5IEHA

Structure of hla-b*40:02 in complex with the phosphorylated endogenous peptide ref(p)skepel
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
276
structure length
276
Chain Sequence
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPAKEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HLA-B*40:02 in complex with the phosphorilated endogenous peptide REFpSKEPEL
rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-40 alpha chain
total genus 78
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2016-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5iehA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5iehA01
2P5EB 3ARGB 5IK3A 2MJWA 4U33A 4TUKH 3FQTA 1CCZA 4FFVD 3VWJD 2PXYC 1MPAL 5DYOA 4PGDA 2V17L 3X13B 5C09B 5D8JH 2OQJA 5D6CA 5L8LB 1IGYA 1A1OA 3MUGB 3D25B 3VMPA 5LGHH 5DEGB 3U1SH 1BIIB 1ZANL 4DKFH 1MWAH 1KLGB 1RJYB 1VPOH 1EHNA 3UTTD 2YMXL 1KN2H 3HPJA 3UTTE 3ZKND 3OF6A 3UTSB 4KXZI 2VDOL 5C08B 1WITA 1YA5A 1A47A 4ESKA 3F5WA 3VFVA 2OI9A 2FB4H 2HFFB 2YBRA 3KPNA 4JO4H 4KJYA 4UT9L 4AEEA 2H2PC 4Q6IC 3OAUL 4F7PA 5D7JD 1KEGL 4NQDB 1JNHA 4Q6YA 4G43B 1A7RL 3P4LA 1MQ8A 1YEFH 2VXTL 1CE6B 3I9GL 4L8SA 1G7LB 4LL9A 2VLKE 1YMME 2KH2B 2P8MB 1MY7A 3SE9H 3TO4B 5JQ6H 3JWNC 4U1GC 3GI9L 3RU8H 1QR1A 1ZLUK 1QVOA 1XH3A 1K5NB 1Q9LB 2ARJQ 2Q3ZA 1DZBA 3BPCA 5DF0A 4MLIA 3MV8B 4HIHA 1WCBB 3KXFE 5D1QC 1K85A 4ZAKB 4ZFGL 2EYSB 5ADOH 4HK3N 1YYLH 2IAMA 3MRCB 4CDHA 2GJJA 5HI5D 2X4OA 1LP9B 4LVHC 4WRLA 3U0PB 4TVPE 3B8SA 3KLHC 4O58H 5F3BB 4GBXA 1BHGA 3KWWB 4OB5L 4OF7A 4PJXF 5EO1B 5ESQB 3DRQB 4RRPG 3QIWA 3SJVD 1CDBA 1W2KT 2BRRH 4L4JA 4IMLB 3V4PL 4WGWB 2PW2A 4KH2A 4KKCC 1DE4A 1NANH 5BRZD 1JI2A 5TE4L 3ZE2E 4E5XA 3FO1B 4X6DB 1WBZA 1HOCB 4JANB 1RUAH 1XGQB 3OGCB 3BZEA 4P4KD 1M7XA 5LQBL 2A73B 1F4YL 2MOVA 1G9MH 4OLYL 3GMOB 4WI4A 1HKLL 5C2BL 5CHNA 4MA8H 4FTVA 4FFWC 1YN7A 1BBJA 3NA4A 1H8SA 5C9JB 4MXWH 5E5MA 2F53E 3HUJB 4K9EH 4QRRD 4NC0B 4LFHG 5E8DL 1ZA6B 3OJMB 4NJ9H 1NUGA 1YY8A 2X4PB 3R06B 4JG1L 1T21B 3PQYD 4YC2B 2NY2C 3OAZH 4RMUA 3QUMA 1NFDF 4YBHA 2DM4A 2H26B 1OWRM 4MDJA 4H25A 3GO1L 5I1GH 3BDYH 3PWPE 1YQ2A 3ARTA 1IAII 2QLVB 1UC6A 1NJ9B 1HXMA 3REWA 4OV6F 4YBLC 1VKXB 1XIWD 4JN1H 3JWDL 4KWUA 4HKZA 4OFVA 1ZA3B 4YC2C 1JN6B 4J3XA 4OIAA 1M05B 4M7KH 3S3PA 2YWYA 3PIQA 5CINH 3AU1A 1NCDL 1F4XL 2A1WL 1SEBA 1H3PL 2Z8VC 2CSPA 4PJIA 5C86A 3NBNA 1HH9A 1T21A 4YGAB 3ALPA 4KTYA 3BSZH 3MLZL 5HDLA 2CKBH 2PYEE 4FS0A 4C58B 1WK0A 4PJCB 2ICWA 5ID1A 3PL6C 2HTKD 3MOQA 5I66B 2FGWL 2YK1H 2J7LA 4P2YA 5B38A 1J1PL 4HT1H 2IBBA 4JFXA 3OKEA 4UT7L 4X98B 1H0DA 4QRSB 3VFTB 1A7BA 5DQJA 2FCBA 3PQYE 1IFHL 4P23C 3LEVL 2P47B 4NQCA 1NBVL 4LASL 2XWBA 3ZL4L 4GKSB 1RUML 4AMKH 4G42B 3ARDC 5JIKA 1DBKH 3TBYB 4OZGA 2WINB 1S7WA 3A67H 3I50L 3UAJC 1OT2A 3FAWA 2Y36H 3TNMA 3GSRB 1HHHA 3BESR 4KRLB 3GSXB 1BVKA 3UDWC 1C5BH 1OAUL 3OKKA 4ACPA 1OAXH 2J88H 1CXIA 3OJDA 1KFAL 1JIBA 3BEVB 5GJSL 4XB8A 1CE1H 5I2IA 3BO8A 2I07A 1YNTA 4RFEA 1XIWC 4KUCD 3EJYD 4APQB 2AGJL 4CJ1A 4O2CA 1EFQA 1EJ6A 2EYSA 2VQUA 4M1DL 5JXED 4J2XA 3BXNB 2N7AA 1NAKH 4GSDH 5EU6D 4JFDB 4MQSB 1JV5B 3GMNA 2HT4C 5DMKB 2D31A 3QO1A 4YHYB 3BP6A 3MLRH 3OJ2C 3BT2L 2FL5A 3C5ZA 3SDDC 2VDKL 3BISA 2DTSA 3TVMB 5EU5B 2OL3B 3NCEB 1L0YA 3QIBD 3GM0A 1G0DA 4LLDA 4IRZH 3RUGF 4ZNCD 5DMGD 3RWGB 5D5MA 3T4AB 1AHWB 3JWDC 3MJ8A 3D2UD 1KENL 1HSAB 2VITB 3WFZA 3WIHA 4HG4J 5D5MF 1JRHI 2Z31A 1U0QA 1J18A 1MCPL 4HWBL 4JRYD 5JOPE 5IW3A 1GGIL 4LPVA 3R0MA 1MFBL 2FHCA 3TO4C 1UCBH 3O81A 2IFFL 3BHBA 2XZCL 4PG9A 3VE0A 2Q86A 1A1OB 5IHBA 4UUJA 1BX2A 1I1AD 2FRGP 5DK3A 5EC1B 2ZUQC 3MV7B 2PW1B 4Q9RL 3MBED 5DJYB 4AIZA 2AJYH 2D7NA 1ZKAA 3LKQB 4I18C 1CL7L 2ADIA 1MUJA 2VL5B 3E2HA 3VFRB 2NR6C 3DV6B 1KB5L 5HHOB 5IW1B 4FFWD 4BK5A 1BJ1H 1YYMH 1HHGB 5GISL 3ZE2F 4H26A 3DRTB 3VG9C 3E3QA 4P9HL 3NFNB 2CLZB 1OSPH 3NN8A 4JM2D 3QR2A 4JDZB 5IESL 3BRGC 1FNGB 1MHPH 3KHQA 4H0IA 5HHXH 1RZGA 4JRYE 4PJXE 5JNYB 1ZT7A 1QD0A 2A9NH 4M61B 4ELKA 4CMHC 5D7IE 5C0JB 4K7PX 3FL7A 4GXVH 1FZKA 3CSYA 4L8BA 1OAZL 2AJSH 3MZGB 5JW4R 4X80L 4XGZA 3FQUA 4WO4B 3EYOA 3AS0A 3H8NA 3SCMA 5IMLB 3B5TA 3D87B 4PREA 2B5IC 5K59F 1EXUB 4NUGH 4M00A 2FX9H 4HJJH 4FZ8H 5EN2A 3T4AA 5HVWA 3RY6A 1FG9C 4ZFZB 4N0FA 4YDIH 2M1KA 1QLRB 5BQ7A 3IFLH 2IAND 1YPZB 1FIGH 1MHEA 1KIQA 2W9DH 3C6LB 3T1WA 1F8TL 2AK4E 2ZPKL 1SJHA 2AVGA 1CXEA 5ETUA 4EI6A 4Y2OA 3RAJH 5FDYA 2NXZD 2XZQH 3V0VA 4CJ0A 4P3DB 3EHBC 3ALXA 4G3YL 5DQDL 4HKJA 4L9LA 4YE4L 1WSST 4WV1A 1HIML 1TVHA 2RGSA 3O4OC 5TF0A 1INDH 4XBGA 1E6OH 3G04A 2X70B 3Q6GL 4G8GD 5F9OH 5KSAD 5I19L 3E1F1 5DEFA 3QWQB 2KBGA 1GZQB 4OZFG 4HS8H 1BZ9A 5DJ0A 2JKXA 4K94C 3G6JF 3W2DL 1IEBA 3SPVB 5HGDA 4X8XA 4YGVB 1R3LA 2AV1A 4K07A 5HHPB 4Y5VA 4Z78A 1I8IB 3EOAB 2NPLX 4OCSL 5JXAL 4ZO9A 2WMPA 1EGJH 4YZFF 3VI3E 2EDXA 1P2CB 4OD3L 4KQ4H 2LABA 1I9JL 2YD7A 2PXYD 3L3GB 2O5XL 2Q7YB 2JB6A 4G8IB 5SWSD 4L9LC 3THMH 2DLFL 3ZKSD 1KULA 5IFJA 1CFVL 4LSRH 3FFDB 3LEXB 4PGZA 3ARGD 4WY7H 3AAZB 4G7YL 3VXQB 2C9AA 5IM7A 3O9WC 2XA8L 1YEHL 4R4FL 2OBGA 1A4KA 4NNPH 4PTUB 4G8EB 2EZ0C 4IDJL 3BN3B 2HT2C 2Q8AL 1KJ2L 2EEDA 5E8PA 4GLRH 2G75B 4R4ND 2BMKA 4ORZC 3EYUL 2HJFB 3VGDA 