5IERA

Structure of a computationally designed 17-ohp binder
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSLWRCTQAHDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFFDTHIAATRLTVTCEETFPSSSPDEIAHILVAHSEFDGGFTSEVRGVFTYRVNKAGLITNLRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OHP9
total genus 34
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ierA00
5D83A 2JQ5A 1JKGB 4X2HA 3EN8A 2F98A 5HGRA 3ROBA 3OXAA 3F8HA 3F9SA 3OWUA 4STDA 1DMMA 5CF1A 1BUQA 5IF6A 2YFIB 1SJWA 1JB4A 2HMNB 4K1UA 1Q40A 3E99A 3F14A 3MG3A 3GZXB 3GZRA 4U13A 4PEJA 3EN1B 1HKXA 2XR8B 2Z7AA 3F7XA 3HZPA 4GB5A 2BMQB 4N3VA 1CQSA 5CXOA 3S5CA 5D82A 1ULIB 4Q53A 5AEWB 4XM4A 4R1KA 1OF5A 1ULJB 5IG5A 1TUHA 3DMCA 1OCVA 4HM4B 5D81A 6STDA 5AIHA 4HM7B 1ISKA 2F86B 1OUNA 4HM8B 4RZMA 4L8OA 2YFLB 4IIAA 1E97A 2CKFB 2HMLB 2GXFA 3H3HA 3JUMA 3H51A 4OVMA 2RGQA 3RGAA 3KZTA 2W2CA 4HJLB 5BVBA 4OUQA 2INXA 1OF5B 2RCDA 4XBXA 3B4PA 3G8ZA 4HVNA 1TP6A 2GBXB 4I4KA 3SEDA 3SOAA 3T8UA 2HMOB 1STDA 3CNMA 4L8PA 2Z76A 5AI1A 4HZ9B 4CDLA 3DUKA 3GWRA 1JN5B 1UUVB 3LYGA 4HM1B 4J9AA 3ER7A 5CK6A 5KP1A 1QJGA 2XSHB 3KKGA 3DM8A 3EJVA 3OX9A 5KP3A 3IPTA 1JKGA 3WMDA 3NXJA 3OV4A 5IG3A 1EA2A 3STDA 5IG4A 2BNGA 4HM6B 4R9LA 1JB2A 1W00A 1GY6A 2CHCA 2GBWB 3ECFA 3B4OA 3OWYA 4HM3B 4R9KA 1GS3A 4WYKB 5DRVA 3VSYA 3VGNA 3GZYB 2RFRA 3EBTA 3MYTA 4WWUC 5KP4A 5AIFA 4LGQA 5G2GA 3NV0A 3MKIA 3EC9A 4ORLA 2I9WA 3CPOA 1OHOA 2R4IA 2A15A 3UJMA 5TGNA 5FW5A 3FSDA 2F99A 3RGRA 1Q40B 3EF8A 4K1VA 3EBYA 1K41A 2YFJB 5BXQA 2HMKB 1QMAA 1OGZA 1OHSA 3FZWA 3KSPA 3F7SA 3G16A 3JUOA 5IEPA 2BMOB 1O7GB 1JB5A 5STDA 3CNXA 3MG1A 3K7CA 3BB9A 3SOYA 3LZAA 4LEHA 3DZLA 8CHOA 3GRDA 3I0YA 3MHEA 4H3UA 4MJDA 4WP5A 1OGXA 3MSOA 3CU3A 4XB5A 3NV0B 3EHCA 4HKVB 1ASKA 4LMIA 4XDVA 3UNLA 4XDWA 3KE7A 1IDPA 1NU3A 3K0ZA 1A2KA 5JPUA 5JPPA 1Q42A 4WYKA 4J8TA 3B8LA 3HK4A 3F40A 4HM2B 1E3VA 5CF2A 2HMMB 1Z1SA 3JUQA 1U5OA 1OH0A 1OPYA 1DMQA 1AR0A 1NWWA 1W6YA 5IENA 3EX9A 1EG9B 3OWSA 4HM0B 3A76A 3FKAA 2PZVA 5IEOA 3JUNA 4HZBB 3D9RA 2Z77A 4FCJA 1JN5A 3JUPA 3FF0A 5DREA 1W01A 1ZO2A 1ZX2A 3MG2A 1O7MB 4KVHA 2IMJA 5IERA 3NBRA 7STDA 2GEXA 2B1XB 1E3RA 1OHPA 2OWPA 3FF2A 1GYBA 1W02A 2QGUA 2XRXB 3DXOA 4HM5B 4X2OA 4XBYA 3BLZA 3HX8A 2UX0A 1GY7A 5CLKA 4XBTA 1GY5A 1O7HB 1O7PB 1WQLB 1O7NB 1UUWB 5AEUB 3GZBA 2HMJB 2K54A 3FLJA 3NHXA 5AIGA 1S5AA 1NDOB 1C7HA 5EVHA 3G0KA 2B24B 3F8XA 3Q90A 5IG0A 2QIYA 3NM2A 4FCMA 3T8NA 2GEYA 1O7WB 2STDA 3FGYA 3B7CA 3EQQB 3M8CA 5AIIA 3FH1A 1VZZA 2BMRB 3NUVA 1DMNA 4L7KA 2XSOB
chains in the Genus database with same CATH superfamily
1U8CB 1B3SA 2OOVA 2F98A 4FMAA 1FUSA 4AKYA 3OWUA 5CF1A 4EW5A 4RBNA 4BTWA 4IT7A 4K1UA 3SLUA 1Q40A 3D4AA 4JRFA 1UI7A 1MGWA 1WMNA 2WOFA 4RNYA 1R4CA 2Z7AA 4DKIA 1FGRA 1BANA 1HU9A 2BMQB 1CQSA 1LOWA 3BU4A 3DGLA 3HZPA 3DGYA 4Q53A 1STFI 4RNTA 4R1KA 2WOHA 5IG5A 3OW22 3X42A 1RGGA 4HM4B 6STDA 1KC84 1D6UA 2AADA 1ISKA 2F86B 4HM8B 1LNIA 2P05A 3AGNA 2F5WA 2YFLB 2WO0A 4IIAA 3JUMA 1UGHI 3VGNA 2GXFA 3RGAA 1DETA 1A90A 3RDEA 4QWTA 1PU4A 1UCKA 2INXA 1WNHA 4I5QA 2IUKA 1T2IA 1UCJA 4HVNA 3G8ZA 3SEDA 1BRKA 3PCSA 3CNMA 5AI1A 2Z76A 2BIRA 3WA3A 1V58A 1B27A 1B2UA 4KFFA 3SXXA 1G0TA 2D42A 1VQ73 1YJN3 2XSHB 3OX9A 2C10A 1M1XB 2RBIA 5IG4A 2CFDA 1IT7A 2BNGA 3LOYA 8RNTA 4R9KA 1GS3A 4ILFA 4WYKB 1F8NA 3GZYB 2RFRA 3MYTA 1B2SA 2P09A 1I3IA 4LGQA 1AVLA 2H0HA 2F5MA 2KF6A 2LYXA 3MKIA 3X3XA 3X3ZA 2A15A 1IV7A 1Q40B 4BL3A 3PXMA 3FCSB 1UI8A 3FZWA 3KSPA 3F7SA 3V98A 3CCE3 5IEPA 2JDIH 3CCM3 2FNQA 2RNTA 3CNXA 4IPBA 3SOYA 1D6YA 8CHOA 1RCLA 3PCRA 3CU3A 4LMIA 4XDVA 5AYRB 3D5IA 4XDWA 3LT9A 2W04A 5GSPA 4FR9A 1YGEA 3KE7A 1IDPA 1NU3A 1V57A 1A2KA 3V99A 3KCHA 4WYKA 3PS8A 4EV5A 1SIIA 3CCV3 3DGOA 5ELUA 2HMMB 4HOHA 4N6TA 1OH0A 1OPYA 1NNVA 3UB1A 1QAKA 1X1WA 1RGEA 1MOLA 2P0XA 5IEOA 1SPUA 1BAOA 1RLSA 3BNBA 1YNVX 3D9RA 1TJDA 3CCU3 1TRPA 1ZO2A 3ZG0A 2KF3A 2R41A 4N6LA 1M9GA 2CFGA 2CG1A 2KXGA 2K3DA 5JPPA 1OHPA 1W02A 1HYFA 2OQEC 2GU3A 1B2ZA 1DYUA 1TFOA 2WGOA 1X1UA 1GY7A 4WFOA 5EEOA 1LOXA 1SARA 1O7NB 1YVBI 2KF4A 2M7OA 5AEUB 1VQK3 1B21A 1NDOB 2UGIA 2H0GA 2B24B 2KCDA 3X40A 2P0MA 3N8BA 1AVKA 2CG0A 3NM2A 3S27A 3AMOB 1O7WB 4HBRA 3EQQB 5AIIA 3ZFZA 1NO3A 1RMSA 4GHOA 3FH1A 3ZG5A 1YIJ3 1S723 2JQ5A 4N6UA 1I3FA 2AAEA 3DH2A 3AGOA 3KN4A 4CCVA 1WMPA 3F9SA 1N9JA 1DMMA 1MNLA 2O3OA 5G1KA 2XFSA 