5IDVA

Structure of the nucleotide binding domain of an abc transporter msba from acinetobacter baumannii
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
263
structure length
262
Chain Sequence
FELLDLPEEQNSGELKPQLQGAIRFDHVVLNYADGTQAIKDFSLDIRPGETVALVGRSGAGKTSLVNLVRFQEVSSGQIYLDDLPIRDIELSSLRTQIAMVNQQVVLFNRTVRENIAYGQLHNASDEDVIAAAKAAYAHDFIMNLPNGYDTVLGAQGLNLSGGQRQRIAIARAILKNAPILILDEATSALDNESEHFIQQAFDEAMQDRTTIVIAHRLSTIENADRIVVMDRGQIVEQGTHQELLAKHGAYYQLHQRNFEDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the nucleotide binding domain of an ABC transporter MsbA from Acinetobacter baumannii
rcsb
source organism Acinetobacter baumannii ab5075
molecule tags Transport protein
molecule keywords Lipid A export ATP-binding/permease protein MsbA
total genus 90
structure length 262
sequence length 263
ec nomenclature ec 3.6.3.-:
pdb deposition date 2016-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5idvA01
1KNXA 1S1CA 5DO9A 5BWMA 2RGNC 4NKRA 4O25A 2IT1A 4DUGA 2YINC 4B33A 2FZ4A 2QP4A 4NCJA 1ESMA 3AV0B 4TTQA 4DEXA 5JSZA 3L8YA 3GJXC 3RHFA 5B58C 1NIJA 1U81A 1YZUA 4DZZA 2H5EA 2QE7D 2W0MA 1G1MA 3NEJA 3PUVA 2Q9AA 1KK0A 1IXZA 5A4JA 4QC2A 2NPIA 4NMMA 4Q1FA 4DLUA 4LK2A 2W6JD 3DDCA 1IJFA 2J59A 2OHFA 3BXZA 1VPLA 1OB5A 4Q18A 4JKIA 3VQTA 5TY0A 1T3HA 1YE8A 3K0CA 4PC7A 3V4FA 3I8SA 4O2RA 3ZDQA 4D2IA 1E3MA 4II7A 2DWOA 3V4RA 4B2PA 1IN5A 1JR3D 3MWKA 1LF5A 4PXAA 3TAHA 1BYIA 3F8TA 4LC0A 4LPSA 4QOSA 5C4GB 4YMVA 3SQWA 4BFVA 2FA9A 1OXSC 4Q4HA 2XSZA 2Q3MA 4PZYA 2X1VA 3EPLA 3MFYA 2QPTA 1NKTA 2CE7A 4HUQA 4TT3A 1VKJA 2ZS9A 1N6LA 2ZRCA 4C4PA 3EIEA 4G5SA 2ZI6A 3F5FA 4IDHA 2PMKA 4URUR 1CKEA 3ZS8A 2A30A 1OHHA 3TJZA 3KQLA 1E2EA 4M21A 4Z51A 4AURA 3FHTA 1YQTA 4JSTA 4GL2A 1D9XA 1VHTA 2J7KA 3FGNA 4R71A 4PZLA 3FKSD 1A1VA 3AKDA 1PLKA 2CL0X 3E1SA 1WXQA 3U6KA 1WP9A 2Z5FA 3BIFA 3QEJA 4ZKDA 4K81B 4LX0A 1GAJA 4DLRA 4RZUA 3FMIA 1U0LA 1ANKA 3RDPA 5IDVA 1XTJA 2EQBA 1N0WA 1P5ZB 1MR3F 1JQLB 3EZ7A 2ZJYA 1NIPA 1OJLA 1EFRA 4AYWA 3ZIAA 1RVDA 3D8BA 4M1TA 4M9XA 4WZ6A 3GLGA 5EJEA 4B74A 4RKFA 1EX6A 5G3YA 3U6BA 1S1MA 1J8MF 5A0FA 2RAPA 2ZRIA 1E2IA 3VX4A 3R9IA 4ZV4A 4JBXA 5LDDC 4PO9A 3BD9A 3NBYC 3CBQA 4NYJR 1OF1A 2VH5R 4KI0A 4F4IA 1KHTA 2AX4A 3FFBA 4I4LA 5HPYB 4NYMR 1OPXA 1NBME 1T4GA 5BN5A 4E07A 1L2TA 4EFMA 3ZQJA 3H0KA 2MMGA 3U5ZB 3WYGA 3SQXA 2IEYA 4L5BA 1GRNA 5JHGB 2ZAOA 5FR2A 2JIZD 2ZYTX 1P2VA 5F2EA 3NIBA 1UDXA 1ZM2A 5JS8A 1KI6B 1ZD8A 2G83A 1DAKA 4GFDA 3G5UA 4MGKR 1KDPA 2CNWD 5J40A 3OIUA 4LJAA 1O3YA 2QT0A 3THYB 3BH6A 5AK0A 4JLKA 1AGPA 3QKTA 1W4AA 2O8CA 4ASUA 5J5CA 1W4CA 1UKEA 2AXNA 4HDOB 5HZKA 2BM0A 4TMTA 2RGAA 5L3QA 3ND9A 1YJ5A 1AZTA 2FPLA 4RD4A 3O8CA 3FOZA 2W83A 4Q9JA 2ZE6A 1KNQA 2YC4C 2WWXA 1XPOA 1CJTC 2DFNA 1SGWA 2IS4A 1I4DD 1TMKA 2CEAA 1JNYA 3MLEA 2EFEB 5AJZA 4DKXA 2DHRA 3RC8A 4HB3A 1P61B 1W2HA 2GDJA 4ABYA 2VQSA 3X1ZA 1N25A 4IFEA 4NYMQ 5FBRB 4ZDWA 3W6OA 3RRMA 4MDFA 3A58B 5G41A 4P33A 2DY1A 4ZI2A 1G8HA 3CPJB 1XFAA 2W6ID 3O8DA 3NXSA 4AY2A 2KWIA 1QHNA 1R5NA 1RE0A 1U94A 4W7SA 4C0LA 1E9SA 4R98A 1ELOA 4IOLA 4DLXA 4GOKA 3TH5A 1AZSC 2YOGA 3CUEF 4KHZA 5GJCA 1LY1A 4GT1A 4JL5A 4Z1MD 4OBEA 4WA7A 1HQYE 1QHHB 4JL8A 3CF2A 1D5CA 3DZ8A 1N6HA 1CJMA 4ON9A 3QF7A 1KIMA 1XTKA 4YQFA 2W6IA 5KPDA 4LHVA 5L3QB 3REFA 3HYRA 2XXAA 3VU9A 2ERXA 1KI4A 1E9RA 1IM2A 3ONWA 2OEPA 2C78A 3SBEA 5DNYB 3ZJYA 3K70B 3KQHA 4NCIA 2GCOA 1IY1A 2NTYC 3C15C 5CK4A 2ZRGA 4YMTA 3FE2A 4Q19A 1XXHA 2QPOA 5EUMA 4HAWA 4YDHB 3VR4A 5JRZA 3K70C 4EIWA 4Q02A 2OILA 1YKSA 5A5GA 4FMDF 1QDEA 4RSGA 3I61A 4TLEA 4C30A 2IHBA 4L15A 3TK1A 5UKDA 3OIWA 2ONKA 2Z6VA 1DS6A 2HT1A 4G5OA 3QKRB 3BBPA 4KYUA 2UZ3A 2ODBA 3BB1A 3EZFA 3KKOA 2JLVA 4MYUA 2XNDD 1VCIA 1XD8A 4NP6A 3WRYC 3WHLA 3T34A 3MRSA 4BUJA 1ZNWA 4LHWA 1S4QA 2V7QD 3D6TB 2ZVPX 2ZM5A 1JPJA 1YZLA 5J4HA 1G4UR 1EGAA 4V0NA 3X1XA 3ZVRA 521PA 1W49A 1BKDR 4CYMA 1CBUA 5IK2D 4D80A 2GCOB 2EWWA 3LRPA 2AN9A 4JVSB 2OBNA 1VHLA 5SZIA 4ZDKA 2FX3A 4HAVA 3O8BA 4TYYA 4A6XA 121PA 2UVQA 1F2UB 3E70C 1N2CE 2BBWA 1XF9A 2ZRNA 3L43A 1II0A 2G1KA 5JZVA 2A2ZA 2IF0A 1GDDA 3AF1A 1P75A 4LYJA 1SKYE 2NZ8A 2R6DA 1KO1A 4Q4AB 1ODFA 1NI3A 2FH5B 3BJIC 3WP1B 1JXMA 3WXMA 4W5WA 4PHHA 4M4SA 1LF0A 2HF9A 2OBLA 1FUKA 1VYUA 4CEHB 4EJSB 2ZJ2A 2WWHA 3WYAA 3PUWA 3A1WA 4L9WA 5FPYA 4A0HA 5DIFA 3K9GA 2YWEA 3KQNA 1W44A 5JBQA 2O52A 1A2KC 2N42A 1GFIA 3IHLA 1UBFA 4PO8A 3I5XA 3K0SA 4O3MA 3DPUA 4PFSA 2GAOA 2F3RA 4JT2A 3RC3A 3QBTA 2I1VB 4I1SA 4M9SA 3QPVA 4F7WA 5LD2B 2OLJA 4G01B 3TQFA 3EPHA 1FQKA 1ZRHA 2Z4RA 1RC8A 2BEKA 2R44A 3UMFA 2E87A 2O8BA 4KV9A 1NF3A 4OHYA 4Q48A 1T3LA 3CNLA 4PTLA 2JEOA 5CDFA 4Q1DA 4B76A 5E3HA 5LD2C 3OEED 1DADA 1Q1QA 4X8OA 2XSZD 4I1OA 4DLSA 1W0KD 3QENA 5DGXA 3W90A 1A5TA 4TLCA 1Q1ZA 3QF4A 1SVIA 1XEWY 1XD2A 1OLOA 3I1FA 2F43B 1NG1A 1ZVQA 1SKYB 1HE1C 3TUJC 4AKHA 1FTSA 1XRJA 3BH0A 4XJXA 4BPBA 4MRVA 3W8RA 3GD7A 4CIDA 2AKAB 2WOJA 2WSMA 4CRWB 1UEJA 5EZ5A 4BGDA 4AYTA 1Z6XA 1VMAA 3K0CC 4IOMA 4RD3A 4JJZA 4RFSA 5IF9A 3ZYCA 1WBDA 1X6VA 3W6PA 3CRQA 3O8RA 2A9KA 4TWZA 4DLWA 2P6RA 3VR6A 1XD2B 2B21A 3CRMA 5FTLA 4XVQA 3IBYA 3SBDA 4QBFA 1Z06A 4D4JA 1Z0FA 4FCTA 1KDOA 3THXA 2BJVA 4FI3C 3U4QB 4HAUA 2WJJA 4DCSA 2ZSBA 