1CBVL 2E9JA 4LCIL 2P4AB 2ZUUA 1B4JL 1R5WB 4RRPA 5F1OB 1SEQH 4X9IA 1OLZA 1JZ8A 3CFCL 3EFFA 2F54E 3QUYB 3I85A 2NZ9C 1G1CA 4M6NH 5EBGA 4BZ1H 4PGDB 5DJAA 2IGFH 3QYCA 3V5HA 1FL6B 5H35A 3P30H 4L5FH 1JPFA 4K55A 3TBVB 3P11L 4M3JA 2Z8WC 4H25B 2VQ1A 5I1KL 2UYLA 4G9FE 3WJLA 1CICD 2QKIB 5DC9B 1UZ8A 2Q8BH 4U6TA 4KC3B 4LDEB 2ENSA 5CEXB 4XB7A 1BD2A 3S96B 4I0PA 4LEXL 5AYUL 3VFSB 1AGDA 3UZQA 1CXLA 1JHLL 5GRJH 5TF1H 5E95B 4QRPE 4NZTL 3BKCH 1KXVC 4X83A 1VGEL 5F1KC 4MZ2A 4WI9A 4Y19A 2DOCA 1RV6X 3T3MF 5FEBA 3BI9X 1QKZL 5DDHB 5DQ9B 1JRHH 1LHZA 5GRWA 5DVNA 1B0GB 2N56A 1N8ZA 5D2LF 3RVTC 5C0GA 4JANA 1UZ8B 4CW1A 2IANE 3LPWA 3F62A 4KPHL 4HBQA 4NN5C 3IJHA 2LV4A 4JO3L 3SKJH 1Q38A 4Y5YA 4HHAA 3QEUA 2XTLA 4NP4L 1WBYB 4S1SL 2FR4B 1OGAE 4NFCA 5I18H 4PGCB 2UZYB 1A4JA 2E9WA 3LHPH 3FO9B 4HUUB 1U8OB 5GGUA 2X9YA 3VD5A 4LARL 1RJLB 3B9EA 3L7FA 3OHXA 5IQ7H 1AIFA 2R0KH 4PJ9A 4MQ7A 2JELL 3MRBB 5ID0A 4OCRL 5HPMB 5DDHA 4PS4L 3V6ZB 2P7TB 3IDXH 3QDMB 2G2RB 1P6FA 2IANB 3CDYA 3TO4D 2WSKA 3MCKB 1MCLA 3RZCD 4HF5L 1FLRH 2EDEA 2Z93B 3MLTB 1TPXB 3G6DL 2D9CA 5J9PA 5E2TH 4KV5F 1LO5A 3ZTNH 2GI7A 3NFPA 1SM3H 4OLEA 2B20A 1U3HD 2DQHH 1G6RL 4JHAH 1Z5LB 3IDGA 1H3TA 1JZ6A 4BFIB 2VYRE 4J4PC 4I4WA 4ZUSB 1KCUL 4JFZL 4NQDA 3UC0L 1FVDA 3NACH 1LO2L 3LS4L 2R56L 1CLOL 3RHWF 4D9RD 5C8JB 1EFXD 3QEGH 4RIRA 4DOHB 1EEYA 4JZJB 3TO2A 5CZVL 4ZTPH 4XP5L 3IS0X 3MOBH 4X5XA 3K3QA 3GSQB 1FQ9C 1M1SA 4JFEE 4HK0A 1CDHA 3FT4B 3W5NA 3IT8D 2BVOB 4KRMB 2IQAA 4WO4C 4LKXB 5T3ZH 4LLWB 5BRZB 5C7XH 1S7UB 5E24E 1NQBA 5D96C 3MUGA 4FA8A 3QDGA 5JORB 4U6HB 1AY1H 4K8RD 4O4YL 5HYIA 1ULVA 2YUZA 3TFKD 1QO3A 4K3EL 4NO3B 4LRNH 4R6UA 1LK3L 1RIVL 4YK4B 5ITBL 4HKBA 2PR4L 5D96B 1G7PA 1JPTH 3FOMA 1R5VA 3JVGC 2JCCB 2GTWB 1WT5C 4DKAA 4I77L 4ODXB 3VXMA 5CD3A 1CGTA 1CQYA 1FFPB 4Z18A 1FL3B 3WHXB 2IC2A 4OF8A 2P8PB 5HHPA 1WUNT 3HAEG 4NQEA 1AQDB 1JGLL 3CFBA 5KANI 2DD8H 5M94B 1FBIH 2VZ3A 3W39B 3G5YB 1AGDB 1S7TA 3FT2B 4FFYL 1KPVB 3B9KB 4I3RL 1MY5A 4NHCH 3QPXH 3RFZC 2HJLA 4PJEE 5SX4I 1A6VL 2QSQA 4YZFE 2N1KA 3UDWA 1ND0A 1D9KC 1XF2B 4DGIL 4IJ3B 1GYAA 2EXYD 4JFOB 4PJAB 1A2YA 1IGFH 5DRWA 4Z7WB 5I1EL 1SY6H 5I1IL 1F97A 1JTOA 2EDOA 5ITFB 4JRXA 3QDJA 1AI1L 1P4IH 1VFOA 3BPLB 3MRDB 5TE7H 2IQ9L 4JVUA 3O6ML 3MODL 4OLWL 1VACA 1J11A 5EZOL 5FYJH 5DHVB 5C0AA 1KJMA 2EDLA 4G80B 4O02L 3M8OH 2OTUA 1OTTC 1NCWH 2A6JB 1TTFA 4XNUH 3TYGH 3WIIL 2W0LA 5E8EA 4IIQB 2VXSH 1S7UA 1ZLVH 4UINL 5K9QI 4LIQL 4K7PH 1RFDL 3CFJA 2EC8A 1HQRA 2JLLA 1WFOA 3FQRA 5I8CB 5IFJB 2D4DA 3LKPA 3QHZH 3LMJH 4JPVH 3RVWD 5D1ZB 2UWEE 1L9MA 4HX1B 4PJAF 3RGHA 3IJSA 5MI0B 3E8UH 1HWGB 1VGKA 5D2NE 5A16A 2YUXA 4X6FB 5JOFA 1QLRA 1I1FA 3BGFB 4KKBC 5CLWA 4PJ8D 4DCQB 5DRXB 5T1DL 3ULUF 3SGDI 4X8JA 3DX7A 2AERT 5JMOC 2VXQH 1AKJA 5BVPH 3O2DH 3WKNA 4JM4L 4KKCD 3W5MA 5T5NF 3BUYB 4JM2C 3WN5A 1QSED 3QI9B 4K3DL 3NZ8B 3V8CA 3O6FA 2APBA 4WFFE 3D69B 1WIPA 5E94B 1WJ3A 3R8BB 1IILE 3AC0A 4KKNA 4W6YB 1OB1B 5EBWA 3IKKA 4OFDA 4BQCA 3L5WA 1B0RA 4L4TD 1FZOB 4JFFD 5F7WC 3CH1B 2V9QA 1B9ZA 3KPMA 5E5RB 1P53A 2NY7H 3O41B 4JJ5B 2AXGA 4Z5RB 5KVFL 2BSTA 1T2JA 4W70A 3SDYL 3O4LB 1AGFB 4QHUB 3DV6A 4UTAH 1ZGLB 1SJVA 4KTDH 1QRNA 2H32H 4N5UA 1SVCP 5CKGA 3PWUA 4NNYB 3RTQC 1U8NA 1OAKH 1UB5A 1S5IH 2R4RL 2VNCA 3QCTH 1XCQA 3V6OE 3PWVA 4L8BB 2Y5TB 4C56E 1YQVH 1RZIB 2RHEA 3IJSB 3RJDA 2WWMC 3BGAA 4FQ1H 2DQFA 5MP6L 3MLXH 2NY0B 1I9RL 1H15B 3BRFA 2BNUA 1RURL 3BD4A 5GZNC 4XMPL 2F74A 1QRNB 3JWOL 2MSPA 1DQJB 2P5ED 2QKIA 4Y4KB 1EVTC 3SOBL 3O3DA 3LD8B 5ID1B 1HCVA 4MVBC 5D7JA 5AZEH 3GSVB 2V9TA 2VLJB 4XBEH 4MCZA 2WWKO 3B8YA 5DJ8B 4LLUB 1J8HE 4J23A 2ENYA 3K74B 4PRAA 5L0QB 1IEAA 5IB4B 4UOW0 5ALCL 1ZSDB 3DJ9A 4X4YB 1YUHA 1KLUA 4CAGA 4P5TB 3FO2B 4LQ1A 1C7TA 4LSPL 2XV6B 1I7ZB 3QRGL 3WS3B 2P5WA 3H9YA 3TBYA 5KJRH 3GGWB 2G75A 4KK9D 5LXGL 4CN1A 3WXWL 3NIGE 5C6TL 1MAML 5AWNL 1FPTL 4GRLA 2BY0A 5EZIL 4N0YL 1T5WB 2NR6D 2HWZH 1L4IA 1BEYL 2BCKA 4WHCA 1QYGH 1KPVA 2LFGA 3OJDB 4ALAH 5TQ0H 4ZFOB 2WNGA 5KSAA 4R90L 4PJFA 3FQXA 2E6PA 4M8QB 3WO4B 2EO9A 3MV8D 3QG6B 1V05A 1CD0A 3OKNB 2FEDC 4HFWB 3ULVH 3FRUA 7FABL 4NQTA 1KCRH 1MFAH 5JHDA 1AFVL 2VXVH 5GZND 1F6AB 2CJUL 3D1MC 1AD0A 1NSNL 1JWUA 2D31B 3U7AA 3TESA 2QQKL 4QHMA 4X7DC 1NEZA 2X9WA 4RFNB 4OUUB 5F8RC 1D5IL 5T5NG 4IIQA 1YEDB 4X5WB 4N8CL 1MRCH 2FD6H 43C9A 3UTZA 2F8XC 3MV9A 2YSSA 1W72L 5GGTA 3CFDA 5C08E 5GHWL 5IGXH 2NY3C 1KCSH 3LN4A 2Q76A 3VG0L 1KELL 3GMRA 2NXZC 4OZHB 1F58H 2J6EH 2DYPD 2ZP0T 5EFIA 4P5TA 5FKAA 5HHVL 1TMCA 4M62H 5C8JA 1WV7T 1D5ZB 5FYKH 5J8OA 3UYRL 2X05A 2WV3A 3K80A 3UJJH 1RU9L 2M26A 4JY4B 4L8DB 1FDLH 1CIDA 1SJEA 4N5EC 4OF0A 4CU6A 2WAHA 4XNQA 2UWEF 3KNBB 5H94B 2DBJA 4H8WL 5IMLA 3T0EB 1JZ5A 4PRHB 1FVCB 4TUJA 4G6KL 1N0XL 2QQQA 4DN3H 1J87A 1HQ4B 3ZYJA 4PJGA 3SQOH 5BS0D 4ODUA 4ZS7L 3OKEB 5T5FL 4DKDC 1JYWA 1WFUA 3VFPA 1OM3L 5T3ZE 5HYJB 1DFBL 4JCMA 1QPPA 4K2UL 2A9MH 3V9FA 5TQ2H 1N4XH 2GIYA 1RK1B 1FL3A 3ZT6A 1YEEH 4WNQA 5F6IC 4XPBH 5I1JH 3VGEA 4DGVH 4YDKH 1AXSA 3BKJH 5D7JC 4JDZA 4F9LC 4B0MM 5C0BE 2R2EB 1IC5H 2ATKB 2VC2H 5GS2H 1HHIA 5HDQL 1MWAA 5D7IA 4WEMB 4S0TD 1GC1L 1VKXA 3MUHL 4JB9H 1CQKA 1CR9L 4MXVF 3UBXA 2FJFA 5IB2B 4PJIE 5DLML 4GAJL 