5IERA

Structure of a computationally designed 17-ohp binder
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSLWRCTQAHDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFFDTHIAATRLTVTCEETFPSSSPDEIAHILVAHSEFDGGFTSEVRGVFTYRVNKAGLITNLRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OHP9
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 34
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ierA00
5FW5A 5KP3A 5DRVA 3KSPA 1QJGA 3G0KA 5JPPA 3MYTA 4HKVB 3OV4A 3F7SA 2STDA 3UJMA 1JN5A 3JUNA 5CF1A 3EBYA 3JUQA 1DMQA 2F98A 2B24B 4J9AA 2RFRA 2UX0A 3M8CA 5EVHA 3SEDA 1GY5A 2GBXB 1O7MB 2Z7AA 4HM8B 2XSHB 2K54A 1TUHA 3DZLA 1W01A 2CKFB 4XB5A 4WWUC 5BXQA 1Q40A 1ULIB 3FGYA 1GS3A 4X2HA 3Q90A 4HVNA 5DREA 3CNXA 2CHCA 1ZO2A 3T8UA 4K1VA 5CF2A 4OUQA 1OF5A 8CHOA 1A2KA 4STDA 5CLKA 5AIGA 1Z1SA 4HZ9B 1EG9B 2XR8B 4IIAA 3NBRA 4HJLB 1OHSA 3VGNA 2PZVA 5IF6A 3EF8A 1DMNA 2JQ5A 1HKXA 3LZAA 5AIFA 2W2CA 3DUKA 3H3HA 3CU3A 1OGXA 1ULJB 2BMRB 1C7HA 5CXOA 5KP4A 1JKGA 3I0YA 2YFLB 4HM2B 4N3VA 1UUVB 3K7CA 1S5AA 3MG2A 4L7KA 2BMQB 4HM0B 2Z77A 3EX9A 3T8NA 1BUQA 1NU3A 5AIIA 3EN8A 3ROBA 2HMOB 1E97A 3FF2A 5HGRA 3WMDA 1AR0A 3NHXA 3NV0A 1Q42A 5TGNA 3A76A 1OGZA 3NUVA 5IENA 3E99A 4OVMA 7STDA 1UUWB 3B7CA 4I4KA 5IG0A 3B4OA 4R9KA 1NDOB 2HMKB 5CK6A 2YFIB 2GEXA 2GEYA 3GWRA 3EJVA 4J8TA 4WYKB 3GZYB 1O7HB 3D9RA 2QIYA 4L8PA 3SOAA 1E3VA 4Q53A 5D81A 4LEHA 3ECFA 1O7WB 2A15A 3OWSA 5AIHA 2BMOB 2F99A 3B4PA 1U5OA 4HM7B 3F9SA 3FH1A 3CPOA 3HX8A 4K1UA 1O7GB 1OHOA 2HMLB 5IG5A 4PEJA 1OPYA 3HZPA 3OXAA 1JN5B 3OX9A 1W6YA 5STDA 1W00A 3DMCA 3FSDA 5IG4A 3F8XA 3BLZA 3MSOA 5IG3A 3UNLA 3RGRA 1DMMA 4HM6B 4XBYA 4WP5A 5IEPA 4XM4A 3FZWA 3LYGA 3DXOA 3EC9A 3OWYA 1Q40B 3EBTA 3GZBA 1O7PB 3MHEA 2HMJB 3F8HA 4U13A 4LMIA 1WQLB 4XDWA 5AI1A 1GY6A 4KVHA 3G16A 6STDA 1QMAA 2QGUA 3KE7A 4CDLA 1K41A 3F7XA 4MJDA 1OF5B 1IDPA 1ZX2A 4R1KA 2GBWB 2RCDA 3NM2A 3OWUA 2Z76A 3H51A 1TP6A 1GYBA 3F40A 4R9LA 5JPUA 5AEUB 3BB9A 1NWWA 3GRDA 3STDA 3JUPA 3FKAA 4FCJA 4ORLA 1JB4A 1ASKA 3EHCA 1SJWA 4HM3B 3VSYA 1GY7A 4XBXA 3SOYA 5D82A 5D83A 1OUNA 4LGQA 3DM8A 1JKGB 3GZRA 3MG1A 4HM5B 2BNGA 2GXFA 3G8ZA 3KKGA 3MG3A 3NXJA 1STDA 4X2OA 2I9WA 3EQQB 4HM4B 5IEOA 3K0ZA 1E3RA 3NV0B 2XRXB 2R4IA 3JUOA 4L8OA 1CQSA 1O7NB 3ER7A 5KP1A 1EA2A 2F86B 2XSOB 3FF0A 3EN1B 3KZTA 5IERA 1VZZA 1JB2A 1W02A 4XBTA 1ISKA 4H3UA 4HZBB 4XDVA 3S5CA 5BVBA 1JB5A 2IMJA 5AEWB 3MKIA 4HM1B 3GZXB 2B1XB 4WYKA 2YFJB 2OWPA 3FLJA 5G2GA 3RGAA 3IPTA 4GB5A 2INXA 2RGQA 4RZMA 2HMNB 4FCMA 1OHPA 3CNMA 3F14A 2HMMB 3HK4A 1OCVA 3B8LA 1OH0A 3JUMA
chains in the Genus database with same CATH superfamily
5FW5A 5KP3A 2MF7A 5DRVA 3AMOB 3KSPA 4FMAA 1QJGA 3G0KA 5JPPA 3MYTA 7GSPA 4HKVB 3DGNA 1PY3A 2RNTA 3SYUA 1BSBA 2P09A 3OV4A 1DVCA 3F7SA 1K8A4 1DE3A 1W4NA 2STDA 3UJMA 3CCL3 1JN5A 3JUNA 3ZG0A 5GSPA 1VQ43 1TJDA 1IYYA 2F4YA 5CF1A 1TFOA 3EBYA 3JUQA 3WA2X 1N5PA 1DMQA 1RSNA 1VQL3 3S67A 2F98A 4R4KA 3I563 3FG3A 1BVIA 1CEWI 1UI7A 1I2FA 2B24B 3NBJA 4J9AA 1RGGA 1W2ZA 2BT3A 2RFRA 2UX0A 3M8CA 1RDSA 2W56A 5EVHA 3SEDA 1GY5A 2ZL8A 2GBXB 1O7MB 2Z7AA 1N8R4 1VQ93 4HM8B 4LSOA 2XSHB 2K54A 2XGLA 3ALAA 2C4BA 1TUHA 3DZLA 1W01A 2CKFB 1B2UA 3PCRA 4WWUC 4XB5A 1QVG2 1A90A 1JJ22 3CC73 5BXQA 3V99A 1Q40A 1BNIA 2CX1A 1LQGC 1ULIB 3FGYA 1R4YA 3X3XA 3G6E3 1GS3A 1FGMA 4X2HA 2XH9A 4J5GA 3Q90A 4HVNA 5DREA 1YVBI 3CNXA 2CHCA 4MEIA 2UUGC 2H0GA 3JVCA 1I70A 1NO3A 3LT9A 3CXC2 3CPW2 1BNGA 2D42A 1ZO2A 3A5EA 2C11A 4HBRA 3T8UA 1N9EA 4K1VA 1MNLA 2W03A 1EKMA 2CH9A 2F5MA 1SIIA 5CF2A 4OUQA 3MWZA 1AQZA 3LXUX 1BRKA 2C10A 3CMA3 1QALA 1I2EA 1UI8A 4IT7A 2Q07A 3CCS3 1YJN3 1Y4KA 4EV5A 1LRAA 5M19A 4O2HA 2CG1A 1GMRA 1OF5A 1GD4A 3CME3 3RNTA 1GMPA 4FCZA 1M1K4 8CHOA 1A2KA 2KF4A 4STDA 2K0MA 3LMLA 4GSPA 5CLKA 2F56A 1SPUA 1YJ93 3AHWA 1BNJA 1AVKA 2L4VA 1KQS2 5AIGA 1Z1SA 1BOXA 1I0VA 2BIRA 5G1LA 4HZ9B 5RNTA 1IK3A 2GU1A 2K3DA 2KXGA 1EG9B 3LTAA 2XR8B 2GU3A 1B21A 2H0IA 4IIAA 1IV9A 3OW22 1Q9EA 1EUIC 1W2B2 3NBRA 4HJLB 2W04A 1OHSA 4ZM8A 4EV2A 4RNYA 1TRPA 3HI7A 3VGNA 2F5WA 4JRFA 1IVWA 2PZVA 5IF6A 1RNTA 4N6TA 3EB8A 3IJEB 3NQYA 1YGWA 3EF8A 4N6NB 5G1KA 1FGTA 3V98A 3PZWA 1RGLA 1DETA 3PS8A 5BU4A 3WA3A 1DMNA 2JQ5A 1TFKA 1I2GA 3UL6A 1HKXA 4GHOA 2ML5A 1RCKA 1Q7Y4 3LZAA 4KFDA 2W2CA 2M7OA 5AIFA 3J7Yd 3DUKA 1IT8A 3LH4A 3H3HA 3N9HA 3CU3A 1MWUA 2QA43 1OGXA 1RMSA 