2GBLC 4RCYA 4ITRC 1II8A 2QBYA 2FOLA 1ZD1A 4V0KA 2FSIA 2DFLA 4XSHA 1U0HC 3CF0A 4AKGA 4PR0A 4TTPA 2G88A 2QMEA 2IWHA 4XD7A 3GJ0A 1KZ7B 3C4JA 2ZU0C 2LCFA 1MABB 2YZ2A 1QHXA 3UANA 4B34A 2YWGA 3NBZC 1Q1BA 2FFBA 1UF9A 5GVSA 1U9IA 2B7BA 4QJ3A 1J90A 1OXXK 3QF4B 2QTHA 4UNSA 1D2MA 3ZIAD 5SZHB 4LSGA 5IRCD 4OYHA 2ASEA 5KHOC 1KKLA 1QHIA 1KY3A 2XITA 4US0R 2O8DA 1OW3B 1JBKA 2GF0A 4JSYA 2WJGA 5TARA 3UK6A 2BMJA 2TMKA 4GNKA 1Z08A 2QM7A 4B3BA 4V0ME 5LB2A 4BASA 3EC1A 2ZRJA 3LXRA 2DWQA 1G7TA 2ZE5A 1DOAA 4L4UA 3NC1C 2ANBA 2JLYA 2WVJA 1AS2A 1XWIA 2F1HA 3EC2A 2G0TA 4PAOA 4OQLA 3T15A 1XU4A 1Q21A 1RYFA 2ZRLA 1MABA 1OHHD 3AF0A 4WZAE 3LFUA 1SVWA 4XWKA 3EG5A 2AWOA 4DSTA 3QEOA 2ZI7A 1YHNA 1NSFA 1W36D 1AGRA 2HV8A 4BLPA 3TVDA 3PQCA 2BKUA 4NE2A 4WAUA 2JLXA 2FWRA 3Q5DA 1E2NA 1M8PA 2REXB 1P2TA 721PA 3SJCA 1R0ZA 3EPKA 1P60A 4MUAA 4IVPA 2C98A 2J3EA 2QUZA 2JDID 3Q85A 1EWRA 4JLBA 2XGJA 4AK9A 1MV5A 4TQAA 3QIAA 4RZ3A 1NVVQ 2Q0HA 5D3QA 1Y3AA 3X2SA 4LV6A 4PC3A 4IKEA 2FSHA 2VHTA 1ZD9A 4Q01A 3KX2A 2OXRA 4QG7A 4M2LA 1KI8A 2D06A 5KDDA 2O0HA 1X8KA 2YWHA 5KDOA 4KLNA 4MYCA 1U8YA 5FUWA 1G3UA 4EPTA 1G17A 1H8EA 4JL6A 3NDPA 3LV8A 4HLQB 4A2WA 5KNCA 1Z6GA 3LQRA 1RRGA 1Z6AA 4TYPA 3EZ6A 3BFXA 4JLAA 4IEEA 4KODA 3RWOA 3WP0A 3ZVMA 5F3WB 2H16A 3IILA 2KI5A 4YXWA 4Q4JB 2IYVA 1W5SA 4C9BA 3QXHA 2O8EB 1QHSA 2QA5A 2ZRHA 4UJ3A 4Q9HA 3T1QA 4D0NA 4CT4B 2BMDA 2CNWA 2HDNB 3B1YA 2QRNA 3ICEA 2J0UA 2AXPA 2O8BB 1NVVR 2YVUA 3QBVA 2RGGA 1OH8A 2CBZA 3THOA 2V6JA 2VPPA 1Z29A 4TMWA 2N1BA 5EE1A 4QHTA 1DAGA 2GBLA 2ZRAA 4NL4H 3R9XA 4TN1A 4Q4HB 2W2VA 1E94E 1XMIA 2R6FA 5BQ5A 4PC2A 3IO5A 4B47A 2FZLA 1R0YA 3CONA 1XX6A 4XH9B 3TVTA 4PANA 2HF8A 1AK2A 2GXAA 1XEXA 3HJNA 3X1YA 2E1RA 3K9NA 4FWIB 4R9UC 2JLWA 1IHUA 4Q7MB 2IW3A 1LFDB 2WV9A 3EAQA 2NMVA 1L4UA 4L16A 4C0QC 1E6CA 1ZBDA 4H1UA 2BC9A 2CLDX 2G6BA 1FP7A 4KBGA 4PZZA 3GFTA 1E0SA 4QXAA 4ARZB 1C9KA 1G5TA 2RH5A 4TYQA 1KY2A 4C7OA 4IOKA 4DSNA 3ADBA 4KFUA 3SS8A 2ATVA 1JEEA 4MRNA 4OL0A 3WMFA 2GZAA 1KK2A 4DEYA 3TLXA 1XMVA 2NIPA 5CK5A 4RY2A 3MWYW 1ZIOA 1OV4A 2QQ0A 3RRNA 4H1VA 1C1YA 2BBTA 4QGAA 3SNHA 2CLCX 1TU3A 2BOVA 3X1WA 4YMUA 4LV5B 3U4QA 2CJWB 4FWTA 4LGMA 2FDCA 4LHXA 4Q4JA 4M1WA 4BE7B 3U2QA 4DT1A 2AWNA 3IIJA 4D26A 3DHWC 2OFWA 1W46A 1AM4D 1Z2AA 2VHUA 1KO4A 2OT3B 1E1RA 1KZGB 5AUPB 1YU9A 4DLVA 2OSBA 1KI1A 5H70A 1N6PA 2Q9BA 3Q7PA 4RFSB 3OHMA 1YR8A 5FUXA 4ACBA 3RABA 2QL6A 4PHTA 5KOYA 1SQ5A 2QSYA 1GRQA 2OLKA 3ETLA 3EXAA 4GPTA 4JLDA 4LJ5A 4TL7A 4TL9A 3R7WA 5HKKD 3QVVA 1EESA 1R4AA 2WIAA 3GLFA 2G77B 2CHVA 3LO5A 1M34E 2PMDA 1N6IA 1CRQA 2J9RA 1UADA 4FMBB 4CT5A 1Z6TA 5HE8A 1K6MA 4TMZA 5EXTA 2QSZA 4OI4A 3A8TA 3FDIA 4HLDA 3LLMA 4UNRA 5JMTA 4DDVA 1OE0A 1XTQA 4JKYA 4JJKA 1JJVA 2R6CA 1XCPA 3OE7D 4O2LA 3UG6A 1PVOA 3VKHA 5EZ6B 3IIMA 1PLJA 2GA8A 4LV8B 2IF2A 3W34A 5E7JA 2WJIA 4MGZR 5AWFC 2VEDA 2C8VA 4MGIR 2LKDA 1GVNB 3KXKA 1GKYA 3CX6A 2RGNA 2ZS7A 2ZVQX 1TQ2A 2FJUA 1J8YF 1TEXA 4KFRA 4LJ7A 3LVRE 2D4HA 4QBIA 1UBCA 2XOKD 1R8SA 4KYIB 1CULC 1HYQA 5ELXA 4A0FA 1N5KA 3AEZA 4BZQA 5E7MA 2FG5A 3QY0A 3PFIA 5KO2A 3Q9LA 1XZPA 1E69A 1I2DA 2WJVA 2WMNB 3NG1A 2ZSAA 1NVWQ 4NYIR 5CJ2A 3A1UA 3BAFA 1R7RA 3H86A 3T1VA 1D9ZA 1KTVA 4ZCIA 1H8ED 4CZ2A 1E2QA 3IPYA 4Z8XA 3AVPA 1OYWA 3AF3A 2QEQA 3MCAA 2GAAA 3UMSA 1ZM3A 5DN6D 4DLTA 1KSHA 3JVVA 4QJ4A 4FMDB 3T5GA 4Q5IA 5LBIA 1X1SA 3E5HA 2P3SA 3V9PA 3QVUA 4IXMA 2XTMA 1ZNYA 2IUTA 2EW1A 3F0TA 3QNUA 4FCWA 4M1MA 1U99A 2CE2X 1OYYA 3D7MA 1NBMA 2AHOA 4Z8YA 1Q12A 1E1QD 4EPRA 1IN7A 821PA 1E2GA 3VKWA 3GJ4A 4DHEA 5JJKA 2P6UA 1I4TD 3CNOA 2XTZA 5JWRA 3KUDA 5JS7A 3U7GA 3IHWA 3T06B 2O8EA 1U90A 2GZHA 4IVQA 3SHWA 2J5XA 1ZAKA 5DI3B 3JVUA 5M04A 3KKPA 4HLCA 3U61B 5J4LA 2B8WA 2IYSA 1UDWA 2YOHA 4HATA 3ICQB 4YMWA 4IDOA 5EXSA 2QAGA 3ZS9A 4PSKA 3GLHB 5ANRB 4X8MA 3ADDA 1X8JA 3Q72A 4BZPA 4KVAA 2IK8A 2NO1A 4V0LA 2DBYA 3RS0A 2Q3FA 1N6OA 2WHXA 4DLYA 3BRWD 3PUXA 1TQ6A 4TMXA 5TV2A 1TEVA 2C9OA 2YKGA 4YLGA 1G8PA 2C96A 5FOVA 4BRWA 1W2GA 1CTQA 3LH5A 2QMOA 3UXMA 4EFLA 2WBLC 4EQ6B 2W6JA 4ASUD 3EIQA 1GOTA 4YMSA 1IONA 2WAYA 2ZYVX 1WQ1R 3SOPA 3I32A 3KJEA 4XIGS 5FUVA 1NLYA 2EU8A 4QBGB 2VO1A 4OI2A 2FFAA 1AS3A 4QNRA 1MH1A 2X8AA 3B60A 2JLSA 5BN4A 1HV8A 1BYUA 2ZR0A 1MRNA 3M6AA 2GXSA 2GCPA 4P32A 4E03A 1T0JB 1R10A 4WZBE 1ZC3A 2BMFA 2MMCA 5CITA 1AKEA 3GPLA 2Z4SA 1ZU4A 4UKDA 5EE5B 1SXJE 1G18A 4D82A 3N70A 4P4UA 1WE2A 1AJEA 2HXSA 2OCBA 2ODNA 4X8LA 2W58A 3MMPA 4CW7A 3FHCB 1XXHB 1YR7A 1T5LA 2C9CA 4Q7JB 1OIVA 2QN6A 2OBMA 4Z1MA 3TSZA 2F1RA 2J87A 3PENA 1D6JA 1I2MA 5DE3A 3WYFA 2VRWA 2FE4A 1G9XA 2AK3A 4GZLA 2IYQA 3FFAA 1P7CA 4JLNA 4IJMA 4JVNA 5AUQA 4AD8A 1T0HB 1Z28A 4URVR 1TX4B 2RHDA 4Q9LA 5FBWB 2XXAB 2BDTA 2ZJ5A 3PITA 1SZPA 4IFBA 5CYOA 5DN6A 4A9AA 1GKUB 2FN4A 2FFHA 1RZ3A 3WBKA 4M0LA 2XNSA 2O8DB 4PPFA 3U3OA 1DELA 1S8FA 5L3RA 2V8OA 3W9YA 2PLFA 3OAAD 1DAHA 1E4VA 3GJ6A 3SN6A 5GJWC 4P3YA 2PL3A 2ZJZA 4OK5A 4BFSA 3CPEA 4GRAA 5L3VA 1E2LA 3EPJA 1GUAA 4F4CA 1SXJD 1QVRA 3F3YA 5C4MA 1XPUA 3IBGA 4DCVA 2WWFA 2IC5A 2HEIA 1BS1A 3PEWA 1YZKA 1E32A 1NVUQ 2A5YB 1JQJC 4UXJA 2JJ1D 1G6OA 2QMUA 2ECKA 5JEDA 4DIDA 1IJEA 4Y0AA 4MYTA 3WMEA 1JAIA 3FWYA 4TSFD 3QJYA 2REBA 4F91B 1MT0A 4KVGA 3ZVLA 3TE6A 4MA4A 4B32A 4NCHA 4A8JA 