1A2YB 1WEJH 2R0LH 5KG9B 2OL3H 3BJ91 3U6RA 3HAEA 4AH2B 2VB5A 4R2GD 4FQIL 2V2WB 1PY9A 1AP2A 2Z35B 3GRWA 3FMGH 4UQ3A 3QWOA 2AEQL 5GS1B 4S2SB 2GUOA 1AXTH 1LEIA 5FKPA 5FOBB 4GAYB 4WUUD 2L7JA 3RUGB 1J8HD 2EC9T 4YQXL 4PUBH 2W9EH 3GMOA 3VRLF 3VWKD 5L7XL 1BOYA 3D69A 5DUML 4HMDA 2LU7A 2W1NA 4HJGB 1ZGLP 5FYKD 3VMOA 2MCG1 4K8RC 1JGVL 1ZMYA 3VRJB 4RWYL 1A02N 1A3LL 5GGSB 3MXWL 2F54A 3DXAD 1W0YT 5ISZA 4XPHH 3KPSE 5CGYD 4HCRA 3MRNB 1REIA 1BQLH 5DYOB 3MRGA 1KXTB 5HYQA 1DUZB 3K8KA 2AXFA 2UUDH 3WNMA 5CJ8A 1XZ0B 2WUBL 5T33H 4LP4A 4M6ML 1U93A 3GRWH 4L4TE 5IW6B 5HHMA 5E8NB 2HLAB 4J3OC 4OSUH 2HAZA 2E9IA 3KYOA 4E41D 5CJXC 3QNXA 3GMLB 2D7TL 4NJAH 1T2QH 3HC4H 2ITCB 5ID0B 4MDIA 2CDGB 3FT3B 3C5JB 1AIFB 4PJ9B 2CKBB 4U1GB 2V6HA 4X6CA 4XMLH 2R1XA 4LQFH 1NLDL 1ZLSH 3TZVB 2B5IB 1NCCH 1A7NL 3OAYK 1A21A 3JV6A 3PJSB 1MCNA 3QJHA 4RAUB 2HLFC 3OZ9H 4WEUD 4N9OB 3QCUH 4CN4A 4L8SB 5DHVA 1DUYB 1KB9K 1ZVSB 2FJHA 4MQXD 4XCEA 4Y4HC 5T1LB 2LTQC 4X7CC 4PJBE 5JW3L 1BIHA 2GTZB 1I1AB 1F4WH 1IQDB 4NO5B 5I17B 4GFTB 5DI8B 1KV3A 4IEFB 2CDFB 2X5PA 3IAPA 4CVXB 2BSSA 1LO3H 3DYOA 4L29A 4LDLB 2NW2B 3VXMD 5C08A 2XPGB 3QWOB 4EN3B 3RWEA 3L3OB 1GZQA 3QCVL 1N2RB 3UTPE 5BVJA 4LVOB 4M4PA 5F88B 3KYNB 2ID5A 1F11B 2QSCH 5IQ9B 3U30C 3BQUB 3RVVD 5L2JA 3L7FB 3DWTA 3C60C 4AEIL 5ECJE 2YD4A 3DHMA 5I16A 4GLRI 5FO7B 1JPFB 4WHYH 5B3JE 3SDAB 3MLVH 2VUOA 4BA8A 4LSQH 2DQJH 4P4KC 5EH1A 4LSVL 4RA3A 5EUOB 3FFCB 3QULA 3DMMC 1S9YB 4TSCL 4OZIE 2YD5A 1PJ9A 3SDXB 3Q5OA 3IFNH 3GJEA 3QDJD 3BYTA 3O8XB 4YXLL 2KZWA 5FF6A 1JHKH 4OLVH 5LGJA 2IF7A 2V7HA 1OQOA 4G8FB 1P7QD 4Y19B 5CZXC 5I74C 2P5WE 4OCYL 3GM8A 5FUOL 3GMMB 3PDOA 4KK6D 4N1HB 1HE7A 2Y07H 2IAMD 3MREA 5D70H 5EU4A 3PXHA 1PLGL 2I60H 5C0AD 1FG2A 4YHML 4YDJB 1A3RH 4X4XA 2Q6WB 5HVFB 3UX9B 5I1HH 3GJFB 1JZ7A 3UTQA 3CX5K 4DAGL 3HE6D 2BVPB 4MAUL 4XXCC 5J1AA 3VRIA 5D7LB 4FP8H 1MCCA 3C60D 3B9KA 1CWVA 4TTGA 5E1AA 4E41B 2Z91A 3EZJB 2G9HA 5FGCE 3WN5C 3EO1A 1EEYB 1U92A 3ARFA 4UIKH 2CLVA 5KTEH 3K2UH 2HKHH 2BXZA 1T4KB 3O3EA 2W59A 1C12A 4NCC1 1T7ZA 4P23B 1T89A 4DEPB 2GTZA 3RVTD 4POYA 1UKSA 2MFNA 3FRPG 4F15C 1HOCA 4YDLB 1A6WL 2YZ8A 3REVB 4LPCA 2F58L 1MFDL 4XTRC 2VLMD 2EZ0D 1F42A 3OBAA 2P44B 1TVBB 1PKOA 2F53B 3UTTB 4FFZL 2EXWC 1UWEH 3ZHKA 1JYNA 1EH9A 1NMAH 2VDNL 5KVDH 3VXSA 1O7VA 3VWKC 1WBXA 5F97E 3O2WH 5DHXB 4D0BB 4XNYH 1MCOL 3AAZA 5ICZB 3FT3A 1X7QB 2VDMH 4RGMB 4YBQC 1Y6NR 1NFDB 4ZPVB 3Q5TA 4MJ5B 4XP6H 4ENED 3HKFA 3F58H 4PRBB 4DW2H 1QSFA 2X7LB 2Z9TA 2BVTA 3MRHB 1NGQH 4A2LA 1S7QB 3T65A 3RNQB 4K3JH 3IFPA 4PGCA 3X3FH 5HYEA 1WZLA 4DZ8B 2GJ6D 3PL6A 3QI9C 4HZLB 4MJ6A 2HTKC 4NO0D 1ZWIA 2HYMA 4G6JH 4Z8FH 4XPGL 3ZKQD 5I30H 3CMOL 3FQUB 3VRLE 4RFOH 4DJMA 4C56D 4X4XB 1UH3A 4G6AD 3FB6B 5FK9A 3PQYB 2UY6A 3S5LG 1P84J 4NUJB 1J1OL 1P7KA 4PP1D 4GMSL 4KMTH 1P7QB 3ARGC 3NGBB 1A6AB 3QH3A 4B50A 4V1DB 5I8KH 4H1LH 3NH7H 2EDNA 5GRUL 3CFKA 4PLKD 3U4BL 3HMWL 4O51A 4AEHH 4XZUB 3STZB 1X5LA 4JRYB 4PJXB 1S78C 2APTA 2GTWA 4BUGA 4H8WC 3PP4H 4TSAH 4FQLH 1KLGA 5C0BA 1S9YA 5DJDA 1CTOA 4OGYH 5F1IA 2QQNH 3EYSL 4MJIB 2RCSL 5L8KB 4KZDL 1H3VA 1HZHL 5DD0L 4M1CC 1C1EH 1WBYA 4M5ZL 1QFWH 2V5RA 3FO0L 3EW3B 5GSVA 4G7VL 5LVEA 1Z9MA 1H5BA 5DJ6A 1FYTB 4K9EC 4YXHL 1U2HA 3EYOB 4ZOCA 4JN2A 3QQ9C 4FQQB 3P4MB 5T1MA 4DVBA 3ME0A 2O61A 4UUJB 3R4DA 3OAYH 4AK1A 3OQ3B 2JK5A 5HY9A 3QUXA 3V4VH 2R39A 4KRPC 1IM3A 4XP1H 3V4UH 3EOTL 1OF2A 4JFHE 5C07A 1FGNL 5KS9E 1U93B 4UI2A 1T20A 2VKWA 1AJ7H 2N7BA 1OHQA 2X4TB 1JZ2A 4G9FD 4I48B 3CJJA 3PABA 2Z91B 4TVPL 2VL4A 5DMYA 3T2QA 2AK4B 3L3HB 5KZCB 3MJ8B 3KVQA 2O5YL 5C0AE 4JHWL 1SJEB 3FONA 4QO1A 3RWGA 1LO5B 4A2MA 3SE4A 2Y25A 1LILA 3WE6A 2AJUL 5LAXB 3TM6A 3IU3B 1KUMA 5I8OL 1CFSA 3RUGA 5K59E 2CLRB 5IB3B 4NDMB 1PKQB 3GHEL 3RBSA 2CH8A 1AGEA 2NY2D 5GS1A 3MJ9H 2VABB 4YO0B 4NYLA 5M95B 3UXFA 4JFDD 2GSIB 4OGAC 4V2BA 1NCBH 3FZUD 1BFTA 5KSVB 1UADC 3C60B 4PG9B 2JJTC 1FFOB 2YEZA 4MQ7B 1NFDE 3PGFL 3OXRA 3SKMA 3T2NL 5IOPA 1XGYH 3GUTA 1MVFA 3LQAL 4KAQH 2ERJB 2HRPL 1VPOL 4NM4H 3NCYP 2YKLH 3R1GL 1EIBA 2H32B 1FIEA 4DGYL 4XAWH 3QI9A 2GITA 5DJZA 4NRYB 3BUYA 4QXUL 3IVKA 3MMEA 2D3VA 2C3VA 2AI0L 1UWXH 3BFOA 3D2UB 3QNYA 3KPRD 1UEMA 4BSVB 3WFDL 5C9JA 4JFEA 1KJ2A 8FABA 1CU4L 1MHEB 2F15A 3TFKA 3DX9B 1E4WL 5JO5A 4TPRH 2FBOJ 3LS5L 4EUPH 3DBXA 1EPFA 2DRUA 5I1CH 1MJJA 3BIKB 4R26L 4G6FD 3TV3L 3MNZA 4PJFB 3WHE1 4QGTA 2ZSVB 1Q0XL 4QT5A 3L3KB 4FABH 1EAPB 3D0VB 3MGTA 5KSUA 3GIZH 3MJ7A 3D3VA 4LU5H 5H2BB 5C0NC 4Q9QH 1TETH 2NY1D 3WDJA 4RAVB 4RDQF 3ARBA 5IVZB 3QA3A 4PRDB 5B38G 1I8KB 3UYPA 4QHLB 2ADJA 2DLHA 4FRWA 2XFXB 3HC0A 3UTSD 5HHQB 2ZOKA 4B7IA 5LCVL 1JTPA 3CXDL 2ZCKH 1JGUH 4PJEA 5CGYC 5F9WB 1JNNH 2EIEA 2ZUSA 5ABDE 5IW1A 1B4RA 3V4PH 1LK2B 4HWZA 4OFKA 3VFRA 2OTPA 2VLRB 1MQKH 2GKIA 1ETZA 2XG5A 2OK0L 3PWLB 4ODWA 1WVZA 3R06A 4JG0H 5HYJE 3FQWB 4QNPF 1BZ7B 2D0FA 4TOYL 2Y06L 5EWIH 4GBXD 1R24B 4OZFH 4Z7UE 3E6HB 4PRPB 4PRHA 2PO6B 3T0VA 3LKRB 6CGTA 3KNBA 5KSBF 1FHGA 4ODTL 5I8EA 1NCNA 3HZMA 2BVEA 4LVNB 1C8PA 3ESUF 5IF0B 4EXPX 4H88H 4PY7B 5J6GA 5DJXA 2OR9L 3LH2H 1HINH 4Y5VB 2DTML 4ZS6C 2EC9U 4Z78B 5IG7A 3IAGC 3C5SB 3PIQB 4YGVA 4F8QA 4P4KA 4HJ0D 3PXJA 4XBPA 1A14L 4OI7A 