1T5YA 1ULJB 4EW5A 5AYSC 2BMRB 1BNRA 3LTBA 1QVF2 1C7HA 5CXOA 3QK9A 3X3ZA 1KC84 4RNZA 3CCJ3 5ELUA 5KP4A 1JKGA 3I0YA 2YFLB 4HM2B 4N3VA 4BTYA 1Q824 1VQ73 1F8NA 1UUVB 3K7CA 4JF8A 1IVUA 1S5AA 3MG2A 4L7KA 2BMQB 1OACA 4HM0B 2Z77A 3EX9A 3T8NA 1BUQA 1NU3A 2FXTA 5AIIA 3EN8A 1U8CB 1GD3A 4N6MA 3LOYA 3SX1A 1BANA 1Q7HA 4FMDA 4K90B 3ROBA 1VQK3 2HMOB 3K63A 3U1WA 1E97A 1V57A 3FF2A 5HGRA 1JBSA 3WMDA 1B20A 1AR0A 1HU9A 1BSCA 3LTDA 4N6OB 4EXRA 2OOVA 1RRLA 3KIIA 3UB1A 3WODG 5M18A 3NHXA 3KN4A 5AYRB 1WMOA 2XGNA 3HIGA 3NV0A 3WR2A 1DYUA 1G02A 1Q42A 3A76A 5TGNA 3U97A 1PYLA 1FYSA 1OGZA 1HYFA 3NUVA 1YGEA 2IUKA 3KSED 1Q814 1JV2B 3DH2A 2ML6A 7RNTA 5IENA 1MWRA 1I0XA 3E99A 1QAFA 4OVMA 1RJOA 2OTJ3 2XEPA 7STDA 1RGCA 1VQP3 1UUWB 2P05A 3B7CA 3PCSA 4RBNA 1LXEA 1YNVX 2PNCA 5ELJA 3UL5A 4I4KA 1M904 3PYJA 3I553 1J2BA 3S28A 1LOXA 3HOHA 2OTL3 1ZS7A 3S29A 5IG0A 2W9QA 4WHAA 3B4OA 3CCR3 3CD63 1WNHA 3CC43 4R9KA 1NDOB 1UCLA 2HMKB 5CK6A 1NB3I 2YFIB 1FUWA 2GEXA 2WGOA 4NHFA 1BNFA 2LQVA 2GEYA 4N6UA 1GOUA 3GWRA 3EJVA 1BSDA 1I3IA 4J8TA 1IT7A 3GZYB 1UGIA 1K28A 4WYKB 3ZFZA 1RN7A 1O7HB 1BU4A 2CFWA 3D9RA 6RNTA 3BNEA 4AKYA 4KZ1A 1TIJA 1LOVA 4BIRA 4EC6A 2QIYA 2OOVC 3WOEB 4L8PA 3SOAA 1E3VA 4Q53A 5D81A 1T2IA 3BIRA 3BNDA 1MGWA 3DGMA 4LEHA 5IW9A 3SXXA 3BU4A 4LZIA 3ECFA 2YX9A 4NREA 1O7WB 1UCJA 1KD14 1Q864 1IU7A 5LC7A 2A15A 3PXMA 2D1WA 3OWSA 3SLUA 1FA3A 5AIHA 3K9MC 2BMOB 2F99A 3B4PA 2XFTA 1U5OA 4HM7B 2O3OA 3F9SA 3FH1A 1A2VA 1FGOA 5BIRA 3CPOA 3HX8A 1BRSA 5JBSA 3D3LA 1BSAA 2RSXA 1O7GB 3EE1A 1OHOA 2HMLB 4K1UA 6GSPA 5FGOA 1YHQ3 5IG5A 2CW9A 4PEJA 4I5QA 1OPYA 2KF3A 2P38A 2XFSA 3HZPA 3G713 1N5HA 2QEX3 1RKYA 4BTWA 3OXAA 1JN5B 1X1UA 1YVSA 3X3YA 3OX9A 1IQ8A 1BNEA 1FGQA 1RN1A 1W6YA 3AMOA 3Q1CA 2ZHXB 5STDA 1MWSA 2Y74A 3Q3FA 1W00A 3DMCA 2GSPA 2R41A 5HOHA 3FSDA 5IG4A 1CH0A 3F8XA 1DVDA 3BLZA 1BAOA 3AGOA 3MSOA 4MMZB 5IG3A 4KFFA 2W56B 3UNLA 4EYCA 3RGRA 4MMXB 1DMMA 1JBTA 1A67A 1N9JA 2W9PA 4HM6B 4XBYA 2IUJA 1RGFA 4WP5A 5IEPA 4XM4A 1MGRA 3FZWA 3LYGA 3DXOA 3EC9A 3OWYA 3FG1A 2WOFA 1Q40B 3EBTA 2Y73A 3GZBA 2FGTA 4WFOA 3WDGB 4KT3B 1AV4A 3CCV3 2J8XB 4MMYB 4ILFA 3MPHA 1O7PB 3S27A 3MHEA 1BUJA 4BL3A 2HMJB 2WOHA 9RNTA 3F8HA 4RNTA 2SARA 3CC23 1VQ53 2CK3H 1PU4A 1I3FA 4U13A 4TX4A 4LMIA 2CIUA 1FUSA 1WQLB 4R80A 4XDWA 5AI1A 3GAXA 1LNHA 3VF1A 3X41A 4DKIA 4EBGA 3QRDA 1GY6A 4KVHA 1K9M4 3G16A 1KSIA 1CYUA 1BRNL 3CCM3 6STDA 1X1XA 1QMAA 1ROAA 2QGUA 3DGOA 1FZUA 1BRHA 1RRHA 3KE7A 4CDLA 1GSPA 2E2VA 1K41A 1RGAA 3X40A 1W6CA 3F7XA 1BRIA 4J5KA 8RNTA 4MJDA 3KFQC 1OF5B 3PGBA 2BHMA 1IDPA 1ZX2A 1MWTA 1STFI 4OK0A 1WMNA 1QAKA 1YIT3 4R1KA 1LOWA 4KFEA 5EEOA 3NX0A 2P0MA 1BSEA 2MC8A 2GBWB 2RCDA 2WGQA 2XF3A 1YI23 4AEQA 1D6YA 3SVAA 3NM2A 1UDII 1B27A 3FG4A 1YIJ3 1V74A 1X1WA 3OWUA 1US1A 4H61A 1C54A 2Z76A 3H51A 1JBRA 1TP6A 1GYBA 2IY2A 3F40A 1GMQA 1SARA 2W0QA 1CYVA 1TTOA 4K61A 1VQM3 4FMBA 4R9LA 2CG0A 1LNIA 5JPUA 1RGKA 3AHSA 4FR9A 5AEUB 1YJW3 1HZ1A 3BB9A 1NWWA 3O8YA 1IQXA 1G96A 1FGRA 1UCKA 3GRDA 1RN4A 5A0OB 2KAAA 3STDA 2W6JH 1MOLA 2ZA4A 3BNCA 1UGHI 1IVXA 3KCHA 3JUPA 3DGLA 2KF5A 4FMCA 2OQEA 1IQYA 1B2MA 3FKAA 1LOYA 4FCJA 4O8SA 4ORLA 3NM7A 1W7CA 2CFLA 4G1MB 1K734 4HAAA 2O9UX 1A2PA 1JB4A 1JNQA 4NPBA 4N6V0 1EQKA 1ASKA 1NNVA 1JRQA 1SJWA 3EHCA 4HOHA 1EEJA 1WTHA 4HM3B 1GY7A 3DY5A 1R4CA 1UCIA 3VSYA 3ZG5A 1B2XA 2CFDA 2RBIA 1GOYA 2CX0A 4XBXA 3SOYA 3TDGA 2HOHA 1BNSA 3GSPA 3K5TA 5D82A 5D83A 1OUNA 1T2HA 3L0RA 3D79A 3AGNA 4CPKA 2V1LA 4CCVA 1WMPA 4LGQA 2OCTA 3IMAB 3DM8A 1FW7A 2BU4A 1M1XB 1JKGB 1S723 2ZDJA 1D6ZA 1T3BA 3GZRA 3MG1A 1RGHA 1RHLA 4HM5B 4QWTA 2BNGA 4BU4A 3WOFB 2CFKA 2GXFA 3D5IA 1B2ZA 4O3VA 3BNBA 3G8ZA 3KKGA 4CJNA 1B2SA 2H0HA 2CWVA 5EQLA 5I97A 3X42A 3LT8A 3NBBA 3N8BA 3MG3A 3NXJA 1STDA 2SBLA 4GL6A 3CCQ3 1W5ZA 1VQN3 4X2OA 1UW1A 2I9WA 2OQEC 1UUGB 3D5GA 3EQQB 4BL2A 1NB5I 3V92A 2FNQA 2WO0A 1W6GA 4HM4B 5IEOA 3DGYA 3K0ZA 1E3RA 2AADA 2P0XA 3NV0B 2XRXB 1LQMB 1VQQA 1VQO3 1RCLA 2R4IA 3JUOA 1BIRA 4O02B 2AAEA 3CCU3 1SIHA 2LYXA 4L8OA 1B3SA 1SQWA 1GOVA 2KRTA 1RLSA 1VQ63 1CQSA 1ROVA 1O7NB 3NQZA 3Q2PA 4AKZA 3CCE3 3FCSB 4HYZA 3ER7A 5KP1A 1EA2A 1IV7A 2F86B 3WHOA 1M9GA 2XSOB 3FF0A 3EN1B 1KWIA 3KZTA 5IERA 1G0TA 1D6UA 1VZZA 1JB2A 1W02A 4XBTA 2KF6A 1ISKA 1VQ83 4H3UA 4HZBB 2IA7A 4XDVA 3S5CA 1PFPA 3HIIA 4N6LA 1RNBA 1JZOA 5LC6A 2E2TA 5BVBA 1JB5A 2IMJA 2IYJA 1NJI4 2CWTA 1BRJA 5AEWB 1JZDA 3MKIA 4HM1B 1TU5A 3N54B 1I8VA 3GZXB 2JDIH 2B1XB 4WYKA 2L1SA 1LVNA 1ZGXA 2KCDA 2OWPA 2YFJB 3FLJA 5G2GA 3URPA 2E2UA 1FUTA 1AY7A 2BO9B 3RGAA 1TRQA 3IPTA 3LTCA 4GB5A 2INXA 2RGQA 2UGIA 3T0UA 1BRGA 2Z6BA 2CWUA 1IVVA 1RTUA 3RDEA 2CFGA 4RZMA 3G4S3 2HMNB 1L5GB 4BTXA 4FCMA 1OHPA 1V58A 1X1YA 3CNMA 1RGEA 5M1AA 2CC3A 3F14A 2HMMB 3HK4A 1OCVA 4LYLB 4IPBA 3B8LA 1OH0A 3D4AA 3JUMA 1BGSA 1N8QA 1AVLA
