5IERA

Structure of a computationally designed 17-ohp binder
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSLWRCTQAHDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFFDTHIAATRLTVTCEETFPSSSPDEIAHILVAHSEFDGGFTSEVRGVFTYRVNKAGLITNLRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OHP9
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 34
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ierA00
2W2CA 2RCDA 1SJWA 5AIHA 5AIFA 1IDPA 3OX9A 2YFIB 1E97A 4OVMA 3SEDA 1TP6A 3EBYA 1EG9B 3FKAA 3A76A 5IF6A 2GEXA 4X2OA 3F8HA 3FLJA 3I0YA 3FSDA 3GZXB 3MKIA 5IENA 5D81A 1GY6A 3OWUA 3RGRA 1JKGB 5IERA 4KVHA 4WP5A 3D9RA 4XDVA 1ASKA 2CKFB 3HK4A 1JN5A 5AEUB 3B4OA 2PZVA 1JB5A 1Q40A 4ORLA 5D82A 3MG1A 3SOYA 1DMNA 1W00A 1OCVA 1UUWB 4L8PA 4OUQA 4IIAA 2JQ5A 4HM6B 4FCJA 1ZX2A 5IG0A 4HM1B 4LGQA 4RZMA 2HMKB 4N3VA 3UNLA 5D83A 3VGNA 3OWSA 4U13A 2K54A 1Q42A 1UUVB 3T8NA 3KE7A 4HZBB 2YFJB 1E3RA 1QMAA 3H51A 4HM2B 4HKVB 5AI1A 3EC9A 4XB5A 2F98A 4HM3B 1ISKA 2HMOB 1OHPA 3F7XA 3EN8A 1W02A 1A2KA 3CU3A 4GB5A 1GY7A 2STDA 3GRDA 1JKGA 1W01A 1EA2A 4XBYA 3NM2A 5AIIA 3GWRA 1ULIB 3NHXA 3S5CA 2Z7AA 1Z1SA 2HMLB 3KKGA 2XRXB 1JB2A 2RGQA 2HMJB 4LEHA 1OF5B 1O7WB 2CHCA 1GY5A 2BMOB 5EVHA 1AR0A 5DRVA 1TUHA 3K0ZA 4PEJA 3MSOA 1NU3A 3NXJA 3STDA 3NUVA 3CNXA 8CHOA 4Q53A 1OPYA 4I4KA 2BNGA 5CF1A 3BLZA 3F8XA 3KSPA 1NWWA 1STDA 3JUQA 1NDOB 2YFLB 5IEOA 3MG3A 1DMMA 5IG5A 3T8UA 2F86B 4CDLA 1E3VA 3OV4A 2XSOB 3K7CA 1GYBA 3CNMA 3DZLA 4HJLB 2XR8B 1O7HB 3Q90A 3MYTA 3G16A 1ULJB 3DM8A 1VZZA 3EF8A 3G0KA 3KZTA 4XM4A 1WQLB 3NBRA 3HZPA 4WWUC 3MHEA 1CQSA 2R4IA 3F7SA 3M8CA 3NV0B 5G2GA 3EJVA 3JUNA 4LMIA 2QGUA 2F99A 3GZBA 3JUOA 4L7KA 3F40A 5CK6A 2I9WA 3ECFA 5DREA 1O7GB 1C7HA 4MJDA 4H3UA 3RGAA 3ROBA 3LYGA 3EHCA 2BMQB 2Z76A 2IMJA 2GXFA 2QIYA 1GS3A 3H3HA 3SOAA 3CPOA 3FZWA 7STDA 1BUQA 1OUNA 5IG3A 3F14A 5AIGA 1DMQA 4K1VA 2XSHB 5BVBA 1QJGA 4R1KA 3EBTA 3DMCA 4X2HA 3EQQB 4WYKB 3GZYB 4HM7B 4HM8B 3EX9A 4R9LA 3IPTA 5JPUA 3FH1A 4FCMA 4HM0B 4STDA 5CF2A 3FF0A 1OGXA 2BMRB 1OHOA 2GBXB 5KP3A 4J9AA 1OHSA 4K1UA 5AEWB 2UX0A 3WMDA 3JUPA 3NV0A 4XDWA 1W6YA 1K41A 1JB4A 3HX8A 5FW5A 3FGYA 2OWPA 1O7NB 3BB9A 2B24B 2HMNB 2A15A 3B8LA 3DXOA 5IEPA 4HM5B 3FF2A 5CXOA 4HZ9B 2GEYA 5IG4A 3LZAA 4J8TA 5TGNA 3EN1B 6STDA 4HM4B 4R9KA 3F9SA 3DUKA 1ZO2A 1S5AA 1HKXA 3VSYA 3ER7A 2B1XB 1O7PB 5KP1A 4WYKA 1OF5A 1JN5B 2Z77A 5BXQA 4HVNA 5STDA 5CLKA 3G8ZA 3UJMA 1O7MB 1Q40B 4XBXA 5HGRA 5JPPA 5KP4A 2HMMB 3OWYA 1OGZA 4L8OA 3OXAA 3B4PA 2INXA 2RFRA 3E99A 3MG2A 1OH0A 1U5OA 2GBWB 3JUMA 3GZRA 3B7CA 4XBTA
chains in the Genus database with same CATH superfamily
2W2CA 1W6CA 2RCDA 3RDEA 1JZDA 3DH2A 1SJWA 4EC6A 5AIHA 1BSBA 1LOVA 3LTDA 5AIFA 1NO3A 1IDPA 3OX9A 1IT7A 3ZG0A 1YJW3 1G02A 2YFIB 1E97A 1BVIA 1MNLA 4MMZB 1L5GB 1RRHA 4LZIA 3D3LA 4OVMA 2QEX3 3SEDA 1TP6A 3EBYA 1EG9B 1W4NA 1MWSA 3FKAA 4HAAA 3N8BA 2HOHA 1RLSA 3LTAA 3A76A 4RNTA 1VQN3 1FYSA 1T2IA 2BO9B 5IF6A 6RNTA 1J2BA 3S28A 2GEXA 1VQM3 4X2OA 3F8HA 2OQEC 3FLJA 2ZHXB 2ZL8A 2OTJ3 2H0GA 1F8NA 3I0YA 1MWUA 3FSDA 4BTXA 1RN7A 2XEPA 3GZXB 1RGGA 1A2PA 2MF7A 3MKIA 2CG1A 5IENA 1YHQ3 1STFI 1RNTA 2Y74A 4NPBA 1BRNL 3LTBA 3EB8A 1TFKA 5D81A 1GY6A 1D6UA 1MGRA 1BSDA 3OWUA 4O02B 3CD63 3RGRA 1JKGB 5IERA 3FG4A 4J5GA 2W9PA 4KVHA 3DGYA 2Q07A 5GSPA 1VQ93 4WP5A 3D9RA 2CWVA 5G1KA 3X3YA 4XDVA 4O2HA 1VQK3 3WA3A 1KSIA 1ROAA 1ASKA 1RGKA 1NB3I 1RJOA 2CKFB 2C4BA 3HK4A 1JN5A 1PU4A 1MWRA 5AEUB 3B4OA 1YIJ3 3GAXA 1IQXA 1X1YA 2PZVA 1A2VA 3X3XA 1JB5A 1DE3A 2CK3H 2CWUA 2XF3A 1B2XA 1RMSA 3PXMA 5A0OB 1Q40A 4ORLA 5D82A 3MG1A 1BNIA 3SOYA 3CCM3 4MEIA 2GSPA 1DMNA 1W00A 2M7OA 3L0RA 4EW5A 1YIT3 1KC84 1KWIA 1OCVA 1UUWB 1RHLA 3A5EA 1HZ1A 4L8PA 1KD14 8RNTA 4OUQA 4IIAA 2XGNA 3WDGB 2P09A 2JQ5A 4BU4A 4HM6B 4FCJA 1GMRA 1ZX2A 4RNZA 4NHFA 1ZGXA 5EEOA 1BSAA 3N9HA 4H61A 3MPHA 5IG0A 4I5QA 1GMPA 4GHOA 3AGOA 1RN1A 3KN4A 4N6LA 4HM1B 4LGQA 4RZMA 1M1K4 2HMKB 1V57A 2GU3A 4N3VA 2OCTA 2XFTA 5AYSC 3UNLA 2C10A 1GSPA 1YJN3 2OQEA 1GD4A 3KSED 5D83A 3VGNA 3HI7A 1VQ83 4LYLB 3OWSA 4RNYA 4U13A 3LT9A 3CCR3 1UCLA 2W0QA 2K54A 1Q42A 1UUVB 3T8NA 3KE7A 4HZBB 2YFJB 1QMAA 1BNFA 1E3RA 3EE1A 1Q9EA 3AMOB 1Q814 3H51A 2KF6A 1YGWA 4WFOA 1X1WA 3SLUA 1UDII 2WOFA 2L4VA 1LNHA 3Q3FA 4HM2B 3NQYA 4HKVB 4CJNA 1K734 5AI1A 3ZG5A 1T2HA 4QWTA 1BRKA 4TX4A 1JNQA 2IUJA 3EC9A 1MWTA 