4U13A 1K8A4 1W6CA 3GZXB 5M19A 3FG4A 1HKXA 2O9UX 5LC6A 4R80A 3CCJ3 1UW1A 5CXOA 4EV2A 1LOYA 1ULIB 5AEWB 1OF5A 1ULJB 1B20A 3DMCA 1OCVA 2YX9A 5AIHA 1T2HA 4HM7B 2XH9A 2XF3A 1JBRA 1Q7Y4 1E97A 2CKFB 1KD14 1I70A 2BO9B 1YJW3 4OUQA 1Q824 2RCDA 1BRIA 3MPHA 2CK3H 3B4PA 3T8UA 5IW9A 2GBXB 4I4KA 1Q814 3G4S3 2HMOB 3PYJA 3EE1A 3RNTA 4KT3B 1KSIA 3LTAA 4K61A 1RRHA 2FGTA 3SVAA 4MMXB 3CPW2 4J9AA 3ER7A 5CK6A 5KP1A 1BNJA 4FMBA 1MWUA 1EEJA 3IMAB 4J5KA 2IYJA 1JKGA 3OV4A 5IG3A 4R9LA 1VQM3 1W00A 2QA43 1GY6A 2GBWB 2XEPA 3ECFA 3LMLA 1BUJA 3O8YA 1I8VA 1W6GA 1GMPA 2XGLA 2L4VA 1IT8A 1YGWA 3NQZA 1GOUA 4H61A 3NV0A 1BVIA 2I9WA 4K90B 4ORLA 2R4IA 3UJMA 1VQO3 1RNTA 5TGNA 3FSDA 3RGRA 3N54B 4G1MB 3X3YA 1M904 1KQS2 1N9EA 3U1WA 4BTXA 1RN4A 3JUOA 3NQYA 2IUJA 1N8QA 2BMOB 1GSPA 1O7GB 1IU7A 1JBTA 1JB5A 1JBSA 4BIRA 3IJEB 3BB9A 3DZLA 2E2UA 1X1XA 2L1SA 3I0YA 1IQYA 3KFQC 4MJDA 4O2HA 1YJ93 4WP5A 3BNEA 1QAFA 3MSOA 4O3VA 4XB5A 3EHCA 1ROAA 1L5GB 1RN7A 3HOHA 1RNBA 2K0MA 3K0ZA 4TX4A 1T5YA 3B8LA 1E3VA 5CF2A 3NBBA 1BNSA 5M18A 1Z1SA 1DMQA 4FCZA 7GSPA 1W6YA 1M1K4 1IYYA 3NBJA 1EG9B 3OWSA 5I97A 1YI23 2PZVA 1J2BA 4N6V0 5DREA 3JUPA 3G6E3 1B2MA 2OTL3 1RRLA 2J8XB 3Q3FA 6GSPA 2Z6BA 1ROVA 2GEXA 1GD4A 3HIGA 2XRXB 1GOYA 2QGUA 4HM5B 4X2OA 2BT3A 4J5GA 1AQZA 1PFPA 2CH9A 2FXTA 1EQKA 1O7PB 1IV9A 1CYUA 5AIGA 1FYSA 3NHXA 1BSDA 1S5AA 2C11A 3JVCA 6RNTA 1RSNA 3G0KA 2IA7A 3KIIA 3G713 3AHWA 3GAXA 3Q90A 2GEYA 4EBGA 1I2EA 3M8CA 3CCL3 1QVG2 1VQ83 1AV4A 4X2HA 1YHQ3 4L7KA 3I553 1JKGB 3EN8A 1BSBA 3LH4A 5BU4A 1CEWI 1PY3A 3F8HA 4STDA 3UL6A 3I563 2IY2A 1SJWA 5IF6A 1I0XA 3E99A 3MG3A 3F14A 3CC73 2KAAA 1UCIA 3F7XA 3S5CA 3EB8A 4GB5A 4ZM8A 3CC23 1CYVA 5EQLA 3LXUX 4BU4A 1JRQA 4N6OB 3CC43 5D81A 1BNFA 2W0QA 1BRHA 4MMYB 1PYLA 4WHAA 1FA3A 1TRQA 2HMLB 4OVMA 5BVBA 2GU1A 4O02B 2CFKA 3K9MC 3SOAA 4OK0A 4HYZA 1WTHA 3S28A 1W4NA 2KRTA 4KFEA 1STDA 4CDLA 2F4YA 2PNCA 1FGQA 1RTUA 3GWRA 1JN5B 4HM1B 4RNZA 2ML5A 3KKGA 3EJVA 4FMDA 1NB5I 3D79A 1G02A 3L0RA 4HAAA 1JB2A 4AKZA 2CHCA 4HM3B 2XFTA 3B4OA 4LYLB 4LZIA 1RGKA 1GD3A 5DRVA 1QALA 1OACA 2V1LA 3EBTA 5KP4A 1K9M4 3TDGA 1VQP3 2MF7A 2E2TA 1D6ZA 1VQQA 1RGLA 3DGMA 1BNRA 3CPOA 1BGSA 1RKYA 1LRAA 2C4BA 3NX0A 5FW5A 3X41A 4K1VA 1MWSA 3EBYA 1RGAA 1DVDA 1B2XA 2HMKB 1QMAA 3WA2X 1OHSA 1I2GA 3HI7A 2HOHA 3J7Yd 2CFLA 2WGQA 1W2B2 3K7CA 2CWTA 3K5TA 3GRDA 1V74A 3BIRA 4EYCA 5HOHA 3NV0B 1BSAA 3WOFB 4BL2A 3UNLA 2F56A 1BOXA 4GSPA 3VF1A 1VQN3 1BNGA 3QK9A 4KFDA 2Y73A 3UL5A 1I0VA 1Q42A 3D5GA 1LXEA 3HK4A 4N6MA 1BRSA 4HM2B 1VQL3 5JBSA 2D1WA 1U5OA 1A2PA 3NM7A 1NWWA 1Q9EA 5IENA 1GMRA 4HM0B 2ZL8A 1FGMA 3D3LA 4HZBB 2XGNA 1LVNA 2Z77A 1JN5A 3GSPA 1SIHA 3FF0A 1N5HA 1W01A 2XSOB 3FG3A 3K63A 3CXC2 1N8R4 1ZX2A 1TTOA 3PGBA 1RGFA 5IERA 3KSED 3WOEB 7STDA 3WR2A 2W6JH 2OWPA 4XBYA 2BHMA 2BU4A 3HX8A 1SQWA 2Q07A 2UX0A 1RJOA 5M1AA 1IVWA 1W7CA 1FGOA 3SX1A 1JZOA 2UUGC 3FG1A 3GZBA 3WODG 3FLJA 2MC8A 1RCKA 1NB3I 1C7HA 5EVHA 4LSOA 1W5ZA 2CC3A 5IG0A 3T8NA 2STDA 1RHLA 5AYSC 2W9QA 4N6NB 1MGRA 1BNIA 1JNQA 1DMNA 1UDII 4KZ1A 5D83A 3S67A 5A0OB 5HGRA 3ROBA 3OXAA 3SYUA 1LQMB 1N5PA 1BUQA 2YFIB 1GMQA 2OTJ3 1JB4A 1A2VA 2HMNB 2Y74A 3AMOA 3GZRA 4PEJA 3EN1B 4N3VA 1LNHA 2XR8B 1VQ43 1RGCA 5D82A 1K734 1RGHA 1IVXA 4XM4A 1BSEA 1TUHA 3V92A 1LQGC 3A5EA 1DVCA 1OUNA 4RZMA 4L8OA 2CWVA 4NHFA 2CFWA 3CCR3 3H3HA 1CH0A 3CCS3 3H51A 1FUWA 2RGQA 3CD63 3KZTA 2W2CA 4HJLB 5G1LA 1OF5B 2P38A 2CX1A 3U97A 3WDGB 4XBXA 2W56A 4CPKA 3Q2PA 1TP6A 1QVF2 3WHOA 4L8PA 4HZ9B 1DE3A 1X1YA 3DUKA 1UUVB 2ZA4A 3LYGA 1T3BA 3Q1CA 1QJGA 1IQXA 2H0IA 1EUIC 3DM8A 1Q864 5KP3A 3IPTA 3WMDA 2ML6A 3NXJA 3URPA 1EA2A 1WMOA 4MMZB 3STDA 4HM6B 1BRGA 3DY5A 3VSYA 3OWYA 2GSPA 3PZWA 3CMA3 1C54A 1RN1A 5FGOA 3BNDA 2SBLA 3DGNA 4MEIA 4WWUC 5AIFA 5G2GA 4EXRA 2OCTA 1US1A 2ZDJA 3EC9A 1OHOA 3QRDA 9RNTA 1R4YA 3LTBA 2F99A 4AEQA 1EKMA 3EF8A 5BIRA 3AHSA 1G96A 1K41A 2YFJB 3CME3 1VQ93 1OGZA 1TFKA 3G16A 2CIUA 4GL6A 5LC7A 5STDA 3CCQ3 3MG1A 1BIRA 1BSCA 1VQ63 1NJI4 1JV2B 3LZAA 4LEHA 4R4KA 3MHEA 3T0UA 4H3UA 1Y4KA 1Q7HA 1OGXA 1A67A 1FGTA 4HKVB 1ASKA 4EC6A 1BRJA 1FUTA 1IQ8A 1MWRA 4BTYA 5JPUA 1HZ1A 3LTCA 2OQEA 4J8TA 1ZGXA 3F40A 1IVVA 2LQVA 4FMCA 1TU5A 1YVSA 1BNEA 3HIIA 1IK3A 3JUQA 5RNTA 1YIT3 2ZHXB 1AR0A 2CW9A 3LTDA 1W2ZA 3EX9A 1BU4A 3A76A 3FKAA 2CWUA 3BNCA 3JUNA 5ELJA 3S29A 4FCJA 2KF5A 2W03A 4O8SA 2W9PA 3MG2A 1VQ53 1O7MB 4KVHA 2IMJA 2CX0A 3NBRA 4CJNA 2W56B 4NREA 1KWIA 2B1XB 1E3RA 3FF2A 1RDSA 1JJ22 1GYBA 3DXOA 3LT8A 2OOVC 2E2VA 1K28A 3BLZA 1MWTA 4NPBA 5CLKA 1LOVA 4XBTA 3N9HA 1GY5A 1WQLB 1O7HB 1TIJA 1GOVA 1UUWB 1UUGB 2HMJB 2K54A 2QEX3 1BRNL 1ZS7A 1FW7A 7RNTA 2RSXA 1UCLA 3ALAA 3F8XA 2QIYA 4FCMA 3MWZA 1AY7A 1FZUA 1JZDA 3FGYA 3B7CA 4JF8A 1UGIA 2SARA 1I2FA 1VZZA 2BMRB 3NUVA 5BXQA 1IVUA