chains in the Genus database with same CATH topology
5FW5A 5KP3A 2MF7A 5DRVA 3AMOB 3KSPA 4FMAA 1QJGA 3G0KA 5JPPA 3MYTA 4HKVB 3DGNA 2P09A 3OV4A 1DVCA 3F7SA 1K8A4 1W4NA 2STDA 3UJMA 3CCL3 1JN5A 3JUNA 1VQ43 5CF1A 1TFOA 3EBYA 3JUQA 3WA2X 1N5PA 1DMQA 1VQL3 3S67A 2F98A 4R4KA 3I563 3FG3A 1CEWI 1UI7A 2B24B 3NBJA 4J9AA 1W2ZA 2BT3A 2RFRA 2UX0A 3M8CA 2W56A 5EVHA 3SEDA 1GY5A 2ZL8A 2GBXB 1O7MB 2Z7AA 1N8R4 1VQ93 4HM8B 4LSOA 2XSHB 2K54A 2XGLA 3ALAA 1TUHA 3DZLA 1W01A 2CKFB 3PCRA 4XB5A 4WWUC 1QVG2 1A90A 1JJ22 3CC73 5BXQA 3V99A 1Q40A 1ULIB 3FGYA 3X3XA 3G6E3 1GS3A 1FGMA 4X2HA 2XH9A 3Q90A 4HVNA 5DREA 1YVBI 3CNXA 2CHCA 4MEIA 3CXC2 3JVCA 3CPW2 1NO3A 3LT9A 2D42A 1ZO2A 2C11A 4HBRA 3T8UA 1N9EA 4K1VA 1MNLA 2W03A 1EKMA 2CH9A 1SIIA 5CF2A 4OUQA 3MWZA 3LXUX 2C10A 3CMA3 1QALA 1UI8A 4IT7A 1YJN3 2Q07A 3CCS3 1Y4KA 4EV5A 4O2HA 2CG1A 1OF5A 1GD4A 3CME3 4FCZA 1M1K4 8CHOA 1A2KA 4STDA 2K0MA 3LMLA 5CLKA 1SPUA 1YJ93 1KQS2 2L4VA 1AVKA 5AIGA 1Z1SA 1IK3A 4HZ9B 2GU1A 2KXGA 1EG9B 3LTAA 2XR8B 2GU3A 4IIAA 1IV9A 3OW22 1W2B2 3NBRA 4HJLB 2W04A 1OHSA 4ZM8A 4EV2A 4RNYA 3HI7A 3VGNA 4JRFA 1IVWA 2PZVA 5IF6A 4N6TA 3EB8A 3IJEB 3NQYA 3EF8A 4N6NB 1FGTA 3V98A 3PZWA 3PS8A 3WA3A 1DMNA 2JQ5A 1TFKA 3UL6A 1HKXA 2ML5A 1Q7Y4 3LZAA 4KFDA 2W2CA 2M7OA 5AIFA 3J7Yd 3DUKA 1IT8A 3LH4A 3H3HA 3N9HA 3CU3A 2QA43 1OGXA 1T5YA 1ULJB 5AYSC 2BMRB 3LTBA 1QVF2 1C7HA 5CXOA 3QK9A 3X3ZA 1KC84 4RNZA 3CCJ3 5ELUA 5KP4A 1JKGA 3I0YA 2YFLB 4HM2B 4N3VA 4BTYA 1Q824 1VQ73 1F8NA 1UUVB 3K7CA 4JF8A 1IVUA 1S5AA 3MG2A 4L7KA 2BMQB 1OACA 4HM0B 2Z77A 3EX9A 3T8NA 1BUQA 1NU3A 2FXTA 5AIIA 3EN8A 1U8CB 1GD3A 4N6MA 3LOYA 3SX1A 4FMDA 4K90B 3ROBA 1VQK3 2HMOB 3K63A 3U1WA 1E97A 3FF2A 5HGRA 3WMDA 1HU9A 1AR0A 4EXRA 3LTDA 4N6OB 2OOVA 1RRLA 3KIIA 3UB1A 3WODG 3NHXA 3KN4A 5AYRB 1WMOA 2XGNA 3HIGA 3NV0A 1DYUA 1Q42A 5TGNA 3A76A 3U97A 1OGZA 3NUVA 1YGEA 2IUKA 3KSED 1Q814 1JV2B 5IENA 2ML6A 2OTJ3 3E99A 4OVMA 1QAFA 1RJOA 2XEPA 7STDA 1VQP3 1UUWB 2P05A 3B7CA 3PCSA 4RBNA 1LXEA 2PNCA 5ELJA 3UL5A 4I4KA 1M904 3PYJA 3I553 1J2BA 3S28A 1LOXA 2OTL3 3S29A 5IG0A 2W9QA 4WHAA 3B4OA 3CCR3 3CD63 1WNHA 3CC43 4R9KA 1NDOB 2HMKB 5CK6A 1NB3I 2YFIB 1FUWA 2GEXA 2WGOA 4NHFA 2LQVA 2GEYA 4N6UA 3GWRA 3EJVA 4J8TA 4WYKB 1IT7A 3GZYB 1K28A 1RN7A 1O7HB 2CFWA 3D9RA 3BNEA 4AKYA 4KZ1A 1TIJA 4EC6A 2QIYA 2OOVC 3WOEB 4L8PA 3SOAA 1E3VA 4Q53A 5D81A 3BNDA 3DGMA 4LEHA 5IW9A 3SXXA 4LZIA 3ECFA 2YX9A 4NREA 1O7WB 1KD14 1Q864 1IU7A 5LC7A 2A15A 3PXMA 2D1WA 3OWSA 3SLUA 1FA3A 5AIHA 3K9MC 2BMOB 2F99A 3B4PA 2XFTA 1U5OA 4HM7B 2O3OA 3F9SA 3FH1A 1A2VA 1FGOA 3CPOA 3HX8A 5JBSA 3D3LA 2RSXA 1O7GB 3EE1A 1OHOA 2HMLB 4K1UA 1YHQ3 5FGOA 5IG5A 2CW9A 4PEJA 1OPYA 2XFSA 2P38A 3HZPA 3G713 1N5HA 2QEX3 1RKYA 4BTWA 3OXAA 1JN5B 3X3YA 3OX9A 1IQ8A 3AMOA 1FGQA 3Q1CA 1W6YA 5STDA 2Y74A 1W00A 3DMCA 3FSDA 5IG4A 3F8XA 1DVDA 3BLZA 3MSOA 4MMZB 5IG3A 4KFFA 2W56B 3UNLA 4EYCA 3RGRA 4MMXB 1DMMA 1A67A 1N9JA 2W9PA 4HM6B 4XBYA 2IUJA 4WP5A 5IEPA 4XM4A 3FZWA 3LYGA 3DXOA 3EC9A 3OWYA 3FG1A 2WOFA 1Q40B 3EBTA 2Y73A 3GZBA 2FGTA 4WFOA 3WDGB 1AV4A 3CCV3 4MMYB 3MPHA 1O7PB 3S27A 3MHEA 2HMJB 2WOHA 3F8HA 3CC23 1VQ53 2CK3H 1PU4A 4U13A 4TX4A 4LMIA 2CIUA 1WQLB 4XDWA 4R80A 5AI1A 3VF1A 3GAXA 1LNHA 3X41A 4EBGA 3QRDA 1GY6A 4KVHA 1K9M4 3G16A 1KSIA 1CYUA 3CCM3 6STDA 1QMAA 1ROAA 2QGUA 3DGOA 1RRHA 3KE7A 4CDLA 2E2VA 1K41A 3X40A 1W6CA 3F7XA 4MJDA 3KFQC 1OF5B 3PGBA 2BHMA 1IDPA 1ZX2A 1STFI 4OK0A 1WMNA 1QAKA 1YIT3 4R1KA 5EEOA 4KFEA 3NX0A 2P0MA 2MC8A 2GBWB 2RCDA 2WGQA 2XF3A 1YI23 4AEQA 1D6YA 3SVAA 3NM2A 3FG4A 1YIJ3 1V74A 3OWUA 1US1A 4H61A 2Z76A 3H51A 1TP6A 1GYBA 3F40A 2W0QA 1CYVA 4K61A 1VQM3 4FMBA 4R9LA 2CG0A 5JPUA 1YJW3 5AEUB 4FR9A 3BB9A 1NWWA 3O8YA 1IQXA 1G96A 1FGRA 3GRDA 5A0OB 3STDA 2W6JH 1MOLA 3BNCA 1IVXA 3JUPA 3DGLA 4FMCA 2OQEA 1IQYA 3FKAA 4FCJA 4O8SA 4ORLA 3NM7A 1W7CA 2CFLA 4G1MB 1K734 2O9UX 1JB4A 1JNQA 4N6V0 1EQKA 1ASKA 3EHCA 1JRQA 