4A0RA 3DKVA 3WBJA 5H8WA 5EQTA 4Q9IA 5FPTA 2Q9CA 3B5JA 5C2JB 1KJZA 1UBGA 2V3CC 4MUBA 3W8NA 2GJKA 2XZOA 3GLIA 1FW6A 3IEUA 3K0EA 2WKPA 2QAGC 1R8QA 3JZAA 3ZLJA 2ZRDA 3MAAC 2YHSA 4KSCA 4UNQA 3S1AB 2QY9A 2O0JA 5H1YA 2YYZA 3S1AA 5DYIA 4RD2A 3EWSA 4JBWA 2IXGA 2CMKA 3LDAA 5FL7A 1UFQA 1Z0AA 2GXUA 4ZCMA 1M7BA 2QP3A 2WOOA 1WMSA 1Z3IX 3TMKA 5JI3E 1S96A 1SXJC 2GK7A 2EFGA 4DB2A 5KU1A 2ZU6A 1BH2A 2IYLD 2R6GA 3KL4A 1CJVC 1VDZA 1W5TA 1COWA 2Z43A 4GZMA 1TADA 1G3IA 2FGKA 4ZCLA 4RVCA 1QHHA 2ZSFA 2ZRFA 3IIKA 2JLUA 2BCJQ 2ZITA 4PHFA 1U8ZA 1R0XA 4BFZA 2FSFA 2ZS8A 1EX7A 1Z5ZA 2PJZA 4IDPA 1YZGA 4KBFA 3RS7A 3AUXA 4HLUA 4B43A 2ZRKA 4BLTA 4JIMA 1US8B 1OT3A 3G82C 3AF2A 5GJVC 1G7CA 4E09A 1D2EA 1OB2A 2VP2A 1VTKA 2VF7A 4JLPA 2QAGB 1GL9B 3AKEA 2ZJAA 1A4RA 3B1WA 2ZANA 4JYBA 3PJRA 2OV2A 4QGGA 4YONB 2CCJA 1UKVY 4MRRA 2QM8A 5TVKA 1KAOA 3IQXA 1FZQA 4P4TA 1X3SA 1G291 1VCOA 3HU2A 3DOFA 2IYRA 4IOJA 2GXQA 3IQWA 1NP6A 2GHIA 2HLDD 5CIQA 3BB4A 5K8UA 2KE5A 5L8VA 4P31A 1L7VC 2ZR7A 3MD0A 2A5JA 2VL7A 3NH9A 3NTUA 4JVMA 1G8GA 2GTPA 4Q1AA 5JEEA 3LW7A 2A5GA 1F2TB 2ATXA 2BCGY 2ZREA 5AR1A 3JZMA 4URWR 1IN6A 1GSIA 1N0UA 1P6XA 4BFUA 3RNLA 2ZE7A 1P9RA 5DHFA 2D7CA 1VG1A 1Q3HA 4LWZA 1DAFA 3CF6R 1XEXB 1RRCA 4F4JA 1D8TA 1XEFA 1ZNZA 3BFVA 3CZQA 3RSLA 5FPKA 4D0GA 4KSBA 3AVXA 1UEIA 2F9MA 5FOSA 1VG0B 2C5LA 3PIRA 4N0EA 2HUPA 3B8HA 2KJQA 2IL1A 2ZRMA 3AKYA 4PHGA 3VAAA 1CR2A 1E2KA 1M74A 4G3XA 3UATA 4MRSA 4LC1A 4QL3A 4TTRA 2P5SA 2W2TA 4UJ5A 1AQUA 3KKMA 1DG1G 4KCGA 1FNNA 2XTNA 4ZDIA 5AJXA 1GNPA 2QMHA 4ESVA 3EZ2A 2Q21A 3C7KA 1XPRA 1MOZA 4KJZA 2ZSEA 4Q7LA 3PEUA 4EPVA 1CJKC 3UG7A 1ETUA 3NHAA 2AR7A 2EYUA 2NZJA 4I1VA 4DCTA 5E4FA 1XJ0A 5JFGA 1OFTA 3K09C 4IVRA 2EVWX 1Z2CA 4RCZA 4U00A 2QNRA 3QXJA 1WCV1 3DVLA 2ERYA 5DLQC 5JCZA 4ZKEA 1AN0A 4R2HA 3ZVNA 4PO1A 1OFUX 1R2QA 4FINA 3FKSA 4ERNA 2IYUA 5KDLA 2C03A 2CJWA 3FTQA 2JATA 5JCPA 1E9DA 4UNNA 1JR3E 4CVNA 2WPDD 3BS4A 1R0WA 2P67A 5AJYA 3W3ZB 2ORWA 4C0AC 5DYGA 3SFVA 5FOUA 4EUNA 2DYKA 1IN4A 3ZZ0A 2VP5A 3PG5A 1Z83A 1TAGA 3T12A 2PEYA 2VP4A 3P1JA 4DVGA 3HPRA 4FCVA 2X19A 4AWXA 3OEHD 3GJ5A 4G5GA 4BFTA 5C18A 5DHAA 2WAXA 1M7GA 2Q3HA 4LPKA 2BIFA 4OJQA 3ZD6A 2D74A 5TDHA 2H17A 1OFIA 1KKMA 1F5NA 4POAA 2ZI3A 1ZNXA 1W0JD 4LJYA 4OI1A 4XWOA 4JT4A 2IA5A 1SVSA 3QG1A 2RGXA 3BFKA 5KSYA 4M9ZA 1GG2A 2G9NA 2X77A 4MRPA 2VBCA 4XSGA 3HYTA 4PSVA 1U8AA 5IHPA 4LBZA 3AVVA 5HZHA 4EKDA 4OHVA 4QNMA 4PAMA 3TBKA 4WBSA 2D7DA 1ZYUA 1E79D 2D2FA 3O47A 4NZYA 1Z8FA 2VHQA 2BHRA 1E9BA 5FR1A 3ASZA 5D3MA 2B8TA 1P62B 1KO5A 1GM5A 3DZDA 2PCLA 1FX0B 1GNRA 1RIFA 2ZUBA 2OAP1 3SZRA 2VHJA 3CR7A 2ZETA 1OIWA 4M9QA 4Y0VA 1G7RA 1ZIPA 1TUEA 4LBVA 3ADCA 4LHZA 5FOTA 3B85A 4RFVA 4KLZA 4AC9A 2O8CB 1F2UA 4GMDA 5AJVB 1S2MA 1G6HA 3QKSA 3BERA 4TT3D 3A1SA 2QPAA 3ASYA 2G0NA 4X8HA 3CH4B 1KK1A 1Q44A 2A78A 2OG2A 3KXLA 1JAHA 1GP2A 3R7WB 4B6EA 3IO3A 1P4SA 3KZ1E 4G5QA 3MG9A 4JBYA 1Z22A 4WXRA 1CR1A 4BZXA 2GVDC 1DPFA 1GITA 1NY5A 1F60A 5CJPA 3DOEA 3LNCA 5BW8A 3RVBA 2FFQA 2H1LA 1P9WA 3C41J 1CIPA 3ZD7A 1KMQA 4EPYA 2PEZA 1DG3A 1OSNA 4S2EA 5B57C 3AVYA 4RJLA 4TYNA 4LJ8A 2YNMA 1KMHB 1N5LA 3NWJA 2VHCA 1F3OA 4QGHA 1E2PA 1VIYA 4OHZA 4GMXA 1IAQA 3LBIA 1CJUC 1TF2A 4HYYA 3T35A 5JECA 5JHHB 1T5IA 2QT1A 4G0NA 4URYR 3Q5EA 1F6BA 3EA5A 3CRVA 2IS2A 1XJCA 1XTSA 4PQFA 1T8UA 2ZYUX 3I62A 3DMDA 3U7EB 4A8JB 2IS6A 3FYHA 2IYXA 4TMKA 1JECA 1UM8A 2KB0A 1TNDA 2HYIC 3P32A 1ZUNB 4MKGA 2D3WA 3TIFA 3B2EA 4CGZA 4LBWA 1E2FA 1X86B 1ONBA 1G3MA 2PCJA 4EFNA 3QPUA 2ZROA 4FD2A 4HB0A 5HR5A 5CLQA 1CR0A 4Q4AA 1NBMD 2DFTA 1Q57A 2QRZA 5FTNA 2NO6A 3M1IA 2C2HA 3VNUA 4D4LA 3AP1A 1IXRC 1KGDA 1V43A 3MSXA 2GJSA 1JB1A 1EFRD 4IW3B 3PV0A 2WKRA 4OHWA 4GSYA 2J7PA 1CP2A 1J7KA 3A4MA 4HAXA 1ZUIA 5FFMA 3HU1A 5B64A 3AVQA 2AL7A 5H68A 1HURA 4EJSA 4M1SA 1NJGA 2PBRA 1XDBA 2QP9X 1E79A 3SYKA 3U60B 2FMXA 1LVGA 1SULA 2HYDA 5TMPA 3AGQA 2WIBA 2CXXA 2PT7A 3FVQA 5EE9A 5FOWA 4IHQA 3B6EA 4FMCF 3OFNA 3C14C 1Z0KA 1ZP6A 1KOFA 3OEEA 1XZQA 4LJ6A 3NBXX 1TTTA 2AFHE 2L0XA 2UZIR 1KI3A 3EW9A 1Q1EA 2HCBA 1TF7A 3NC0C 2BM1A 3I5YA 3AVWA 5FPSA 4ILEA 3GJ7A 1US8A 3GLIE 1L4YA 5FI1B 5HCIA 1HA3A 1KI6A 2ZRPA 1E98A 3GLGB 4LDJA 2GZDA 2H92A 4ZPXA 4PPGA 1W36C 1VIAA 3H1TA 2ZI9A 4ZDJA 3P20A 3DKPA 5EE3A 4HZUB 3TW8B 3BOSA 1DE0A 5FUYA 1OH5A 1KI2A 4TZ6A 3PXGA 1VECA 1GTVA 2HXYA 1WA5A 3I3SR 1XB2A 4KAXA 4RD6A 1Z6YA 2JLRA 4AYXA 1KO8A 3QKUA 5C1BA 3LX5A 3REGA 1YR6A 5E95A 1NY6A 4RKEA 3VU9B 4JZKA 2ORVA 5FTKA 3RANA 5K8LA 1S3SA 1SVLA 4TQUS 5CLLA 3SR0A 3B9QA 2FF7A 2ZIAA 1HT1E 1IBRA 3CWZA 5KTYA 3QG5A 1QHYA 3DMNA 4MQBA 4PC1A 3VNVA 3B9PA 4GP6A 1J70A 2NOAA 3VTKA 1ZM9A 2W00A 1FL9A 3HR8A 4GOXA 3TSWA 2P0EA 4WIAA 1WF3A 4DCUA 4JYCA 3W6NA 1F2TA 4LYHA 2YV5A 4M8NE 1JPNA 3OESA 2NPFA 4YC7A 4ARZA 5EP4A 1NVXQ 3BWDD 1K5GA 2H18A 1Z47A 2ANCA 2IYZA 2V7QA 1G64A 3B78A 2OZEA 2ZE8A 1G4AE 4NTZA 4TLDA 3T1OA 3K9HA 3PEYA 1LS6A 1HQCA 4B3FX 3RS5A 2YOFA 4UQOA 3QE0A 5KSZA 3U7FB 4Q7KA 1FMLA 2VSFA 2RCNA 4R2IA 1HE8B 5FI0B 1EFHA 1JXOA 2D2EA 2ZQ5A 2RGDA 2CLSA 4QGFA 5GADl 1XP8A 3IEVA 3FMOB 4I1UA 3EX7C 4QHYA 1B0UA 1NN0A 1UKYA 1ESNA 2RB4A 2HT6A 3HDTA 1Q0UA 2J7PD 4A2PA 4LJ4A 2O5VA 1E0JA 1J99A 2B92A 5L3SB 3OIVA 3GLHE 4D4MA 2CK3D 3QPWA 2HLDA 1TF5A 2WWGA 