chains in the Genus database with same CATH topology
1U8CB 2OOVA 2F98A 4FMAA 4AKYA 3OWUA 5CF1A 4RBNA 4BTWA 4IT7A 4K1UA 3SLUA 1Q40A 4JRFA 1UI7A 1WMNA 2WOFA 4RNYA 1R4CA 2Z7AA 2QEX3 1FGRA 1HU9A 2BMQB 3DGLA 1CQSA 3HZPA 4Q53A 1STFI 4R1KA 2WOHA 5IG5A 3OW22 3X42A 4HM4B 6STDA 1KC84 1D6UA 1ISKA 2F86B 4HM8B 2P05A 2YFLB 2WO0A 4IIAA 3JUMA 3VGNA 1A90A 2GXFA 3RGAA 3RDEA 4QWTA 1PU4A 2INXA 1WNHA 2IUKA 4HVNA 3G8ZA 3SEDA 3PCSA 3CNMA 5AI1A 2Z76A 3WA3A 3SXXA 4KFFA 1VQ73 2D42A 1YJN3 2XSHB 3OX9A 2C10A 1M1XB 5IG4A 2CFDA 1IT7A 2BNGA 3LOYA 4R9KA 1GS3A 4WYKB 1F8NA 3GZYB 2RFRA 3MYTA 2P09A 4LGQA 1AVLA 3MKIA 2LYXA 3X3XA 3X3ZA 2A15A 1IV7A 1Q40B 3PXMA 3FCSB 1UI8A 3FZWA 3KSPA 3F7SA 3V98A 3CCE3 5IEPA 2JDIH 3CCM3 2FNQA 3CNXA 4IPBA 3SOYA 1D6YA 8CHOA 3PCRA 3CU3A 4LMIA 4XDVA 5AYRB 4XDWA 3LT9A 2W04A 4FR9A 1YGEA 3KE7A 1IDPA 1NU3A 3V99A 1A2KA 4WYKA 3PS8A 4EV5A 1SIIA 3CCV3 3DGOA 5ELUA 2HMMB 4N6TA 1OH0A 1OPYA 3UB1A 1QAKA 2P0XA 1MOLA 5IEOA 1SPUA 3BNBA 3D9RA 3CCU3 1ZO2A 4N6LA 1M9GA 2CFGA 2CG1A 2KXGA 5JPPA 1OHPA 1W02A 2OQEC 2GU3A 2WGOA 1DYUA 1TFOA 4WFOA 5EEOA 1GY7A 1LOXA 1O7NB 1YVBI 2M7OA 1VQK3 5AEUB 1NDOB 2B24B 2KCDA 3X40A 2P0MA 3N8BA 1AVKA 2CG0A 3NM2A 3S27A 3AMOB 1O7WB 4HBRA 3EQQB 5AIIA 1NO3A 3FH1A 1YIJ3 1S723 2JQ5A 4N6UA 4CCVA 3KN4A 1WMPA 3F9SA 1N9JA 1DMMA 1MNLA 2O3OA 2XFSA 4U13A 1K8A4 1W6CA 3GZXB 3FG4A 1HKXA 2O9UX 5LC6A 4R80A 3CCJ3 1UW1A 5CXOA 4EV2A 1ULIB 5AEWB 1OF5A 1ULJB 3DMCA 1OCVA 2YX9A 5AIHA 4HM7B 2XH9A 2XF3A 1Q7Y4 1E97A 2CKFB 1KD14 2BO9B 1YJW3 4OUQA 1Q824 2RCDA 3MPHA 2CK3H 3B4PA 3T8UA 5IW9A 2GBXB 4I4KA 1Q814 3G4S3 2HMOB 3PYJA 3EE1A 1KSIA 3LTAA 4K61A 1RRHA 2FGTA 3SVAA 4MMXB 3CPW2 4J9AA 3ER7A 5CK6A 5KP1A 4FMBA 3IMAB 1JKGA 3OV4A 5IG3A 4R9LA 1VQM3 1W00A 2QA43 1GY6A 2GBWB 2XEPA 3ECFA 3LMLA 3O8YA 1W6GA 2XGLA 2L4VA 1IT8A 3NQZA 4H61A 3NV0A 4K90B 2I9WA 4ORLA 2R4IA 3UJMA 1VQO3 5TGNA 1M904 3FSDA 3RGRA 3N54B 4G1MB 3X3YA 1KQS2 1N9EA 3U1WA 4BTXA 3JUOA 3NQYA 2IUJA 1N8QA 2BMOB 1O7GB 1IU7A 1JB5A 3IJEB 3BB9A 3DZLA 2E2UA 3KFQC 3I0YA 1YJ93 1IQYA 4MJDA 4O2HA 4WP5A 3BNEA 1QAFA 3MSOA 4O3VA 4XB5A 3EHCA 1ROAA 1L5GB 1RN7A 2K0MA 3K0ZA 4TX4A 1T5YA 3B8LA 1E3VA 5CF2A 3NBBA 1Z1SA 1DMQA 4FCZA 1W6YA 1M1K4 3NBJA 1EG9B 3OWSA 5I97A 1YI23 2PZVA 1J2BA 4N6V0 5DREA 3JUPA 3G6E3 2OTL3 1RRLA 2Z6BA 1ROVA 2GEXA 1GD4A 3HIGA 2XRXB 4HM5B 2QGUA 4X2OA 2BT3A 1PFPA 2CH9A 2FXTA 1EQKA 1O7PB 1IV9A 1CYUA 5AIGA 3NHXA 1S5AA 2C11A 3JVCA 3G0KA 2IA7A 3KIIA 3G713 3GAXA 3Q90A 2GEYA 4EBGA 3M8CA 1QVG2 3CCL3 1VQ83 1AV4A 4X2HA 1YHQ3 4L7KA 3I553 1JKGB 3EN8A 3LH4A 1CEWI 3UL6A 3F8HA 4STDA 3I563 1SJWA 5IF6A 3E99A 3MG3A 3F14A 3CC73 3F7XA 3S5CA 3EB8A 4GB5A 4ZM8A 3CC23 1CYVA 5EQLA 3LXUX 1JRQA 4N6OB 3CC43 5D81A 2W0QA 4MMYB 4WHAA 1FA3A 4OVMA 2HMLB 5BVBA 2GU1A 4O02B 2CFKA 3K9MC 3SOAA 4OK0A 4HYZA 1WTHA 3S28A 1W4NA 2KRTA 4KFEA 1STDA 4CDLA 2PNCA 1FGQA 3GWRA 1JN5B 4HM1B 4RNZA 2ML5A 3KKGA 3EJVA 4FMDA 1NB5I 3L0RA 1JB2A 4AKZA 2CHCA 4HM3B 2XFTA 3B4OA 4LZIA 5DRVA 1GD3A 1QALA 1OACA 2V1LA 3EBTA 5KP4A 1K9M4 3TDGA 1VQP3 2MF7A 2E2TA 1D6ZA 3DGMA 3CPOA 1RKYA 3NX0A 5FW5A 3X41A 4K1VA 3EBYA 1DVDA 2HMKB 1QMAA 3WA2X 1OHSA 3HI7A 3J7Yd 2CFLA 2WGQA 1W2B2 3K7CA 2CWTA 3K5TA 3GRDA 1V74A 4EYCA 3NV0B 3WOFB 3UNLA 3VF1A 1VQN3 3QK9A 4KFDA 2Y73A 3UL5A 1Q42A 1LXEA 3HK4A 4N6MA 1VQL3 4HM2B 5JBSA 1U5OA 2D1WA 3NM7A 1NWWA 5IENA 4HM0B 2ZL8A 1FGMA 3D3LA 4HZBB 2XGNA 1LVNA 2Z77A 1JN5A 1SIHA 3FF0A 1N5HA 1W01A 3FG3A 3K63A 3CXC2 1N8R4 1ZX2A 3PGBA 5IERA 3KSED 3WOEB 7STDA 2W6JH 2OWPA 4XBYA 2BHMA 3HX8A 1SQWA 2Q07A 2UX0A 1RJOA 1IVWA 1W7CA 1FGOA 3SX1A 3FG1A 3GZBA 3WODG 3FLJA 2MC8A 1NB3I 1C7HA 5EVHA 4LSOA 1W5ZA 2CC3A 5IG0A 3T8NA 2STDA 5AYSC 2W9QA 4N6NB 1DMNA 1JNQA 3S67A 4KZ1A 5D83A 5A0OB 5HGRA 3ROBA 3OXAA 1N5PA 1BUQA 2YFIB 2OTJ3 1JB4A 1A2VA 2HMNB 2Y74A 3AMOA 3GZRA 4PEJA 3EN1B 4N3VA 1LNHA 2XR8B 1VQ43 5D82A 1K734 4XM4A 1IVXA 1IVUA 1TUHA 3V92A 1DVCA 1OUNA 4RZMA 4L8OA 2CWVA 4NHFA 