1SJWA 4HM3B 1WTHA 3VSYA 1GY7A 3DY5A 1R4CA 2CFDA 4XBXA 3SOYA 3TDGA 3K5TA 5D82A 5D83A 1OUNA 3L0RA 2V1LA 4CCVA 1WMPA 4LGQA 2OCTA 3IMAB 3DM8A 1M1XB 1JKGB 1S723 2ZDJA 1D6ZA 3GZRA 3MG1A 4QWTA 4HM5B 2BNGA 3WOFB 2CFKA 2GXFA 4O3VA 3BNBA 3G8ZA 3KKGA 2CWVA 5EQLA 5I97A 3X42A 3LT8A 3NBBA 3N8BA 3MG3A 3NXJA 1STDA 2SBLA 4GL6A 3CCQ3 1W5ZA 1VQN3 4X2OA 1UW1A 2I9WA 2OQEC 3EQQB 1NB5I 3V92A 2FNQA 2WO0A 1W6GA 4HM4B 5IEOA 3K0ZA 1E3RA 2P0XA 3NV0B 2XRXB 1VQO3 2R4IA 3JUOA 4O02B 3CCU3 1SIHA 2LYXA 4L8OA 1SQWA 2KRTA 1VQ63 1CQSA 1ROVA 1O7NB 3NQZA 3Q2PA 4AKZA 3CCE3 3FCSB 4HYZA 3ER7A 5KP1A 1EA2A 1IV7A 2F86B 1M9GA 2XSOB 3FF0A 3EN1B 1KWIA 3KZTA 5IERA 1D6UA 1VZZA 1JB2A 1W02A 4XBTA 1ISKA 1VQ83 4H3UA 4HZBB 2IA7A 4XDVA 3S5CA 1PFPA 3HIIA 4N6LA 5LC6A 2E2TA 5BVBA 1JB5A 2IMJA 1NJI4 2CWTA 5AEWB 3MKIA 4HM1B 1TU5A 3N54B 3GZXB 2JDIH 2B1XB 4WYKA 1LVNA 2OWPA 2KCDA 2YFJB 3FLJA 5G2GA 2E2UA 2BO9B 3RGAA 3IPTA 3LTCA 4GB5A 2INXA 2RGQA 3T0UA 2Z6BA 2CWUA 1IVVA 3RDEA 2CFGA 4RZMA 3G4S3 2HMNB 1L5GB 4BTXA 4FCMA 1OHPA 3CNMA 2CC3A 3F14A 2HMMB 3HK4A 1OCVA 4IPBA 3B8LA 1OH0A 3JUMA 1N8QA 1AVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FW5 A;  5KP3 A;  5DRV A;  3KSP A;  1QJG A;  3G0K A;  5JPP A;  3MYT A;  4HKV B;  3OV4 A;  3F7S A;  2STD A;  3UJM A;  1JN5 A;  3JUN A;  5CF1 A;  3EBY A;  3JUQ A;  1DMQ A;  2F98 A;  2B24 B;  4J9A A;  2RFR A;  2UX0 A;  3M8C A;  5EVH A;  3SED A;  1GY5 A;  2GBX B;  1O7M B;  2Z7A A;  4HM8 B;  2XSH B;  2K54 A;  1TUH A;  3DZL A;  1W01 A;  2CKF B;  4XB5 A;  4WWU C;  5BXQ A;  1Q40 A;  1ULI B;  3FGY A;  1GS3 A;  4X2H A;  3Q90 A;  4HVN A;  5DRE A;  3CNX A;  2CHC A;  1ZO2 A;  3T8U A;  4K1V A;  5CF2 A;  4OUQ A;  1OF5 A;  8CHO A;  1A2K A;  4STD A;  5CLK A;  5AIG A;  1Z1S A;  4HZ9 B;  1EG9 B;  2XR8 B;  4IIA A;  3NBR A;  4HJL B;  1OHS A;  3VGN A;  2PZV A;  5IF6 A;  3EF8 A;  1DMN A;  2JQ5 A;  1HKX A;  3LZA A;  5AIF A;  2W2C A;  3DUK A;  3H3H A;  3CU3 A;  1OGX A;  1ULJ B;  2BMR B;  1C7H A;  5CXO A;  5KP4 A;  1JKG A;  3I0Y A;  2YFL B;  4HM2 B;  4N3V A;  1UUV B;  3K7C A;  1S5A A;  3MG2 A;  4L7K A;  2BMQ B;  4HM0 B;  2Z77 A;  3EX9 A;  3T8N A;  1BUQ A;  1NU3 A;  5AII A;  3EN8 A;  3ROB A;  2HMO B;  1E97 A;  3FF2 A;  5HGR A;  3WMD A;  1AR0 A;  3NHX A;  3NV0 A;  1Q42 A;  5TGN A;  3A76 A;  1OGZ A;  3NUV A;  5IEN A;  3E99 A;  4OVM A;  7STD A;  1UUW B;  3B7C A;  4I4K A;  5IG0 A;  3B4O A;  4R9K A;  1NDO B;  2HMK B;  5CK6 A;  2YFI B;  2GEX A;  2GEY A;  3GWR A;  3EJV A;  4J8T A;  4WYK B;  3GZY B;  1O7H B;  3D9R A;  2QIY A;  4L8P A;  3SOA A;  1E3V A;  4Q53 A;  5D81 A;  4LEH A;  3ECF A;  1O7W B;  2A15 A;  3OWS A;  5AIH A;  2BMO B;  2F99 A;  3B4P A;  1U5O A;  4HM7 B;  3F9S A;  3FH1 A;  3CPO A;  3HX8 A;  4K1U A;  1O7G B;  1OHO A;  2HML B;  5IG5 A;  4PEJ A;  1OPY A;  3HZP A;  3OXA A;  1JN5 B;  3OX9 A;  1W6Y A;  5STD A;  1W00 A;  3DMC A;  3FSD A;  5IG4 A;  3F8X A;  3BLZ A;  3MSO A;  5IG3 A;  3UNL A;  3RGR A;  1DMM A;  4HM6 B;  4XBY A;  4WP5 A;  5IEP A;  4XM4 A;  3FZW A;  3LYG A;  3DXO A;  3EC9 A;  3OWY A;  1Q40 B;  3EBT A;  3GZB A;  1O7P B;  3MHE A;  2HMJ B;  3F8H A;  4U13 A;  4LMI A;  1WQL B;  4XDW A;  5AI1 A;  1GY6 A;  4KVH A;  3G16 A;  6STD A;  1QMA A;  2QGU A;  3KE7 A;  4CDL A;  1K41 A;  3F7X A;  4MJD A;  1OF5 B;  1IDP A;  1ZX2 A;  4R1K A;  2GBW B;  2RCD A;  3NM2 A;  3OWU A;  2Z76 A;  3H51 A;  1TP6 A;  1GYB A;  3F40 A;  4R9L A;  5JPU A;  5AEU B;  3BB9 A;  1NWW A;  3GRD A;  3STD A;  3JUP A;  3FKA A;  4FCJ A;  4ORL A;  1JB4 A;  1ASK A;  3EHC A;  1SJW A;  4HM3 B;  3VSY A;  1GY7 A;  4XBX A;  3SOY A;  5D82 A;  5D83 A;  1OUN A;  4LGQ A;  3DM8 A;  1JKG B;  3GZR A;  3MG1 A;  4HM5 B;  2BNG A;  2GXF A;  3G8Z A;  3KKG A;  3MG3 A;  3NXJ A;  1STD A;  4X2O A;  2I9W A;  3EQQ B;  4HM4 B;  5IEO A;  3K0Z A;  1E3R A;  3NV0 B;  2XRX B;  2R4I A;  3JUO A;  4L8O A;  1CQS A;  1O7N B;  3ER7 A;  5KP1 A;  1EA2 A;  2F86 B;  2XSO B;  3FF0 A;  3EN1 B;  3KZT A;  5IER A;  1VZZ A;  1JB2 A;  1W02 A;  4XBT A;  1ISK A;  4H3U A;  4HZB B;  4XDV A;  3S5C A;  5BVB A;  1JB5 A;  2IMJ A;  5AEW B;  3MKI A;  4HM1 B;  3GZX B;  2B1X B;  4WYK A;  2YFJ B;  2OWP A;  3FLJ A;  5G2G A;  3RGA A;  3IPT A;  4GB5 A;  2INX A;  2RGQ A;  4RZM A;  2HMN B;  4FCM A;  1OHP A;  3CNM A;  3F14 A;  2HMM B;  3HK4 A;  1OCV A;  3B8L A;  1OH0 A;  3JUM A; 