4BQSA 1U9IC 3CZPA 4A82A 4E5UA 3OAAA 5JSZB 1EFUA 3NEYA 2J0UB 1JEDA 2F9LA 3R20A 4PQYA 3A6PC 4TLAA 3PUYA 1TPZA 2AD5A 1IOZA 4B3CA 4PQRA 2XZPA 3GEIA 1DVRA 3CW2A 2CHGA 3LY5A 5IT5A 5K8IA 4C0SA 2PZGA 4DLZA 4MITA 2J41A 3THYA 1IY0A 3BH7A 4XD7D 3VKGA 1HT2E 4FN5A 2QU8A 2OFXA 1LNZA 2KSQA 1NN3A 1AIPA 4HEJA 3GLFB 3VR1A 1OXVA 1W0JA 4JMPA 5IK2A 2OM2A 4UXIA 5JWHA 3LAWA 3IKJA 2CL7X 3UWKA 1T3SA 2XB4A 5EXXA 3B1XA 4QBHA 1II9A 4GI7A 2WMOB 1XBTA 1ZUHA 2OXCA 3OEHA 4F92B 3KUCA 1SHZA 5TXGA 1CF4A 3VR5A 1KMHA 1GKIA 4C0KA 2CVHA 3ECCA 2IUUA 4KFSA 2DR3A 3AB3A 3D31A 2XNDA 1H8HD 1DAEA 3TSOA 4FXPA 1FFHA 2XEXA 3EASA 3FKQA 1FP6A 2ZYWX 2UKDA 4C0BA 1EG7A 2IXFA 3GJ3A 4HDCA 2PX0A 3M4YA 4Q1CA 3K0AA 3ZGXA 2F55A 2X2FA 2RMKA 1JR3A 5HKKA 4QM7A 4K8OA 4CEJB 2V1UA 4OK6A 4URZR 4JS0A 4GOJA 2CL6X 1YVDA 5CB8A 2J0QA 4DIEA 4OKSA 2QG6A 2B7CA 2C77A 1S3GA 2GEVA 1CLUA 3J81k 4DCNA 3QKSB 1E2JA 1NSTA 3EA0A 3U3JA 4DDUA 1RPZA 4KFTA 3QXCA 4BFXA 4V02A 2CHQA 3CX8A 3TAUA 4K46A 1TU4A 2MSCB 3SU8A 1KSFX 3QI2A 2KBEA 2NO7A 3OIYA 4LI0A 2BBOA 2GRJA 2JCSA 4B3XA 1R5OA 4QFMA 1Z0IA 1N6KA 2F3TA 4MDEA 3B82A 2G1JA 2BBSA 1XEWX 2IWRA 3U44B 2QZ4A 3CRRA 1KJWA 5CB6A 4ZIRB 4NHOA 4NCKA 5JWOA 2R62A 2GILA 3B7GA 3MWLA 4RD1A 5TB5A 2A7QA 4HDQB 2NO0A 1GL7A 1N5JA 1XNJA 2V9PA 2W0SA 3P4XA 4CEIB 4TL6A 5DI9A 3SYLA 4DSOA 2C9YA 3AUYA 4N3NA 2ZR9A 3QUSA 3W3AA 1W47A 4ESHA 1QZXA 2MSEB 3L2OB 4PPQA 5CYPA 4NDZA 3FB4A 1DAMA 1G5PA 1SKQA 3CR8A 3SHFA 1Z0DA 4M1OA 5JI2E 4BLQA 3K70D 4IDNA 2GJ9A 1Q20A 5AJWA 1WB9A 4DDTA 3K9LA 1E2DA 5G3ZA 5JRJA 4KITB 2J46A 1TUIA 1FOEB 2QENA 2VF8A 5FBQB 3U3MA 4EPXA 4HUTA 3VHXA 1IQPA 1E9EA 1EXMA 2ZJ8A 1YR9A 2VP6A 3KJIA 3U7HB 2FV8A 2GVZC 1FUUA 2P5TB 3UPUA 2BMEA 3SI7A 1LV7A 4A8JC 1DBSA 4H9GA 1KI7A 1W4BA 2FSGA 1KO7A 2BKEA 2V4ZA 4U5XA 4XVUA 2VSXA 5KSOA 2JLQA 1UKZA 3LBNA 1M2OB 1E96A 2R2AA 1W1WA 4NPHA 4L8GA 3THXB 1WDTA 2C95A 1RFLA 4F93B 1SVMA 1ZMXA 2BVNA 3GP8A 1W7AA 2OAQ1 4LCBA 3A4NA 3KTAB 3SFZA 4MYHA 4HSEA 3ADKA 3THWA 2NG1A 3SYNA 1CXZA 4RD0A 5FBLB 2SHKA 1AQYA 3K53A 1OKKD 2ZTSA 1S9DA 3MGCA 4LZZA 2FGJA 2GEDA 3RS4A 2PZEA 2WSSD 4C0JA 2OCPA 1DO0A 1U98A 3AQ4A 1R5BA 2ZEJA 4A36A 1N6NA 1XCGB 3UMRA 3CIOA 3TR0A 4EJSC 2ODEA 3H4MA 1KAGA 2GESA 3ZZTA 4TZ0A 3L0IB 3C5CA 3C8UA 4D81A 4I99A 1P73A 5K8TA 1MO6A 2WWWA 1A2BA 3KQUA 4TMVA 2CCKA 4XTCS 2PJRA 1G7SA 1T9HA 4GDFA 3AGPA 2XJ4A 4TLBA 1MO3A 5F9HA 2BWJA 1CS4C 2GF9A 1NLZA 2A3RA 5HE9A 4A4DA 3FPAA 3KJGA 1CRPA 3CRW1 1NL3A 2ORIA 4BLRA 3V00A 1ZM4A 5FBVB 3FMPB 1G20E 2R8RA 3BC1A 3DM9B 2WM9B 3L82B 2WJHA 1Z07A 2RGBA 4LYAA 3E2IA 2E9SA 2RKOA 1G41A 3GLGE 3U3RA 3C5HA 1OXUA 4Q1BA 5FL3A 4C0HA 3R9WA 2PT5A 4E22A 2K5UA 1ZC4A 2IYWA 2ZI4A 3A36A 3D3QA 3KFXA 3LA6A 4LY6A 4BWYA 4CF7A 4C7OB 4WVFA 3L0OA 2J0SA 1NG9A 2PH1A 3G0HA 2JJ2D 3QOFA 3GQBA 3TKLA 1P72A 3RS2A 3X1DA 5GJBA 3BORA 4BEBA 2P65A 4O0MA 4EPWA 1LTQA 1PUJA 2ZXUA 1ZW6A 2ZJBA 2PX3A 4M53A 3IUYA 2VIIA 1G3QA 4QKQA 1PZNA 3TR5A 3HWSA 4WW0A 4D25A 4Q66C 3TUZC 3RWMB 5JJLA 2JGNA 5SZJA 1MKYA 4MGYR 3UKDA 2CK3A 4Q21A 1RRPA 1XMSA 4DB4A 4QHSA 1S0UA 1SXJA 4PX9A 3KFVA 4IDQA 4LOAA 3C16C 1UPTA 1DEKA 1MRSA 3SJZA 1OIXA 2H7VA 1S9HA 1NLFA 3QKRA 3LBHA 2GWHA 1YZQA 1MO4A 3CM0A 3AP2A 1Z63A 1G21E 2JJ2A 3GLFE 5DH9A 3AVUA 1BMFD 3EARA 3NKVA 1LS1A 4LYFA 1JR6A 5J4YA 2C04A 3TGPA 1D2NA 2JLZA 4JVLA 4UXHA 1FMJA 1LW7A 4M1YA 5AUNB 1M1YE 2Z0MA 3K0AB 4HLUC 1COWD 3Q3JB 4KO8A 1SVKA 5EP1A 5HCNA 4B2LA 3BB3A 2OCYC 1M7HA 1UAAA 5LPNA 1NMZA 3GEEA 2IUSA 1ZU5A 2KBFA 4A1FA 4MKIA 1N5IA 5J4KA 2G3YA 1P2SA 4HZUA 2DFKB 2XJ9A 3U3KA 4PPNA 4G1UC 1KSGA 1NKSA 1DO2A 3K8YA 3GJ8A 1VCNA 3EWAA 4URXR 1T6NA 4GP7A 2XX3A 3LD9A 3I8XA 3L0PA 4N0DA 4JLOA 1N6RA 2ZAMA 4DSUA 2JJ1A 5EXPA 1Z0JA 2WWYA 5C46F 5FL7D 2EFHB 1IXSB 4DUGD 1KK3A 4B3GA 2CDNA 1PJRA 4P4SB 2O0KA 4US2R 1BO6A 1U0JA 1SXJB 2JJ8A 2HJGA 1VYTA 3NHBA 4ZO4A 4DT1B 3RRYA 1AA9A 3SE0A 1W4RA 1GNQA 4B75A 2FEMA 1RYHA 1W0KA 4J0QA 3H84A 1ZCBA 2ZSDA 2BJWA 2BEJA 1Y63A 2H8KA 1XXHE 3GFOA 1BIFA 3NVAA 5F9FA 1KI9A 5BXQC 4Z54A 1VYVA 2I1QA 2R6AA 1EK0A 1IN8A 3R8CA 4OHXA 2W2XA 1DARA 4HUQB 4OQNA 4W5HA 5KNDA 3B1ZA 4WOPA 1T91A 2WPDA 2D62A 5JJIA 2HCJB 421PA 2FU5C 4A0GA 2O8FB 2DWPA 1XD9A 1SVOA 5KUTA 3ZH9B 3RLFA 2P2LA 2WJYA 5JLJA 2EFCB 4AG6A 1O87A 2IHYA 1NNEA 3AF4A 1TQDA 2VP9A 2V1XA 4M22A 3K1JA 3SDZA 3KJHA 1EFCA 1RJ9B 3U44A 4PAQA 2ODWA 1II8B 3DM5A 2QBYB 2VLIA 3UWOA 4BLOA 4MKFA 3QXXA 1NRJB 1E4YA 1FQJA 2GK6A 5BYKA 4Q4LA 3ZQ6A 3K0FA 1VCMA 2QTFA 1HTWA 3QXSA 3L8ZA 5G53C 4ZI3A 3EZ9A 1E9CA 3W5IA 5KSPA 1AS0A 5FTMA 4B73A 3HP1A 3KTAA 2OO7A 4OQMA 3VFDA 4JLMA 1XTIA 4BEJA 2VTKA 1AKYA 3T61A 3Q8XB 4NH0A 2GNOA 4A92A 1E0AA 3M0EA 4ACAA 2Z83A 6Q21A 1QF9A 3RSOA 2GCNA 1TQ4A 1GL6A 4DBLC 3T5DA 4CEJA 5GVRA 1BOFA 1P2UA 1RKBA 1E2HA 4S35A 4US1R 3DO6A 3LX8A 2XAUA 2XOKA 4Q00A 3WMGA 4N1AA 3TW4A 5SZKB 3BGWA 3VR3A 2YC2C 3GLIB 4AG5A 3NDBB 4KU4A 1E2MA 2FNAA 1Q3TA 2AD1A 1E99A 2OCAA 2FPKA 2J0VA 4LRWA 3VR2A 5DSZA 4JLJA 1A82A 2QORA 4DWJA 2HJVA 3PR1A 1ZCAA 4TSFA 1E0KA 1KYIA 4MH0R 3QQ5A 4IEIA 3NBFA 2QQEA 3FHOA 3OE7A 1HUQA 3K0FB 1QRAA 3IGFA 1G8YA 3TRFA 3RAPR 2V54A 4BECA 4OI0A 4D4KA 2PZFA 5J4VA 4EQ6A 1VG9B 1GIAA 4IXNA 3TUIC 2V55B 1GILA 1UBEA 1RJ9A 5CDFE 5D3MB 3GEHA 1GZSA 2IYTA 1HH4A 1QG4A 2REOA 