2CFWA 3CCR3 3H3HA 3CCS3 3H51A 1FUWA 2RGQA 3CD63 3KZTA 2W2CA 4HJLB 1OF5B 2P38A 3U97A 3WDGB 4XBXA 2W56A 1QVF2 3Q2PA 1TP6A 4L8PA 4HZ9B 3DUKA 1UUVB 3LYGA 3Q1CA 1QJGA 1IQXA 1Q864 3DM8A 5KP3A 3IPTA 3WMDA 2ML6A 3NXJA 1EA2A 1WMOA 4MMZB 3STDA 4HM6B 3DY5A 3VSYA 3OWYA 3PZWA 3CMA3 5FGOA 3BNDA 2SBLA 3DGNA 4MEIA 4WWUC 5AIFA 5G2GA 4EXRA 3EC9A 2OCTA 1US1A 2ZDJA 1OHOA 3QRDA 3LTBA 2F99A 4AEQA 1EKMA 3EF8A 1G96A 1K41A 2YFJB 3CME3 1VQ93 1OGZA 1TFKA 3G16A 2CIUA 4GL6A 5LC7A 5STDA 3CCQ3 3MG1A 1VQ63 1NJI4 1JV2B 3LZAA 4LEHA 4R4KA 3MHEA 3T0UA 4H3UA 1Y4KA 1A67A 1OGXA 1FGTA 4HKVB 1ASKA 4EC6A 1IQ8A 4BTYA 5JPUA 3LTCA 2OQEA 4J8TA 3F40A 1IVVA 2LQVA 4FMCA 1TU5A 3HIIA 1IK3A 3JUQA 1YIT3 1AR0A 2CW9A 3LTDA 1W2ZA 3EX9A 3A76A 3FKAA 2CWUA 3BNCA 3JUNA 5ELJA 3S29A 4FCJA 2W03A 4O8SA 2W9PA 3MG2A 1VQ53 1O7MB 4KVHA 2IMJA 3NBRA 2W56B 4NREA 1KWIA 2B1XB 1E3RA 3FF2A 1JJ22 1GYBA 3DXOA 3LT8A 2OOVC 2E2VA 1K28A 3BLZA 5CLKA 4XBTA 3N9HA 1GY5A 1O7HB 1TIJA 1WQLB 1UUWB 2HMJB 2K54A 2RSXA 3ALAA 3F8XA 2QIYA 4FCMA 3MWZA 3FGYA 3B7CA 4JF8A 1VZZA 2BMRB 3NUVA 5BXQA 2XSOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D83 A;  2JQ5 A;  1JKG B;  4X2H A;  3EN8 A;  2F98 A;  5HGR A;  3ROB A;  3OXA A;  3F8H A;  3F9S A;  3OWU A;  4STD A;  1DMM A;  5CF1 A;  1BUQ A;  5IF6 A;  2YFI B;  1SJW A;  1JB4 A;  2HMN B;  4K1U A;  1Q40 A;  3E99 A;  3F14 A;  3MG3 A;  3GZX B;  3GZR A;  4U13 A;  4PEJ A;  3EN1 B;  1HKX A;  2XR8 B;  2Z7A A;  3F7X A;  3HZP A;  4GB5 A;  2BMQ B;  4N3V A;  1CQS A;  5CXO A;  3S5C A;  5D82 A;  1ULI B;  4Q53 A;  5AEW B;  4XM4 A;  4R1K A;  1OF5 A;  1ULJ B;  5IG5 A;  1TUH A;  3DMC A;  1OCV A;  4HM4 B;  5D81 A;  6STD A;  5AIH A;  4HM7 B;  1ISK A;  2F86 B;  1OUN A;  4HM8 B;  4RZM A;  4L8O A;  2YFL B;  4IIA A;  1E97 A;  2CKF B;  2HML B;  2GXF A;  3H3H A;  3JUM A;  3H51 A;  4OVM A;  2RGQ A;  3RGA A;  3KZT A;  2W2C A;  4HJL B;  5BVB A;  4OUQ A;  2INX A;  1OF5 B;  2RCD A;  4XBX A;  3B4P A;  3G8Z A;  4HVN A;  1TP6 A;  2GBX B;  4I4K A;  3SED A;  3SOA A;  3T8U A;  2HMO B;  1STD A;  3CNM A;  4L8P A;  2Z76 A;  5AI1 A;  4HZ9 B;  4CDL A;  3DUK A;  3GWR A;  1JN5 B;  1UUV B;  3LYG A;  4HM1 B;  4J9A A;  3ER7 A;  5CK6 A;  5KP1 A;  1QJG A;  2XSH B;  3KKG A;  3DM8 A;  3EJV A;  3OX9 A;  5KP3 A;  3IPT A;  1JKG A;  3WMD A;  3NXJ A;  3OV4 A;  5IG3 A;  1EA2 A;  3STD A;  5IG4 A;  2BNG A;  4HM6 B;  4R9L A;  1JB2 A;  1W00 A;  1GY6 A;  2CHC A;  2GBW B;  3ECF A;  3B4O A;  3OWY A;  4HM3 B;  4R9K A;  1GS3 A;  4WYK B;  5DRV A;  3VSY A;  3VGN A;  3GZY B;  2RFR A;  3EBT A;  3MYT A;  4WWU C;  5KP4 A;  5AIF A;  4LGQ A;  5G2G A;  3NV0 A;  3MKI A;  3EC9 A;  4ORL A;  2I9W A;  3CPO A;  1OHO A;  2R4I A;  2A15 A;  3UJM A;  5TGN A;  5FW5 A;  3FSD A;  2F99 A;  3RGR A;  1Q40 B;  3EF8 A;  4K1V A;  3EBY A;  1K41 A;  2YFJ B;  5BXQ A;  2HMK B;  1QMA A;  1OGZ A;  1OHS A;  3FZW A;  3KSP A;  3F7S A;  3G16 A;  3JUO A;  5IEP A;  2BMO B;  1O7G B;  1JB5 A;  5STD A;  3CNX A;  3MG1 A;  3K7C A;  3BB9 A;  3SOY A;  3LZA A;  4LEH A;  3DZL A;  8CHO A;  3GRD A;  3I0Y A;  3MHE A;  4H3U A;  4MJD A;  4WP5 A;  1OGX A;  3MSO A;  3CU3 A;  4XB5 A;  3NV0 B;  3EHC A;  4HKV B;  1ASK A;  4LMI A;  4XDV A;  3UNL A;  4XDW A;  3KE7 A;  1IDP A;  1NU3 A;  3K0Z A;  1A2K A;  5JPU A;  5JPP A;  1Q42 A;  4WYK A;  4J8T A;  3B8L A;  3HK4 A;  3F40 A;  4HM2 B;  1E3V A;  5CF2 A;  2HMM B;  1Z1S A;  3JUQ A;  1U5O A;  1OH0 A;  1OPY A;  1DMQ A;  1AR0 A;  1NWW A;  1W6Y A;  5IEN A;  3EX9 A;  1EG9 B;  3OWS A;  4HM0 B;  3A76 A;  3FKA A;  2PZV A;  5IEO A;  3JUN A;  4HZB B;  3D9R A;  2Z77 A;  4FCJ A;  1JN5 A;  3JUP A;  3FF0 A;  5DRE A;  1W01 A;  1ZO2 A;  1ZX2 A;  3MG2 A;  1O7M B;  4KVH A;  2IMJ A;  5IER A;  3NBR A;  7STD A;  2GEX A;  2B1X B;  1E3R A;  1OHP A;  2OWP A;  3FF2 A;  1GYB A;  1W02 A;  2QGU A;  2XRX B;  3DXO A;  4HM5 B;  4X2O A;  4XBY A;  3BLZ A;  3HX8 A;  2UX0 A;  1GY7 A;  5CLK A;  4XBT A;  1GY5 A;  1O7H B;  1O7P B;  1WQL B;  1O7N B;  1UUW B;  5AEU B;  3GZB A;  2HMJ B;  2K54 A;  3FLJ A;  3NHX A;  5AIG A;  1S5A A;  1NDO B;  1C7H A;  5EVH A;  3G0K A;  2B24 B;  3F8X A;  3Q90 A;  5IG0 A;  2QIY A;  3NM2 A;  4FCM A;  3T8N A;  2GEY A;  1O7W B;  2STD A;  3FGY A;  3B7C A;  3EQQ B;  3M8C A;  5AII A;  3FH1 A;  1VZZ A;  2BMR B;  3NUV A;  1DMN A;  4L7K A;  2XSO B; 