2CK0H 1SBSH 1MSPA 3QZWA 1YEKH 1S3KL 4TTDC 5EOCH 1WAAE 5FO8A 2GFBA 1DQLH 3WD5L 4TULL 4CADB 2H2SD 2F54D 3RWCB 3LEYH 3TA3A 4KFZC 4NQDE 1SYSA 5IHZB 1FRGL 3KLDA 3CC5B 1KIUA 2FJFB 1EERB 1P6AB 5CINL 5ACMA 1F4XH 2IG2H 1Z2KA 5DD6B 1JPGB 1NCAL 4QTIL 4UT6H 3MJGX 4WGVB 1KCGC 1D5MB 3IXAA 2OJZL 4WFED 4P48A 4ZAKA 3WNPA 3BEWB 4UAOB 3G5ZB 4BSJA 3S3SA 2IADB 4FZEL 3H42L 3AS3A 2PYFB 3MJ9A 2MHAB 3WO3B 1P4LA 4JFFA 3B6SA 1OTTD 4GKNA 3LEVH 1NBVH 1UACH 5KVMC 2ADFH 3Q2CA 5C6WH 3HI6H 3KR3L 1RSFA 1UCTA 4N1EA 1VFAB 4ZYKB 1CK0H 4WWKB 3MXVL 4MNQD 1BQHG 5KBNC 2SEBA 5BZWA 1OGAD 3IDMB 4NHUE 3QUYD 2J8UB 1BFSA 1T1XB 4MD0A 5F9JB 5ISZE 2F5AL 3KYMA 5E7FA 3PWVB 3QO1B 3DVGA 4PJ8C 3RHWK 1I3RB 4GUPA 1JV5A 2V2TB 3HG1B 5DQJB 4JZNB 3QJFB 4M3KB 3F7VB 4HIEA 2GCYB 1K5NA 1Q9LA 2OQJB 3DRTA 3RGVB 4R4NC 4KQ3L 2EDDA 2FSEA 3HE6B 3CLEH 1X5YA 4TQEH 2AK1L 2DS4A 2ZCHH 3R8QA 1U8HA 4Y4KA 1LE5A 1KIPA 3KPMB 4QXTA 3CMGA 1FE8H 3W9DB 2R0ZH 4PP2B 3O3UN 4KMLB 4YPGA 2XQYG 1YEGL 1OL0A 2CIKB 3ZYZA 4HKZB 4U1IA 5IROA 3UJIH 3VDCA 4R7DB 4DFHA 4JPWH 5B21A 4F3FB 1CFSB 1WCQA 4TUOA 3VGAB 1O5DT 4MHHI 1HH6B 1HILA 3H0TA 3FN0H 4KK9C 1MLCA 1MCPH 4LCYA 4MA1B 4X98A 4M7JL 1TJGH 5DK2A 1Z3GL 5EORH 4B5EA 2LVEA 3K1DA 3GSNA 5JPMB 4RMTA 3IFPB 5I0ZA 3CPLB 1CGXA 2RJMA 3MBXL 1R3IH 3HHRB 2C4FU 1ORSA 5D2NA 5C0IB 2A2QT 1LEGA 1N5AB 3N85H 3U36A 3EHBD 1S7SB 1J1XH 3L5WB 2K1MA 3GI8L 4M43L 4HQQL 1IC4H 1PG7L 3EDEA 4ETQA 5E2JA 3SHSA 1ZTXL 4Q7DA 3HZKB 2A83B 2B1HH 5GISH 3MO1B 1PZUB 1OSPL 1AO7A 3DSFL 3O11B 4HCRH 3WBDA 2DQDH 3QXAA 3HCVA 2BVOA 1T04A 2CGRH 3QIWC 3PNWB 2YWZA 4YFLF 3S4SB 4KROB 1IGMH 4RNRB 1BM3L 4XPAH 5IMKB 1FZMB 3RVUD 5BOZG 4U1JA 1IM9B 2EYTB 5L88H 5F7MC 1UVQB 5CILH 1CI5A 5HI4C 2H1PL 2XKSA 4X80H 3NIDE 4MNQE 3QQ3A 5ILTH 1MVUB 1N3NB 1QFPA 2DQCL 5HYSB 1GPOL 4A6YB 5D71H 2GJ6A 1IKFH 3BPNC 4Q97A 2RIKA 1UYWL 1OWWA 3GNML 3WFHA 1XFPA 1JK8B 1CGVA 2OM5A 3OR7B 4MQTB 5F3BA 3MR9A 3WL9B 4OQTH 5EOQL 3PWNB 3QQNA 4NOBA 3FCTA 3U9PL 1FV1B 4MAYD 3C2AL 4YHLH 3MA7B 4G59A 1FL5B 2JTDA 1I8MB 4ZUWB 2XI9A 2C3XA 5DMIL 5JA8B 1BQSA 2NNAA 4EI5D 2MQCA 3OHXB 4X7SH 3WKMH 4PJ7A 3VW3H 1C5DA 2ICCA 3IXAB 5CP3H 2FZ3B 3WHE0 2FX7H 4W6XB 5GGRA 2W65A 4M6AA 4YFLI 1U91B 4N0RA 1ZT4B 1C08A 1KPUB 1ZV5A 1S8DB 4KI5D 1CE6A 4LK4A 2EH7H 3CSGA 1JI1A 4FQHA 3W2DH 5FDWB 3FHQA 5IQ9A 3WUWB 4WEBH 3LDBC 2VAAB 2YPVL 5DVOA 2NY3D 1B2WL 2B4CL 2XYCA 4XAKD 5HI3D 2MNUA 4GRMB 1CVRA 4XBPB 5JHLH 3EJJX 1RUKH 4G8GA 3X12A 3T8XB 1II4E 3GFUA 4JO2L 3WS6C 4J12A 4ELKB 2AJZA 1NUFA 4FXLA 1TTGA 4JDTL 4U6VL 4QNPE 3TP4A 3ZKXB 4JQIH 4JFYA 4UU9B 3LRHA 4RBPH 5B8CC 3L1OH 1I9IL 4K8RL 3T2OA 5F89A 1R0AL 4C55A 1AKJD 1VFUA 1FL6A 2HFGH 5H35B 4LLMA 2GK0A 1QBML 4DTGH 3ZKNC 3KPPA 3QPQD 3GBLA 2ZWLT 1BFVL 2GJ6E 4LCIH 3VXUB 3ARXA 3EYFB 2OMNA 2VXUH 5BOPA 3UJTL 2A83A 2X4NA 4YR6A 5DJYA 4AIZB 2WWKT 2DMKA 4LPUA 2ITDA 2HFTA 2WWMD 3BH8A 1XR9B 2HFEA 2FJGA 3KYOB 4ELMA 2VSDA 3I02A 4PLKC 5CEYB 3VU2A 1J05B 2WIMA 4LCCC 5EO0A 4JHZA 5JDSA 5C0DA 4Z7NF 5E8OB 3PGCB 3BDXA 3GMPA 4P23A 4KJPD 1U8KB 1FL5A 1RPQA 3SJVE 4QRUB 3ULVD 3JV0A 3P3YA 2VTFA 5TDNB 4NO2A 1KBGL 3S98A 1X4YA 5DFTA 3B2VH 3TT3L 4BQ6A 5DK2B 3C6SB 5FK9B 3KS0H 1K8IB 3X11B 4G8GE 3Q6FB 1SQ2N 5TFSL 3TN0B 3QI9D 3C8DA 3ZDXF 3BPOB 4HKXB 3W81A 3IDUA 3VFOA 4PJHF 3QZWG 3DUHA 1Q9KB 4JFED 3P9MA 3W9EA 4F58L 1RULL 2AKRA 3VFVB 1FCGA 1T7VA 3E3QE 4X99A 1FORL 1IEBB 3SPVA 2IPTL 3MNZB 4NKDA 1ZAGA 2FECL 4S11A 5HHME 3V6ZA 2R1WB 3S96A 4NP4H 3L3IB 5CSZB 3TBWB 5IVXA 2FX8L 3U9UA 3TN0A 1KCVH 4PBXA 4JM2F 3N0PB 4ZTOL 2NY3B 1P9MA 5AZ2H 1KNOA 2HKFH 2FWOA 2K3TA 5IB2A 3HCVB 5C92A 1VENA 3FQTB 2DF3A 2P5EA 5IK3B 5J57B 4PS4H 1CGYA 1CD1A 5TJWK 2FH8A 2R1XB 3INUH 5F7DB 3BE1H 2ATPA 3QO0B 4EN3D 1BAFL 1U9KA 4WTZG 1BVKB 1NC2B 4PTTA 5IVXB 4LF3B 4KKBD 1PSKL 2QSTA 4OFYA 1HEZB 2I9TA 5IB5B 1K2DB 3FN9A 2AABH 1EV2E 3CVHH 5AUMB 5C0FB 3K7UA 3CH8A 1JWMA 1IGTA 1OAYH 4P59H 5DTFB 1S9WA 4OZIA 3NACL 5HYQB 3FONB 4MA7H 4UQ2B 1J0IA 4NZDA 4YEFA 3HMXL 1MJ8L 1SY6A 3WCYA 4E42B 4NSKA 4HD9A 1KG0A 2HT3D 3KDMB 3VRIB 4K23L 1MELA 4OTXL 4IRSD 2Q7YA 5I1LB 3O9WA 1MFCL 4JFFB 4PRHD 3ARBC 5E00A 2PKDA 3D39B 4F2MA 2G5BB 3BN9D 5GGTL 2R9HD 4ODVL 1I85A 1D6VH 2O93L 1GOHA 1TMCB 2VWEE 3CSBA 3MRMB 1DANT 3CK0H 4NQVB 5DHYA 2EIZA 4YX2L 4GW5A 3MFFB 1P5VA 1J0KA 1K4DA 1IZJA 1GGBH 2B1AL 1M71A 3QAZB 4LSSL 4MXQA 1EFXA 1YNLH 2O61B 4MXVE 1T22A 3S37X 4ZPTB 1IRAY 1NJ9A 1UGNA 4RCAA 2P43B 1MIMH 4YR6B 4GG6A 5IV2A 5HVGB 1CD9B 4OZFA 4UOW1 1N7ML 2D03H 4EUPB 1ZANH 1JFQL 3VMNA 3TVMD 4H5SA 3CPLA 1IL1B 3PWPD 4EIZC 5C0EB 2FR4A 5ESAB 2DM2A 1T83C 2YPLB 3UROR 5HI4D 1TQBC 1NC4D 5ISZB 4XC1L 1KEMH 4GOSA 4ZDHA 3BZDA 2H45A 3WV0A 3WDIA 3OAUH 4KUZH 4HUVA 5IJVB 4WJ5A 1MFEH 1P4BL 4HULB 2Q7NA 5T3XD 4U3HA 1A7RH 3LV3B 4DGIH 2ZJSH 4U1IB 1A7OL 4N9GA 5FA4B 3VCLA 5T3XL 3VFOB 1KF9B 5D7LE 2JB5H 4LSTH 4ORGB 1F90L 4N90E 2ZUXA 5CJOL 1FNHA 2H8PA 2FEDD 1GGUA 3RA7H 1NGWA 4XC3H 4N0UE 3G5VA 3E6FB 2GT9B 3U4EA 1C08B 4O5LH 2A6IB 5IMMB 2IH1B 4O00A 2YRLA 5BS0A 1JZ4A 3L3DA 4M61A 3IU4H 2WP3T 4PJEB 5CAYB 4DUWA 5C0RL 1IM9A 4OLZH 4KZEH 3EFFB 3QUYA 5DJCA 4HPYH 4HLJA 2DM3A 4RISL 5C0DB 4ZXBB 5DD3H 3W0WE 3HG1A 3CFIC 3L95A 4RSVA 5CEYA 