4XB5A 4BTWA 3VF1A 1OACA 2AADA 1RDSA 2F98A 1OHPA 2HMOB 4HM3B 3T0UA 3F7XA 1ISKA 2FGTA 1BSEA 3EN8A 1ROVA 3NX0A 2CH9A 1W02A 2IA7A 1A2KA 3CU3A 4FMBA 4GB5A 1IK3A 1GY7A 4O3VA 1B20A 2STDA 3DGLA 3HIIA 3GRDA 3NQZA 1BNGA 4N6V0 1JKGA 2RNTA 2J8XB 3AGNA 4G1MB 1N9JA 2W6JH 1W01A 5ELJA 2W9QA 1BIRA 4MMYB 3OW22 3LMLA 3BU4A 3BNCA 3CCQ3 1EA2A 1TRQA 5G1LA 4BTYA 4XBYA 3CC23 3N54B 1Q824 1M904 3WA2X 4N6TA 3NM2A 2CFGA 5AIIA 3GWRA 1ULIB 2XH9A 3NHXA 2Z7AA 5EQLA 1LNIA 3S5CA 3CCS3 1AVKA 1Z1SA 3J7Yd 2HMLB 1DVDA 2LYXA 2H0IA 1MGWA 4N6UA 3UL5A 1CH0A 3KKGA 2XRXB 1JB2A 1SIIA 2RGQA 2HMJB 1VQO3 4LEHA 4LSOA 4IPBA 1OF5B 1BRJA 1B2SA 1O7WB 1B2UA 1IT8A 4BL2A 2R41A 1QAFA 1RGCA 3BIRA 1D6ZA 2CHCA 1GY5A 2BMOB 1GMQA 5EVHA 4ILFA 1AR0A 4AKYA 3PYJA 4RBNA 2CX1A 5DRVA 9RNTA 2XFSA 1TUHA 1FZUA 3PGBA 3K0ZA 2WO0A 1BGSA 3CPW2 1PYLA 3KIIA 4N6MA 3KCHA 3MSOA 4PEJA 1NU3A 3NXJA 3WOFB 3STDA 2E2TA 3NUVA 3CNXA 2D1WA 8CHOA 4Q53A 1OPYA 4I4KA 4O8SA 2BNGA 5CF1A 1V74A 3BLZA 3I553 3F8XA 1N8R4 3KSPA 2P05A 1NWWA 2FXTA 5JBSA 1CYVA 4HOHA 1YI23 1STDA 3CC43 1W2B2 3JUQA 1BNRA 2BIRA 1NDOB 2YFLB 1JBRA 3LTCA 3NBJA 5IEOA 1B2MA 3MG3A 1DMMA 1W6GA 6GSPA 3D4AA 4HYZA 1K28A 5IG5A 3T8UA 2F86B 1LQGC 2C11A 1U8CB 1RNBA 1I8VA 1I3IA 2CFDA 4CDLA 5RNTA 1E3VA 2BT3A 1YVSA 1IV7A 3LXUX 7RNTA 3OV4A 2O9UX 4KZ1A 4R4KA 3D5IA 1IVVA 2XSOB 1GYBA 3K7CA 1YNVX 3CCL3 3CNMA 1BNSA 4EV5A 3DZLA 5LC6A 4FCZA 5BIRA 1JBSA 1IYYA 1IQYA 4HJLB 1WMNA 2XR8B 1O7HB 2OOVC 3Q90A 5M18A 1M9GA 1UCJA 4WHAA 3UL6A 3MYTA 3U1WA 2UUGC 4GSPA 2F4YA 1HU9A 4J5KA 1VQL3 1BRSA 3S67A 3G16A 2F5WA 1QAKA 3NBBA 5FGOA 1UCIA 3BNDA 3TDGA 4K61A 1RRLA 1ULJB 3DM8A 3DY5A 5ELUA 1VZZA 2KAAA 2PNCA 3EF8A 2CC3A 1PY3A 1S723 3ZFZA 2Y73A 3G0KA 3KZTA 3FG1A 5BU4A 4XM4A 3CMA3 1D6YA 1WQLB 1G0TA 2W56B 3NBRA 4BIRA 4EBGA 3K63A 3HZPA 4WWUC 3MHEA 2SBLA 1AY7A 1CQSA 2YX9A 3DGMA 3G4S3 2E2VA 2L1SA 2R4IA 3F7SA 3M8CA 3NV0B 5G2GA 5IW9A 2AAEA 3EJVA 3PCSA 1FGOA 3ALAA 3JUNA 2H0HA 4LMIA 2CG0A 2QGUA 5M1AA 3SVAA 3CC73 1RGAA 1RGHA 5AYRB 2F99A 1B2ZA 2KXGA 3GZBA 3JUOA 1LOWA 3F40A 4HBRA 1B3SA 2I9WA 3ECFA 4FMCA 4L7KA 5CK6A 5DREA 1O7GB 1BAOA 1C7HA 4MJDA 4H3UA 3RGAA 3ROBA 3CXC2 3LYGA 3EHCA 2ML6A 4KFFA 1Q7Y4 3I563 1Y4KA 4K90B 2BMQB 2Z76A 3MWZA 1MOLA 4KT3B 1B27A 2IMJA 2GXFA 2QIYA 1GS3A 3H3HA 1W5ZA 3SOAA 1FUWA 1JBTA 3CPOA 1TRPA 3FZWA 1BNJA 1I3FA 7STDA 1NB5I 1I70A 1T5YA 5LC7A 2WGQA 1VQQA 1M1XB 1BUQA 1OUNA 1RGEA 5IG3A 3F14A 5AIGA 1C54A 1N5HA 3WODG 1DMQA 1FGRA 1UI8A 1LOXA 1KQS2 1EQKA 2KF4A 4JF8A 4K1VA 3RNTA 1N9EA 2RSXA 3SX1A 3X41A 2XSHB 1BSCA 3SXXA 3IMAB 3LOYA 2OOVA 5BVBA 2W03A 1QJGA 4R1KA 3EBTA 3DMCA 4N6OB 2Z6BA 3PS8A 4X2HA 3WHOA 1N5PA 1R4CA 2P0XA 3EQQB 4WYKB 3GZYB 7GSPA 2ML5A 4HM7B 1PFPA 3V98A 1SQWA 2ZDJA 3K5TA 1EKMA 1N8QA 2BHMA 3LH4A 4HM8B 1LVNA 1Q7HA 2CFKA 3EX9A 4R9LA 1I0VA 2CIUA 1BANA 3Q1CA 3IPTA 1YVBI 4AKZA 5JPUA 1BRIA 1AV4A 1QVF2 3FH1A 1BRGA 4FCMA 4R80A 3QK9A 4N6NB 1JRQA 4HM0B 1LXEA 2KRTA 1DETA 2RBIA 1BUJA 2P0MA 2ZA4A 3AHWA 4STDA 3KFQC 1AQZA 5CF2A 3FF0A 1K9M4 1FGMA 1OGXA 2CX0A 2BMRB 1X1XA 2V1LA 1TIJA 1UW1A 1OHOA 1R4YA 2GBXB 1Q864 1IQ8A 3O8YA 2K3DA 5KP3A 1QVG2 1RN4A 3CME3 1V58A 3V99A 1IV9A 1EUIC 2WGOA 1LQMB 4J9AA 2W56A 2SARA 3CCE3 3AHSA 3FG3A 3UB1A 2LQVA 1RKYA 1OHSA 4K1UA 5AEWB 1WMOA 2UX0A 1WTHA 1LRAA 3AMOA 1BU4A 4AEQA 3WMDA 5HOHA 1RCKA 3CCU3 1UUGB 3JUPA 1FGQA 3NV0A 4CCVA 2K0MA 2IYJA 4XDWA 2XGLA 1W6YA 1FUSA 2KF5A 1K41A 3DGOA 1JB4A 1RSNA 3HX8A 2CW9A 5FW5A 1GOVA 3FGYA 2OWPA 3Q2PA 3QRDA 1O7NB 3BB9A 3LT8A 1QALA 2B24B 1FGTA 1LOYA 4FMAA 2OTL3 1VQ53 2HMNB 1T3BA 1SPUA 3S27A 1UGHI 1JJ22 1RGFA 1B21A 3SYUA 1US1A 2A15A 4EXRA 4ZM8A 3CCJ3 1DVCA 3D79A 3WR2A 1BNEA 3B8LA 3DXOA 4NREA 5IEPA 4JRFA 3X42A 4HM5B 1FUTA 1W7CA 3FF2A 1YJ93 5CXOA 1NJI4 1IU7A 1YGEA 3CCV3 1BRHA 3K9MC 4HZ9B 1VQ73 1SIHA 3WOEB 1UI7A 3S29A 1BOXA 3HOHA 3BNBA 2GEYA 5IG4A 3LZAA 3X40A 4J8TA 5TGNA 1CYUA 1DYUA 1HYFA 3JVCA 1TTOA 3EN1B 1CEWI 1W2ZA 4HM4B 4R9KA 6STDA 1A67A 3D5GA 3F9SA 4EYCA 2IUKA 3DUKA 1ZO2A 1S5AA 3PZWA 2KCDA 1HKXA 3VSYA 4FMDA 5M19A 3ER7A 1RGLA 1I0XA 3HIGA 1SARA 1O7PB 2B1XB 5KP1A 4WYKA 2GU1A 3GSPA 3IJEB 1IVWA 2UGIA 4KFDA 1RCLA 1I2FA 4MMXB 1OF5A 2D42A 2WOHA 1JN5B 1I2GA 2Z77A 3BNEA 5BXQA 2F5MA 3DGNA 1X1UA 1VQ63 1TFOA 3G6E3 4HVNA 5STDA 3U97A 5CLKA 1JV2B 1GOUA 3G8ZA 1JZOA 1ZS7A 3UJMA 1O7MB 1UCKA 1Q40B 1FA3A 3FCSB 3G713 3V92A 2JDIH 1A90A 4XBXA 5HGRA 2BU4A 5JPPA 5KP4A 1NNVA 1GD3A 1RTUA 1AVLA 1VQ43 1G96A 2HMMB 4OK0A 4BL3A 2KF3A 1IVXA 3OWYA 1OGZA 4GL6A 1FW7A 1WNHA 3X3ZA 4CPKA 1GOYA 3PCRA 4FR9A 2E2UA 3OXAA 4L8OA 4DKIA 3B4PA 2INXA 1WMPA 2RFRA 2IY2A 3E99A 4IT7A 1TU5A 1K8A4 1UGIA 4KFEA 1EEJA 3MG2A 1OH0A 1U5OA 2QA43 2FNQA 2CFWA 2W04A 2CFLA 2F56A 5I97A 2CWTA 2MC8A 1I2EA 1TJDA 2P38A 2GBWB 3NM7A 1IVUA 3JUMA 3GZRA 1VQP3 3URPA 3B7CA 2O3OA 4XBTA 4EV2A