#chains in the Genus database with same CATH topology
 1U8C B;  1B3S A;  2OOV A;  2F98 A;  4FMA A;  1FUS A;  4AKY A;  3OWU A;  5CF1 A;  4EW5 A;  4RBN A;  4BTW A;  4IT7 A;  4K1U A;  3SLU A;  1Q40 A;  3D4A A;  4JRF A;  1UI7 A;  1MGW A;  1WMN A;  2WOF A;  4RNY A;  1R4C A;  2Z7A A;  4DKI A;  1FGR A;  1BAN A;  1HU9 A;  2BMQ B;  1CQS A;  1LOW A;  3BU4 A;  3DGL A;  3HZP A;  3DGY A;  4Q53 A;  1STF I;  4RNT A;  4R1K A;  2WOH A;  5IG5 A;  3OW2 2;  3X42 A;  1RGG A;  4HM4 B;  6STD A;  1KC8 4;  1D6U A;  2AAD A;  1ISK A;  2F86 B;  4HM8 B;  1LNI A;  2P05 A;  3AGN A;  2F5W A;  2YFL B;  2WO0 A;  4IIA A;  3JUM A;  1UGH I;  3VGN A;  2GXF A;  3RGA A;  1DET A;  1A90 A;  3RDE A;  4QWT A;  1PU4 A;  1UCK A;  2INX A;  1WNH A;  4I5Q A;  2IUK A;  1T2I A;  1UCJ A;  4HVN A;  3G8Z A;  3SED A;  1BRK A;  3PCS A;  3CNM A;  5AI1 A;  2Z76 A;  2BIR A;  3WA3 A;  1V58 A;  1B27 A;  1B2U A;  4KFF A;  3SXX A;  1G0T A;  2D42 A;  1VQ7 3;  1YJN 3;  2XSH B;  3OX9 A;  2C10 A;  1M1X B;  2RBI A;  5IG4 A;  2CFD A;  1IT7 A;  2BNG A;  3LOY A;  8RNT A;  4R9K A;  1GS3 A;  4ILF A;  4WYK B;  1F8N A;  3GZY B;  2RFR A;  3MYT A;  1B2S A;  2P09 A;  1I3I A;  4LGQ A;  1AVL A;  2H0H A;  2F5M A;  2KF6 A;  2LYX A;  3MKI A;  3X3X A;  3X3Z A;  2A15 A;  1IV7 A;  1Q40 B;  4BL3 A;  3PXM A;  3FCS B;  1UI8 A;  3FZW A;  3KSP A;  3F7S A;  3V98 A;  3CCE 3;  5IEP A;  2JDI H;  3CCM 3;  2FNQ A;  2RNT A;  3CNX A;  4IPB A;  3SOY A;  1D6Y A;  8CHO A;  1RCL A;  3PCR A;  3CU3 A;  4LMI A;  4XDV A;  5AYR B;  3D5I A;  4XDW A;  3LT9 A;  2W04 A;  5GSP A;  4FR9 A;  1YGE A;  3KE7 A;  1IDP A;  1NU3 A;  1V57 A;  1A2K A;  3V99 A;  3KCH A;  4WYK A;  3PS8 A;  4EV5 A;  1SII A;  3CCV 3;  3DGO A;  5ELU A;  2HMM B;  4HOH A;  4N6T A;  1OH0 A;  1OPY A;  1NNV A;  3UB1 A;  1QAK A;  1X1W A;  1RGE A;  1MOL A;  2P0X A;  5IEO A;  1SPU A;  1BAO A;  1RLS A;  3BNB A;  1YNV X;  3D9R A;  1TJD A;  3CCU 3;  1TRP A;  1ZO2 A;  3ZG0 A;  2KF3 A;  2R41 A;  4N6L A;  1M9G A;  2CFG A;  2CG1 A;  2KXG A;  2K3D A;  5JPP A;  1OHP A;  1W02 A;  1HYF A;  2OQE C;  2GU3 A;  1B2Z A;  1DYU A;  1TFO A;  2WGO A;  1X1U A;  1GY7 A;  4WFO A;  5EEO A;  1LOX A;  1SAR A;  1O7N B;  1YVB I;  2KF4 A;  2M7O A;  5AEU B;  1VQK 3;  1B21 A;  1NDO B;  2UGI A;  2H0G A;  2B24 B;  2KCD A;  3X40 A;  2P0M A;  3N8B A;  1AVK A;  2CG0 A;  3NM2 A;  3S27 A;  3AMO B;  1O7W B;  4HBR A;  3EQQ B;  5AII A;  3ZFZ A;  1NO3 A;  1RMS A;  4GHO A;  3FH1 A;  3ZG5 A;  1YIJ 3;  1S72 3;  2JQ5 A;  4N6U A;  1I3F A;  2AAE A;  3DH2 A;  3AGO A;  3KN4 A;  4CCV A;  1WMP A;  3F9S A;  1N9J A;  1DMM A;  1MNL A;  2O3O A;  5G1K A;  2XFS A;  4U13 A;  1K8A 4;  1W6C A;  3GZX B;  5M19 A;  3FG4 A;  1HKX A;  2O9U X;  5LC6 A;  4R80 A;  3CCJ 3;  1UW1 A;  5CXO A;  4EV2 A;  1LOY A;  1ULI B;  5AEW B;  1OF5 A;  1ULJ B;  1B20 A;  3DMC A;  1OCV A;  2YX9 A;  5AIH A;  1T2H A;  4HM7 B;  2XH9 A;  2XF3 A;  1JBR A;  1Q7Y 4;  1E97 A;  2CKF B;  1KD1 4;  1I70 A;  2BO9 B;  1YJW 3;  4OUQ A;  1Q82 4;  2RCD A;  1BRI A;  3MPH A;  2CK3 H;  3B4P A;  3T8U A;  5IW9 A;  2GBX B;  4I4K A;  1Q81 4;  3G4S 3;  2HMO B;  3PYJ A;  3EE1 A;  3RNT A;  4KT3 B;  1KSI A;  3LTA A;  4K61 A;  1RRH A;  2FGT A;  3SVA A;  4MMX B;  3CPW 2;  4J9A A;  3ER7 A;  5CK6 A;  5KP1 A;  1BNJ A;  4FMB A;  1MWU A;  1EEJ A;  3IMA B;  4J5K A;  2IYJ A;  1JKG A;  3OV4 A;  5IG3 A;  4R9L A;  1VQM 3;  1W00 A;  2QA4 3;  1GY6 A;  2GBW B;  2XEP A;  3ECF A;  3LML A;  1BUJ A;  3O8Y A;  1I8V A;  1W6G A;  1GMP A;  2XGL A;  2L4V A;  1IT8 A;  1YGW A;  3NQZ A;  1GOU A;  4H61 A;  3NV0 A;  1BVI A;  2I9W A;  4K90 B;  4ORL A;  2R4I A;  3UJM A;  1VQO 3;  1RNT A;  5TGN A;  3FSD A;  3RGR A;  3N54 B;  4G1M B;  3X3Y A;  1M90 4;  1KQS 2;  1N9E A;  3U1W A;  4BTX A;  1RN4 A;  3JUO A;  3NQY A;  2IUJ A;  1N8Q A;  2BMO B;  1GSP A;  1O7G B;  1IU7 A;  1JBT A;  1JB5 A;  1JBS A;  4BIR A;  3IJE B;  3BB9 A;  3DZL A;  2E2U A;  1X1X A;  2L1S A;  3I0Y A;  1IQY A;  3KFQ C;  4MJD A;  4O2H A;  1YJ9 3;  4WP5 A;  3BNE A;  1QAF A;  3MSO A;  4O3V A;  4XB5 A;  3EHC A;  1ROA A;  1L5G B;  1RN7 A;  3HOH A;  1RNB A;  2K0M A;  3K0Z A;  4TX4 A;  1T5Y A;  3B8L A;  1E3V A;  5CF2 A;  3NBB A;  1BNS A;  5M18 A;  1Z1S A;  1DMQ A;  4FCZ A;  7GSP A;  1W6Y A;  1M1K 4;  1IYY A;  3NBJ A;  1EG9 