#chains in the Genus database with same CATH topology
 5FW5 A;  5KP3 A;  2MF7 A;  5DRV A;  3AMO B;  3KSP A;  4FMA A;  1QJG A;  3G0K A;  5JPP A;  3MYT A;  7GSP A;  4HKV B;  3DGN A;  1PY3 A;  2RNT A;  3SYU A;  1BSB A;  2P09 A;  3OV4 A;  1DVC A;  3F7S A;  1K8A 4;  1DE3 A;  1W4N A;  2STD A;  3UJM A;  3CCL 3;  1JN5 A;  3JUN A;  3ZG0 A;  5GSP A;  1VQ4 3;  1TJD A;  1IYY A;  2F4Y A;  5CF1 A;  1TFO A;  3EBY A;  3JUQ A;  3WA2 X;  1N5P A;  1DMQ A;  1RSN A;  1VQL 3;  3S67 A;  2F98 A;  4R4K A;  3I56 3;  3FG3 A;  1BVI A;  1CEW I;  1UI7 A;  1I2F A;  2B24 B;  3NBJ A;  4J9A A;  1RGG A;  1W2Z A;  2BT3 A;  2RFR A;  2UX0 A;  3M8C A;  1RDS A;  2W56 A;  5EVH A;  3SED A;  1GY5 A;  2ZL8 A;  2GBX B;  1O7M B;  2Z7A A;  1N8R 4;  1VQ9 3;  4HM8 B;  4LSO A;  2XSH B;  2K54 A;  2XGL A;  3ALA A;  2C4B A;  1TUH A;  3DZL A;  1W01 A;  2CKF B;  1B2U A;  3PCR A;  4WWU C;  4XB5 A;  1QVG 2;  1A90 A;  1JJ2 2;  3CC7 3;  5BXQ A;  3V99 A;  1Q40 A;  1BNI A;  2CX1 A;  1LQG C;  1ULI B;  3FGY A;  1R4Y A;  3X3X A;  3G6E 3;  1GS3 A;  1FGM A;  4X2H A;  2XH9 A;  4J5G A;  3Q90 A;  4HVN A;  5DRE A;  1YVB I;  3CNX A;  2CHC A;  4MEI A;  2UUG C;  2H0G A;  3JVC A;  1I70 A;  1NO3 A;  3LT9 A;  3CXC 2;  3CPW 2;  1BNG A;  2D42 A;  1ZO2 A;  3A5E A;  2C11 A;  4HBR A;  3T8U A;  1N9E A;  4K1V A;  1MNL A;  2W03 A;  1EKM A;  2CH9 A;  2F5M A;  1SII A;  5CF2 A;  4OUQ A;  3MWZ A;  1AQZ A;  3LXU X;  1BRK A;  2C10 A;  3CMA 3;  1QAL A;  1I2E A;  1UI8 A;  4IT7 A;  2Q07 A;  3CCS 3;  1YJN 3;  1Y4K A;  4EV5 A;  1LRA A;  5M19 A;  4O2H A;  2CG1 A;  1GMR A;  1OF5 A;  1GD4 A;  3CME 3;  3RNT A;  1GMP A;  4FCZ A;  1M1K 4;  8CHO A;  1A2K A;  2KF4 A;  4STD A;  2K0M A;  3LML A;  4GSP A;  5CLK A;  2F56 A;  1SPU A;  1YJ9 3;  3AHW A;  1BNJ A;  1AVK A;  2L4V A;  1KQS 2;  5AIG A;  1Z1S A;  1BOX A;  1I0V A;  2BIR A;  5G1L A;  4HZ9 B;  5RNT A;  1IK3 A;  2GU1 A;  2K3D A;  2KXG A;  1EG9 B;  3LTA A;  2XR8 B;  2GU3 A;  1B21 A;  2H0I A;  4IIA A;  1IV9 A;  3OW2 2;  1Q9E A;  1EUI C;  1W2B 2;  3NBR A;  4HJL B;  2W04 A;  1OHS A;  4ZM8 A;  4EV2 A;  4RNY A;  1TRP A;  3HI7 A;  3VGN A;  2F5W A;  4JRF A;  1IVW A;  2PZV A;  5IF6 A;  1RNT A;  4N6T A;  3EB8 A;  3IJE B;  3NQY A;  1YGW A;  3EF8 A;  4N6N B;  5G1K A;  1FGT A;  3V98 A;  3PZW A;  1RGL A;  1DET A;  3PS8 A;  5BU4 A;  3WA3 A;  1DMN A;  2JQ5 A;  1TFK A;  1I2G A;  3UL6 A;  1HKX A;  4GHO A;  2ML5 A;  1RCK A;  1Q7Y 4;  3LZA A;  4KFD A;  2W2C A;  2M7O A;  5AIF A;  3J7Y d;  3DUK A;  1IT8 A;  3LH4 A;  3H3H A;  3N9H A;  3CU3 A;  1MWU A;  2QA4 3;  1OGX A;  1RMS A;  1T5Y A;  1ULJ B;  4EW5 A;  5AYS C;  2BMR B;  1BNR A;  3LTB A;  1QVF 2;  1C7H A;  5CXO A;  3QK9 A;  3X3Z A;  1KC8 4;  4RNZ A;  3CCJ 3;  5ELU A;  5KP4 A;  1JKG A;  3I0Y A;  2YFL B;  4HM2 B;  4N3V A;  4BTY A;  1Q82 4;  1VQ7 3;  1F8N A;  1UUV B;  3K7C A;  4JF8 A;  1IVU A;  1S5A A;  3MG2 A;  4L7K A;  2BMQ B;  1OAC A;  4HM0 B;  2Z77 A;  3EX9 A;  3T8N A;  1BUQ A;  1NU3 A;  2FXT A;  5AII A;  3EN8 A;  1U8C B;  1GD3 A;  4N6M A;  3LOY A;  3SX1 A;  1BAN A;  1Q7H A;  4FMD A;  4K90 B;  3ROB A;  1VQK 3;  2HMO B;  3K63 A;  3U1W A;  1E97 A;  1V57 A;  3FF2 A;  5HGR A;  1JBS A;  3WMD A;  1B20 A;  1AR0 A;  1HU9 A;  1BSC A;  3LTD A;  4N6O B;  4EXR A;  2OOV A;  1RRL A;  3KII A;  3UB1 A;  3WOD G;  5M18 A;  3NHX A;  3KN4 A;  5AYR B;  1WMO A;  2XGN A;  3HIG A;  3NV0 A;  3WR2 A;  1DYU A;  1G02 A;  1Q42 A;  3A76 A;  5TGN A;  3U97 A;  1PYL A;  1FYS A;  1OGZ A;  1HYF A;  3NUV A;  1YGE A;  2IUK A;  3KSE D;  1Q81 4;  1JV2 B;  3DH2 A;  2ML6 A;  7RNT A;  5IEN A;  1MWR A;  1I0X A;  3E99 A;  1QAF A;  4OVM A;  1RJO A;  2OTJ 3;  2XEP A;  7STD A;  1RGC A;  1VQP 3;  1UUW B;  2P05 A;  3B7C A;  3PCS A;  4RBN A;  1LXE A;  1YNV X;  2PNC A;  5ELJ A;  3UL5 A;  4I4K A;  1M90 4;  3PYJ A;  3I55 3;  1J2B A;  3S28 A;  1LOX A;  3HOH A;  2OTL 3;  1ZS7 A;  3S29 A;  5IG0 A;  2W9Q A;  4WHA A;  3B4O A;  3CCR 3;  3CD6 3;  1WNH A;  3CC4 3;  4R9K A;  1NDO B;  1UCL A;  2HMK B;  5CK6 A;  1NB3 I;  2YFI B;  1FUW A;  2GEX A;  2WGO A;  4NHF A;  1BNF A;  2LQV A;  2GEY A;  4N6U A;  1GOU A;  3GWR A;  3EJV A;  1BSD A;  1I3I A;  4J8T A;  1IT7 A;  3GZY B;  1UGI A;  1K28 A;  4WYK B;  3ZFZ A;  1RN7 A;  1O7H B;  1BU4 A;  2CFW A;  3D9R A;  