chains in the Genus database with same CATH topology
2W2CA 1W6CA 2RCDA 3RDEA 1SJWA 4EC6A 5AIHA 3LTDA 5AIFA 1NO3A 1IDPA 3OX9A 1IT7A 1YJW3 2YFIB 1E97A 1MNLA 4MMZB 1L5GB 1RRHA 4LZIA 3D3LA 4OVMA 2QEX3 3SEDA 1TP6A 3EBYA 1EG9B 1W4NA 3FKAA 3N8BA 3LTAA 3A76A 1VQN3 2BO9B 5IF6A 1J2BA 3S28A 2GEXA 1VQM3 4X2OA 3F8HA 2OQEC 3FLJA 2ZL8A 2OTJ3 1F8NA 3I0YA 3FSDA 4BTXA 1RN7A 2XEPA 3GZXB 2CG1A 2MF7A 3MKIA 5IENA 1YHQ3 1STFI 2Y74A 3LTBA 3EB8A 1TFKA 5D81A 1GY6A 1D6UA 3OWUA 4O02B 3CD63 3RGRA 1JKGB 5IERA 3FG4A 4KVHA 2W9PA 2Q07A 1VQ93 4WP5A 3D9RA 2CWVA 3X3YA 4XDVA 4O2HA 1VQK3 3WA3A 1KSIA 1ROAA 1ASKA 1NB3I 1RJOA 2CKFB 3HK4A 1JN5A 1PU4A 5AEUB 3B4OA 1YIJ3 3GAXA 1IQXA 2PZVA 1A2VA 3X3XA 1JB5A 2CK3H 2CWUA 2XF3A 5A0OB 3PXMA 1Q40A 4ORLA 5D82A 3MG1A 3SOYA 3CCM3 4MEIA 1DMNA 1W00A 2M7OA 3L0RA 1YIT3 1KC84 1KWIA 1OCVA 1UUWB 4L8PA 1KD14 4OUQA 4IIAA 2XGNA 3WDGB 2P09A 2JQ5A 4HM6B 4FCJA 1ZX2A 4RNZA 4NHFA 5EEOA 3N9HA 4H61A 3MPHA 5IG0A 3KN4A 4N6LA 4HM1B 4LGQA 4RZMA 1M1K4 2HMKB 2GU3A 4N3VA 2OCTA 2XFTA 5AYSC 3UNLA 2C10A 1YJN3 2OQEA 1GD4A 3KSED 5D83A 3VGNA 3HI7A 1VQ83 3OWSA 4RNYA 4U13A 3LT9A 3CCR3 2W0QA 2K54A 1Q42A 1UUVB 3T8NA 3KE7A 4HZBB 2YFJB 1QMAA 1E3RA 3EE1A 3AMOB 1Q814 3H51A 4WFOA 3SLUA 2WOFA 2L4VA 1LNHA 4HM2B 3NQYA 4HKVB 1K734 5AI1A 4QWTA 4TX4A 1JNQA 2IUJA 3EC9A 4XB5A 4BTWA 3VF1A 1OACA 2F98A 4HM3B 2HMOB 1OHPA 3T0UA 1ISKA 3F7XA 2FGTA 3EN8A 1ROVA 3NX0A 2CH9A 1W02A 2IA7A 1A2KA 3CU3A 4FMBA 4GB5A 1IK3A 1GY7A 4O3VA 2STDA 3DGLA 3HIIA 3GRDA 3NQZA 4N6V0 1JKGA 4G1MB 1N9JA 2W6JH 1W01A 5ELJA 2W9QA 4MMYB 3OW22 3LMLA 3BNCA 3CCQ3 1EA2A 4BTYA 3CC23 1M904 4XBYA 3N54B 1Q824 3WA2X 4N6TA 3NM2A 2CFGA 5AIIA 3GWRA 1ULIB 2XH9A 3NHXA 2Z7AA 5EQLA 3S5CA 3CCS3 1AVKA 1Z1SA 3J7Yd 2HMLB 1DVDA 2LYXA 4N6UA 3UL5A 3KKGA 2XRXB 1JB2A 1SIIA 2RGQA 2HMJB 1VQO3 4LEHA 4LSOA 4IPBA 1OF5B 1O7WB 1IT8A 1QAFA 1D6ZA 2CHCA 1GY5A 2BMOB 5EVHA 1AR0A 4AKYA 3PYJA 4RBNA 5DRVA 2XFSA 1TUHA 3PGBA 3K0ZA 2WO0A 3CPW2 3KIIA 4N6MA 4PEJA 3MSOA 1NU3A 3NXJA 3WOFB 3STDA 2E2TA 3NUVA 3CNXA 2D1WA 8CHOA 4Q53A 1OPYA 4I4KA 4O8SA 2BNGA 5CF1A 1V74A 3BLZA 3I553 3F8XA 1N8R4 3KSPA 2P05A 1NWWA 2FXTA 5JBSA 1CYVA 1YI23 3CC43 1STDA 1W2B2 3JUQA 1NDOB 2YFLB 3LTCA 3NBJA 5IEOA 3MG3A 1DMMA 1W6GA 4HYZA 1K28A 5IG5A 3T8UA 2F86B 2C11A 1U8CB 2CFDA 4CDLA 1E3VA 2BT3A 1IV7A 3LXUX 3OV4A 2O9UX 4KZ1A 4R4KA 1IVVA 2XSOB 1GYBA 3K7CA 3CCL3 3CNMA 4EV5A 3DZLA 5LC6A 4FCZA 1IQYA 4HJLB 1WMNA 2XR8B 1O7HB 2OOVC 3Q90A 1M9GA 4WHAA 3UL6A 3MYTA 3U1WA 1HU9A 1VQL3 3S67A 3G16A 1QAKA 3NBBA 5FGOA 3BNDA 3TDGA 4K61A 1RRLA 1ULJB 3DM8A 3DY5A 5ELUA 1VZZA 2PNCA 3EF8A 2CC3A 1S723 2Y73A 3G0KA 3KZTA 3FG1A 4XM4A 3CMA3 1D6YA 1WQLB 2W56B 3NBRA 4EBGA 3K63A 3HZPA 4WWUC 3MHEA 2SBLA 1CQSA 2YX9A 3DGMA 3G4S3 2E2VA 2R4IA 3F7SA 3M8CA 3NV0B 5G2GA 5IW9A 3EJVA 3PCSA 1FGOA 3ALAA 3JUNA 4LMIA 2CG0A 2QGUA 3SVAA 3CC73 5AYRB 2F99A 3GZBA 2KXGA 3JUOA 4HBRA 3F40A 4L7KA 5CK6A 2I9WA 3ECFA 4FMCA 5DREA 1O7GB 1C7HA 4MJDA 4H3UA 3RGAA 3ROBA 3CXC2 3LYGA 3EHCA 2ML6A 4KFFA 1Q7Y4 3I563 1Y4KA 4K90B 2BMQB 2Z76A 3MWZA 1MOLA 2IMJA 2GXFA 2QIYA 1GS3A 3H3HA 1W5ZA 3SOAA 1FUWA 3CPOA 3FZWA 7STDA 1NB5I 1T5YA 5LC7A 2WGQA 1M1XB 1BUQA 1OUNA 5IG3A 3F14A 5AIGA 1N5HA 3WODG 1DMQA 1FGRA 1UI8A 1LOXA 1KQS2 1EQKA 4JF8A 4K1VA 1N9EA 2RSXA 3SX1A 3X41A 2XSHB 3SXXA 3IMAB 3LOYA 2OOVA 5BVBA 2W03A 1QJGA 4R1KA 3EBTA 3DMCA 4N6OB 2Z6BA 3PS8A 4X2HA 1N5PA 1R4CA 2P0XA 3EQQB 4WYKB 3GZYB 2ML5A 4HM7B 1PFPA 3V98A 2ZDJA 1SQWA 3K5TA 1EKMA 1N8QA 2BHMA 3LH4A 4HM8B 1LVNA 3EX9A 2CFKA 4R9LA 2CIUA 3Q1CA 3IPTA 1YVBI 4AKZA 5JPUA 1AV4A 1QVF2 3FH1A 4FCMA 4R80A 3QK9A 4N6NB 1JRQA 4HM0B 1LXEA 2KRTA 2P0MA 4STDA 3KFQC 5CF2A 3FF0A 1K9M4 1FGMA 1OGXA 2BMRB 2V1LA 1TIJA 1UW1A 1OHOA 2GBXB 1Q864 1IQ8A 3O8YA 5KP3A 1QVG2 3CME3 3V99A 1IV9A 2WGOA 4J9AA 2W56A 3CCE3 3FG3A 3UB1A 2LQVA 1RKYA 1OHSA 4K1UA 5AEWB 1WMOA 2UX0A 1WTHA 4AEQA 3AMOA 3WMDA 3CCU3 3JUPA 1FGQA 