B;  3OWS A;  5I97 A;  1YI2 3;  2PZV A;  1J2B A;  4N6V 0;  5DRE A;  3JUP A;  3G6E 3;  1B2M A;  2OTL 3;  1RRL A;  2J8X B;  3Q3F A;  6GSP A;  2Z6B A;  1ROV A;  2GEX A;  1GD4 A;  3HIG A;  2XRX B;  1GOY A;  2QGU A;  4HM5 B;  4X2O A;  2BT3 A;  4J5G A;  1AQZ A;  1PFP A;  2CH9 A;  2FXT A;  1EQK A;  1O7P B;  1IV9 A;  1CYU A;  5AIG A;  1FYS A;  3NHX A;  1BSD A;  1S5A A;  2C11 A;  3JVC A;  6RNT A;  1RSN A;  3G0K A;  2IA7 A;  3KII A;  3G71 3;  3AHW A;  3GAX A;  3Q90 A;  2GEY A;  4EBG A;  1I2E A;  3M8C A;  3CCL 3;  1QVG 2;  1VQ8 3;  1AV4 A;  4X2H A;  1YHQ 3;  4L7K A;  3I55 3;  1JKG B;  3EN8 A;  1BSB A;  3LH4 A;  5BU4 A;  1CEW I;  1PY3 A;  3F8H A;  4STD A;  3UL6 A;  3I56 3;  2IY2 A;  1SJW A;  5IF6 A;  1I0X A;  3E99 A;  3MG3 A;  3F14 A;  3CC7 3;  2KAA A;  1UCI A;  3F7X A;  3S5C A;  3EB8 A;  4GB5 A;  4ZM8 A;  3CC2 3;  1CYV A;  5EQL A;  3LXU X;  4BU4 A;  1JRQ A;  4N6O B;  3CC4 3;  5D81 A;  1BNF A;  2W0Q A;  1BRH A;  4MMY B;  1PYL A;  4WHA A;  1FA3 A;  1TRQ A;  2HML B;  4OVM A;  5BVB A;  2GU1 A;  4O02 B;  2CFK A;  3K9M C;  3SOA A;  4OK0 A;  4HYZ A;  1WTH A;  3S28 A;  1W4N A;  2KRT A;  4KFE A;  1STD A;  4CDL A;  2F4Y A;  2PNC A;  1FGQ A;  1RTU A;  3GWR A;  1JN5 B;  4HM1 B;  4RNZ A;  2ML5 A;  3KKG A;  3EJV A;  4FMD A;  1NB5 I;  3D79 A;  1G02 A;  3L0R A;  4HAA A;  1JB2 A;  4AKZ A;  2CHC A;  4HM3 B;  2XFT A;  3B4O A;  4LYL B;  4LZI A;  1RGK A;  1GD3 A;  5DRV A;  1QAL A;  1OAC A;  2V1L A;  3EBT A;  5KP4 A;  1K9M 4;  3TDG A;  1VQP 3;  2MF7 A;  2E2T A;  1D6Z A;  1VQQ A;  1RGL A;  3DGM A;  1BNR A;  3CPO A;  1BGS A;  1RKY A;  1LRA A;  2C4B A;  3NX0 A;  5FW5 A;  3X41 A;  4K1V A;  1MWS A;  3EBY A;  1RGA A;  1DVD A;  1B2X A;  2HMK B;  1QMA A;  3WA2 X;  1OHS A;  1I2G A;  3HI7 A;  2HOH A;  3J7Y d;  2CFL A;  2WGQ A;  1W2B 2;  3K7C A;  2CWT A;  3K5T A;  3GRD A;  1V74 A;  3BIR A;  4EYC A;  5HOH A;  3NV0 B;  1BSA A;  3WOF B;  4BL2 A;  3UNL A;  2F56 A;  1BOX A;  4GSP A;  3VF1 A;  1VQN 3;  1BNG A;  3QK9 A;  4KFD A;  2Y73 A;  3UL5 A;  1I0V A;  1Q42 A;  3D5G A;  1LXE A;  3HK4 A;  4N6M A;  1BRS A;  4HM2 B;  1VQL 3;  5JBS A;  2D1W A;  1U5O A;  1A2P A;  3NM7 A;  1NWW A;  1Q9E A;  5IEN A;  1GMR A;  4HM0 B;  2ZL8 A;  1FGM A;  3D3L A;  4HZB B;  2XGN A;  1LVN A;  2Z77 A;  1JN5 A;  3GSP A;  1SIH A;  3FF0 A;  1N5H A;  1W01 A;  2XSO B;  3FG3 A;  3K63 A;  3CXC 2;  1N8R 4;  1ZX2 A;  1TTO A;  3PGB A;  1RGF A;  5IER A;  3KSE D;  3WOE B;  7STD A;  3WR2 A;  2W6J H;  2OWP A;  4XBY A;  2BHM A;  2BU4 A;  3HX8 A;  1SQW A;  2Q07 A;  2UX0 A;  1RJO A;  5M1A A;  1IVW A;  1W7C A;  1FGO A;  3SX1 A;  1JZO A;  2UUG C;  3FG1 A;  3GZB A;  3WOD G;  3FLJ A;  2MC8 A;  1RCK A;  1NB3 I;  1C7H A;  5EVH A;  4LSO A;  1W5Z A;  2CC3 A;  5IG0 A;  3T8N A;  2STD A;  1RHL A;  5AYS C;  2W9Q A;  4N6N B;  1MGR A;  1BNI A;  1JNQ A;  1DMN A;  1UDI I;  4KZ1 A;  5D83 A;  3S67 A;  5A0O B;  5HGR A;  3ROB A;  3OXA A;  3SYU A;  1LQM B;  1N5P A;  1BUQ A;  2YFI B;  1GMQ A;  2OTJ 3;  1JB4 A;  1A2V A;  2HMN B;  2Y74 A;  3AMO A;  3GZR A;  4PEJ A;  3EN1 B;  4N3V A;  1LNH A;  2XR8 B;  1VQ4 3;  1RGC A;  5D82 A;  1K73 4;  1RGH A;  1IVX A;  4XM4 A;  1BSE A;  1TUH A;  3V92 A;  1LQG C;  3A5E A;  1DVC A;  1OUN A;  4RZM A;  4L8O A;  2CWV A;  4NHF A;  2CFW A;  3CCR 3;  3H3H A;  1CH0 A;  3CCS 3;  3H51 A;  1FUW A;  2RGQ A;  3CD6 3;  3KZT A;  2W2C A;  4HJL B;  5G1L A;  1OF5 B;  2P38 A;  2CX1 A;  3U97 A;  3WDG B;  4XBX A;  2W56 A;  4CPK A;  3Q2P A;  1TP6 A;  1QVF 2;  3WHO A;  4L8P A;  4HZ9 B;  1DE3 A;  1X1Y A;  3DUK A;  1UUV B;  2ZA4 A;  3LYG A;  1T3B A;  3Q1C A;  1QJG A;  1IQX A;  2H0I A;  1EUI C;  3DM8 A;  1Q86 4;  5KP3 A;  3IPT A;  3WMD A;  2ML6 A;  3NXJ A;  3URP A;  1EA2 A;  1WMO A;  4MMZ B;  3STD A;  4HM6 B;  1BRG A;  3DY5 A;  3VSY A;  3OWY A;  2GSP A;  3PZW A;  3CMA 3;  1C54 A;  1RN1 A;  5FGO A;  3BND A;  2SBL A;  3DGN A;  4MEI A;  4WWU C;  5AIF A;  5G2G A;  4EXR A;  2OCT A;  1US1 A;  2ZDJ A;  3EC9 A;  1OHO A;  3QRD A;  9RNT A;  1R4Y A;  3LTB A;  2F99 A;  4AEQ A;  1EKM A;  3EF8 A;  5BIR A;  3AHS A;  1G96 A;  1K41 A;  2YFJ B;  3CME 3;  1VQ9 3;  1OGZ A;  1TFK A;  3G16 A;  2CIU A;  4GL6 A;  5LC7 A;  5STD A;  3CCQ 3;  3MG1 A;  1BIR A;  1BSC A;  1VQ6 3;  1NJI 4;  1JV2 B;  3LZA A;  4LEH A;  4R4K A;  3MHE