2C3GA 2EDTA 3RL1A 4R0LC 3B83A 2NY5H 3MLWH 2BHYA 2X1OA 5BS0B 3H3PL 5ICYA 3OKMA 5I73C 3RRQA 3VXRD 2EE6A 4FQ2H 3WFBL 4M48L 1IKNC 4Y0GA 2C4FT 4X6DF 1QRKA 4PY8J 2NW3A 1V8HA 3VXQA 2EEBA 5JXEA 1CLCA 1FO0B 2FECI 2IPKB 2OP4H 4RQQA 5C2BH 1LDPH 4NOFA 2BFVL 3BW9B 3BPOC 1A0QH 1CDIA 4JREC 4KY1L 4G42A 5GSRB 5ANMA 2AEWA 2D9QB 1X6LA 3HS0B 2Y5EA 2JE8A 1OTSD 3SDCB 3O6KH 3HPJB 4O9HL 4NJ9L 3KPSA 2VN4A 3ARDD 5IHLB 1LEIB 4U3CA 4R2GC 4UILH 3MGAA 4PLNC 2C3VB 5MEOB 2VZSA 1DQDH 3MRFA 1K9TA 4WENB 1Q72H 1D9KA 1CFTB 2IWGA 1HH9B 3PWLA 3CCHB 3IXTB 1F3JB 1QSEA 3WDHA 4WI8A 5EU4B 3U30B 3VWJB 4K71C 1XF4B 4OZIF 4W4OC 5D7SL 3QDJE 3U7YL 1OAQH 4YEEA 1IC7H 1YNKH 3QFDA 1CD8A 4LBEB 1TZHA 2EECA 1YPZA 3BPLC 3TT1H 2FGWH 4QOKD 5BQ7B 5EUKB 5DWUL 3TBSA 5DFVC 3IXTA 3HZVA 2X41A 4U6XB 4Z0XB 1BGXL 4HUMB 1WWAX 4S0SD 3DURB 1UM5H 4JZOA 1PG7W 2VITA 4JR9L 3QCTL 4NFDA 4ODSL 4IS6A 1RJZA 1QNZL 5IKCB 3UTPD 3KPLB 2RAMA 1CXKA 4QYOA 3CLFL 1W72B 2JJWA 1A6ZA 4U1KA 5MP6H 4AT6A 4I8DA 3SDXE 1TJHH 3UZEA 1I1FB 5EUKA 2B39A 1FZKB 1UM6L 3AM8A 3V5KB 3T77A 4RGNC 1Y6KR 2W60A 4NPYB 5AZEL 2RFXA 4U2YA 4UV7L 4JO1H 1U8LB 4HBCL 2F9BT 3PHSA 4QYOB 4KI5E 4R7NB 5EZLA 5KW9L 4NQSB 2PO6C 4Z7QE 5T1LD 4F33A 1U8HB 4L3EA 3U4AA 1X5GA 1N59A 5E9DB 4L4VD 4GSDL 3N9GL 4WUKH 3ARBD 4OCXH 4MS8C 1V7NH 5DURD 1AO7B 3RL1B 4F8TA 5BCAA 4R7NA 3RZCC 1OW0C 4I18A 4R96A 5IBUB 1R3JB 1AR1C 5GJTL 3IF1A 1BBDH 32C2B 3ZE0E 5FECB 1BVZA 3GHBL 2HMID 3BPNB 4M9PA 2EKSA 1RMFL 1INQA 1F3RB 3WNKA 5CSBA 3GIVA 4DKEL 4BFGA 5CD5D 4IDLA 5F1SA 4Z77B 1AO7E 1HCFX 3UBXG 2NY4D 5J0BA 3DUSB 3VJ6A 4LLQB 5TDPB 1AR2A 1NFIA 4MD5B 4AL8H 3CZFA 1FAIL 5E03A 1XT5A 2HT2D 4C59B 4NCC2 4OJFH 3BP7B 4NO2B 1UJ3A 3B9KD 1NSNH 5CMAB 1LD9A 2MKWA 4HAGA 1JF5A 1IMHC 4KJPC 4KVNL 3N1FC 2BC4B 1INQB 1T0MB 4QF1A 4FQJH 4CDGC 2A74B 2YEZB 1FYTE 4ISVB 2ARWA 1MEXH 1EMTH 4R7DA 5IFHL 1RZFL 3C5ZC 5I1AA 5SWSA 2XWJB 1LWRA 3O8XD 1J86A 2CIKA 4WWID 1M6OB 2XOTA 3X13A 4HXAH 3IETA 3TNNB 4PRPD 1ZHLA 5IT2H 2EH8H 5EBLA 3HPLA 4I0KA 3SCMC 3ARGA 5LBSH 4E41E 2R29L 3QPQC 5IEHB 2H6PB 3PF2A 1ZHBA 4MNGB 3TA3B 4QY8A 3EFDL 2WQRA 4MJID 4OLXL 3P4OA 4GRWE 1XIWA 1FDLL 1KCKA 5FHAH 3PABB 1MH5A 4ZQKB 4JZNA 3MNVB 3LQMA 3VI4F 2X4QA 4PJAE 1SYVA 4O51B 3DX7B 1QFOA 1QTYT 1VFMA 3RGVC 3CFEA 4XCCL 2DYPA 4OD1H 1KN2L 4DK6A 5D72L 5ANMB 5ITFA 3T8XA 5D93C 1GIGH 4G8GB 3F8UB 3W11C 5HI3C 3LKRA 1OP3H 3PDDA 4K2UH 5D7LA 1UG9A 4JN2B 3OTTA 3MRQA 3C09C 3H9SE 1JWMB 5C0FA 3QEQD 4MJ6B 3IFLL 3H9SB 3DSNA 1U6AH 1Q1JL 2IMNA 1F3DH 3OKMB 2AJVH 5FOJA 3QEQE 2HVJB 3SJVB 1YEFL 2DLGA 1EJOH 2CIIA 4LOUD 3FB7B 4FHBD 4XWOD 4PGBA 4S1QL 4JFDE 4JHBA 1GC1H 3G6JB 3UCRA 5E2VH 1CL7I 3MRJA 4ZD3L 3NA9L 4FNLL 4HMCA 4BSVA 1Z9SA 3QFDB 4WW1A 4XP4L 3S9DB 5MERA 5GGUB 4R3SB 1DBMH 4JY5L 4F2MB 1IAIH 3S35X 2ESVA 4AIOA 5J1TC 3Q6GH 5I19H 3SDAC 5ADOL 2Y7QA 4MB4A 4OKVB 4UDUB 1KTKE 1QPXA 3I6GB 3GK8L 3TJEL 1GJIA 4MSWA 1OQXA 3KG5A 25C8H 3VI4E 1X4ZA 5HHNA 4JPKL 5H2BA 3QUKA 4IRSB 4RMSA 4EDWL 4PJ9D 3HE7C 5EU6A 4NN6C 1EGJL 2HJKA 2QHRL 4OLUH 2QBWA 4U1NA 5J4MA 5F7UA 5DUBA 3ROOA 4F37F 3NAAH 3C5SA 1JPSL 1U3ZA 3VGAC 3R0NA 2W0PA 43CAB 5CP3A 4ODXA 3MRLA 1BQLL 4D8PA 5E2UH 1IAOB 4ZO6A 4M8QA 1NKRA 4XCNB 3J8F7 3DTXB 2WUBH 4NQXA 5FYJE 3QHFL 3D2UA 1FYTD 2X9XA 1Q9WA 1U3JA 3ZLQC 1T03L 1L9NA 2XA3A 3NCCB 4GO6B 1OD9A 2WBKA 4R0LA 2R69H 4ODWB 1OCWL 4I13B 3O4LE 3GB7A 4M93C 4GKZA 5IVXE 3LY6A 5HJ3B 3U83A 3ZTJG 1YECL 1RZ8A 5C09E 4LKXA 4FXKB 5B4MC 4XVUC 4GBXC 1NH6A 5HGBA 1UXWA 3GSNL 3VXOB 5FM5M 4XPTH 4O58L 4JQVC 4PJFE 4UOJA 5CGTA 2QV2A 4IRJC 1UH4A 5CJQH 5JZ7D 4JN1L 1NLBH 4Y16D 1HSBA 3ARYA 3O3BB 3QCUL 1KIRB 2DBLH 3HNTL 4A6YH 5JR1L 1OGTA 4M03A 1VESA 1EHXA 5TE4H 4LPYA 3KYAA 1EHLL 3GJFK 2A1WH 4I3SH 2OTWB 3QHTC 3CVIL 4OCWL 5KSBA 1JZ3A 3EDKA 1S7VB 4KROC 2LU3A 2R8SL 3Q1SL 1MLCB 2XNAB 2J8UF 4YHYC 5CSZA 3TBWA 2YD3A 4PJCF 3QSKB 5KN5B 5EB9A 1YEJH 1ADQH 1QFUL 4F9PC 4CBPA 4S1DD 2VLME 4AG4L 4M8VA 4D94A 4FQPA 5DUBB 2XXMB 4FFVC 5SV4A 4ELMB 4M7LH 1IAKA 5EDXA 3EYQC 4M6OH 1CLYL 1CFNA 1J10A 3O3AA 5CZKA 2X09A 2ATPB 3QO0A 1RJLA 4XNZB 1L0XA 4HFUH 2VQ1B 1CD1B 1PZ5B 5CP7B 3ECBB 2R0KL 4Z0BL 2F5BH 3BGMA 1JF1B 2BP3A 4PPTA 4Z7UA 3OV6A 4KJQC 1UM4H 4WW1B 4YUEH 3FB8B 2VO5A 1DBAL 4OZFB 2FIKB 4U1LA 2HH0H 3OG6B 1F11A 3ABZA 1I8MA 1J0HA 4WTWA 5I76B 5EZJB 2DQTL 3VXOA 1MREH 4NWTH 3Q0HA 4QHNB 5CMAA 1J1PH 2XQBH 4MAUH 2X4NB 3QFJD 4ZXBC 5E8PB 4OGXH 5DZLA 1ED3A 3RVUC 5JPNB 4UB0H 1G6RH 1ORQA 3DARA 2VMFA 2UV3A 4JHAL 4YNYA 3TYFA 3AXLB 3ULUH 3DIFA 4F9PA 1T80A 4WFHD 1E4XH 1J12A 4GMTL 3OSKA 5DA4A 2Q20A 1YJDC 1P5UA 4DVRH 3X14B 3S34L 3QIWD 1ZE3C 3K2UL 5EU6E 3NIFF 4XCEB 3MRPA 2FBJH 4Y4KC 2EDWA 5D5ME 1DUYA 4KU1A 3RTQB 5J6HA 4DUVA 2PN5A 3DTXA 1TJIL 3EGSB 4HWUA 2CQVA 5DJAB 1G0XA 4ONGL 3VXRB 2UZIL 1DSFL 2P49B 1GVIA 5IHUH 5C0CB 1I8IA 1JHTA 3EOAA 5DUPL 1QSFB 3ARFD 3D6GA 1IBGH 1I75A 1RZJH 3MCKA 3VXME 2CO7B 5IB5A 3LB6D 5B8CB 2X40A 1MI5A 3DGGB 3PP3H 5A2JH 4JKKA 4P4RB 1E6JL 5I9QB 2J4WL 2BOBB 3ARDA 5E6YA 4FQQA 4D9QD 5IBLD 1CF8L 4MWFB 1Q0YH 1LEKB 1I7TB 3FAXA 3IYLW 4LRNL 4M1DH 3RDTC 5ALBH 1NL0L 5E8EB 4ZOEA 4HWEH 4JFQA 4QXGL 2Q87A 2L7UA 1T5XB 3RWCA 3U7WL 3CVHB 1JNLL 4LLMB 3RY4A 1TVBA 1E28A 2AS5M 