 1Y6QA 3C8UA 3R9XB 2I6TA 2OXCA 3JQCA 4ASUA 1JS1X 1ECGA 1UC9A 1R4NB 2GUWA 4Y6OA 1A4XA 3OIUA 1DXHA 4ND3A 1JHXA 4P4SB 1UMCB 3JRWA 2R5WA 2KW5A 1E6KA 1L5QA 3BOSA 4M54A 2HKIA 3R3HA 4TROA 3SM3A 4C22A 2BH2A 1QWOA 2DH6A 3USCS 1HYGA 1CUIA 4CEIB 2QL6A 3O3OB 3TEJA 3ADOA 3GLIA 2VP6A 3KT6A 1ZICA 3FOCA 1S0UA 3VQTA 3E22B 4TTJA 1Z5VA 3DUFB 3N07A 2FN4A 4FN4A 2ZIZA 1EZ4A 1WRBA 2AUMA 4ZANA 4OFZA 2WHEA 2CVPA 2AMLA 4RENA 4JLVA 4YA6A 4ZVPA 4AJJA 4BEVA 3CEPB 1DAKA 2TMDA 2CHEA 4AXXA 4IINA 1JDBB 4CQLB 1UWKA 4RD4A 4UTXA 3L7AA 4X1IB 5AXBA 4EWLA 2RC6A 3CLTD 2QTFA 4C0WA 4R51A 2K87A 1DUIA 1YDFA 2QN1A 3NPAA 4MVJP 4PRZA 4B6FA 1QBGA 3RARA 3JWEA 4XB2A 2R8RA 3HBLA 4QG3A 3OPYI 3Q7TA 2XD9A 3LNCA 1FTNA 5TQ2B 1Z25A 2QD4A 3P2OA 4D9HA 1IHPA 1EX7A 5TEWA 3W4KA 3QVTA 2FMFA 5JRZA 4GXTA 4YAFA 1HFWA 1V2GA 1P17A 1EB8A 2V6MA 1KDZA 3RASA 1EP3B 1Z0FA 2CE2X 2O0LA 3O4FA 4D0NA 2VTVA 3FN4A 2PGAA 3SEQA 5ILQA 2QTLA 4R5MA 3RR2A 3U4AA 2FLVA 2P0YA 3JR7A 1JKJB 2H4HA 3BHJA 5EC8A 3GUVA 3QOFA 1I4OA 1Z5UA 2JGDA 4KAAA 3BXPA 3WBFA 1TT5B 3B1ZA 2FCRA 1P6XA 4QASA 1YL5A 5EE0A 3VFDA 3WVNA 2GF9A 5JLJA 2DETA 3JQ9C 2HA4A 1PGOA 3IMCA 4ZEWA 4F4FA 3SC3A 2Z6QA 5JWOA 3W7AA 1E4EA 2BF7A 3SKVA 2P5UA 1XPJA 3MYYA 3D4BA 5LMCA 4WOKA 3C41J 1P1JA 2UZ4A 2ROQA 5E3IA 3Q6IA 4XSGA 3CNNA 1YB1A 3MFQA 1RRKA 3RHZA 4DCJA 3ONFA 3LQ2A 3B12A 2R8OA 3UO8B 1LX6A 4S3MA 2QXYA 3DOUA 5L3RA 3VC1A 2NQ2C 5J4KA 1D1TA 2V6FA 2EKPA 4ND2A 3KZ1E 2VDKB 4COOA 1ZK3A 1H3EA 3K8YA 1GKIA 2QJOA 2J5RA 4YECA 5CXXA 3GAZA 4ILEA 1G5TA 2FSFA 3ICWA 4PHGA 1X1DA 4I66A 2OQVA 2ACEA 3VHLB 4UTPA 2JHGA 1JDPA 4N01A 4TWZA 4QDKA 1BHJA 4LMBA 5F5XA 3TO5A 4RHXA 1M1YE 3LMKA 1W44A 1W9MA 2PDAA 3ZWWA 1XTUA 4BMZA 1XD8A 4YRBA 1MO3A 4ZU6X 4LXHA 4AKTA 1RI3A 5MHTA 4YTEA 3OZ7A 4OBBA 5HHTA 2VTBB 3DHNA 3U4MA 4JLDA 2V6GA 3HU1A 5CJJA 4G37A 1V5WA 2HU5A 1FYVA 2O2GA 2C2BA 3VH3A 2R1TB 2ZRBA 3SWWA 4F38A 4AS2A 3IERA 3L77A 4Q7LA 3COWA 1F60A 4N6NA 3EBPA 2AG0A 1O94A 5AFSA 3KEQA 5T4FA 3MZ0A 4EMBA 2XGGA 3KPUA 4K6OA 1M7GA 5HF8A 2Y1GA 4YK7A 2QT0A 2WQZA 3HZRA 2X0FA 1LZLA 3A32A 3DFMA 3Q3VA 4M86A 3N8DA 2IXFA 5IASA 4NENA 3ERCA 3UM9A 1RS0A 1J2YA 1OGIA 2DM6A 4V03A 4ND8A 1HT3A 4XX0B 1DFGA 5IBRA 5I7FA 5GZ1A 3E61A 3ROQA 3RSZA 1TEZA 2Q3EA 1OWMA 4LC1A 3EIXA 4FBLA 3D9QX 5KNDA 1YDWA 2X9QA 3SOZA 5TGTA