5HTKA 1JI0A 3AKCA 1E1QA 2WTUA 3KB2A 4OK3A 4CEIA 3LLUA 4QM6A 2JIZA 4DRZA 2OUKA 4HB2A 3SC3A 1U2RA 5KNBA 3MJRA 1T8TA 1X8LA 5DI3A 4DXAA 3RS3A 4F38A 3AM1A 4LHYA 2IX3A 3CKLA 2RGEA 4V03A 1HY3A 8OHMA 1H8HA 4HB4A 3KB1A 4D0LB 4D6PA 3AH8A 5J47A 3SJBA 4V0OA 3CX7A 4W5JA 3OZXA 3KKQA 4TL8A 1P3JA 5CM9C 3FMFA 3I72A 1LB1B 5CM8B 1E1RD 4YDSA 2GJ8A 3LVQE 4OQXA 4BRUA 4A2QA 4NYIQ 1X1RA 5EUQB 1QBKC 1V5WA 4P4SA 4GBMA 1NJFA 3WNDA 2F6RA 4MKHA 3N2EA 3P4YA 5L3SA 1HEIA 2F1IA 4A6PA 4C3ZA 2Y8EA 4YXWD 2ONJA 1CR4A 2AKYA 2OE2A 3GCGA 2GKSA 4B6FA 4U7DA 1E9AA 3I92A 3MWJA 4AKEA 1KDRA 4ZIRA 4BFWA 1R6BX 2QROA 5EP2A 3WNCA 4QJ5A 2OFOA 2EYQA 3PCRB 1YZNA 1JJ7A 1TL7C 4KXFB 3GMTA 3TNFA 1N3BA 1XCMA 4PC6A 4HAYA 1FPMA 2C99A 3LWNA 1H65A 1XMJA 1Q22A 2WSSA 3I4LA 2N46A 1DAIA 4DC9A 2LKCA 1PLLA 3THWB 1ZINA 2FPMA 2F7SA 2ZPTX 3CO5A 2IXEA 4DJTA 2DB3A 1ZM7A 3HR7A 4B48A 5BYJA 1NN1A 2RGCA 3A1TA 5F98A 4IRUB 2JDIA 4P0TA 4B2IA 2MSDB 2ZRBA 4NONA 5FPHA 1P9NA 3WY9A 1DTSA 2AFIE 3TQCA 5KPJA 2EFDB 3KXIA 1G5RA 1OKKA 4V0MA 4B44A 5FTJA 2I4IA 3AVOA 3PEVA 4EAQA 3LXXA 5FOXA 1L8QA 2QI9C 2I3BA 4B3DA 1G19A 2ZUDA 4FIDA 4HZIA 3GLHA 3N5CA 1N0VC 4M1KA 4B71A 2XB2A 2B6HA 3MJHA 3Q7QA 4XTRA 2DCUA 1OFHA 221PA 2VYFA 3OFND 2EWVA 3A1VA 1WBBA 1XJQA 1VG8A 2A5DA 2JAQA 2YJTD 2ZJOA 3DL0A 1F48A 3DEFA 3H2YA 1YRAA 4RZ2A 2WWIA 4Q47A 1FX0A 2JASA 2NGRA 3QSYA 3WRXC 3P26A 2GETA 1QG2A 3B1VA 1EFTA 5B2ZA 2NQ2C 3B13B 2WICA 5AUOB 3R8FA 1QHGA 1M6NA 4L9SA 1W36B 4NBSA 1C4OA 2QAJA 3K09A 4UNPA 2O8FA 3HU3A 4NU0A 1UJ2A 4TQ9A 2JA1A 4Q9KA 1GWNA 1A7JA 2R65A 4R7ZA 3LW8A 3RRZA 3AP3A 1QVAA 4AIIA 2GEUA 1NMXA 3N2IA 5FH9A 1OXTA 3MUFA 2VSOA 2H57A 3GFPA 5CIWA 3CLVA 2OESA 2P6NA 3SEAA 3VX3A 2QGZA 4Q1EA 1MO5A 5EP3A 3ND8A 4W9MC 4XOIA 4G5RA 2IS1A 2J1LA 4QRHA 4WXPA 1BMFA 2IYYA 3CH5A 1EWQA 3NH6A 4LUCA 2FEOA 1RRFA 4OQFA 1YRBA 4AKIA 2IEZA 2V6IA 4XWAA 1RW4A 1G3RA 5DISB 1CU1A 3CB4A 4CEHA 4XVRA 4HI0E 3KDSE 3T1TA 1J2JA 1K5DA 2RHMA 621PA 3BE4A 5P21A 2LWIA 4FW9A 4NCNA 3IPXA 4BFYA 1PUIA 4I81A 3A37A 1I4LD 3KKNA 4PSAA 4U02A 5LB4A 3BK7A 2Q6TA 3L0SA 4LJ9A 3CNNA 4HAZA 2XZLA 1JALA 1W48A 1YZTA 5E7IA 3EIHA 4LBYA 1K8RA 1ZJ6A 5G40A 5B30A 1PV4A 1CEEA 2J45A 5BN3A 3PUZA 1FNMA 2X2EA 4BLSA 3ZZUA 3CPHA 1G16A 4A15A 2A5FA 3WHKA 1XTRA 4B35A 3LQQA 1NMYA 4Q03A 4JLVA 2DPXA 1OH6A 4RZXA 3SJAA 5EE0A 2AK2A 1IY2A 1GRRA 4EDHA 1G8FA 2WZQA 1NN5A 4C2UA 2YWFA 2QGNA 1KJYA 2VP0A 3UIEA 2R9VA 1FTNA 3OF5A 4NYJQ 3I73A 4AI6A 2NO9A 2QE7A 1KSJA 2IBMA 2ZI5A 3PVSA 3RYTC 4C2TA 5KYKA 3IDQA 2CVFA 2ZUCA 1E9FA 4FMCB 1OH7A 3AVTA 2GJAA 2QTVB 1SHKA 1KDTA 2F43A 4TYWA 2WKQA 4DDWA 4OJKA 3VMFA 4CDGA 1WRBA 3KQKA 3HPQA 3VHLB 2PLRA 2VA8A 3W5JA 2BV3A 2F1JA 2CCGA 3A4LA 1B23P 3WNBA 3CWQA 3P27A
chains in the Genus database with same CATH superfamily
1S02A 3NHSA 4N5LA 4ZAVA 5JDCA 4UTNA 3H5AA 3C74A 3HBMA 4NFHA 1Y4DE 2BZGA 2QP4A 5EIAA 1W93A 2AX3A 4TTQA 4B33A 5KCZA 4JP8A 1XAHA 2JKYA 3GJXC 1DMRA 5ITZB 2K2QB 1DQSA 1SEVA 2V7BA 4IHAA 4ISBA 4MV4A 5JZOA 4O1HA 4FYKA 1T1JA 3SX4A 4AUMA 5JATA 2W0MA 3MD9A 1S8NA 3QVTA 4HSGA 4RCVA 1RADA 2C8KA 3O84A 1G1MA 1CZKA 3NEJA 5F2KA 3PUVA 1IXZA 3LL4A 2P9CA 3WQBA 3LDGA 5DYNA 4R1OA 2PX2A 1G1AA 4DLUA 4G25A 3A4TA 3U7QB 2PXCA 4C1NA 1IJFA 4KN8A 2FWJA 3PTAA 1OBVA 1VPLA 2AH5A 2D0OB 5K05A 3ANSA 3SFTA 4P93A 4DDHA 2I6GA 4PC7A 1VE6A 2FFRA 1C7IA 1QZUA 3HHEA 4FZJA 4PYKA 4HFMA 4D2IA 1PJBA 1RLUA 1NW6A 5BNTA 4GSLA 5HA5A 3UC9A 2C84A 1IN5A 1GL3A 4H3KB 4EI9A 5LKRA 4HADA 3M34A 2WHEA 1GUDA 2BE7A 5JCOC 1G2QA 2FSVA 5IAOA 1PU2A 3OLXA 3TAHA 3G68A 3F8TA 3QPDA 4LPSA 2ZATA 2NADA 5AP9A 1USGA 4KWEA 2OGTA 1OXSC 4INAA 3KR0A 4BFVA 3QMWA 5EN4A 1PFGA 2FF5A 2Q3MA 3QPCA 3HDYA 3HO6A 2AN4A 5ENVA 1N2XA 2OHVA 1N1MA 4PZYA 5BV2P 5IXYA 3MFYA 3GEDA 1NNSA 4HTFB 4X7PA 2QN1A 4DOMA 4TT3A 4P1ZA 1ZD3A 1ZLYA 2Z9DA 4FNMA 4JA2A 4X1YA 1QUFA 4Y2PA 2DG2A 4C4PA 4IDHA 4URUR 1CKEA 3DE5X 5B3JA 3LLVA 2A30A 1M1UA 2YXEA 3K2QA 3ZEIA 5CGZA 1EVQA 3EQ8A 3QUBA 1VHTA 2X3FA 2QYSA 4TSKA 4CJXA 3FGNA 2WPNA 3HYCA 1O7JA 3KWJA 4PZLA 4CG2A 2CVZA 2Q6OA 1A1VA 1LZLA 3GOHA 3TZ6A 1FVOA 1Y37A 1F7VA 5CDTA 3U6KA 1WXQA 3U17A 3BIFA 3PA8A 1B0PA 1JMYA 4EB3A 4LX0A 2O7NA 1TEHA 4DLRA 3EFOB 2GYWA 1KU0A 1X7GA 4L5AA 3ROKA 4EATA 4ME6A 3MJEA 2C2KA 3C3CA 4LSZA 4MPRA 3AHDA 1JAXA 2ZJYA 2OHOA 2MIIA 2NUAA 4YAWA 4LAFA 1ZONA 1RVDA 3M2TA 3SLRA 1Z5GA 3HRKA 4OBXA 3N8KA 3WX0A 2AG6A 2BJHA 3WWZA 5KC8A 2ACEA 1VMKA 2VPIA 3NHLA 1J8VA 2BHNA 1L4KA 4E4TA 3D9QX 3L7DA 3C2QA 1DEXA 1THTA 3OZAA 5G3YA 3RB8A 3I1YA 1V1RA 3KVOA 1S1MA 3TXYA 3VC3A 2OECA 5FV7A 2W98A 3FCXA 1EFPA 1LDMA 2RAPA 3NHKA 3O82A 5A0FA 4EX7A 5K8VA 1XYVA 3I9V1 3VO8A 3L4BC 3VPAA 4WSOA 3BWCA 2XTAA 5LDDC 4PO9A 1M2WA 3BMCA 4WECA 4BYMA 3ECSA 4GOLD 1UMBA 4KI0A 4NYJR 4N47A 4I4LA 1LDEA 1C7RA 1N9GA 1OPXA 1PN3A 1T4GA 3BDVA 3JWPA 5CMLA 5HIKA 3KTOA 4O8ZA 1YCDA 1BCSA 2F2TA 3WMXA 4P8RA 3K1AA 3ZDDA 3HNRA 4M7RA 1C7FA 1OA1A 2F62A 2ZAOA 3DQZA 4U6QA 1N7HA 2JIZD 3L4SO 3FBWA 5FR2A 3SP1A 3X2FA 1B41A 5HMLA 2PYIA 1A8QA 1H2XA 4D3XA 1QZTA 4EHBA 4YAFA 2VYVD 2K2WA 1KI6B 1ZD8A 1TM7E 5E3IA 1VPWA 5MGNA 4FFBA 4MGKR 4PVCA 1E3LA 1VLVA 4ZTBA 3GNTA 2XV1A 3MWEB 3ZWMA 5KZMB 4E2XA 5AK0A 1ZK0A 1KFEB 3A0RB 5KU7A 1D0IA 4LVOA 2X7XA 4ASUA 1A2OA 3OC0A 4K9KA 