3NV0A 4CCVA 2K0MA 4XDWA 2XGLA 1W6YA 1K41A 3DGOA 1JB4A 3HX8A 2CW9A 5FW5A 3FGYA 2OWPA 3Q2PA 3QRDA 1O7NB 3BB9A 3LT8A 1QALA 2B24B 1FGTA 4FMAA 2OTL3 1VQ53 2HMNB 1SPUA 3S27A 1JJ22 1US1A 2A15A 4EXRA 4ZM8A 3CCJ3 1DVCA 3B8LA 3DXOA 4NREA 5IEPA 4JRFA 3X42A 4HM5B 3FF2A 1W7CA 1YJ93 5CXOA 1NJI4 1IU7A 1YGEA 3CCV3 1VQ73 3K9MC 4HZ9B 1SIHA 3WOEB 1UI7A 3S29A 3BNBA 2GEYA 5IG4A 3LZAA 3X40A 4J8TA 5TGNA 1CYUA 1DYUA 3JVCA 3EN1B 1CEWI 1W2ZA 4HM4B 4R9KA 6STDA 1A67A 3F9SA 4EYCA 2IUKA 3DUKA 1ZO2A 1S5AA 3PZWA 2KCDA 1HKXA 3VSYA 4FMDA 3ER7A 3HIGA 2B1XB 1O7PB 5KP1A 4WYKA 2GU1A 3IJEB 1IVWA 4KFDA 4MMXB 2D42A 2WOHA 1OF5A 1JN5B 2Z77A 3BNEA 5BXQA 3DGNA 1VQ63 1TFOA 3G6E3 4HVNA 5STDA 3U97A 5CLKA 1JV2B 3G8ZA 3UJMA 1O7MB 1FA3A 1Q40B 3FCSB 3G713 3V92A 2JDIH 1A90A 4XBXA 5HGRA 5JPPA 5KP4A 1GD3A 1AVLA 1VQ43 1G96A 2HMMB 4OK0A 1IVXA 3OWYA 1OGZA 4GL6A 1WNHA 3X3ZA 3PCRA 4FR9A 2E2UA 3OXAA 4L8OA 3B4PA 2INXA 1WMPA 2RFRA 3E99A 4IT7A 1TU5A 1K8A4 4KFEA 3MG2A 1OH0A 1U5OA 2QA43 2FNQA 2CFWA 2W04A 2CFLA 5I97A 2CWTA 2MC8A 2P38A 2GBWB 3NM7A 1IVUA 3JUMA 3GZRA 1VQP3 3B7CA 2O3OA 4XBTA 4EV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2C A;  2RCD A;  1SJW A;  5AIH A;  5AIF A;  1IDP A;  3OX9 A;  2YFI B;  1E97 A;  4OVM A;  3SED A;  1TP6 A;  3EBY A;  1EG9 B;  3FKA A;  3A76 A;  5IF6 A;  2GEX A;  4X2O A;  3F8H A;  3FLJ A;  3I0Y A;  3FSD A;  3GZX B;  3MKI A;  5IEN A;  5D81 A;  1GY6 A;  3OWU A;  3RGR A;  1JKG B;  5IER A;  4KVH A;  4WP5 A;  3D9R A;  4XDV A;  1ASK A;  2CKF B;  3HK4 A;  1JN5 A;  5AEU B;  3B4O A;  2PZV A;  1JB5 A;  1Q40 A;  4ORL A;  5D82 A;  3MG1 A;  3SOY A;  1DMN A;  1W00 A;  1OCV A;  1UUW B;  4L8P A;  4OUQ A;  4IIA A;  2JQ5 A;  4HM6 B;  4FCJ A;  1ZX2 A;  5IG0 A;  4HM1 B;  4LGQ A;  4RZM A;  2HMK B;  4N3V A;  3UNL A;  5D83 A;  3VGN A;  3OWS A;  4U13 A;  2K54 A;  1Q42 A;  1UUV B;  3T8N A;  3KE7 A;  4HZB B;  2YFJ B;  1E3R A;  1QMA A;  3H51 A;  4HM2 B;  4HKV B;  5AI1 A;  3EC9 A;  4XB5 A;  2F98 A;  4HM3 B;  1ISK A;  2HMO B;  1OHP A;  3F7X A;  3EN8 A;  1W02 A;  1A2K A;  3CU3 A;  4GB5 A;  1GY7 A;  2STD A;  3GRD A;  1JKG A;  1W01 A;  1EA2 A;  4XBY A;  3NM2 A;  5AII A;  3GWR A;  1ULI B;  3NHX A;  3S5C A;  2Z7A A;  1Z1S A;  2HML B;  3KKG A;  2XRX B;  1JB2 A;  2RGQ A;  2HMJ B;  4LEH A;  1OF5 B;  1O7W B;  2CHC A;  1GY5 A;  2BMO B;  5EVH A;  1AR0 A;  5DRV A;  1TUH A;  3K0Z A;  4PEJ A;  3MSO A;  1NU3 A;  3NXJ A;  3STD A;  3NUV A;  3CNX A;  8CHO A;  4Q53 A;  1OPY A;  4I4K A;  2BNG A;  5CF1 A;  3BLZ A;  3F8X A;  3KSP A;  1NWW A;  1STD A;  3JUQ A;  1NDO B;  2YFL B;  5IEO A;  3MG3 A;  1DMM A;  5IG5 A;  3T8U A;  2F86 B;  4CDL A;  1E3V A;  3OV4 A;  2XSO B;  3K7C A;  1GYB A;  3CNM A;  3DZL A;  4HJL B;  2XR8 B;  1O7H B;  3Q90 A;  3MYT A;  3G16 A;  1ULJ B;  3DM8 A;  1VZZ A;  3EF8 A;  3G0K A;  3KZT A;  4XM4 A;  1WQL B;  3NBR A;  3HZP A;  4WWU C;  3MHE A;  1CQS A;  2R4I A;  3F7S A;  3M8C A;  3NV0 B;  5G2G A;  3EJV A;  3JUN A;  4LMI A;  2QGU A;  2F99 A;  3GZB A;  3JUO A;  4L7K A;  3F40 A;  5CK6 A;  2I9W A;  3ECF A;  5DRE A;  1O7G B;  1C7H A;  4MJD A;  4H3U A;  3RGA A;  3ROB A;  3LYG A;  3EHC A;  2BMQ B;  2Z76 A;  2IMJ A;  2GXF A;  2QIY A;  1GS3 A;  3H3H A;  3SOA A;  3CPO A;  3FZW A;  7STD A;  1BUQ A;  1OUN A;  5IG3 A;  3F14 A;  5AIG A;  1DMQ A;  4K1V A;  2XSH B;  5BVB A;  1QJG A;  4R1K A;  3EBT A;  3DMC A;  4X2H A;  3EQQ B;  4WYK B;  3GZY B;  4HM7 B;  4HM8 B;  3EX9 A;  4R9L A;  3IPT A;  5JPU A;  3FH1 A;  4FCM A;  4HM0 B;  4STD A;  5CF2 A;  3FF0 A;  1OGX A;  2BMR B;  1OHO A;  2GBX B;  5KP3 A;  4J9A A;  1OHS A;  4K1U A;  5AEW B;  2UX0 A;  3WMD A;  3JUP A;  3NV0 A;  4XDW A;  1W6Y A;  1K41 A;  1JB4 A;  3HX8 A;  5FW5 A;  3FGY A;  2OWP A;  1O7N B;  3BB9 A;  2B24 B;  2HMN B;  2A15 A;  3B8L A;  3DXO A;  5IEP A;  4HM5 B;  3FF2 A;  5CXO A;  4HZ9 B;  2GEY A;  5IG4 A;  3LZA A;  4J8T A;  5TGN A;  3EN1 B;  6STD A;  4HM4 B;  4R9K A;  3F9S A;  3DUK A;  1ZO2 A;  1S5A A;  1HKX A;  3VSY A;  3ER7 A;  2B1X B;  1O7P B;  5KP1 A;  4WYK A;  1OF5 A;  1JN5 B;  2Z77 A;  5BXQ A;  4HVN A;  5STD A;  5CLK A;  3G8Z A;  3UJM A;  1O7M B;  1Q40 B;  4XBX A;  5HGR A;  5JPP A;  5KP4 A;  2HMM B;  3OWY A;  1OGZ A;  4L8O A;  3OXA A;  3B4P A;  2INX A;  2RFR A;  3E99 A;  3MG2 A;  1OH0 A;  1U5O A;  2GBW B;  3JUM A;  3GZR A;  3B7C A;  4XBT A; 