A;  3T0U A;  4H3U A;  1Y4K A;  1Q7H A;  1OGX A;  1A67 A;  1FGT A;  4HKV B;  1ASK A;  4EC6 A;  1BRJ A;  1FUT A;  1IQ8 A;  1MWR A;  4BTY A;  5JPU A;  1HZ1 A;  3LTC A;  2OQE A;  4J8T A;  1ZGX A;  3F40 A;  1IVV A;  2LQV A;  4FMC A;  1TU5 A;  1YVS A;  1BNE A;  3HII A;  1IK3 A;  3JUQ A;  5RNT A;  1YIT 3;  2ZHX B;  1AR0 A;  2CW9 A;  3LTD A;  1W2Z A;  3EX9 A;  1BU4 A;  3A76 A;  3FKA A;  2CWU A;  3BNC A;  3JUN A;  5ELJ A;  3S29 A;  4FCJ A;  2KF5 A;  2W03 A;  4O8S A;  2W9P A;  3MG2 A;  1VQ5 3;  1O7M B;  4KVH A;  2IMJ A;  2CX0 A;  3NBR A;  4CJN A;  2W56 B;  4NRE A;  1KWI A;  2B1X B;  1E3R A;  3FF2 A;  1RDS A;  1JJ2 2;  1GYB A;  3DXO A;  3LT8 A;  2OOV C;  2E2V A;  1K28 A;  3BLZ A;  1MWT A;  4NPB A;  5CLK A;  1LOV A;  4XBT A;  3N9H A;  1GY5 A;  1WQL B;  1O7H B;  1TIJ A;  1GOV A;  1UUW B;  1UUG B;  2HMJ B;  2K54 A;  2QEX 3;  1BRN L;  1ZS7 A;  1FW7 A;  7RNT A;  2RSX A;  1UCL A;  3ALA A;  3F8X A;  2QIY A;  4FCM A;  3MWZ A;  1AY7 A;  1FZU A;  1JZD A;  3FGY A;  3B7C A;  4JF8 A;  1UGI A;  2SAR A;  1I2F A;  1VZZ A;  2BMR B;  3NUV A;  5BXQ A;  1IVU A; 
#chains in the Genus database with same CATH homology
 1U8C B;  2OOV A;  2F98 A;  4FMA A;  4AKY A;  3OWU A;  5CF1 A;  4RBN A;  4BTW A;  4IT7 A;  4K1U A;  3SLU A;  1Q40 A;  4JRF A;  1UI7 A;  1WMN A;  2WOF A;  4RNY A;  1R4C A;  2Z7A A;  2QEX 3;  1FGR A;  1HU9 A;  2BMQ B;  3DGL A;  1CQS A;  3HZP A;  4Q53 A;  1STF I;  4R1K A;  2WOH A;  5IG5 A;  3OW2 2;  3X42 A;  4HM4 B;  6STD A;  1KC8 4;  1D6U A;  1ISK A;  2F86 B;  4HM8 B;  2P05 A;  2YFL B;  2WO0 A;  4IIA A;  3JUM A;  3VGN A;  1A90 A;  2GXF A;  3RGA A;  3RDE A;  4QWT A;  1PU4 A;  2INX A;  1WNH A;  2IUK A;  4HVN A;  3G8Z A;  3SED A;  3PCS A;  3CNM A;  5AI1 A;  2Z76 A;  3WA3 A;  3SXX A;  4KFF A;  1VQ7 3;  2D42 A;  1YJN 3;  2XSH B;  3OX9 A;  2C10 A;  1M1X B;  5IG4 A;  2CFD A;  1IT7 A;  2BNG A;  3LOY A;  4R9K A;  1GS3 A;  4WYK B;  1F8N A;  3GZY B;  2RFR A;  3MYT A;  2P09 A;  4LGQ A;  1AVL A;  3MKI A;  2LYX A;  3X3X A;  3X3Z A;  2A15 A;  1IV7 A;  1Q40 B;  3PXM A;  3FCS B;  1UI8 A;  3FZW A;  3KSP A;  3F7S A;  3V98 A;  3CCE 3;  5IEP A;  2JDI H;  3CCM 3;  2FNQ A;  3CNX A;  4IPB A;  3SOY A;  1D6Y A;  8CHO A;  3PCR A;  3CU3 A;  4LMI A;  4XDV A;  5AYR B;  4XDW A;  3LT9 A;  2W04 A;  4FR9 A;  1YGE A;  3KE7 A;  1IDP A;  1NU3 A;  3V99 A;  1A2K A;  4WYK A;  3PS8 A;  4EV5 A;  1SII A;  3CCV 3;  3DGO A;  5ELU A;  2HMM B;  4N6T A;  1OH0 A;  1OPY A;  3UB1 A;  1QAK A;  2P0X A;  1MOL A;  5IEO A;  1SPU A;  3BNB A;  3D9R A;  3CCU 3;  1ZO2 A;  4N6L A;  1M9G A;  2CFG A;  2CG1 A;  2KXG A;  5JPP A;  1OHP A;  1W02 A;  2OQE C;  2GU3 A;  2WGO A;  1DYU A;  1TFO A;  4WFO A;  5EEO A;  1GY7 A;  1LOX A;  1O7N B;  1YVB I;  2M7O A;  1VQK 3;  5AEU B;  1NDO B;  2B24 B;  2KCD A;  3X40 A;  2P0M A;  3N8B A;  1AVK A;  2CG0 A;  3NM2 A;  3S27 A;  3AMO B;  1O7W B;  4HBR A;  3EQQ B;  5AII A;  1NO3 A;  3FH1 A;  1YIJ 3;  1S72 3;  2JQ5 A;  4N6U A;  4CCV A;  3KN4 A;  1WMP A;  3F9S A;  1N9J A;  1DMM A;  1MNL A;  2O3O A;  2XFS A;  4U13 A;  1K8A 4;  1W6C A;  3GZX B;  3FG4 A;  1HKX A;  2O9U X;  5LC6 A;  4R80 A;  3CCJ 3;  1UW1 A;  5CXO A;  4EV2 A;  1ULI B;  5AEW B;  1OF5 A;  1ULJ B;  3DMC A;  1OCV A;  2YX9 A;  5AIH A;  4HM7 B;  2XH9 A;  2XF3 A;  1Q7Y 4;  1E97 A;  2CKF B;  1KD1 4;  2BO9 B;  1YJW 3;  4OUQ A;  1Q82 4;  2RCD A;  3MPH A;  2CK3 H;  3B4P A;  3T8U A;  5IW9 A;  2GBX B;  4I4K A;  1Q81 4;  3G4S 3;  2HMO B;  3PYJ A;  3EE1 A;  1KSI A;  3LTA A;  4K61 A;  1RRH A;  2FGT A;  3SVA A;  4MMX B;  3CPW 2;  4J9A A;  3ER7 A;  5CK6 A;  5KP1 A;  4FMB A;  3IMA B;  1JKG A;  3OV4 A;  5IG3 A;  4R9L A;  1VQM 3;  1W00 A;  2QA4 3;  1GY6 A;  2GBW B;  2XEP A;  3ECF A;  3LML A;  3O8Y A;  1W6G A;  2XGL A;  2L4V A;  1IT8 A;  3NQZ A;  4H61 A;  3NV0 A;  4K90 B;  2I9W A;  4ORL A;  2R4I A;  3UJM A;  1VQO 3;  5TGN A;  1M90 4;  3FSD A;  3RGR A;  3N54 B;  4G1M B;  3X3Y A;  1KQS 2;  1N9E A;  3U1W A;  4BTX A;  3JUO A;  3NQY A;  2IUJ A;  1N8Q A;  2BMO B;  1O7G B;  1IU7 A;  1JB5 A;  3IJE B;  3BB9 A;  3DZL A;  2E2U A;  3KFQ C;  3I0Y A;  1YJ9 3;  1IQY A;  4MJD A;  4O2H A;  4WP5 A;  3BNE A;  1QAF A;  3MSO A;  4O3V A;  4XB5 A;  3EHC A;  1ROA A;  1L5G B;  1RN7 A;  2K0M A;  3K0Z A;  4TX4 A;  1T5Y A;  3B8L A;  