1AKRA 2BM0A 1C7QA 2RGAA 4TMTA 5L3QA 1ACMA 4TWBA 3AMVA 4Q9JA 4ZQGA 3OLCX 4HH4A 3GH1A 3LTNC 1PJZA 3HBJA 1PTJA 3OOYA 2DFNA 1QE3A 1FJ2A 2CEAA 2H4HA 1EP3B 3MLEA 4AMUA 2FVXA 5DVZA 4C4TA 1J0EA 5IJZA 4HB3A 1P61B 1W2HA 2JGDA 3G0OA 1ZQ9A 4EM6A 4NYMQ 1PD0A 5E4JA 4ZDWA 5H9VA 3F7TA 3A1FA 1V4NA 3RF6A 3RRMA 4P33A 2DY1A 1G8HA 3CPJB 2W8BB 3OX4A 1L5MA 2VDWB 4AY2A 1C41A 1R5NA 1RE0A 1RKVA 1TYBE 2V7XA 5JSQA 1ELOA 5D1HA 1CD5A 1FYXA 3HZZA 3LY9A 4IOLA 1LGYA 4ZQBA 3TH5A 4KHZA 2OVFA 3PHCA 3S4YA 4R5HA 3BHJA 2CY0A 4IF4A 1J97A 2HF7A 4CU5A 4IGEA 1C2TA 4Z1MD 5AVXA 3FB1A 1PL7A 5A5EA 1K8YB 1SUAA 3NCHA 2X3UA 3CF2A 1D5CA 3DR5A 3DZ8A 3QEMB 1W4LA 1YJQA 2QXUA 1CJMA 3DFZA 3IOMA 1W76A 5T6MA 5A7FA 2VPYA 5ELMA 3IMEA 3KVRA 4DUZB 1QTIA 1XTKA 5H3LA 3OT1B 2QZZA 4MVXA 4MWGA 4E1BA 5L3QB 1I4EB 3GUVA 1RS0A 3CZ9A 4JX9A 3L8DA 1N1DA 4YRCA 4WTOA 2PMFA 2Z2IA 3A6LA 2RK3A 3UMJA 1ABEA 4JENA 4ECAA 2IIPA 5FWXA 5B2FA 5BWCA 4L74A 3CLHA 5DNYB 3PKJA 3KQHA 4K6MA 5FA5A 2BFNA 2B30A 2GCOA 1UT5A 2WFAA 2GSWA 1V8DA 3N7UA 5CK4A 4F46A 3M82A 2I9KA 1RWOA 1L3CA 5EUMA 3L7AA 1ZSYA 1SWWA 3K70C 4CHTA 4EIWA 4X45A 4Q02A 2YWXA 2AEEA 4ZYVA 2BHSA 4YCJA 2R0QC 2P9QA 3R24A 2YVKA 3TOSA 2C83A 5EC8A 4LF6B 3OIWA 3EULA 4S05A 5L7TA 3PNMA 1M1YB 2HT1A 1HYHA 5D1NA 1NBAA 3QKRB 1M6EX 2TECE 2C88A 4FX5A 5DP1A 2JLVA 3ZHXA 3ZXYA 4MYUA 3W5AA 1Z0SA 1IG3A 3RYFB 5AIBA 1VCIA 4IIJB 2V59A 2OQVA 1JKJB 1UOQA 1XEAA 3MRSA 3T34A 4BUJA 2B9VA 4E2ZA 2F8TA 1X1DA 2V7QD 3D6TB 3GGPA 4L6CA 4ECEA 4YI5A 1WZIA 4GXNA 1FS4A 3LCVB 4P4NA 2ZM5A 3VSDA 1G4UR 1CDDA 4KGVA 3OQHA 1GCIA 4GKAA 3KEMA 4NK5A 3X1XA 521PA 3ZDYB 3PE4A 4QYTA 2HQ1A 1AKVA 4UM5A 3T38A 1B73A 2AN9A 2H3EA 5SZIA 2XDAA 1TT5B 3UTDA 5IVHA 4A6XA 3O1IC 2CDRA 3T5PA 3UHPA 4D1YA 1N2CE 1TKCA 1CVIA 5E9QA 3RYHA 1HR0B 4IWXA 3LKDA 2ZRNA 3P9XA 2G1KA 2TMGA 2JGDB 1HDGO 3AF1A 5E2AA 2YHBA 4OF4A 1Q0HA 1DKPA 2OL4A 3R6LA 4MVJA 4RANA 1TW3A 5D51S 2C3YA 3N8NA 1RCTE 4PHHA 4PLCA 4AMBA 1LF0A 3A6GA 5IHPA 5K6AA 2HF9A 4ZQCB 2PKQO 4BB6A 1UC8A 3C8MA 2V9ZA 4CEHB 1B2LA 3QLUA 4CODB 1NU8A 3PUWA 3LY8A 5FWYB 4A0HA 3RVOA 5EJ8A 4UW9A 1X9GA 3N0WA 4LZNA 2O52A 4QOEA 1GEEA 3QXGA 1C1XB 4MA0A 3RU3A 3GV0A 3SJUA 1Q5PA 3K0SA 3UKOA 5A9SA 3DPUA 4PFSA 4Z9YA 3ZJUA 2F3RA 2I2CA 5DU2A 5BNZA 1BVHA 3EQ9A 3PFWO 2GPJA 3M6WA 1RC8A 3IPCA 2R44A 2FY8A 3OX3A 4O4LA 1WWKA 3SQNA 7REQB 3PICA 1NXTA 2C8LA 5K0GA 3TB4A 5LD2C 3ZWVA 1PFQA 1PQWA 2CLIB 1QU3A 4NFSA 1TDJA 3WLTA 1I3NA 2UVPA 1VSVA 3L06A 5BW4A 1LRKA 3HC7A 4IRMA 4IIHA 3ZUPA 1FS5A 1XR3A 1DQRA 4BWGA 4RTSA 1XD2A 1DZIA 2EG9A 5BOVA 4AROA 1TUGA 1MDFA 3KYCA 3R09A 4TTSA 1L6RA 3HN2A 1MFZA 3U09A 1EUCA 5IKOA 1IK4A 3NBUA 1ORIA 3T7CA 1SFRA 5EA2A 1M67A 1LX7A 1B6TA 2J3IA 2WSMA 3KSRA 3HCCA 3ICVA 4XWYA 2HBZA 5EZ5A 5BQPA 5E2BA 1FS6A 2RBGA 4EDFA 5A2QA 4FFOA 1Z6XA 1KPIA 1EUQA 3D81A 1VMAA 3MWDA 2WD7A 3KUXA 3MWGA 3DW3X 3IEIA 1D03A 4IOMA 1T13A 1CFZA 1SQFA 1D2CA 3KAQA 4RFSA 1JEOA 4JQOA 3FSGA 4BMXA 3TL2A 1WBDA 1X6VA 3KT6A 2A9KA 2FOIA 3UJ7A 3VKVA 5FWXB 5FTLA 1TAUA 1H3FA 4ID9A 3IBYA 1L5WA 1X1BA 1B8OA 5ALWA 1E3EA 4D4JA 4FD3A 1Z0FA 3MMSA 4KXMA 4FCTA 4WL0A 1KDOA 2Q8QA 5AKHA 3THXA 1K4KA 2X15A 3K94A 3VC7A 2J3MA 2UUOA 2XB6A 2ZSBA 5I7HA 2GBLC 4RCYA 2WWTA 1F17A 1TVMA 1PV2A 2QIPA 4ITRC 2UZ0A 1EDZA 3IH5A 4IWYA 4V0KA 5COBA 2FSIA 3F46A 2GVNA 1L0BA 1PT5A 3D4PA 2JFOA 1SOVA 3RV3A 2BZSA 4GX0A 3GJ0A 1KZ7B 4XD7A 3HXMA 1SKAA 3FXAA 1MABB 3S1LA 1NC1A 4GBED 4I8IA 4XARA 4X66B 2YWGA 3T9CA 2YQ5A 1GYPA 2FFBA 1RQ2A 3JRXA 3NKLA 1JA0A 1LVHA 3A0UA 4P7FA 3SHQA 1QNFA 1GSAA 2QL9A 3LUBA 3QF4B 3S2FA 4R1PA 3NBAA 1D2MA 3ANLA 3B7PA 5CCEA 4Y8VA 1RWPA 4MW7A 4LSGA 5KTSA 5IRCD 2I4LA 3P9RA 1KKLA 4LHEA 2O8DA 3F74A 3HR4A 1JBKA 2QW1A 3BXFA 4K05A 1Z45A 2TMKA 4GNKA 4HQLA 4ZOLA 4FP9A 2VTDA 1B3BA 4KVFA 3ENZA 5FNVB 4ZGBA 4I50A 1SHUX 4EHDA 4D74A 2DWQA 1G7TA 3S2GA 4KXQA 3I5AA 3NC1C 2Q1TA 4Y2QA 3RAFC 1PTJC 3UMYA 1XWIA 5J1TB 4OYRA 3OJ0A 3QW4B 4OQLA 2JHFA 5KAPA 1XGKA 1XU4A 4H60A 3UUFA 5GWXA 1N7IA 4AJJA 1SUPA 1L5OA 4IIFA 5JOQA 1N2HA 1N75A 1YVRA 2GBGA 2PV7A 3RGGA 3AF0A 3SEFA 2DR2A 1SVWA 4XWKA 3DFMA 5ILGA 2FUKA 5FYDA 4C7MA 2AWOA 2CF6A 4AP6A 4PG6A 2Z2XA 1YASA 2HKIA 5EVCA 2WYIA 2BKUA 2L19A 3P2JA 3COYA 4YIKA 2JLXA 3PC4A 3RFCA 2Q6VA 3GCZA 2I54A 1P2TA 3MCWA 4IIGA 4K6KA 1Z16A 3EPKA 1P60A 2CBGA 3FHLA 4RGVA 4IVPA 2CUZA 4KTVE 4NE9A 4R1MA 3KR9A 3EEBA 4ENPA 5IG2A 1CB7A 3LT1A 1MV5A 1F2VA 1LXCA 2Q0HA 5DK6A 1NNI1 1SUDA 2AJ8A 4EUSA 2QTWB 1PL8A 4NPCA 2VHTA 1QLWA 3CUUA 5K0BA 1CB0A 1G38A 1JT2A 4MCIA 2XH8A 4JYMA 3ZTTA 4FB5A 4JLUA 5C4IA 4F1WA 2XBUA 2HDOA 2D06A 5KDDA 3O4VA 4KGXA 1YQEA 5KDOA 2FFJA 1KPGA 1TLLA 4KHPB 5CBKA 1QC5B 5BV8A 5FUWA 1ZH6A 2XUJA 4PAGA 4TWIA 1TFRA 2BFWA 4JL6A 4CKXA 1EM6A 4WA8A 1Z6GA 4FTWA 3ORHA 3RWOA 4TYPA 2P30A 3BFXA 5F3WB 5CR9A 3IILA 2JCGA 3F6BX 4YXWA 5TPWA 3A3PA 3DV0A 4CR7A 5CFQA 4JJAA 4GW3A 1XZNA 4H7FA 2O8EB 1NVTA 4JB8A 4Q9HA 3S2ZA 1Q7GA 3R6DA 2BMDA 1XA0A 1J20A 2J0UA 3PR2B 1RAHA 2AXPA 3G8CA 2QYHA 1JQBA 3ZD9A 5F1YA 5A9TA 4M55A 4K6OA 3UW1A 3ABRB 3WO1A 4B4KA 5JJBA 1WX1A 1DOZA 2V6JA 4A91A 4H6PA 2VPPA 4C3OB 5LQJA 1DAGA 1A50B 3AFHA 4NL4H 4YJ3F 5F21A 3TNJA 4DG9A 5AW1A 1IEWA 4NFLA 3ZWQA 1XMIA 4N7MA 1ORDA 1Y80A 2A92A 3DMHA 1GAQA 3IO5A 3LRTA 3NWOA 4PC2A 