#chains in the Genus database with same CATH topology
 2W2C A;  1W6C A;  2RCD A;  3RDE A;  1JZD A;  3DH2 A;  1SJW A;  4EC6 A;  5AIH A;  1BSB A;  1LOV A;  3LTD A;  5AIF A;  1NO3 A;  1IDP A;  3OX9 A;  1IT7 A;  3ZG0 A;  1YJW 3;  1G02 A;  2YFI B;  1E97 A;  1BVI A;  1MNL A;  4MMZ B;  1L5G B;  1RRH A;  4LZI A;  3D3L A;  4OVM A;  2QEX 3;  3SED A;  1TP6 A;  3EBY A;  1EG9 B;  1W4N A;  1MWS A;  3FKA A;  4HAA A;  3N8B A;  2HOH A;  1RLS A;  3LTA A;  3A76 A;  4RNT A;  1VQN 3;  1FYS A;  1T2I A;  2BO9 B;  5IF6 A;  6RNT A;  1J2B A;  3S28 A;  2GEX A;  1VQM 3;  4X2O A;  3F8H A;  2OQE C;  3FLJ A;  2ZHX B;  2ZL8 A;  2OTJ 3;  2H0G A;  1F8N A;  3I0Y A;  1MWU A;  3FSD A;  4BTX A;  1RN7 A;  2XEP A;  3GZX B;  1RGG A;  1A2P A;  2MF7 A;  3MKI A;  2CG1 A;  5IEN A;  1YHQ 3;  1STF I;  1RNT A;  2Y74 A;  4NPB A;  1BRN L;  3LTB A;  3EB8 A;  1TFK A;  5D81 A;  1GY6 A;  1D6U A;  1MGR A;  1BSD A;  3OWU A;  4O02 B;  3CD6 3;  3RGR A;  1JKG B;  5IER A;  3FG4 A;  4J5G A;  2W9P A;  4KVH A;  3DGY A;  2Q07 A;  5GSP A;  1VQ9 3;  4WP5 A;  3D9R A;  2CWV A;  5G1K A;  3X3Y A;  4XDV A;  4O2H A;  1VQK 3;  3WA3 A;  1KSI A;  1ROA A;  1ASK A;  1RGK A;  1NB3 I;  1RJO A;  2CKF B;  2C4B A;  3HK4 A;  1JN5 A;  1PU4 A;  1MWR A;  5AEU B;  3B4O A;  1YIJ 3;  3GAX A;  1IQX A;  1X1Y A;  2PZV A;  1A2V A;  3X3X A;  1JB5 A;  1DE3 A;  2CK3 H;  2CWU A;  2XF3 A;  1B2X A;  1RMS A;  3PXM A;  5A0O B;  1Q40 A;  4ORL A;  5D82 A;  3MG1 A;  1BNI A;  3SOY A;  3CCM 3;  4MEI A;  2GSP A;  1DMN A;  1W00 A;  2M7O A;  3L0R A;  4EW5 A;  1YIT 3;  1KC8 4;  1KWI A;  1OCV A;  1UUW B;  1RHL A;  3A5E A;  1HZ1 A;  4L8P A;  1KD1 4;  8RNT A;  4OUQ A;  4IIA A;  2XGN A;  3WDG B;  2P09 A;  2JQ5 A;  4BU4 A;  4HM6 B;  4FCJ A;  1GMR A;  1ZX2 A;  4RNZ A;  4NHF A;  1ZGX A;  5EEO A;  1BSA A;  3N9H A;  4H61 A;  3MPH A;  5IG0 A;  4I5Q A;  1GMP A;  4GHO A;  3AGO A;  1RN1 A;  3KN4 A;  4N6L A;  4HM1 B;  4LGQ A;  4RZM A;  1M1K 4;  2HMK B;  1V57 A;  2GU3 A;  4N3V A;  2OCT A;  2XFT A;  5AYS C;  3UNL A;  2C10 A;  1GSP A;  1YJN 3;  2OQE A;  1GD4 A;  3KSE D;  5D83 A;  3VGN A;  3HI7 A;  1VQ8 3;  4LYL B;  3OWS A;  4RNY A;  4U13 A;  3LT9 A;  3CCR 3;  1UCL A;  2W0Q A;  2K54 A;  1Q42 A;  1UUV B;  3T8N A;  3KE7 A;  4HZB B;  2YFJ B;  1QMA A;  1BNF A;  1E3R A;  3EE1 A;  1Q9E A;  3AMO B;  1Q81 4;  3H51 A;  2KF6 A;  1YGW A;  4WFO A;  1X1W A;  3SLU A;  1UDI I;  2WOF A;  2L4V A;  1LNH A;  3Q3F A;  4HM2 B;  3NQY A;  4HKV B;  4CJN A;  1K73 4;  5AI1 A;  3ZG5 A;  1T2H A;  4QWT A;  1BRK A;  4TX4 A;  1JNQ A;  2IUJ A;  3EC9 A;  1MWT A;  4XB5 A;  4BTW A;  3VF1 A;  1OAC A;  2AAD A;  1RDS A;  2F98 A;  1OHP A;  2HMO B;  4HM3 B;  3T0U A;  3F7X A;  1ISK A;  2FGT A;  1BSE A;  3EN8 A;  1ROV A;  3NX0 A;  2CH9 A;  1W02 A;  2IA7 A;  1A2K A;  3CU3 A;  4FMB A;  4GB5 A;  1IK3 A;  1GY7 A;  4O3V A;  1B20 A;  2STD A;  3DGL A;  3HII A;  3GRD A;  3NQZ A;  1BNG A;  4N6V 0;  1JKG A;  2RNT A;  2J8X B;  3AGN A;  4G1M B;  1N9J A;  2W6J H;  1W01 A;  5ELJ A;  2W9Q A;  1BIR A;  4MMY B;  3OW2 2;  3LML A;  3BU4 A;  3BNC A;  3CCQ 3;  1EA2 A;  1TRQ A;  5G1L A;  4BTY A;  4XBY A;  3CC2 3;  3N54 B;  1Q82 4;  1M90 4;  3WA2 X;  4N6T A;  3NM2 A;  2CFG A;  5AII A;  3GWR A;  1ULI B;  2XH9 A;  3NHX A;  2Z7A A;  5EQL A;  1LNI A;  3S5C A;  3CCS 3;  1AVK A;  1Z1S A;  3J7Y d;  2HML B;  1DVD A;  2LYX A;  2H0I A;  1MGW A;  4N6U A;  3UL5 A;  1CH0 A;  3KKG A;  2XRX B;  1JB2 A;  1SII A;  2RGQ A;  2HMJ B;  1VQO 3;  4LEH A;  4LSO A;  4IPB A;  1OF5 B;  1BRJ A;  1B2S A;  1O7W B;  1B2U A;  1IT8 A;  4BL2 A;  2R41 A;  1QAF A;  1RGC A;  3BIR A;  1D6Z A;  2CHC A;  1GY5 A;  2BMO B;  1GMQ A;  5EVH A;  4ILF A;  1AR0 A;  4AKY A;  3PYJ A;  4RBN A;  2CX1 A;  5DRV A;  9RNT A;  2XFS A;  1TUH A;  1FZU A;  3PGB A;  3K0Z A;  2WO0 A;  1BGS A;  3CPW 2;  1PYL A;  3KII A;  4N6M A;  3KCH A;  3MSO A;  4PEJ A;  1NU3 A;  3NXJ A;  3WOF B;  3STD A;  2E2T A;  3NUV A;  3CNX A;  2D1W A;  8CHO A;  4Q53 A;  1OPY A;  4I4K A;  4O8S A;  2BNG A;  5CF1 A;  1V74 A;  3BLZ A;  3I55 3;  3F8X A;  1N8R 4;  3KSP A;  2P05 A;  1NWW A;  2FXT A;  5JBS A;  1CYV A;  4HOH A;  1YI2 3;  1STD A;  3CC4 3;  1W2B 2;  3JUQ A;  1BNR A;  2BIR A;  1NDO B;  2YFL B;  1JBR A;  3LTC A;  3NBJ A;  5IEO A;  1B2M A;  