4Y5YB 1D6EB 4P2OB 1UXSB 3CDCA 3KJ4C 1KB5H 4OCLC 3MBEB 5I75C 3DROB 3MLUL 1TNMA 3HLAA 1HHKA 1LQSR 5FM5O 1GZPA 5F96L 1B6UA 5IESH 2R9HC 1OP5H 1KEGH 4Z76B 2A9NL 3NFSH 3TPUE 4Z7WA 5DRWB 5I74B 3DO3A 4ERSL 5GRYA 5F7YC 4D9QE 2Z0BA 1R24A 2HP4A 4JJHA 3LZFH 1BD2B 5B3NA 3P4OB 3QIBC 1MFBH 5F88A 5CBAA 1T5WA 4Y89A 1QEWB 4BH7A 5DURB 1DVFB 1UH2A 3HMWH 3MGOB 4AEHL 3C6SA 5FCUH 1NDMA 4BYHA 3DXAE 2V7NA 1DLFH 1OVZA 4DZ8A 4GW1A 1UB6B 3DUUB 1DCLA 4P3DA 1NGZA 4KVCL 4PJBA 4MGXA 4X6CF 1FNGA 1HSBB 1QHOA 4UNUA 5HHQA 4RNRA 5DXWA 3TYGL 3V52L 1QLFB 2R0WH 3QULB 1FNAA 2HFEB 1AE6H 5DJ8A 2NYYD 2Y9RT 1U58B 4R8WH 3PJSA 5EUOE 5E9DA 4LNRB 4D0BA 1IT9L 4X5WA 5HYJA 1BF8A 3B43A 1ZGLM 4GJTB 5JXEC 1DL7L 2DB8A 3NOIA 3EOTH 4YIQB 1FH5H 3MLYH 1FGNH 3D9AH 3VE0B 2XPGA 4EN3A 4BELD 3QUZB 5J11B 2R2BB 5E8NA 4LHUD 1RZIA 3MACL 2Y5TA 4TVPH 1BLNB 3MCLL 3C9NB 2NY6B 2BRQA 1W72A 2ZUYA 4P3CH 4AT6B 1A7PL 2A6KB 4HIXH 2UUDK 4JCLA 3FQXB 5MENE 3P0YH 1MH5B 1CGWA 5CWSB 1J5OL 3DI3B 1M4KA 5CGMA 4NZRL 2VDPL 5L9DL 3BDYL 2O5XH 3RPIA 1D3CA 4POZD 3THML 3QJHB 2X70A 3JWDH 2P45B 4OM1L 3GSWB 5DRZA 4F33B 5SWQA 1RHHA 2ZPKH 5DJ2B 2PXYB 5DD1H 5F6IB 4GAYA 4R4FH 5CD5C 1XGYL 1WZ1H 1PGRB 3T0AA 3IETB 4G8FA 1N64L 4CNIB 2ZNXA 4HWBA 5C0CD 3JTCA 5HPMA 3NCYS 1T6WA 3BHBB 5ESVA 3IDIA 1Y0LB 3BDBA 1A1NA 5F9OL 4CMMB 3BKYL 3ARVA 2VDLL 3GSWA 3S97C 3VFUA 2WBJA 4OT1H 1L7TH 2COQA 3FB5A 3LS5H 9CGTA 1MWAB 4PJDA 3K4AA 2QQLL 5EC2B 4K94L 3P11H 5DRNA 4XP9L 1URLA 4Z77A 1HHHB 4N0CD 2OL3A 1KB5B 4I1NB 4PJ5A 2VZ1A 1IM3B 4WI3A 2WINA 4Q9BA 3IDMA 3C08H 1T0NB 5F1NB 2GUOB 1TZHB 4S2SA 4G5ZL 4G7YH 3VFPB 1MCSA 5GJSH 3U2SB 5IFAH 3LPFA 4NNPL 1FSKC 2CUMA 2P42B 3KYKL 5GS0D 3DRQA 5GGVL 3CIQA 1QP1A 4P9MH 2FJHB 2CRMA 4F7CA 2O26U 3IB4A 2OZ4H 3D3VD 3UYOD 8CGTA 3T3ME 4XRCA 4ZPTA 4JO3H 3SKJL 2F53D 4MNGA 4HPOH 1IAIM 1RHFA 2D0GA 2YN3A 4OI9A 1C16A 1UWGL 1HXYB 4NWUL 2Q3AA 3JBG7 3HI1B 1FVEB 3BPCB 5J6GB 3P30L 5DFVD 2BNQD 1YDPA 1GGTA 4MS8A 4PGEB 2DQFB 3RDTB 1OTUD 1CLZL 2HT3C 2EIBA 5DGRA 3OXSB 4JG0L 4XNXL 4EI5A 4PRNA 3JTSB 1J88A 4JAMA 1CS6A 5TDOB 5BZDB 4HUWB 4R9HA 4GKSA 3G08A 1QBLH 3O0RL 2MPAH 2BJMH 2B7DT 3SKNA 4LFHD 1MRDL 3RNKB 4EBQL 4HF5H 2WUCL 2X4UA 3VFNA 4YAQA 3RWHB 4I5BB 1HNFA 1OPGH 4RMQA 1MFAL 3CDGB 3LV3A 1WICA 3VXTA 1ZHNA 2NXYC 3PWJB 4XWGL 1YN6B 3LKSA 2W91A 3MV11 3SO3B 2C1PA 3G6JE 4WHDA 3L5IA 3S88L 4WVRA 3PHOA 3DBXB 4XPFL 5GSRA 2IADA 1TZIB 4ENEC 3LS4H 5TPWH 3G5ZA 2R56H 4P5KA 4S1SH 4Y4FA 1KPRB 5DT1L 2IALB 3V0WL 2PTTA 4N8CH 4WFGD 3LN4B 4ZTPL 4MD4B 5EIIA 4MA3B 5MEPA 4TSBL 3AVEA 2RR3A 4P9HH 1DBJL 4PRDA 5HHOE 4U7MA 4DN4L 3QQ4B 2J6EL 3U0WL 2KKQA 4KHTH 3I6GA 2IEPA 5KS9B 4OKVA 1KC5H 4U0RC 5FO8B 2QSVA 2YUVA 3MLSL 5DR5L 3MRCA 5C2UB 2XT1B 4TUKL 1KPRA 3K81A 3OKKB 4QHKJ 3BRDA 5I6XC 1HXYA 4TRPH 4IJ3C 4H8WH 1X5FA 1U8QB 3HAEH 3WFEL 2GY5A 4F7EA 4OKDA 3MRIA 4OV5B 2V7NB 4MJ2A 5DEZA 4P23D 5HDOA 5T5FH 1H3UA 4PIRF 3L3HA 1JYVA 3GBNL 1DBBL 2VZTA 2NQCA 2XN9B 2VSCA 1DE4B 3AS2A 5I1DA 1JNHB 3WLBB 1QRND 5D1XB 2IH3A 2VDRL 1B6DA 5F7NC 1R3KA 3SE8L 2DQGL 1PBYA 4NQEE 3VWKB 5I15L 3QAZC 3QUZC 5J11C 1I1YA 1UEYA 3A6BL 4F7EB 1AGCA 1JGEB 3ZKMC 1IGFL 5C0AB 4I9WD 4JY4A 4L8DA 5C08D 1N0LA 3D48R 1OGAA 5JIHA 4EVNA 3BZFB 3GKWH 4JB9L 2FATH 5LWYL 4FXKA 2YS4A 1P4IL 4OM0H 1HIMH 1WCBA 4GAJH 5HJ3A 4P2CG 3I75B 1AY1L 5E2WH 5DJZB 5GRVK 5C09A 4PB9H 1RIVH 4AEFA 4WHTB 1WT5A 3REWB 5GS0C 4DKFL 4HHAB 5D7JB 1EK3A 3TBTA 1S5HB 3M8OL 2HRLA 1MF2H 4OAWB 2VIRB 3B2UC 4PLJD 4MMXC 1YY9D 1W8NA 4MWFA 1QLEL 5DC0A 1NEZB 4PUBL 1V5JA 2CR3A 3EOBB 3LB6C 6FABL 4HUKB 2HMIC 2XRAL 2VWEC 5CSGA 4YPJA 3KPNB 4KJYB 4OD3H 3EO9L 2C5DC 3JVGA 3L3KA 4KQ4L 4IM8A 3TH4T 1PKQA 2P5WD 1KLFA 4I3RH 2ADGB 3QHZL 4JPVL 3MXWH 3DVNA 1DQQB 5IBTH 2I9TB 1AR1D 3IU3A 3L5XH 3E8UL 5DRZB 2A73A 4TVSa 5CUSH 3LDBB 4LLYB 2BNRE 3HLAB 1G7PB 1H8NA 1KJ3H 2DM7A 2DWEB 5FUZL 5B39G 2X1XR 5IB1B 4JVPA 2HA1A 2YXFA 4LLQA 5TDPA 5D6CB 3BIAX 1A5FL 3NFPB 4UDUA 3SGJC 3WEXB 4GQPH 5SV3A 4M43H 5C0CE 4Q6IB 1MCFA 2EDJA 5FIEA 5CP7A 3DXAB 4JFPB 5C07B 4KJWC 3M17A 1YYLL 4QCIA 1IGIL 1YY9C 5JHDD 4LQFL 1UFUA 4RGND 3HTLX 2FJGB 1JP5A 4IHOA 1MI5B 3DGGA 1UA6L 2F19H 4V1DA 5JW4N 1NAML 4X5XB 4KKLC 3CU7A 3QXDB 2VISA 3O45A 3ROLB 2A6DB 3BMVA 2HVKA 3RUGE 2P46B 3NZ8A 2DWDA 4PJ9C 1MRFH 1R3HB 1K8IA 3X11A 3LOWA 2PF6A 2QHLA 3JTTA 1ZHKA 5GRJL 4CU8A 1F4YH 1BJ8A 1S78D 3K2MC 2JB6B 3PWPA 4NZTH 2JCCF 4JFHD 1LO3L 2VOTA 4K7PY 1XGTB 1C12B 4Q2ZA 3QXTA 5FFLA 1M7IA 4HH9A 2X4QB 1S7WB 2CRIA 1VEOA 1F3DJ 4PRPE 4ZQKA 4BKLA 4WJ5B 1NMBL 1EEUA 4XX1E 5FA3A 1AP2B 2FHBA 5I8CA 5I18L 4HV8A 3L9RB 1V3LA 4TNWF 1INEL 5SWZB 4GXUN 2YPLD 5ERWA 5ICXA 1TENA 1H9VA 1RVFL 2WBJC 4C56A 3D0LA 3HUJF 3RIFK 3RWIB 4LAQL 4UIMA 5MEQA 1J8KA 3VW3L 1U36A 4NIKB 5CJ5A 4XCFH 1WWWX 3BQUD 4V3DB 3L6FB 3TNNA 2E6JA 4JRXD 4ONHB 4P5MA 3RWFA 3ALWA 3IDXL 4KI5F 5JZ7C 5BMFL 5FUOH 1MCDA 3SE3C 3S37L 4U3XA 1VDGA 4JPIA 5E99L 3QISA 3EIFA 2VLKD 3I6KA 4P46A 4NYLB 3U48A 3S35L 4MMZC 3ZTNL 1DQMH 1YN6A 3F12B 1EO7A 1RZ8B 3HRZA 1ZHNB 2W0KA 1B2WH 2EDKA 2KUTA 3P9MB 3W9EB 3D39D 5JUEH 4PTUA 15C8H 1RUKL 2J8UE 1KCUH 1D9KB 2IH3B 2ARJA 3H0TB 4GQ9L 1PQZA 4TUJB 1CFBA 2LVCA 1E4JA 1S7TB 3FT2A 4WFHE 3QEGL 1S8DA 3REVA 