6RNT A;  3BNE A;  4AKY A;  4KZ1 A;  1TIJ A;  1LOV A;  4BIR A;  4EC6 A;  2QIY A;  2OOV C;  3WOE B;  4L8P A;  3SOA A;  1E3V A;  4Q53 A;  5D81 A;  1T2I A;  3BIR A;  3BND A;  1MGW A;  3DGM A;  4LEH A;  5IW9 A;  3SXX A;  3BU4 A;  4LZI A;  3ECF A;  2YX9 A;  4NRE A;  1O7W B;  1UCJ A;  1KD1 4;  1Q86 4;  1IU7 A;  5LC7 A;  2A15 A;  3PXM A;  2D1W A;  3OWS A;  3SLU A;  1FA3 A;  5AIH A;  3K9M C;  2BMO B;  2F99 A;  3B4P A;  2XFT A;  1U5O A;  4HM7 B;  2O3O A;  3F9S A;  3FH1 A;  1A2V A;  1FGO A;  5BIR A;  3CPO A;  3HX8 A;  1BRS A;  5JBS A;  3D3L A;  1BSA A;  2RSX A;  1O7G B;  3EE1 A;  1OHO A;  2HML B;  4K1U A;  6GSP A;  5FGO A;  1YHQ 3;  5IG5 A;  2CW9 A;  4PEJ A;  4I5Q A;  1OPY A;  2KF3 A;  2P38 A;  2XFS A;  3HZP A;  3G71 3;  1N5H A;  2QEX 3;  1RKY A;  4BTW A;  3OXA A;  1JN5 B;  1X1U A;  1YVS A;  3X3Y A;  3OX9 A;  1IQ8 A;  1BNE A;  1FGQ A;  1RN1 A;  1W6Y A;  3AMO A;  3Q1C A;  2ZHX B;  5STD A;  1MWS A;  2Y74 A;  3Q3F A;  1W00 A;  3DMC A;  2GSP A;  2R41 A;  5HOH A;  3FSD A;  5IG4 A;  1CH0 A;  3F8X A;  1DVD A;  3BLZ A;  1BAO A;  3AGO A;  3MSO A;  4MMZ B;  5IG3 A;  4KFF A;  2W56 B;  3UNL A;  4EYC A;  3RGR A;  4MMX B;  1DMM A;  1JBT A;  1A67 A;  1N9J A;  2W9P A;  4HM6 B;  4XBY A;  2IUJ A;  1RGF A;  4WP5 A;  5IEP A;  4XM4 A;  1MGR A;  3FZW A;  3LYG A;  3DXO A;  3EC9 A;  3OWY A;  3FG1 A;  2WOF A;  1Q40 B;  3EBT A;  2Y73 A;  3GZB A;  2FGT A;  4WFO A;  3WDG B;  4KT3 B;  1AV4 A;  3CCV 3;  2J8X B;  4MMY B;  4ILF A;  3MPH A;  1O7P B;  3S27 A;  3MHE A;  1BUJ A;  4BL3 A;  2HMJ B;  2WOH A;  9RNT A;  3F8H A;  4RNT A;  2SAR A;  3CC2 3;  1VQ5 3;  2CK3 H;  1PU4 A;  1I3F A;  4U13 A;  4TX4 A;  4LMI A;  2CIU A;  1FUS A;  1WQL B;  4R80 A;  4XDW A;  5AI1 A;  3GAX A;  1LNH A;  3VF1 A;  3X41 A;  4DKI A;  4EBG A;  3QRD A;  1GY6 A;  4KVH A;  1K9M 4;  3G16 A;  1KSI A;  1CYU A;  1BRN L;  3CCM 3;  6STD A;  1X1X A;  1QMA A;  1ROA A;  2QGU A;  3DGO A;  1FZU A;  1BRH A;  1RRH A;  3KE7 A;  4CDL A;  1GSP A;  2E2V A;  1K41 A;  1RGA A;  3X40 A;  1W6C A;  3F7X A;  1BRI A;  4J5K A;  8RNT A;  4MJD A;  3KFQ C;  1OF5 B;  3PGB A;  2BHM A;  1IDP A;  1ZX2 A;  1MWT A;  1STF I;  4OK0 A;  1WMN A;  1QAK A;  1YIT 3;  4R1K A;  1LOW A;  4KFE A;  5EEO A;  3NX0 A;  2P0M A;  1BSE A;  2MC8 A;  2GBW B;  2RCD A;  2WGQ A;  2XF3 A;  1YI2 3;  4AEQ A;  1D6Y A;  3SVA A;  3NM2 A;  1UDI I;  1B27 A;  3FG4 A;  1YIJ 3;  1V74 A;  1X1W A;  3OWU A;  1US1 A;  4H61 A;  1C54 A;  2Z76 A;  3H51 A;  1JBR A;  1TP6 A;  1GYB A;  2IY2 A;  3F40 A;  1GMQ A;  1SAR A;  2W0Q A;  1CYV A;  1TTO A;  4K61 A;  1VQM 3;  4FMB A;  4R9L A;  2CG0 A;  1LNI A;  5JPU A;  1RGK A;  3AHS A;  4FR9 A;  5AEU B;  1YJW 3;  1HZ1 A;  3BB9 A;  1NWW A;  3O8Y A;  1IQX A;  1G96 A;  1FGR A;  1UCK A;  3GRD A;  1RN4 A;  5A0O B;  2KAA A;  3STD A;  2W6J H;  1MOL A;  2ZA4 A;  3BNC A;  1UGH I;  1IVX A;  3KCH A;  3JUP A;  3DGL A;  2KF5 A;  4FMC A;  2OQE A;  1IQY A;  1B2M A;  3FKA A;  1LOY A;  4FCJ A;  4O8S A;  4ORL A;  3NM7 A;  1W7C A;  2CFL A;  4G1M B;  1K73 4;  4HAA A;  2O9U X;  1A2P A;  1JB4 A;  1JNQ A;  4NPB A;  4N6V 0;  1EQK A;  1ASK A;  1NNV A;  1JRQ A;  1SJW A;  3EHC A;  4HOH A;  1EEJ A;  1WTH A;  4HM3 B;  1GY7 A;  3DY5 A;  1R4C A;  1UCI A;  3VSY A;  3ZG5 A;  1B2X A;  2CFD A;  2RBI A;  1GOY A;  2CX0 A;  4XBX A;  3SOY A;  3TDG A;  2HOH A;  1BNS A;  3GSP A;  3K5T A;  5D82 A;  5D83 A;  1OUN A;  1T2H A;  3L0R A;  3D79 A;  3AGN A;  4CPK A;  2V1L A;  4CCV A;  1WMP A;  4LGQ A;  2OCT A;  3IMA B;  3DM8 A;  1FW7 A;  2BU4 A;  1M1X B;  1JKG B;  1S72 3;  2ZDJ A;  1D6Z A;  1T3B A;  3GZR A;  3MG1 A;  1RGH A;  1RHL A;  4HM5 B;  4QWT A;  2BNG A;  4BU4 A;  3WOF B;  2CFK A;  2GXF A;  3D5I A;  1B2Z A;  4O3V A;  3BNB A;  3G8Z A;  3KKG A;  4CJN A;  1B2S A;  2H0H A;  2CWV A;  5EQL A;  5I97 A;  3X42 A;  3LT8 A;  3NBB A;  3N8B A;  3MG3 A;  3NXJ A;  1STD A;  2SBL A;  4GL6 A;  3CCQ 3;  1W5Z A;  1VQN 3;  4X2O A;  1UW1 A;  2I9W A;  2OQE C;  1UUG B;  3D5G A;  3EQQ B;  4BL2 A;  1NB5 I;  3V92 A;  2FNQ A;  2WO0 A;  1W6G A;  4HM4 B;  5IEO A;  3DGY A;  3K0Z A;  1E3R A;  2AAD A;  2P0X A;  3NV0 B;  2XRX B;  1LQM B;  1VQQ A;  1VQO 3;  1RCL A;  2R4I A;  3JUO A;  1BIR A;  4O02 B;  2AAE A;  3CCU 3;  1SIH A;  2LYX A;  4L8O A;  1B3S A;  1SQW A;  1GOV A;  2KRT A;  