3MG3 A;  1DMM A;  1W6G A;  6GSP A;  3D4A A;  4HYZ A;  1K28 A;  5IG5 A;  3T8U A;  2F86 B;  1LQG C;  2C11 A;  1U8C B;  1RNB A;  1I8V A;  1I3I A;  2CFD A;  4CDL A;  5RNT A;  1E3V A;  2BT3 A;  1YVS A;  1IV7 A;  3LXU X;  7RNT A;  3OV4 A;  2O9U X;  4KZ1 A;  4R4K A;  3D5I A;  1IVV A;  2XSO B;  1GYB A;  3K7C A;  1YNV X;  3CCL 3;  3CNM A;  1BNS A;  4EV5 A;  3DZL A;  5LC6 A;  4FCZ A;  5BIR A;  1JBS A;  1IYY A;  1IQY A;  4HJL B;  1WMN A;  2XR8 B;  1O7H B;  2OOV C;  3Q90 A;  5M18 A;  1M9G A;  1UCJ A;  4WHA A;  3UL6 A;  3MYT A;  3U1W A;  2UUG C;  4GSP A;  2F4Y A;  1HU9 A;  4J5K A;  1VQL 3;  1BRS A;  3S67 A;  3G16 A;  2F5W A;  1QAK A;  3NBB A;  5FGO A;  1UCI A;  3BND A;  3TDG A;  4K61 A;  1RRL A;  1ULJ B;  3DM8 A;  3DY5 A;  5ELU A;  1VZZ A;  2KAA A;  2PNC A;  3EF8 A;  2CC3 A;  1PY3 A;  1S72 3;  3ZFZ A;  2Y73 A;  3G0K A;  3KZT A;  3FG1 A;  5BU4 A;  4XM4 A;  3CMA 3;  1D6Y A;  1WQL B;  1G0T A;  2W56 B;  3NBR A;  4BIR A;  4EBG A;  3K63 A;  3HZP A;  4WWU C;  3MHE A;  2SBL A;  1AY7 A;  1CQS A;  2YX9 A;  3DGM A;  3G4S 3;  2E2V A;  2L1S A;  2R4I A;  3F7S A;  3M8C A;  3NV0 B;  5G2G A;  5IW9 A;  2AAE A;  3EJV A;  3PCS A;  1FGO A;  3ALA A;  3JUN A;  2H0H A;  4LMI A;  2CG0 A;  2QGU A;  5M1A A;  3SVA A;  3CC7 3;  1RGA A;  1RGH A;  5AYR B;  2F99 A;  1B2Z A;  2KXG A;  3GZB A;  3JUO A;  1LOW A;  3F40 A;  4HBR A;  1B3S A;  2I9W A;  3ECF A;  4FMC A;  4L7K A;  5CK6 A;  5DRE A;  1O7G B;  1BAO A;  1C7H A;  4MJD A;  4H3U A;  3RGA A;  3ROB A;  3CXC 2;  3LYG A;  3EHC A;  2ML6 A;  4KFF A;  1Q7Y 4;  3I56 3;  1Y4K A;  4K90 B;  2BMQ B;  2Z76 A;  3MWZ A;  1MOL A;  4KT3 B;  1B27 A;  2IMJ A;  2GXF A;  2QIY A;  1GS3 A;  3H3H A;  1W5Z A;  3SOA A;  1FUW A;  1JBT A;  3CPO A;  1TRP A;  3FZW A;  1BNJ A;  1I3F A;  7STD A;  1NB5 I;  1I70 A;  1T5Y A;  5LC7 A;  2WGQ A;  1VQQ A;  1M1X B;  1BUQ A;  1OUN A;  1RGE A;  5IG3 A;  3F14 A;  5AIG A;  1C54 A;  1N5H A;  3WOD G;  1DMQ A;  1FGR A;  1UI8 A;  1LOX A;  1KQS 2;  1EQK A;  2KF4 A;  4JF8 A;  4K1V A;  3RNT A;  1N9E A;  2RSX A;  3SX1 A;  3X41 A;  2XSH B;  1BSC A;  3SXX A;  3IMA B;  3LOY A;  2OOV A;  5BVB A;  2W03 A;  1QJG A;  4R1K A;  3EBT A;  3DMC A;  4N6O B;  2Z6B A;  3PS8 A;  4X2H A;  3WHO A;  1N5P A;  1R4C A;  2P0X A;  3EQQ B;  4WYK B;  3GZY B;  7GSP A;  2ML5 A;  4HM7 B;  1PFP A;  3V98 A;  1SQW A;  2ZDJ A;  3K5T A;  1EKM A;  1N8Q A;  2BHM A;  3LH4 A;  4HM8 B;  1LVN A;  1Q7H A;  2CFK A;  3EX9 A;  4R9L A;  1I0V A;  2CIU A;  1BAN A;  3Q1C A;  3IPT A;  1YVB I;  4AKZ A;  5JPU A;  1BRI A;  1AV4 A;  1QVF 2;  3FH1 A;  1BRG A;  4FCM A;  4R80 A;  3QK9 A;  4N6N B;  1JRQ A;  4HM0 B;  1LXE A;  2KRT A;  1DET A;  2RBI A;  1BUJ A;  2P0M A;  2ZA4 A;  3AHW A;  4STD A;  3KFQ C;  1AQZ A;  5CF2 A;  3FF0 A;  1K9M 4;  1FGM A;  1OGX A;  2CX0 A;  2BMR B;  1X1X A;  2V1L A;  1TIJ A;  1UW1 A;  1OHO A;  1R4Y A;  2GBX B;  1Q86 4;  1IQ8 A;  3O8Y A;  2K3D A;  5KP3 A;  1QVG 2;  1RN4 A;  3CME 3;  1V58 A;  3V99 A;  1IV9 A;  1EUI C;  2WGO A;  1LQM B;  4J9A A;  2W56 A;  2SAR A;  3CCE 3;  3AHS A;  3FG3 A;  3UB1 A;  2LQV A;  1RKY A;  1OHS A;  4K1U A;  5AEW B;  1WMO A;  2UX0 A;  1WTH A;  1LRA A;  3AMO A;  1BU4 A;  4AEQ A;  3WMD A;  5HOH A;  1RCK A;  3CCU 3;  1UUG B;  3JUP A;  1FGQ A;  3NV0 A;  4CCV A;  2K0M A;  2IYJ A;  4XDW A;  2XGL A;  1W6Y A;  1FUS A;  2KF5 A;  1K41 A;  3DGO A;  1JB4 A;  1RSN A;  3HX8 A;  2CW9 A;  5FW5 A;  1GOV A;  3FGY A;  2OWP A;  3Q2P A;  3QRD A;  1O7N B;  3BB9 A;  3LT8 A;  1QAL A;  2B24 B;  1FGT A;  1LOY A;  4FMA A;  2OTL 3;  1VQ5 3;  2HMN B;  1T3B A;  1SPU A;  3S27 A;  1UGH I;  1JJ2 2;  1RGF A;  1B21 A;  3SYU A;  1US1 A;  2A15 A;  4EXR A;  4ZM8 A;  3CCJ 3;  1DVC A;  3D79 A;  3WR2 A;  1BNE A;  3B8L A;  3DXO A;  4NRE A;  5IEP A;  4JRF A;  3X42 A;  4HM5 B;  1FUT A;  1W7C A;  3FF2 A;  1YJ9 3;  5CXO A;  1NJI 4;  1IU7 A;  1YGE A;  3CCV 3;  1BRH A;  3K9M C;  4HZ9 B;  1VQ7 3;  1SIH A;  3WOE B;  1UI7 A;  3S29 A;  1BOX A;  3HOH A;  3BNB A;  2GEY A;  5IG4 A;  3LZA A;  3X40 A;  4J8T A;  5TGN A;  1CYU A;  1DYU A;  1HYF A;  3JVC A;  1TTO A;  3EN1 B;  1CEW I;  1W2Z A;  4HM4 B;  4R9K A;  6STD A;  1A67 A;  3D5G A;  3F9S A;  4EYC A;  2IUK A;  3DUK A;  1ZO2 A;  1S5A A;  3PZW A;  2KCD A;  1HKX A;  3VSY A;  4FMD A;  5M19 A;  3ER7 A;  