1E3V A;  5CF2 A;  3NBB A;  1Z1S A;  1DMQ A;  4FCZ A;  1W6Y A;  1M1K 4;  3NBJ A;  1EG9 B;  3OWS A;  5I97 A;  1YI2 3;  2PZV A;  1J2B A;  4N6V 0;  5DRE A;  3JUP A;  3G6E 3;  2OTL 3;  1RRL A;  2Z6B A;  1ROV A;  2GEX A;  1GD4 A;  3HIG A;  2XRX B;  4HM5 B;  2QGU A;  4X2O A;  2BT3 A;  1PFP A;  2CH9 A;  2FXT A;  1EQK A;  1O7P B;  1IV9 A;  1CYU A;  5AIG A;  3NHX A;  1S5A A;  2C11 A;  3JVC A;  3G0K A;  2IA7 A;  3KII A;  3G71 3;  3GAX A;  3Q90 A;  2GEY A;  4EBG A;  3M8C A;  1QVG 2;  3CCL 3;  1VQ8 3;  1AV4 A;  4X2H A;  1YHQ 3;  4L7K A;  3I55 3;  1JKG B;  3EN8 A;  3LH4 A;  1CEW I;  3UL6 A;  3F8H A;  4STD A;  3I56 3;  1SJW A;  5IF6 A;  3E99 A;  3MG3 A;  3F14 A;  3CC7 3;  3F7X A;  3S5C A;  3EB8 A;  4GB5 A;  4ZM8 A;  3CC2 3;  1CYV A;  5EQL A;  3LXU X;  1JRQ A;  4N6O B;  3CC4 3;  5D81 A;  2W0Q A;  4MMY B;  4WHA A;  1FA3 A;  4OVM A;  2HML B;  5BVB A;  2GU1 A;  4O02 B;  2CFK A;  3K9M C;  3SOA A;  4OK0 A;  4HYZ A;  1WTH A;  3S28 A;  1W4N A;  2KRT A;  4KFE A;  1STD A;  4CDL A;  2PNC A;  1FGQ A;  3GWR A;  1JN5 B;  4HM1 B;  4RNZ A;  2ML5 A;  3KKG A;  3EJV A;  4FMD A;  1NB5 I;  3L0R A;  1JB2 A;  4AKZ A;  2CHC A;  4HM3 B;  2XFT A;  3B4O A;  4LZI A;  5DRV A;  1GD3 A;  1QAL A;  1OAC A;  2V1L A;  3EBT A;  5KP4 A;  1K9M 4;  3TDG A;  1VQP 3;  2MF7 A;  2E2T A;  1D6Z A;  3DGM A;  3CPO A;  1RKY A;  3NX0 A;  5FW5 A;  3X41 A;  4K1V A;  3EBY A;  1DVD A;  2HMK B;  1QMA A;  3WA2 X;  1OHS A;  3HI7 A;  3J7Y d;  2CFL A;  2WGQ A;  1W2B 2;  3K7C A;  2CWT A;  3K5T A;  3GRD A;  1V74 A;  4EYC A;  3NV0 B;  3WOF B;  3UNL A;  3VF1 A;  1VQN 3;  3QK9 A;  4KFD A;  2Y73 A;  3UL5 A;  1Q42 A;  1LXE A;  3HK4 A;  4N6M A;  1VQL 3;  4HM2 B;  5JBS A;  1U5O A;  2D1W A;  3NM7 A;  1NWW A;  5IEN A;  4HM0 B;  2ZL8 A;  1FGM A;  3D3L A;  4HZB B;  2XGN A;  1LVN A;  2Z77 A;  1JN5 A;  1SIH A;  3FF0 A;  1N5H A;  1W01 A;  3FG3 A;  3K63 A;  3CXC 2;  1N8R 4;  1ZX2 A;  3PGB A;  5IER A;  3KSE D;  3WOE B;  7STD A;  2W6J H;  2OWP A;  4XBY A;  2BHM A;  3HX8 A;  1SQW A;  2Q07 A;  2UX0 A;  1RJO A;  1IVW A;  1W7C A;  1FGO A;  3SX1 A;  3FG1 A;  3GZB A;  3WOD G;  3FLJ A;  2MC8 A;  1NB3 I;  1C7H A;  5EVH A;  4LSO A;  1W5Z A;  2CC3 A;  5IG0 A;  3T8N A;  2STD A;  5AYS C;  2W9Q A;  4N6N B;  1DMN A;  1JNQ A;  3S67 A;  4KZ1 A;  5D83 A;  5A0O B;  5HGR A;  3ROB A;  3OXA A;  1N5P A;  1BUQ A;  2YFI B;  2OTJ 3;  1JB4 A;  1A2V A;  2HMN B;  2Y74 A;  3AMO A;  3GZR A;  4PEJ A;  3EN1 B;  4N3V A;  1LNH A;  2XR8 B;  1VQ4 3;  5D82 A;  1K73 4;  4XM4 A;  1IVX A;  1IVU A;  1TUH A;  3V92 A;  1DVC A;  1OUN A;  4RZM A;  4L8O A;  2CWV A;  4NHF A;  2CFW A;  3CCR 3;  3H3H A;  3CCS 3;  3H51 A;  1FUW A;  2RGQ A;  3CD6 3;  3KZT A;  2W2C A;  4HJL B;  1OF5 B;  2P38 A;  3U97 A;  3WDG B;  4XBX A;  2W56 A;  1QVF 2;  3Q2P A;  1TP6 A;  4L8P A;  4HZ9 B;  3DUK A;  1UUV B;  3LYG A;  3Q1C A;  1QJG A;  1IQX A;  1Q86 4;  3DM8 A;  5KP3 A;  3IPT A;  3WMD A;  2ML6 A;  3NXJ A;  1EA2 A;  1WMO A;  4MMZ B;  3STD A;  4HM6 B;  3DY5 A;  3VSY A;  3OWY A;  3PZW A;  3CMA 3;  5FGO A;  3BND A;  2SBL A;  3DGN A;  4MEI A;  4WWU C;  5AIF A;  5G2G A;  4EXR A;  3EC9 A;  2OCT A;  1US1 A;  2ZDJ A;  1OHO A;  3QRD A;  3LTB A;  2F99 A;  4AEQ A;  1EKM A;  3EF8 A;  1G96 A;  1K41 A;  2YFJ B;  3CME 3;  1VQ9 3;  1OGZ A;  1TFK A;  3G16 A;  2CIU A;  4GL6 A;  5LC7 A;  5STD A;  3CCQ 3;  3MG1 A;  1VQ6 3;  1NJI 4;  1JV2 B;  3LZA A;  4LEH A;  4R4K A;  3MHE A;  3T0U A;  4H3U A;  1Y4K A;  1A67 A;  1OGX A;  1FGT A;  4HKV B;  1ASK A;  4EC6 A;  1IQ8 A;  4BTY A;  5JPU A;  3LTC A;  2OQE A;  4J8T A;  3F40 A;  1IVV A;  2LQV A;  4FMC A;  1TU5 A;  3HII A;  1IK3 A;  3JUQ A;  1YIT 3;  1AR0 A;  2CW9 A;  3LTD A;  1W2Z A;  3EX9 A;  3A76 A;  3FKA A;  2CWU A;  3BNC A;  3JUN A;  5ELJ A;  3S29 A;  4FCJ A;  2W03 A;  4O8S A;  2W9P A;  3MG2 A;  1VQ5 3;  1O7M B;  4KVH A;  2IMJ A;  3NBR A;  2W56 B;  4NRE A;  1KWI A;  2B1X B;  1E3R A;  3FF2 A;  1JJ2 2;  1GYB A;  3DXO A;  3LT8 A;  2OOV C;  2E2V A;  1K28 A;  3BLZ A;  5CLK A;  4XBT A;  3N9H A;  1GY5 A;  1O7H B;  1TIJ A;  1WQL B;  1UUW B;  2HMJ B;  2K54 A;  2RSX A;  3ALA A;  3F8X A;  2QIY A;  4FCM A;  3MWZ A;  3FGY A;  3B7C A;  4JF8 A;  1VZZ A;  2BMR B;  3NUV A;  5BXQ A;  2XSO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...