1CUBA 1E1NA 4LGYA 3HKDA 4EY7A 4D9CA 1U3VA 4GM4A 4E33A 2B1GA 3TRIA 2HF8A 4S1NA 2GXAA 2Y66A 4OFBA 4I08A 3S3TA 4CMGA 3X1YA 3DVSX 2JBHA 1YTUA 1JG7A 1NPDA 1SUBA 2I1LA 2HK8A 2YQZA 2O3QA 4FWIB 3TWOA 2B9EA 3UB2A 1HL7A 3UWSA 5DCWA 1YIDA 3AJDA 1ZFNA 2NTNA 3KE8A 2G6BA 4I2NA 4HUJA 3RJTA 2FQXA 3EYWA 3KAPA 1VYHA 3M9XA 1E0SA 1SC3A 4ARZB 3PS9A 1G5TA 2HBRA 1LQTA 2RH5A 3WLPA 3ESQA 4TYQA 4BS9A 1M6HA 2F00A 1P2DA 4EVQA 3ADBA 3R9XB 2ZJ3A 3SS8A 3WMFA 1HNZB 3H2IA 1RSZA 3FYSA 1JN0A 2AJBA 2H2GA 3FGOA 3LJKA 3M3HA 1NXVA 1YTLA 2MJLA 3MWYW 4X3CA 1ZIOA 4UVIA 5HJEA 1OV4A 1X87A 4ZOLB 2JCBA 1QV6A 3VJMA 4QGAA 4D8TA 2FPUA 4D9BA 4Y6QA 1RP1A 1CQJB 4IJVA 4ANFA 2CLCX 1T2FA 3X1WA 4YMUA 2OO5A 1IWPB 3BE5A 4JYPA 1T1SA 3CYFA 3U4QA 2CJWB 1SURA 3ZWAA 4LGMA 2ID8A 3UVEA 2JFHA 3W5CA 4LRUA 1W46A 1U63A 2G40A 3BGIA 1E1RA 3DA8A 3TE7A 1KZGB 2ALJA 5AKLA 2NPOA 1XTUA 4DLVA 5E6RA 4F11A 2F67A 1N6PA 3QFTA 3ML1A 3Q7PA 1E5TA 3TX2A 1K7SN 1Z4MA 3L7KA 2WLTA 4PLWA 3C4QA 3RK4A 5BUSA 3NALA 3G0DA 1SA0B 3DNPA 4HL6A 3CUTA 1PDVA 1SQ5A 2ZJ6A 1QQTA 2ZYAA 3D1JA 5HCUA 1GRQA 2OLKA 3DXXA 5KX5A 1Y1QA 5F3RA 3SZLA 3W79A 3QVVA 3KQMA 4M89A 5HKKD 3R44A 3HXTA 3KNZA 3VKUA 2ZXEA 4NNPA 2KW5A 3ZWBA 3FA2A 1N2SA 4X41A 1CRQA 1WSDA 1MDBA 2Q62A 3VTZA 3A7DA 4OFZA 2VT6A 1Z6TA 3A2NA 3C7AA 4H7IA 1T5BA 1RHUA 3PJFA 5L6LB 1T0PA 1ODLA 4QGBA 3BCRA 4TVKA 1PNOA 1C9DB 1ZN2A 2EAUA 3HI6A 1OREA 4HLDA 2MTBA 4B8WA 3C3EA 4UNRA 5EMJA 1HKUA 5ABPA 3ICOA 4JJKA 1JJVA 2RJOA 1CUYA 3OE7D 4J0IA 4H1HA 4YUAA 2J0EA 5EZ6B 6CHYA 3EOBI 3IIMA 4IV5A 1ZRMA 4P3OA 2J32A 2QNIA 1TTPB 5AKJA 1BXGB 3W34A 1TM2A 2VEDA 3U3XA 3UGQA 2DPLA 4BE9A 3SM9A 4YJ2B 2BPOA 3KXKA 3RROA 1PI3A 3CX6A 3MTJA 2RGNA 3WMWA 3WZ2A 1L7BA 2GN0A 2NZWA 1ADGA 1TEXA 4HC4A 3I2YX 1B2RA 4LJ7A 1CUFA 4QDKA 3HB0A 2AFHA 2PMWB 1EEHA 3SLKA 2XD9A 3AEUA 4KYIB 5ALYA 3MG9A 4Y6PA 3W6UA 2VQ6A 3HJTA 4P54A 5KO2A 1YDMA 3PFIA 1B3RA 1XZPA 2WJVA 2Y93A 4EJ2A 5U4QA 2WMNB 3H8WA 1RQLA 4Y1RA 5I9TA 3ZLVA 3Q3VA 1D9ZA 3TG8A 4CZ2A 3OT4A 3Q7EA 4GMFA 4Z8XA 3J80A 2QR3A 5CVUA 4JK3A 3UMSA 3P2IA 5FJIA 2HU5A 2O3JA 2XDQA 3JYNA 3OURA 3VU8A 4RF4A 1RRKA 3JVVA 4Q5IA 5CLHA 5LBIA 1X1SA 4RTPA 2RHBA 1PSWA 4RIIA 1ACLA 3T9AA 3ZCUA 5IH3A 1XNGA 2I2XB 4EFKA 1HG0A 4BVFA 1YS9A 4IXMA 2XTMA 1ZNYA 2AF4C 2CBXA 1IHDA 5DYYA 1JB9A 4HQOA 1EWKA 2RONA 2CE2X 3L8EA 4H7DA 1OYYA 2BMWA 3IKVA 5JNUA 3HFSA 1O0CA 4EPRA 821PA 3HJFA 1TOAA 1YJAA 1PJQA 3L4JA 2CNLA 5FX2A 3KM0A 4NJMA 1I4TD 2P9GA 3JAMA 5B1HA 4DQKA 1KETA 4YUYA 4B3TB 4YWJA 5JS7A 1PZFA 2JHAA 3IHWA 1DC6A 2XQVA 2OY0A 5EPOA 2O8EA 3AEQA 4IXTA 1AB6A 2XRMA 4UBNA 4XDYA 1T24A 3GRUA 2V96A 4LN1A 4C03A 1KQOA 4LQCA 3QA3E 4JGGA 4YMWA 2EV9A 1XZIA 3AW8A 4JD5A 2P6MA 3ZS9A 3GRPA 4KQGA 4FFPA 1XRLA 4FVTA 5TIIA 5KYXB 2H1CA 4JP3A 1MBZA 2DBYA 1ZXXA 4LXQA 4NBUA 2BFOA 2JCXA 4FXOA 4XGRA 1GPAA 1LD3A 3BRWD 3MGBA 2L82A 4YH1A 1YB4A 2I9PA 3DCNA 4L4YA 2RHHA 5DHTA 2C9OA 3G8AA 5JU6A 3OZEA 3RIEA 4EF6A 1W2GA 1DC5A 3CJQA 4EFLA 3UXMA 4F9EA 3M1YA 4EQ6B 4KWHA 4ASUD 4DBZA 3RUPA 4ZI7F 3CNEA 5CA0A 1XALA 3JR7A 1DB3A 1WXWA 2JBAA 1BE0A 2WAYA 4KIGA 3I32A 4XIGS 5AW6A 5FUVA 1PK8A 4RHTA 2EU8A 1GQSA 4OI2A 3WYBA 1AS3A 4LYDA 4MHOA 1P5JA 1JA9A 3FOCA 3RFFA 4QUAA 1BYUA 2P2ZA 3J7TA 5CDSA 2ZR0A 2APJA 4WY8A 5CX4A 4P32A 1DQZA 1YMUA 4E03A 1T0JB 1R10A 4R1TA 4WZBE 5C8YB 1QP8A 2C54A 3GPLA 1EYZA 2Z4SA 3DT6A 1UWVA 3DFKA 1V11A 3QUCA 4R40A 3BMOB 4UKDA 3ZWWA 2O1EA 4D82A 3CSUA 4J0JA 3DC7A 3G79A 4P4UA 4M8KA 4TTJA 3AX6A 1WE2A 2HXSA 4KACA 4X8LA 4ITVA 4OQEA 3H7IA 4CM9D 4BQEA 1WTAA 2YUIA 1WHTA 3D4LA 3W7AA 3PQDA 4Z1MA 3BMNB 3V1TC 5IZCC 2F1RA 3JVEA 4QTTB 2CW5A 3PENA 1XUOA 1GDTA 3WYFA 3GWGA 1G9XA 4M3NA 5EFOA 1IPHA 4J9UE 1SU8A 2FOXA 2C5SA 2QJOA 4JVNA 5P8WA 1KF0A 2BFPA 1Z28A 2J4FA 1E9VA 3G88A 3VNAA 4TS4A 3OVMA 5FBWB 3RQSA 2ZJ5A 3OT1A 3CA8A 1DAOA 2YVQA 1W2WB 3EF0A 4G5XA 4LA4A 4EARA 3KALA 3VSCA 2AOXA 1PYGA 1VBMA 2PGLA 4ZO9A 3STVA 1DAPA 2B25A 4IFBA 2JEZA 5CYOA 1GKUB 1DX4A 3WL5A 2P9TA 4CLEA 3WBKA 4YHBA 2I6SA 1UP4A 3E9RA 4UHCA 2XNSA 1QFYA 3OJCA 4XEHA 2PKQP 1ZG3A 1X7WA 1RPJA 5FA8A 1UQTA 3U3OA 3WDSA 1C4KA 2NVWA 3QTBA 2Z3WA 1EVEA 3AV3A 2G04A 3W9YA 3GJ6A 5THQA 2XF8A 2A14A 1BMTA 5GJWC 1YO6A 2ZJZA 4PQGA 2VQ3A 4OK5A 2W6MA 5DHSA 1QKIA 1RWMA 1GUAA 4F4CA 1IOWA 1SXJD 5DM60 1W1IA 1U3UA 3F3YA 4OY3A 1PNRA 1XPUA 3CEJA 1KY5A 2FB9A 2HEIA 4Q9DA 4OL9A 4IBOA 3GLSA 3W7VA 3PEEA 3HBAA 3L3BA 1M8FA 2GTIA 3TN7A 4AY3A 5FEUA 2H2AA 1DIHA 2X41A 2OMKA 1H0HA 4XUEA 4FILA 5ALSA 4GXQA 4BMPB 2HHHB 4W82A 1JFFB 2G4CA 1IJEA 3D5TA 1T8RA 3OBBA 4RA6A 4GC5A 3R0XA 1OLXB 2QTBA 2H4ZA 4J7XA 4JBGA 2GAJA 1RR6A 2ZVDA 4IP0A 3VPCA 5DGIA 1M6YA 2H1VA 2NWQA 4JEIA 4XQ0A 3HZHA 1F7UA 1R1DA 4FFDA 4HYEA 3QVOA 1Y5IA 4F91B 3ZVLA 5L9AA 2H2FA 4MA4A 2O4UX 1RPTA 2QSUA 4WCFC 4Q9IA 1KEUA 2Q9CA 2C4MA 2R85A 3B5JA 3I4FA 4I9NA 3JZDA 3ITKA 4PZAA 4Y30A 4Y7DA 2HB6A 2XZOA 1OAOA 2VAMA 5LYJF 1ZK2A 1GR0A 3HEAA 3RSZA 4NAVA 2DTEA 3W78A 3ZLJA 3HJCA 1AK9A 3CJTA 1E63A 4RJTA 1GZ4A 2PX5A 1VB5A 4K9SA 3S1AB 2WUDA 5H1YA 3DV9A 3NOQA 5SYAA 7ADHA 4PLYA 1T15A 3EWSA 4MUNA 4N5NA 1HYEA 1EZ1A 1ZWKA 4OIFA 2G8LA 5CVEA 2IXGA 3H6HA 3VR4H 1B1AA 2CMKA 3ENVA 3LDAA 2VZLA 3NBKA 3O3CA 2GXUA 3DF7A 3OQVA 4BQOA 4DR5B 1YR1A 2WOOA 3H3JA 4Y0AA 4UOEA 1X70A 