1RGL A;  1I0X A;  3HIG A;  1SAR A;  1O7P B;  2B1X B;  5KP1 A;  4WYK A;  2GU1 A;  3GSP A;  3IJE B;  1IVW A;  2UGI A;  4KFD A;  1RCL A;  1I2F A;  4MMX B;  1OF5 A;  2D42 A;  2WOH A;  1JN5 B;  1I2G A;  2Z77 A;  3BNE A;  5BXQ A;  2F5M A;  3DGN A;  1X1U A;  1VQ6 3;  1TFO A;  3G6E 3;  4HVN A;  5STD A;  3U97 A;  5CLK A;  1JV2 B;  1GOU A;  3G8Z A;  1JZO A;  1ZS7 A;  3UJM A;  1O7M B;  1UCK A;  1Q40 B;  1FA3 A;  3FCS B;  3G71 3;  3V92 A;  2JDI H;  1A90 A;  4XBX A;  5HGR A;  2BU4 A;  5JPP A;  5KP4 A;  1NNV A;  1GD3 A;  1RTU A;  1AVL A;  1VQ4 3;  1G96 A;  2HMM B;  4OK0 A;  4BL3 A;  2KF3 A;  1IVX A;  3OWY A;  1OGZ A;  4GL6 A;  1FW7 A;  1WNH A;  3X3Z A;  4CPK A;  1GOY A;  3PCR A;  4FR9 A;  2E2U A;  3OXA A;  4L8O A;  4DKI A;  3B4P A;  2INX A;  1WMP A;  2RFR A;  2IY2 A;  3E99 A;  4IT7 A;  1TU5 A;  1K8A 4;  1UGI A;  4KFE A;  1EEJ A;  3MG2 A;  1OH0 A;  1U5O A;  2QA4 3;  2FNQ A;  2CFW A;  2W04 A;  2CFL A;  2F56 A;  5I97 A;  2CWT A;  2MC8 A;  1I2E A;  1TJD A;  2P38 A;  2GBW B;  3NM7 A;  1IVU A;  3JUM A;  3GZR A;  1VQP 3;  3URP A;  3B7C A;  2O3O A;  4XBT A;  4EV2 A; 
#chains in the Genus database with same CATH homology
 2W2C A;  1W6C A;  2RCD A;  3RDE A;  1SJW A;  4EC6 A;  5AIH A;  3LTD A;  5AIF A;  1NO3 A;  1IDP A;  3OX9 A;  1IT7 A;  1YJW 3;  2YFI B;  1E97 A;  1MNL A;  4MMZ B;  1L5G B;  1RRH A;  4LZI A;  3D3L A;  4OVM A;  2QEX 3;  3SED A;  1TP6 A;  3EBY A;  1EG9 B;  1W4N A;  3FKA A;  3N8B A;  3LTA A;  3A76 A;  1VQN 3;  2BO9 B;  5IF6 A;  1J2B A;  3S28 A;  2GEX A;  1VQM 3;  4X2O A;  3F8H A;  2OQE C;  3FLJ A;  2ZL8 A;  2OTJ 3;  1F8N A;  3I0Y A;  3FSD A;  4BTX A;  1RN7 A;  2XEP A;  3GZX B;  2CG1 A;  2MF7 A;  3MKI A;  5IEN A;  1YHQ 3;  1STF I;  2Y74 A;  3LTB A;  3EB8 A;  1TFK A;  5D81 A;  1GY6 A;  1D6U A;  3OWU A;  4O02 B;  3CD6 3;  3RGR A;  1JKG B;  5IER A;  3FG4 A;  4KVH A;  2W9P A;  2Q07 A;  1VQ9 3;  4WP5 A;  3D9R A;  2CWV A;  3X3Y A;  4XDV A;  4O2H A;  1VQK 3;  3WA3 A;  1KSI A;  1ROA A;  1ASK A;  1NB3 I;  1RJO A;  2CKF B;  3HK4 A;  1JN5 A;  1PU4 A;  5AEU B;  3B4O A;  1YIJ 3;  3GAX A;  1IQX A;  2PZV A;  1A2V A;  3X3X A;  1JB5 A;  2CK3 H;  2CWU A;  2XF3 A;  5A0O B;  3PXM A;  1Q40 A;  4ORL A;  5D82 A;  3MG1 A;  3SOY A;  3CCM 3;  4MEI A;  1DMN A;  1W00 A;  2M7O A;  3L0R A;  1YIT 3;  1KC8 4;  1KWI A;  1OCV A;  1UUW B;  4L8P A;  1KD1 4;  4OUQ A;  4IIA A;  2XGN A;  3WDG B;  2P09 A;  2JQ5 A;  4HM6 B;  4FCJ A;  1ZX2 A;  4RNZ A;  4NHF A;  5EEO A;  3N9H A;  4H61 A;  3MPH A;  5IG0 A;  3KN4 A;  4N6L A;  4HM1 B;  4LGQ A;  4RZM A;  1M1K 4;  2HMK B;  2GU3 A;  4N3V A;  2OCT A;  2XFT A;  5AYS C;  3UNL A;  2C10 A;  1YJN 3;  2OQE A;  1GD4 A;  3KSE D;  5D83 A;  3VGN A;  3HI7 A;  1VQ8 3;  3OWS A;  4RNY A;  4U13 A;  3LT9 A;  3CCR 3;  2W0Q A;  2K54 A;  1Q42 A;  1UUV B;  3T8N A;  3KE7 A;  4HZB B;  2YFJ B;  1QMA A;  1E3R A;  3EE1 A;  3AMO B;  1Q81 4;  3H51 A;  4WFO A;  3SLU A;  2WOF A;  2L4V A;  1LNH A;  4HM2 B;  3NQY A;  4HKV B;  1K73 4;  5AI1 A;  4QWT A;  4TX4 A;  1JNQ A;  2IUJ A;  3EC9 A;  4XB5 A;  4BTW A;  3VF1 A;  1OAC A;  2F98 A;  4HM3 B;  2HMO B;  1OHP A;  3T0U A;  1ISK A;  3F7X A;  2FGT A;  3EN8 A;  1ROV A;  3NX0 A;  2CH9 A;  1W02 A;  2IA7 A;  1A2K A;  3CU3 A;  4FMB A;  4GB5 A;  1IK3 A;  1GY7 A;  4O3V A;  2STD A;  3DGL A;  3HII A;  3GRD A;  3NQZ A;  4N6V 0;  1JKG A;  4G1M B;  1N9J A;  2W6J H;  1W01 A;  5ELJ A;  2W9Q A;  4MMY B;  3OW2 2;  3LML A;  3BNC A;  3CCQ 3;  1EA2 A;  4BTY A;  3CC2 3;  1M90 4;  4XBY A;  3N54 B;  1Q82 4;  3WA2 X;  4N6T A;  3NM2 A;  2CFG A;  5AII A;  3GWR A;  1ULI B;  2XH9 A;  3NHX A;  2Z7A A;  5EQL A;  3S5C A;  3CCS 3;  1AVK A;  1Z1S A;  3J7Y d;  2HML B;  1DVD A;  2LYX A;  4N6U A;  3UL5 A;  3KKG A;  2XRX B;  1JB2 A;  1SII A;  2RGQ A;  2HMJ B;  1VQO 3;  4LEH A;  4LSO A;  4IPB A;  1OF5 B;  1O7W B;  1IT8 A;  1QAF A;  1D6Z A;  2CHC A;  1GY5 A;  2BMO B;  5EVH A;  1AR0 A;  4AKY A;  3PYJ A;  4RBN A;  5DRV A;  2XFS A;  1TUH A;  3PGB A;  3K0Z A;  2WO0 A;  3CPW 2;  3KII A;  4N6M A;  4PEJ A;  3MSO A;  1NU3 A;  3NXJ A;  3WOF B;  3STD A;  2E2T A;  3NUV A;  3CNX A;  2D1W A;  8CHO A;  4Q53 A;  1OPY A;  4I4K A;  4O8S A;  2BNG A;  5CF1 A;  1V74 A;  3BLZ A;  3I55 3;  3F8X A;  1N8R 4;  3KSP A;  2P05 A;  1NWW A;  2FXT A;  5JBS A;  1CYV