4JGMA 3TPUB 3W0WB 4YLQT 4WV1C 2BVQA 4OIIH 3T4YA 4CRPA 4WTZA 3RDTA 2E7LC 4X8JB 1ZXQA 4JEGB 2AJXL 4YHOH 4LHUA 3PGCA 4X6FA 5JOFB 4NBYB 5ACZB 3ROOB 3RY5A 5C7XL 2PYEB 1GGCL 4EVNB 1U3YA 1IJ9A 3FO1A 4HUXA 4X6DA 1EO8L 4HC1H 2CJUH 4LRIA 3WIHH 4YHNA 2YSSB 1I3GH 4PJFF 3RY6C 3UTQB 5D8JL 4K3EH 3MR9B 3OKLB 3WL9A 1FYTA 5CEZH 5T3XE 1RZKL 3HZYA 4YNYB 3LKQA 4Q9RH 1CZ8L 5K93A 4LNRA 4J6RH 5BV7H 3TCLA 4JKWA 4XVJL 1D5IH 5HHMD 4YXKH 5ETUB 3EJZC 3CGTA 3IRPX 4HXBH 3TH3T 3WXWH 1DR9A 1W72H 5IGXL 4P5KB 1OT1A 1FO0L 1FAKT 1RZKC 5LJYH 4KDWA 1X5ZA 2SEBB 3NABL 4KHXH 3L3IA 1T0MA 5C0CA 3OKNA 4XVTL 4NHUB 1RZ7L 4HGWB 5I30L 3MYJA 4GXUM 3WIFB 3QH3B 1A6AA 1XGTA 5TQ0L 1FZMA 1PX4A 4P2QB 2DI7A 2APVA 3QEUB 4PDCE 3UJJL 5C70A 1P7KB 4R90H 4XXDA 4PJAA 1BZ9B 4AIXA 3MGOA 1EZVX 3X3GL 4AENA 5EG6C 4G6MH 5E6IB 2GJ6B 4XMKH 4Y4FC 1KCRL 4ORGA 3HI5L 5JQ6L 3HE7D 1QQDB 3BAEL 4FQCL 3IDNA 3ZDYF 1ZHBB 2IQ9H 2IJ0C 1HK6A 2AXHA 4KRPD 4DQOL 3HZKA 1EHAA 3WIFA 3IF1B 2FX9L 4OFIA 4KZDH 1YJDL 5TQ2L 4YPGB 2GJZB 3V2AR 4QHKI 12E8H 3IJYA 4HKBB 1MJ7L 4HEPG 5CKAA 1JMXA 4ONHA 1HHGA 1CFTA 2W9DL 2APXA 1K8DB 2D7PA 5DVMA 3SKOA 4CADA 4MVBD 1V3JA 1UJ3B 3SDAA 2VC2L 3W0WD 3EDJA 3WFCH 1JNJA 1CG9B 5FO7A 4MJIE 1ZEAL 4BQ8A 2C26A 4B41A 4L4VA 3S36L 3GMQA 3MRQB 2VZVA 4UNTA 1LEKA 4RGOH 2F53A 5IR1B 4ZO8A 4FN0A 5T1DH 3FT4A 1MPAH 1G9ML 1INDL 2LQRA 2P48B 3IAQA 2IMMA 1NGYA 3U1SL 5EIVA 1S7SA 1MVUA 3O2DL 3FMGL 4HS8L 2YMXH 3P9LB 1RUPH 5C0IA 2WW8A 3SQOL 3KAAA 3C09B 5DI8A 2I24N 5KN5A 4LCCA 3ULSA 4JG1H 3DGCR 5CCKL 2X4SB 2AEPH 1Q9WB 1KIPB 2FB4L 4NM8H 5J1SC 4OZ4A 3QT2A 4H26B 4E0RA 4WCYH 5HD8C 1PVHA 1MNUL 4P9HC 3X14A 3WXVH 3MJ9L 5DTFA 5DSCB 3GBMH 3VI3F 3I84A 1CFVH 1Q9OB 2ED9A 4LSRL 5KVGH 1JPST 3ROLA 2ADGA 4PJ8B 3C5JA 1NCDH 1V7MH 1R5WA 1H3PH 4G3YH 5DQDH 5A1AA 4NM4L 4J3WA 2CXGA 2NTSP 3QUML 2MMXA 4Y8AA 1L6ZA 2A74A 3NCBB 4Z95H 1N5YH 4MNQB 1SEQL 3HE7B 4RAHA 1QRNE 5IIEA 2ZUTA 4K71B 2XKNB 4P57A 4XMLL 1QSVA 2B2XL 1E4WH 4I2XA 4QXWA 1A7NH 3RTQD 4C54A 4Y5XB 4LVOC 4NNXA 3I75A 3T0BA 4CVWA 1RJZB 4XTRD 3HNVL 3HN3A 4M7LT 5SWZA 4G8IA 4GKNB 1AXSB 1Q0XH 3FRPA 4HV8B 4WDIA 2R1YA 3ERYA 4P5TD 1A7OH 3GIVB 1N2RA 5BVJB 4WU5B 4PGJA 5B39B 4U49A 1HHKB 5T1KB 3LKSB 2VUYA 3H9ZA 2AP2A 1OAUH 5I6XB 3VXTB 4WI2A 5E4EC 1JHLH 4NNXB 1MJUL 3I2CH 3H6JA 1G0YR 4YWGL 3AS1A 3CFJB 2H32A 5I71C 2AGJH 1PYWB 3T0EA 3O2VL 3JTTB 4DK3A 4LVEA 3HZYB 2DN7A 4LP5A 4GBXB 1TVHB 5ELIA 1M7DB 4HWZB 5B4MD 4QGYA 2D7TH 1I7TA 1YC7A 5MEPB 4LSPH 1QSEE 3OXSA 3LIZL 4QRQA 4QRPB 1Z0NA 1A6TB 1PEZA 3Q48A 4PJIB 3U0TA 5CJXA 3O6LH 4Y2DA 4JQVA 2IPUG 3GMPB 3DYPA 5LXGH 5EO0B 3MRMA 2CR6A 3BJLA 3Q3GA 2JIXB 1TIUA 1NGZB 3HS0A 1IM9D 1TQCB 2EDBA 3HZMB 2W92A 2BVQB 2A6IA 5IMMA 1AGBA 5DMGC 5EN2B 4O2FB 4ALAL 5M7QA 4ZFOA 4PJIF 3OR6B 4LPTA 3MRPB 3FQNA 2HN7A 1T1ZA 4K3GA 3LQZA 2ZG3A 3EZ8A 4NZUL 4JLRB 1T1YB 1FCCA 3SDXF 3ZDZE 4X5LA 3VFGH 5I1DB 2VLRD 7FABH 3F7YA 4X6BA 4Y4FB 4JGUA 1LO0L 2DTMH 2VH5H 5FO9B 1FP5A 4DFIA 3QUXD 3CFBB 4UT7H 2DQHL 5JHDB 3VXUE 2DLTA 4UILL 1A14H 1I3VA 1PKQE 1F5WA 4RX4A 1A9BA 3A6CH 3DNKA 4NKOA 4AJ0A 5EOCL 4LASH 4UIKL 3HI1A 1Q72L 5DRNB 1M05A 4JFEB 2HKHL 1A7QH 4I0CC 1D5MA 2QADD 4Y4HD 2AEIT 1XF5B 4GRMA 3ARSA 2Y36L 1MRCL 3KPSD 5DD6A 1UB6A 1BZ7A 3CFDB 2VAAA 5EO9B 3ZSSA 5DFWH 4XI5C 3U4EB 3B3IA 2EDFA 5K9JL 1U3HB 4BH8A 3G08B 5IEHA 2I5YH 1SJXA 1LE9A 1KFAH 1ONQA 1AQKH 3L9RA 1CE1L 3TT1L 4M5YH 5A3ID 3HB3C 5BXFB 3LKNB 5DMKA 3V7MA 4OCMC 3O2WL 1IAKB 1ZVYA 2FDBP 4NRXB 2Y07L 1FLRL 5E5MB 1C5CH 2BERA 3C6LA 5E2TL 2WY3A 5IG7B 2KPNA 4W81A 2J8HA 1Q9KA 1QNZH 3JXAA 4WTXA 3ZE1E 3IGAB 2R2HA 5E70A 1QQDA 1AO7D 2AV7A 1FVDB 2X4RA 5F9JA 3GSVA 3KDMA 4ZS7H 1I7RB 2HG5B 5BZWB 4E42A 5KOMC 3KGRA 5HGHA 4K3JL 4PJBF 4HJJL 4PJDB 4X6EB 1KTRL 4C4KO 1ZGLA 2G5RA 3K8MA 5FYLL 1T1YA 4XGZB 1OSZB 3BP4B 1FFQA 4Y88A 4Z8FL 1WLHA 4PJ7E 2HFFA 4YDKL 1KENH 1N3NA 5JDSB 5TGBB 4PRIE 5TDOA 4ZAKC 2E7LA 2LAGB 2BDNH 1CGSL 1IC5L 4N0CA 3LRGA 4F9LA 1KB5A 3MSPA 1A6ZB 1GGIH 2VABA 4YO0A 4OBRA 1I9EA 3ARRA 4Q0XH 4Z7WF 2YPKB 4HG4K 1UCBL 4NDMA 3NPSB 1MCBA 3QXUA 4QCIB 1RIUH 1V7NL 3PE9A 2OX5A 2R0LL 4GKZB 5E94A 2CLZA 1QVOB 3MODH 5GSVB 4Y5YC 1A6TA 4NKIH 2A6JA 3MOAH 5LGHL 3BKMH 4PV8B 3QXAB 5EZOH 5FYJL 1EX0A 2Z8SA 5AYQA 1LO4H 5TE6L 4F7CB 5IIEB 5I0DA 5J6HB 1G84A 2XZAL 3HG1E 2YR3A 3BX7C 3RWDA 1A1NB 1CL7H 3QG7L 4WI7A 1NCWL 4KKAD 2X4SA 5C0GB 3ULSB 3VD4A 4LLYA 4OCSH 4J1UB 2X42A 3X3FL 1WZKA 4PRIB 2AAVA 5F93C 1PD6A 4GRWH 5BS0E 1OF2B 1JWUB 1P84K 1P1ZA 3WJJA 1P7QA 4FFYH 1CT8A 3G6AA 4QEGA 1NDMB 4NHCL 3QPXL 4PJ5B 4Y5XC 3VGFA 4IRSC 3D85D 4GRLD 4GS7B 4QRPD 5HDBE 3MC0A 5JDJA 4X7TB 5D1ZD 4GXVL 4L4VB 5B38B 2Q8AH 1DDHA 1Q94B 1T83A 3E6HA 3GI9H 3RWHA 2ICWB 2BCKB 2X4UB 3VFNB 4TVPD 5CHNB 4X9BA 4IMKC 2ESVB 2OJEA 4Q74A 1KJMB 3PP4L 4TSAL 3CD4A 1ZTXH 1OP9A 1XAUA 1NGXA 2CDEB 4K3DH 1D5XA 4NT6B 4H0GA 2OR8A 3OXRB 3GUTB 2XWTA 1I7UA 4ODBD 3AB0C 4Q9CA 2GYSA 2IBGA 4W6WB 1OB1A 4YIQA 2BMKB 1NFKA 2E7BA 3AREA 1G9NL 1FGVL 4Y4FD 4RGNE 4NUJA 1F8TH 3V0AC 4N0CC 3LN5A 3TWCL 4WUUE 1IGML 1UKQA 4PB0H 3QBTB 4X7FC 2LU4A 3UBXI 2FYYA 3MYZA 3SQBA 5JW5A 1F4WL 4X4ZA 3MQIA 1RUQH 1S7VA 2DJ4A 3VXPA 3OB0H 5F71A 3SDYH 4HIEB 5AG9A 4QRRB 2GEEA 4OLYH 4APQC 