1RLS A;  1VQ6 3;  1CQS A;  1ROV A;  1O7N B;  3NQZ A;  3Q2P A;  4AKZ A;  3CCE 3;  3FCS B;  4HYZ A;  3ER7 A;  5KP1 A;  1EA2 A;  1IV7 A;  2F86 B;  3WHO A;  1M9G A;  2XSO B;  3FF0 A;  3EN1 B;  1KWI A;  3KZT A;  5IER A;  1G0T A;  1D6U A;  1VZZ A;  1JB2 A;  1W02 A;  4XBT A;  2KF6 A;  1ISK A;  1VQ8 3;  4H3U A;  4HZB B;  2IA7 A;  4XDV A;  3S5C A;  1PFP A;  3HII A;  4N6L A;  1RNB A;  1JZO A;  5LC6 A;  2E2T A;  5BVB A;  1JB5 A;  2IMJ A;  2IYJ A;  1NJI 4;  2CWT A;  1BRJ A;  5AEW B;  1JZD A;  3MKI A;  4HM1 B;  1TU5 A;  3N54 B;  1I8V A;  3GZX B;  2JDI H;  2B1X B;  4WYK A;  2L1S A;  1LVN A;  1ZGX A;  2KCD A;  2OWP A;  2YFJ B;  3FLJ A;  5G2G A;  3URP A;  2E2U A;  1FUT A;  1AY7 A;  2BO9 B;  3RGA A;  1TRQ A;  3IPT A;  3LTC A;  4GB5 A;  2INX A;  2RGQ A;  2UGI A;  3T0U A;  1BRG A;  2Z6B A;  2CWU A;  1IVV A;  1RTU A;  3RDE A;  2CFG A;  4RZM A;  3G4S 3;  2HMN B;  1L5G B;  4BTX A;  4FCM A;  1OHP A;  1V58 A;  1X1Y A;  3CNM A;  1RGE A;  5M1A A;  2CC3 A;  3F14 A;  2HMM B;  3HK4 A;  1OCV A;  4LYL B;  4IPB A;  3B8L A;  1OH0 A;  3D4A A;  3JUM A;  1BGS A;  1N8Q A;  1AVL A; 
#chains in the Genus database with same CATH homology
 5FW5 A;  5KP3 A;  2MF7 A;  5DRV A;  3AMO B;  3KSP A;  4FMA A;  1QJG A;  3G0K A;  5JPP A;  3MYT A;  4HKV B;  3DGN A;  2P09 A;  3OV4 A;  1DVC A;  3F7S A;  1K8A 4;  1W4N A;  2STD A;  3UJM A;  3CCL 3;  1JN5 A;  3JUN A;  1VQ4 3;  5CF1 A;  1TFO A;  3EBY A;  3JUQ A;  3WA2 X;  1N5P A;  1DMQ A;  1VQL 3;  3S67 A;  2F98 A;  4R4K A;  3I56 3;  3FG3 A;  1CEW I;  1UI7 A;  2B24 B;  3NBJ A;  4J9A A;  1W2Z A;  2BT3 A;  2RFR A;  2UX0 A;  3M8C A;  2W56 A;  5EVH A;  3SED A;  1GY5 A;  2ZL8 A;  2GBX B;  1O7M B;  2Z7A A;  1N8R 4;  1VQ9 3;  4HM8 B;  4LSO A;  2XSH B;  2K54 A;  2XGL A;  3ALA A;  1TUH A;  3DZL A;  1W01 A;  2CKF B;  3PCR A;  4XB5 A;  4WWU C;  1QVG 2;  1A90 A;  1JJ2 2;  3CC7 3;  5BXQ A;  3V99 A;  1Q40 A;  1ULI B;  3FGY A;  3X3X A;  3G6E 3;  1GS3 A;  1FGM A;  4X2H A;  2XH9 A;  3Q90 A;  4HVN A;  5DRE A;  1YVB I;  3CNX A;  2CHC A;  4MEI A;  3CXC 2;  3JVC A;  3CPW 2;  1NO3 A;  3LT9 A;  2D42 A;  1ZO2 A;  2C11 A;  4HBR A;  3T8U A;  1N9E A;  4K1V A;  1MNL A;  2W03 A;  1EKM A;  2CH9 A;  1SII A;  5CF2 A;  4OUQ A;  3MWZ A;  3LXU X;  2C10 A;  3CMA 3;  1QAL A;  1UI8 A;  4IT7 A;  1YJN 3;  2Q07 A;  3CCS 3;  1Y4K A;  4EV5 A;  4O2H A;  2CG1 A;  1OF5 A;  1GD4 A;  3CME 3;  4FCZ A;  1M1K 4;  8CHO A;  1A2K A;  4STD A;  2K0M A;  3LML A;  5CLK A;  1SPU A;  1YJ9 3;  1KQS 2;  2L4V A;  1AVK A;  5AIG A;  1Z1S A;  1IK3 A;  4HZ9 B;  2GU1 A;  2KXG A;  1EG9 B;  3LTA A;  2XR8 B;  2GU3 A;  4IIA A;  1IV9 A;  3OW2 2;  1W2B 2;  3NBR A;  4HJL B;  2W04 A;  1OHS A;  4ZM8 A;  4EV2 A;  4RNY A;  3HI7 A;  3VGN A;  4JRF A;  1IVW A;  2PZV A;  5IF6 A;  4N6T A;  3EB8 A;  3IJE B;  3NQY A;  3EF8 A;  4N6N B;  1FGT A;  3V98 A;  3PZW A;  3PS8 A;  3WA3 A;  1DMN A;  2JQ5 A;  1TFK A;  3UL6 A;  1HKX A;  2ML5 A;  1Q7Y 4;  3LZA A;  4KFD A;  2W2C A;  2M7O A;  5AIF A;  3J7Y d;  3DUK A;  1IT8 A;  3LH4 A;  3H3H A;  3N9H A;  3CU3 A;  2QA4 3;  1OGX A;  1T5Y A;  1ULJ B;  5AYS C;  2BMR B;  3LTB A;  1QVF 2;  1C7H A;  5CXO A;  3QK9 A;  3X3Z A;  1KC8 4;  4RNZ A;  3CCJ 3;  5ELU A;  5KP4 A;  1JKG A;  3I0Y A;  2YFL B;  4HM2 B;  4N3V A;  4BTY A;  1Q82 4;  1VQ7 3;  1F8N A;  1UUV B;  3K7C A;  4JF8 A;  1IVU A;  1S5A A;  3MG2 A;  4L7K A;  2BMQ B;  1OAC A;  4HM0 B;  2Z77 A;  3EX9 A;  3T8N A;  1BUQ A;  1NU3 A;  2FXT A;  5AII A;  3EN8 A;  1U8C B;  1GD3 A;  4N6M A;  3LOY A;  3SX1 A;  4FMD A;  4K90 B;  3ROB A;  1VQK 3;  2HMO B;  3K63 A;  3U1W A;  1E97 A;  3FF2 A;  5HGR A;  3WMD A;  1HU9 A;  1AR0 A;  4EXR A;  3LTD A;  4N6O B;  2OOV A;  1RRL A;  3KII A;  3UB1 A;  3WOD G;  3NHX A;  3KN4 A;  5AYR B;  1WMO A;  2XGN A;  3HIG A;  3NV0 A;  1DYU A;  1Q42 A;  5TGN A;  3A76 A;  3U97 A;  1OGZ A;  3NUV A;  1YGE A;  2IUK A;  3KSE D;  1Q81 4;  1JV2 B;  5IEN A;  2ML6 A;  2OTJ 3;  3E99 A;  4OVM A;  1QAF A;  1RJO A;  2XEP A;  7STD A;  1VQP 3;  1UUW B;  2P05 A;  3B7C A;  3PCS A;  4RBN A;  1LXE A;  2PNC A;  5ELJ A;  3UL5 A;  4I4K A;  1M90 4;  3PYJ A;  3I55 3;  1J2B A;  3S28 A;  1LOX A;  2OTL 3;  3S29 A;  5IG0 A;  2W9Q A;  4WHA A;  3B4O A;  3CCR 3;  3CD6 3;  1WNH A;  3CC4 3;  4R9K A;  1NDO B;  2HMK B;  5CK6 A;  1NB3 