A;  1YI2 3;  3CC4 3;  1STD A;  1W2B 2;  3JUQ A;  1NDO B;  2YFL B;  3LTC A;  3NBJ A;  5IEO A;  3MG3 A;  1DMM A;  1W6G A;  4HYZ A;  1K28 A;  5IG5 A;  3T8U A;  2F86 B;  2C11 A;  1U8C B;  2CFD A;  4CDL A;  1E3V A;  2BT3 A;  1IV7 A;  3LXU X;  3OV4 A;  2O9U X;  4KZ1 A;  4R4K A;  1IVV A;  2XSO B;  1GYB A;  3K7C A;  3CCL 3;  3CNM A;  4EV5 A;  3DZL A;  5LC6 A;  4FCZ A;  1IQY A;  4HJL B;  1WMN A;  2XR8 B;  1O7H B;  2OOV C;  3Q90 A;  1M9G A;  4WHA A;  3UL6 A;  3MYT A;  3U1W A;  1HU9 A;  1VQL 3;  3S67 A;  3G16 A;  1QAK A;  3NBB A;  5FGO A;  3BND A;  3TDG A;  4K61 A;  1RRL A;  1ULJ B;  3DM8 A;  3DY5 A;  5ELU A;  1VZZ A;  2PNC A;  3EF8 A;  2CC3 A;  1S72 3;  2Y73 A;  3G0K A;  3KZT A;  3FG1 A;  4XM4 A;  3CMA 3;  1D6Y A;  1WQL B;  2W56 B;  3NBR A;  4EBG A;  3K63 A;  3HZP A;  4WWU C;  3MHE A;  2SBL A;  1CQS A;  2YX9 A;  3DGM A;  3G4S 3;  2E2V A;  2R4I A;  3F7S A;  3M8C A;  3NV0 B;  5G2G A;  5IW9 A;  3EJV A;  3PCS A;  1FGO A;  3ALA A;  3JUN A;  4LMI A;  2CG0 A;  2QGU A;  3SVA A;  3CC7 3;  5AYR B;  2F99 A;  3GZB A;  2KXG A;  3JUO A;  4HBR A;  3F40 A;  4L7K A;  5CK6 A;  2I9W A;  3ECF A;  4FMC A;  5DRE A;  1O7G B;  1C7H A;  4MJD A;  4H3U A;  3RGA A;  3ROB A;  3CXC 2;  3LYG A;  3EHC A;  2ML6 A;  4KFF A;  1Q7Y 4;  3I56 3;  1Y4K A;  4K90 B;  2BMQ B;  2Z76 A;  3MWZ A;  1MOL A;  2IMJ A;  2GXF A;  2QIY A;  1GS3 A;  3H3H A;  1W5Z A;  3SOA A;  1FUW A;  3CPO A;  3FZW A;  7STD A;  1NB5 I;  1T5Y A;  5LC7 A;  2WGQ A;  1M1X B;  1BUQ A;  1OUN A;  5IG3 A;  3F14 A;  5AIG A;  1N5H A;  3WOD G;  1DMQ A;  1FGR A;  1UI8 A;  1LOX A;  1KQS 2;  1EQK A;  4JF8 A;  4K1V A;  1N9E A;  2RSX A;  3SX1 A;  3X41 A;  2XSH B;  3SXX A;  3IMA B;  3LOY A;  2OOV A;  5BVB A;  2W03 A;  1QJG A;  4R1K A;  3EBT A;  3DMC A;  4N6O B;  2Z6B A;  3PS8 A;  4X2H A;  1N5P A;  1R4C A;  2P0X A;  3EQQ B;  4WYK B;  3GZY B;  2ML5 A;  4HM7 B;  1PFP A;  3V98 A;  2ZDJ A;  1SQW A;  3K5T A;  1EKM A;  1N8Q A;  2BHM A;  3LH4 A;  4HM8 B;  1LVN A;  3EX9 A;  2CFK A;  4R9L A;  2CIU A;  3Q1C A;  3IPT A;  1YVB I;  4AKZ A;  5JPU A;  1AV4 A;  1QVF 2;  3FH1 A;  4FCM A;  4R80 A;  3QK9 A;  4N6N B;  1JRQ A;  4HM0 B;  1LXE A;  2KRT A;  2P0M A;  4STD A;  3KFQ C;  5CF2 A;  3FF0 A;  1K9M 4;  1FGM A;  1OGX A;  2BMR B;  2V1L A;  1TIJ A;  1UW1 A;  1OHO A;  2GBX B;  1Q86 4;  1IQ8 A;  3O8Y A;  5KP3 A;  1QVG 2;  3CME 3;  3V99 A;  1IV9 A;  2WGO A;  4J9A A;  2W56 A;  3CCE 3;  3FG3 A;  3UB1 A;  2LQV A;  1RKY A;  1OHS A;  4K1U A;  5AEW B;  1WMO A;  2UX0 A;  1WTH A;  4AEQ A;  3AMO A;  3WMD A;  3CCU 3;  3JUP A;  1FGQ A;  3NV0 A;  4CCV A;  2K0M A;  4XDW A;  2XGL A;  1W6Y A;  1K41 A;  3DGO A;  1JB4 A;  3HX8 A;  2CW9 A;  5FW5 A;  3FGY A;  2OWP A;  3Q2P A;  3QRD A;  1O7N B;  3BB9 A;  3LT8 A;  1QAL A;  2B24 B;  1FGT A;  4FMA A;  2OTL 3;  1VQ5 3;  2HMN B;  1SPU A;  3S27 A;  1JJ2 2;  1US1 A;  2A15 A;  4EXR A;  4ZM8 A;  3CCJ 3;  1DVC A;  3B8L A;  3DXO A;  4NRE A;  5IEP A;  4JRF A;  3X42 A;  4HM5 B;  3FF2 A;  1W7C A;  1YJ9 3;  5CXO A;  1NJI 4;  1IU7 A;  1YGE A;  3CCV 3;  1VQ7 3;  3K9M C;  4HZ9 B;  1SIH A;  3WOE B;  1UI7 A;  3S29 A;  3BNB A;  2GEY A;  5IG4 A;  3LZA A;  3X40 A;  4J8T A;  5TGN A;  1CYU A;  1DYU A;  3JVC A;  3EN1 B;  1CEW I;  1W2Z A;  4HM4 B;  4R9K A;  6STD A;  1A67 A;  3F9S A;  4EYC A;  2IUK A;  3DUK A;  1ZO2 A;  1S5A A;  3PZW A;  2KCD A;  1HKX A;  3VSY A;  4FMD A;  3ER7 A;  3HIG A;  2B1X B;  1O7P B;  5KP1 A;  4WYK A;  2GU1 A;  3IJE B;  1IVW A;  4KFD A;  4MMX B;  2D42 A;  2WOH A;  1OF5 A;  1JN5 B;  2Z77 A;  3BNE A;  5BXQ A;  3DGN A;  1VQ6 3;  1TFO A;  3G6E 3;  4HVN A;  5STD A;  3U97 A;  5CLK A;  1JV2 B;  3G8Z A;  3UJM A;  1O7M B;  1FA3 A;  1Q40 B;  3FCS B;  3G71 3;  3V92 A;  2JDI H;  1A90 A;  4XBX A;  5HGR A;  5JPP A;  5KP4 A;  1GD3 A;  1AVL A;  1VQ4 3;  1G96 A;  2HMM B;  4OK0 A;  1IVX A;  3OWY A;  1OGZ A;  4GL6 A;  1WNH A;  3X3Z A;  3PCR A;  4FR9 A;  2E2U A;  3OXA A;  4L8O A;  3B4P A;  2INX A;  1WMP A;  2RFR A;  3E99 A;  4IT7 A;  1TU5 A;  1K8A 4;  4KFE A;  3MG2 A;  1OH0 A;  1U5O A;  2QA4 3;  2FNQ A;  2CFW A;  2W04 A;  2CFL A;  5I97 A;  2CWT A;  2MC8 A;  2P38 A;  2GBW B;  3NM7 A;  1IVU A;  3JUM A;  3GZR A;  1VQP 3;  3B7C A;  2O3O A;  4XBT A;  4EV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...