4I3HA 4MVJP 3TMKA 3VBCA 1S96A 1SXJC 3WJAA 1M0SA 2EFGA 4UEOA 1YT5A 2BF4A 4AF6A 4NMWA 4MQ4A 5YASA 2IDKA 2QLBA 2JKZA 3KL4A 1VDZA 3KKZA 4FU0A 3AWDA 5FBKA 2IUFA 1JMKC 4YMLA 4DNQA 4BCCA 4V0QA 1COWA 3TW8A 4OHRA 3IJEB 4NU5A 3DMTA 1ZJ5A 3L18A 2K7ZA 3FVRA 3NTVA 1Q91A 3WYDA 3KLBA 2ZITA 3AB8A 3F5QA 4PHFA 4PO3X 1NVMB 4BFZA 4Z4HA 2ZS8A 1OLUB 1Z5ZA 5I4KA 3HVIA 4MWCA 3BRWA 3WGMA 5JSFA 2NXNA 1AKNA 2VNJA 1YI0A 4JODA 1LZKA 3HCBA 4BCDA 2IE8A 4QPNA 4ZMBA 3ZVKA 1YB1A 5D84A 3REOA 1D2EA 4AT1A 2VP2A 4Q0MA 4C14A 5EPEA 4AY5A 4GVXA 4PICA 3ASVA 3R5KA 3R7SA 1FQWA 1GTL1 1P2FA 5KMGA 2ZANA 3JXEA 2P9JA 2OV2A 2XE7A 4QGGA 2OD9A 3RYCA 2ZQZA 5E3JA 3PJRA 1K8QA 1ENOA 1QH1A 1UKVY 2CCJA 3LGAA 5TVKA 4DIKA 1UJNA 4EKEA 3MUEA 3B2QA 1VCOA 2PFKA 3HU2A 3DOFA 1X38A 4Z9BA 2IP2A 2CLHB 4GDMA 1XLTA 3IQWA 2J4CA 1P29A 3B9BA 4N6NA 2Y6VA 2XKJE 2C92A 3RHZA 2HLDD 4OD0A 4X20B 4Z7JA 1G59A 3MCVA 1HSOA 1Z15A 2KE5A 5B4VA 3R0QA 1P1FA 2IU6A 1L5QA 2G9VA 2VL7A 1M2EA 3NH9A 1SAYA 1XKTA 2GTPA 2BUBA 3ADPA 3G5MA 3JAWB 1WKVA 1ZKDA 2A5GA 1DKMA 1F2TB 3GZNA 5LQMA 3QWIA 1MB9A 4FGKA 4C6HA 5EHZA 5JCJD 3I45A 1FDWA 2ZREA 4IQGA 4X62B 1QVZA 1FLNA 1TM5E 1L4FA 1RWNA 3JZMA 3M33A 3T0FA 5BSEA 1M34B 3FCEA 2DLNA 1D4OA 3MZ0A 4BDSA 3ZR4B 4FYVA 1PF7E 3RNLA 4PU0A 1TTQB 2VH1A 1P9RA 3VPXA 2DBQA 3RIMA 4MO2A 4D9GA 5IVIA 3QX7A 1I7SB 2HDHA 1GSOA 4LWZA 4YAKA 3EVEA 1WEHA 5K2OA 4B3RB 3CINA 2YWRA 6REQA 1XEFA 3PXAA 1DLIA 3HL0A 5FPKA 3RYCB 1JA1A 3ED1A 5G0WA 3ZQUA 4D0GA 1RMQA 2ZT7A 3DBHB 3T9DA 2WJ4A 2C3OA 2H8GA 2WIFA 3R7NA 4B4OA 4N0EA 5H3HA 5C37A 2KJQA 4Y1GA 1CIVA 1QQ5A 2IW1A 2SCUB 2WFLA 3N7TA 4LCJA 4I4TF 1KQGA 3DLCA 4G3XA 3S29A 5JADA 4ABTA 3SC6A 2E4AA 3WLQA 1BWPA 1KAEA 4OO3A 1T1RA 4YJHB 2W2TA 2ERCA 4BX9A 3HABA 4RLQA 2IQIA 3LFTA 4L5YA 5B7QA 2QMHA 3EZ2A 1O08A 1XPRA 3L1JA 3LPDA 4Q7LA 3T4UA 4P0QB 1UR5A 4QELA 5BNWA 4G5HA 4EPVA 2RAVA 5AVRA 1WU7A 4JCOA 4E2YA 3E8SA 3NWEA 4IQFA 4V39A 3FH0A 3NJ4A 3BXOA 3IUSA 2NZJA 3MERA 4OP2A 1RYZA 1XJ0A 1Z2OX 1LSUA 5AKZA 5ALGA 5DX0A 1K4YA 2EVWX 5E4FA 2RBEA 5LMZA 1LLDA 1XQYA 4RCZA 4I7EA 4HV4A 3QXJA 4NBRA 2XIJA 4WFKA 2ERYA 5DULA 4DQXA 5IYZB 1SBNE 4ZKEA 4R2HA 3GT0A 4Q3LA 4S1WA 1OFUX 2PRYA 3ZU2A 3LPCA 1G21B 2ZJFA 4R84A 4AX8A 3O38A 1Y98A 1IQ0A 1Q7BA 2QUBA 4D46A 2JATA 3N6RA 5JCPA 1BFUA 1J2EA 1ENZA 1MA0A 2FETA 2ZB3A 4MEJA 4RS3A 2WPDD 3MHTA 1R0WA 1SOMA 2HADA 4O29A 1HLPA 4C0AC 5GM1A 4DJAA 1T2DA 4UPEA 3MLAA 2EHDA 4WCFB 1XYYA 4G81A 2FJPA 5FOUA 3JQ9A 2O14A 1LC3A 2Y76A 3AO0B 3PXXA 1C2YA 5A04A 2VP5A 3Q8KA 5D00A 1Z83A 1TAGA 3T9FA 2FEXA 3EFOA 3NAMA 3UV7A 3HPRA 1C0PA 2YN0A 2VDWA 2X19A 3OEHD 3R7BA 3AHFA 4G5GA 2ZIVB 2IHZA 2QMYA 2FCRA 3G02A 4Z2YA 3ZKAA 5C18A 4LPKA 1JEJA 1PZXA 1CZRA 3L9XA 4NG5A 1L7AA 4B3MB 3H1FA 1C29B 4MS1B 2XGOA 1ATIA 4F3RA 1O9HA 4L5CA 1ZNXA 4LJYA 4FEEA 1QE0A 1V2GA 3LDUA 1HRDA 4GYKA 2HNBA 1U2GC 2WHYA 3LCCA 3H9BA 1MHTA 2DQZA 1TCBA 3QSGA 1O6GA 1SVSA 1PR2A 2M98A 1BE8A 1Z7BA 5BNIA 3BGOS 3PX3A 4UTZA 4OTZA 2EL9A 5DEOA 4YB8A 3L01A 1LDBA 4ENWA 1K88A 3AILA 1U8AA 3FOAA 3L6CA 4HWOA 4M83A 3AUTA 3FPSA 3DCIA 4GX2A 4MYRA 3URKA 4EHJA 2OBBA 5HZHA 3FN4A 4OHVA 4TXNA 4QNMA 1MX9A 1C4WA 4IUCS 1V25A 3DTVA 4P7GA 3WLHA 3SHTA 3BSWA 2BHRA 2P8SA 2Y1XA 1E5LA 2JGIA 2FPWA 3EGWA 1X7WB 3JQAA 2EX1A 3L6RA 1P62B 1P6UA 1W19A 4FYHA 1SM4A 1GM5A 4FDMA 2WG1A 4XQGA 1Y7HA 1FX0B 1GNRA 1LW6E 3K5WA 3G7UA 2XQKA 3STXA 3CR7A 2H9YA 2ZPUA 4KSYA 2G9UA 1L1QA 1CUJA 3ADCA 2Z5LA 5K0NA 1G60A 4J16A 2PMEA 1CR6A 3KVNA 1VL1A 4AC9A 1F2UA 2Z95A 3GLRA 4GMDA 2PU5A 2LCQA 5AW3A 3PGKA 2XKAA 5AHRA 4PBRA 3K7EA 1CC1S 2FP3A 1NX6A 1T2AA 4KNVA 4W99A 4BKUA 3UAVA 4ENSA 1R74A 3PWTA 4YCMA 5EKUA 3QWAA 1AXRA 2PGAA 5GZ6A 5HUQA 3KXLA 1EZZA 3QK7A 4CKWA 4B6EA 5B1DA 3MC1A 5JAZA 2W6OA 1BDJA 3SR3A 2O3UA 1L7NA 2PFGA 1QK3A 1DT3A 4H7HA 4JJIA 4JBYA 3GMSA 4W5NA 2AFVA 4HX9A 5JR3A 4WXRA 4IPTA 4MINA 5H83A 1BFKA 3MW8A 2XTJA 3V8PA 3KB8A 3LNCA 10MHA 2B99A 5JSYA 4FJ2A 4S0XA 1IN1A 2DUNA 1SC1A 3V34A 1MU0A 2R96A 3B51X 4RMGA 4B6JA 1AB5A 4H2DA 3FNIA 3ZD7A 1KH3A 1NW9B 4EPYA 2PEZA 2WSIA 1CZUA 3A26A 1ZGCA 2QOEA 4JHXA 3NDRA 1GGKA 2XWSA 4LJ8A 2OTCA 3UXEA 3WMEA 5T4BA 1TVKA 1N2EA 3BWBA 3M1AA 1E2PA 4UUBA 2IODA 4GMXA 4QAJA 4REMA 4OHZA 4AZSA 2FW8A 2XUQA 3KR1A 4RLFA 3ZI4A 5D7BA 4YV1A 4WADA 5IVDA 3PC8A 2JC3A 1X1QA 3IQFA 1M8GA 1OWOA 3R2JA 4G09A 2ZUVA 2PGXA 2OLEA 1T5IA 2WQZA 1J39A 3UAOA 2YS7A 1EVLA 5EJ2A 2QW8A 4N8EA 4M46A 1OWPA 2LTAA 3RTAA 4EY3A 1F6BA 4K2AA 2XMSA 2OC4A 3CRVA 3G9QA 1XJCA 5AKYA 3GWZA 1JKFA 3GP3A 3ZX5A 2R5FA 3KDAA 2V4MA 3RFTA 2HCTA 3TAXA 1HFEL 3LU1A 2ZTHA 1OPRA 5K01A 3FYHA 4BRZA 4CQLA 2KB0A 1JSCA 1QX4A 1QIFA 3KXDA 4QT4A 3P32A 3UCXA 1Z4NA 3QELB 2D3WA 3RC7A 1P9LA 4Z9XA 4RVNA 5JNRA 2Z56A 1E2FA 4YAOA 3JX9A 3SY8A 3QPUA 4HJXA 4LDNA 1JHXA 3EY9A 4HB0A 2BI7A 1HI9A 1C1DB 1JZQA 3AIKA 2BKLA 5FHQA 1C3LA 1NBMD 2DFTA 4JQSA 3ZHZA 1ZIYA 2CLMB 1N2JA 4RZSA 5KJEA 3DULA 1CW2B 4DXDA 5ADWA 1KGDA 3GFVA 1QZZA 2C0QA 1OR8A 1JB1A 2QRKA 2X58A 1FPQA 2XVZA 2CL5A 3GQBB 3HV0A 3UMCA 5AI9A 3ABIA 3KK0A 3PV0A 4K6HA 4PTYA 2WKRA 3HXQA 1EUYA 4OHWA 3I9LA 4FFBB 5DLEA 4BY9E 2ILTA 3AFIA 3HU1A 1DDOA 1FU7A 3AVQA 5B53A 1GA1A 1DEOA 1HURA 3FDZB 4DV2B 2AJDA 1DO8A 2XGGA 1XDBA 3WRVA 3CRNA 5MN4A 2QP9X 3UA3A 5IYZA 2UXDB