3L3GA 4QXUH 1VGEH 1HKLH 1S7RB 4ZAKD 4E9LA 3AROA 1GOFA 3KPSB 4IIQC 1GPOH 3VGBA 1BVLA 5EU7E 4F15B 1JRHL 4K9EL 5D1QD 5EU3B 1T0NA 5F1NA 1VEMA 2R4RH 2MWCA 4X9HA 2X1WL 3C87A 3TC9A 1XIWB 1NKOA 1K4CB 4OQTL 4NQCB 5EOQH 4POZC 2DLEA 4X9FA 1FNSL 1L7IL 3BH9B 2DQJL 1I9JH 2XTJE 3O4LD 1OARL 3GHEH 1ZLVK 4CVZB 3RGVD 2JF1A 5D7LD 1RURH 2A6DA 1B0WA 3MMEB 5E2VL 4Y5XA 4H20L 1U95A 5IBUG 5FGSA 3U0PA 5EIIB 5E08H 4JKPH 1WZMA 3QFJB 4J3SA 1NBZB 3VFUB 2XA8H 1CGUA 4ONFH 5BW7A 5ACLA 3ULVE 4ISVA 1RIHL 1T7XA 3D85B 2DQIL 1ZLWH 4W4OA 1NGXB 2CDEA 4DGYH 5E9DE 4UTAL 4PJBB 4S0UC 5FB8A 1A6PA 2YK1L 1WISA 5ICZA 3NMEA 4Y1AE 2IH1A 5JW4M 5IB3A 4GG6E 1BQHA 1TZGL 3E6FA 1IFHH 5AG8A 2ESVD 4I5BA 5KJRL 3TIDB 4Y4KD 5IV2B 3DV4B 3LKOA 4YAQB 3TV3H 2VLLB 5F89B 2R4SL 5GIRB 3NGBC 4IRZL 3HUJA 1IQWH 3RI5F 2OSLA 4EXKA 4XP5H 5F3HA 1Z9OA 3QHFH 2F58H 4YHZH 3NCJL 4HUVB 1DTUA 2E7HA 4JPIB 5TF1L 1OCWH 3I02B 4M7ZC 5GIRA 1FNEB 1G7HB 4F7MB 1NC4B 5ISZD 3LKPB 4NO0B 1YECH 3FO9A 3RWJA 2PW2B 1A4JB 4PV8A 4HS3A 3WUWA 3O9WD 4C83B 3ZT7A 1NAKL 4JFQB 5LCVH 2GCYA 2VERN 5EBMA 4CVZA 4ZNEA 2MCPH 1ED3B 1JK8A 4HUNB 3BH9A 5EA0L 3MV7A 3RX5A 1TCMA 3QIUA 1OP5K 3MLRL 3SKOB 3AUVA 1T22B 3U2SA 4YHKL 5FA3B 1G7HA 1R5IA 5F7EL 1MQKL 2ED7A 1ACZA 2MTPA 4TN9A 5AWNH 1VACB 2GSGA 5EZIH 1NCAH 4QTIH 1KELH 4ZUWA 4LHUB 2DJSA 3ZE0F 1T4KA 4BQ9A 2R8SH 4FTVD 4ZYKA 1A6VH 4QOKE 4I4WB 4QRRA 1PZ5A 4NSKB 2DDQL 3BWAB 3S8WA 5H94A 4AG4H 1RULH 1CDGA 1QHPA 4GMSH 4KMTL 3PGDA 1F2QA 1G7MA 2WBJB 1NGPH 1K4CA 5J56B 3KJ6H 5FA4A 3VCLB 1XF1A 4HAFA 1YPZF 5FHBH 1YEIH 1R3LB 3HRZB 2GAZA 5F70A 5GGQH 5EBLB 2XQYK 4O02H 4YK4C 5K9QG 1N6QL 1V3KA 4J1UA 1ZS8B 4ZFOL 1HWHB 4EZMA 1OY3B 2EDQA 2NY5C 3MOBL 3M17B 1GHFL 4UINH 4UTBL 1SBBA 2X1QA 1FV1A 5JW5B 5FGBC 1ACYH 3P0VL 3TJHC 1R3JA 3MNWA 5I16B 1XF5A 2E7LE 3KXFD 5KVEL 4KQ3H 5FV1L 4LIQE 3VJ6B 4X7TA 3DUSA 5IOPB 3O3AB 1CDJA 1B0GA 2EYRA 2I26N 3MRKB 4NQCD 1ZS8A 2E27H 4J8RA 2W60B 4NPYA 1FE8L 4GRWF 3DVGB 1U2CA 1UACL 2DQUL 2QJDA 2FGZA 3GSOB 3OKYA 3QUZA 3TO2B 1NC2D 2ZCLL 3O6FC 3FOLA 4P46D 3UJIL 1M7IB 2OJEB 4IRJA 3ULUE 3KLAB 5L2KB 1DFBH 3OL2A 3MRNA 2DD8L 3SKNB 4M1GH 4M93B 3FN0L 2XY1A 4S1RL 5KSBB 4HUWA 1GSMA 2AJ3A 3NTCH 3EYQD 2FSEB 2ARJB 1TJGL 4G9FB 4WHTA 4D9RE 2MHAA 3DVFA 4LSSH 1U8QA 2WANA 2VXTH 4RGMC 3I3DA 5T33L 3T2NH 3BZ4A 2OXGA 3I3BA 5BV7C 3LQAH 1S7XA 3SE9L 4UZGA 3VGHA 4QRQB 4U1MB 4OSUL 3T77B 4PP1C 2YA2A 1PEWA 3EYUH 4WO4D 3HR5B 5DC4B 2R0ZL 2YRPA 3EYFA 4ZFGH 5CEZD 1B4JH 3QIUC 3B3IB 1KPUA 1JF1A 1QEWA 4UV4H 4NGHH 1G6RB 4MD4A 2X6MA 4TPRL 5SWSE 1S5IL 5F96H 2R2CA 1AXTL 5MHSE 5K33A 4XNUL 3FTGA 4HCRL 5SWSB 4OB5H 2NLJA 1ZT1B 3HC3L 2DWEA 1TVDA 5CIPH 1CTNA 4HMEA 3RJQB 3W11D 5I1KH 4JRYA 4PJXA 4HJGA 3BD3A 2D7QA 1QSFD 3DETC 2L4OA 1JVKA 3MLXL 2Q8BL 43CAA 2DL2A 2J2ZA 3ZDYE 2BVUA 1AH1A 4NN5B 3OGCA 3WMSA 4F37K 5BO1L 5CILL 3C8HA 5FO9A 4TNVK 4WY7L 3WJLC 4YDVB 2VDQH 4LVNC 3FTGB 4P2OA 4PJHA 3BP4A 2C1OB 3QEHA 3TF7A 3MJ6A 1F00I 4MA8L 1IL1A 1KJ2H 5IUSA 3N1QC 4OAWA 1J0JA 1QFWM 4MNQA 1XCTB 1YMMB 1YMHB 2NY6D 4RISH 3SKMB 5E8DH 2DWDB 4HKJB 1B0RB 4EI5C 3HC4L 1BD2E 3QDAA 1KYOK 2YD1A 3QRGH 2PTTB 4QRTB 1MCEA 3BYYA 1ZT7B 4LPWA 3EYVA 1TPXC 3TZVA 3MLVL 1KN4H 3GO1H 5IMKA 3MA9L 5C6TH 2ZOLA 2IGFL 3BZFA 4JDVB 4NRXA 4PRAB 1Q9OA 3IFNL 5JQHC 4PJGF 4N0YH 5FM8A 5IWLA 1RK1A 1X7QA 4YFDB 3BO8B 43C9B 2HVJA 4OLVL 3P4NA 4M7KL 5I9QC 2EDHA 3PHQB 3D9AL 5L0QC 1XCTA 3SGKA 2CO6B 2JCCE 4ODHL 1PDKA 2XN9D 3ZHLA 3L5HA 3SDAD 4Q6IA 4TTDD 1AKJB 5AYUH 1MCWW 5KSUB 4PR5A 3G6DH 4WFGE 4WW2B 3RPKA 3BKCL 3RKPA 3BN9C 2G60H 2OR9H 3LH2L 1AFVH 5D7KD 3V5DB 1I8LC 2EE9A 5IVOA 5FECA 2DI8A 3QCVH 4JFYB 4UU9A 4PJ5E 3KLHD 4WI6A 4KV5E 3TJHD 2XWBB 2QSCL 2BK8A 1D5BA 2I27N 4OZHF 3PHOB 2Z8RA 4ZDHB 2JIXA 4LMQI 5IJKC 3WNNA 3QDMD 5FCSH 1CLOH 1RJYA 1FJ1A 3EJZD 1IEAB 5IB4A 3OJVC 1CICB 5JIPA 4LLUA 2XTJB 3BGMB 2XXCB 3FB5B 4BK4A 2MQ0A 2FWOB 4XMPH 4MX7A 3HZVB 3JWOH 3FQNB 3T09A 4X7SL 1ETZB 3WKML 1YNKL 3V7AE 3MCG1 3IJYB 1DN2A 2DQEH 1I1CA 3HR5A 4PP8C 3PV7A 1RZJC 4ZG1A 3WSQH 1M6OA 3OKOB 4CKVX 2Q86B 1HHIB 4OT1L 4GW5B 4JFDA 3EAKA 4JRXB 2ZSWA 2V17H 1A3RL 2AXJA 2NXYB 1TFHA 5ITBH 1LE5B 3N1GC 3KR3H 3NZHL 4N0FB 2J12B 4FOMA 4U1KB 5F44A 4I77H 2C3WA 3MRFB 4D2NA 1G9EA 1I8KA 3PWJA 2VDOH 5KSAB 1ZT1A 2ICWJ 1LP9F 4LHUG 3VGGA 1AHWA 3E0GA 4GAGL 2D4FA 1BPVA 5FYKU 2F5AH 4OZIB 3WLBA 1HI6B 3GSRA 4JQXA 5AEAA 5KOVC 1I4FB 3KYMB 1U8JB 3L7EB 1VGKB 3WUWG 1AGBB 2X1PA 1AC0A 5T1KA 2EO1A 3BW9A 2IPUK 3I9GH 4HWBH 1J1OH 4OCNC 4WU5A 4BJLA 4PGEA 2NZ9D 2ZKHH 1SY6L 1K4DB 4V3EB 3WJJC 4DUXA 1UJTA 3PWUB 3LPGA 3RU8L 5HHOD 4POUB 5F7DA 2AK1H 4FXGA 2H9GA 3DETD 3MUZ1 4IS6B 5B3JF 4PJCA 3A6OA 5GZOC 5AAWA 3O6FB 4ZOAA 5IJKA 3I3EA 3T0ED 2A38A 2QQNL 3EYSH 3WN5B 4ZMAT 1MUJB 3MUJA 1CICA 3ULVF 3EBAA 5DD0H 4JDVA 1GAFH 3MROA 2ZOLB 4RAVA 1X5IA 3CDFA 1BBJB 2VXSL 5GHWH 3HG1D 4N8PA 4RMVA 3GMLA 5DUMH 3TIEB 4K7PL 1RFDH 4LMQE 5F7KC 1OTSC 3VG0H 2BRRL 2YZ1A 1F58L 2VKXA 2J8UA 3LSOA 1KACB 2J8OA 3S6CA 1F6AA 1N6UA 2R2BA 3T0WA 5TGBA 4X0KB 3CXHJ 4ZUSA 3NIDF 1OOAA 2X44D 4YH6A 4HX1A 4MDJB 4MS8D 3FRUB 3FB6A 2FHFA 5IHZA 1BFOB 2J5LC 1FO0A 5BV7B 4U1HB 1R3IL 5FDWA 2ILLA 4PJEF 1UZ6E 4NKQB 4CGTA 3MREB 2J5LB 4IOFC 5GRUH