I;  2YFI B;  1FUW A;  2GEX A;  2WGO A;  4NHF A;  2LQV A;  2GEY A;  4N6U A;  3GWR A;  3EJV A;  4J8T A;  4WYK B;  1IT7 A;  3GZY B;  1K28 A;  1RN7 A;  1O7H B;  2CFW A;  3D9R A;  3BNE A;  4AKY A;  4KZ1 A;  1TIJ A;  4EC6 A;  2QIY A;  2OOV C;  3WOE B;  4L8P A;  3SOA A;  1E3V A;  4Q53 A;  5D81 A;  3BND A;  3DGM A;  4LEH A;  5IW9 A;  3SXX A;  4LZI A;  3ECF A;  2YX9 A;  4NRE A;  1O7W B;  1KD1 4;  1Q86 4;  1IU7 A;  5LC7 A;  2A15 A;  3PXM A;  2D1W A;  3OWS A;  3SLU A;  1FA3 A;  5AIH A;  3K9M C;  2BMO B;  2F99 A;  3B4P A;  2XFT A;  1U5O A;  4HM7 B;  2O3O A;  3F9S A;  3FH1 A;  1A2V A;  1FGO A;  3CPO A;  3HX8 A;  5JBS A;  3D3L A;  2RSX A;  1O7G B;  3EE1 A;  1OHO A;  2HML B;  4K1U A;  1YHQ 3;  5FGO A;  5IG5 A;  2CW9 A;  4PEJ A;  1OPY A;  2XFS A;  2P38 A;  3HZP A;  3G71 3;  1N5H A;  2QEX 3;  1RKY A;  4BTW A;  3OXA A;  1JN5 B;  3X3Y A;  3OX9 A;  1IQ8 A;  3AMO A;  1FGQ A;  3Q1C A;  1W6Y A;  5STD A;  2Y74 A;  1W00 A;  3DMC A;  3FSD A;  5IG4 A;  3F8X A;  1DVD A;  3BLZ A;  3MSO A;  4MMZ B;  5IG3 A;  4KFF A;  2W56 B;  3UNL A;  4EYC A;  3RGR A;  4MMX B;  1DMM A;  1A67 A;  1N9J A;  2W9P A;  4HM6 B;  4XBY A;  2IUJ A;  4WP5 A;  5IEP A;  4XM4 A;  3FZW A;  3LYG A;  3DXO A;  3EC9 A;  3OWY A;  3FG1 A;  2WOF A;  1Q40 B;  3EBT A;  2Y73 A;  3GZB A;  2FGT A;  4WFO A;  3WDG B;  1AV4 A;  3CCV 3;  4MMY B;  3MPH A;  1O7P B;  3S27 A;  3MHE A;  2HMJ B;  2WOH A;  3F8H A;  3CC2 3;  1VQ5 3;  2CK3 H;  1PU4 A;  4U13 A;  4TX4 A;  4LMI A;  2CIU A;  1WQL B;  4XDW A;  4R80 A;  5AI1 A;  3VF1 A;  3GAX A;  1LNH A;  3X41 A;  4EBG A;  3QRD A;  1GY6 A;  4KVH A;  1K9M 4;  3G16 A;  1KSI A;  1CYU A;  3CCM 3;  6STD A;  1QMA A;  1ROA A;  2QGU A;  3DGO A;  1RRH A;  3KE7 A;  4CDL A;  2E2V A;  1K41 A;  3X40 A;  1W6C A;  3F7X A;  4MJD A;  3KFQ C;  1OF5 B;  3PGB A;  2BHM A;  1IDP A;  1ZX2 A;  1STF I;  4OK0 A;  1WMN A;  1QAK A;  1YIT 3;  4R1K A;  5EEO A;  4KFE A;  3NX0 A;  2P0M A;  2MC8 A;  2GBW B;  2RCD A;  2WGQ A;  2XF3 A;  1YI2 3;  4AEQ A;  1D6Y A;  3SVA A;  3NM2 A;  3FG4 A;  1YIJ 3;  1V74 A;  3OWU A;  1US1 A;  4H61 A;  2Z76 A;  3H51 A;  1TP6 A;  1GYB A;  3F40 A;  2W0Q A;  1CYV A;  4K61 A;  1VQM 3;  4FMB A;  4R9L A;  2CG0 A;  5JPU A;  1YJW 3;  5AEU B;  4FR9 A;  3BB9 A;  1NWW A;  3O8Y A;  1IQX A;  1G96 A;  1FGR A;  3GRD A;  5A0O B;  3STD A;  2W6J H;  1MOL A;  3BNC A;  1IVX A;  3JUP A;  3DGL A;  4FMC A;  2OQE A;  1IQY A;  3FKA A;  4FCJ A;  4O8S A;  4ORL A;  3NM7 A;  1W7C A;  2CFL A;  4G1M B;  1K73 4;  2O9U X;  1JB4 A;  1JNQ A;  4N6V 0;  1EQK A;  1ASK A;  3EHC A;  1JRQ A;  1SJW A;  4HM3 B;  1WTH A;  3VSY A;  1GY7 A;  3DY5 A;  1R4C A;  2CFD A;  4XBX A;  3SOY A;  3TDG A;  3K5T A;  5D82 A;  5D83 A;  1OUN A;  3L0R A;  2V1L A;  4CCV A;  1WMP A;  4LGQ A;  2OCT A;  3IMA B;  3DM8 A;  1M1X B;  1JKG B;  1S72 3;  2ZDJ A;  1D6Z A;  3GZR A;  3MG1 A;  4QWT A;  4HM5 B;  2BNG A;  3WOF B;  2CFK A;  2GXF A;  4O3V A;  3BNB A;  3G8Z A;  3KKG A;  2CWV A;  5EQL A;  5I97 A;  3X42 A;  3LT8 A;  3NBB A;  3N8B A;  3MG3 A;  3NXJ A;  1STD A;  2SBL A;  4GL6 A;  3CCQ 3;  1W5Z A;  1VQN 3;  4X2O A;  1UW1 A;  2I9W A;  2OQE C;  3EQQ B;  1NB5 I;  3V92 A;  2FNQ A;  2WO0 A;  1W6G A;  4HM4 B;  5IEO A;  3K0Z A;  1E3R A;  2P0X A;  3NV0 B;  2XRX B;  1VQO 3;  2R4I A;  3JUO A;  4O02 B;  3CCU 3;  1SIH A;  2LYX A;  4L8O A;  1SQW A;  2KRT A;  1VQ6 3;  1CQS A;  1ROV A;  1O7N B;  3NQZ A;  3Q2P A;  4AKZ A;  3CCE 3;  3FCS B;  4HYZ A;  3ER7 A;  5KP1 A;  1EA2 A;  1IV7 A;  2F86 B;  1M9G A;  2XSO B;  3FF0 A;  3EN1 B;  1KWI A;  3KZT A;  5IER A;  1D6U A;  1VZZ A;  1JB2 A;  1W02 A;  4XBT A;  1ISK A;  1VQ8 3;  4H3U A;  4HZB B;  2IA7 A;  4XDV A;  3S5C A;  1PFP A;  3HII A;  4N6L A;  5LC6 A;  2E2T A;  5BVB A;  1JB5 A;  2IMJ A;  1NJI 4;  2CWT A;  5AEW B;  3MKI A;  4HM1 B;  1TU5 A;  3N54 B;  3GZX B;  2JDI H;  2B1X B;  4WYK A;  1LVN A;  2OWP A;  2KCD A;  2YFJ B;  3FLJ A;  5G2G A;  2E2U A;  2BO9 B;  3RGA A;  3IPT A;  3LTC A;  4GB5 A;  2INX A;  2RGQ A;  3T0U A;  2Z6B A;  2CWU A;  1IVV A;  3RDE A;  2CFG A;  4RZM A;  3G4S 3;  2HMN B;  1L5G B;  4BTX A;  4FCM A;  1OHP A;  3CNM A;  2CC3 A;  3F14 A;  2HMM B;  3HK4 A;  1OCV A;  4IPB A;  3B8L A;  1OH0 A;  3JUM A;  1N8Q A;  1AVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...