5IERA

Structure of a computationally designed 17-ohp binder
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
131
Chain Sequence
QSPALIASQSLWRCTQAHDREGWLALMADDVVIETPIGKSVTNPDGSGIKGKEAVGAFFDTHIAATRLTVTCEETFPSSSPDEIAHILVAHSEFDGGFTSEVRGVFTYRVNKAGLITNLRGYWNLDMMTFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sampling and energy evaluation challenges in ligand binding protein design.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords OHP9
total genus 34
structure length 131
sequence length 131
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ierA00
2XRXB 4OVMA 2IMJA 5AEWB 1VZZA 3EQQB 2HMNB 3EC9A 3KKGA 3HX8A 3DUKA 5CF1A 5IG3A 3BB9A 1O7GB 3GZRA 4X2HA 4IIAA 4HM1B 4XDVA 1OGZA 2INXA 5EVHA 4STDA 3NV0A 3F8HA 4WYKA 1O7HB 1ZO2A 3H3HA 2GBWB 4GB5A 5DREA 6STDA 1OHSA 3B4PA 3OV4A 4HM3B 1OH0A 2HMKB 2CKFB 2OWPA 4FCMA 4H3UA 1JB5A 5IERA 5IENA 1QMAA 2Z76A 4FCJA 3ER7A 4HZ9B 1ISKA 1OGXA 2GXFA 8CHOA 4CDLA 3KZTA 1U5OA 5HGRA 1EA2A 3EJVA 2YFIB 3G16A 3F8XA 3MHEA 3SOYA 1E97A 2PZVA 3ECFA 4R9KA 5STDA 4N3VA 1TUHA 4I4KA 1W6YA 1GY7A 1OF5A 1QJGA 4HJLB 3GZXB 3E99A 3K7CA 1DMNA 3MG3A 4L8PA 1O7WB 4XDWA 1JKGA 3HK4A 3GWRA 4XBTA 1ULIB 2Z77A 3F40A 3KE7A 3FZWA 3KSPA 3M8CA 3NXJA 4R1KA 1SJWA 4WWUC 2B1XB 4XM4A 4MJDA 3DM8A 3EBYA 2I9WA 3FGYA 2CHCA 2XSHB 3B7CA 2F98A 1JB2A 5KP4A 3F14A 3FLJA 3MKIA 3JUNA 5CF2A 1AR0A 3CPOA 4WYKB 5D82A 5IG0A 1C7HA 3NBRA 1NU3A 4K1VA 1DMQA 2QGUA 5IEPA 1W00A 1HKXA 4WP5A 2B24B 4LEHA 3SEDA 3MG2A 5AIIA 3F7XA 3FH1A 5G2GA 3S5CA 1CQSA 3DMCA 3CU3A 5AEUB 5JPPA 3T8NA 1JN5B 4R9LA 3K0ZA 3SOAA 2K54A 2BMOB 3H51A 4L7KA 4Q53A 3D9RA 1ASKA 1EG9B 1GS3A 1O7PB 2A15A 2XR8B 2Z7AA 4HVNA 5TGNA 3OX9A 3B8LA 1JN5A 3I0YA 3OXAA 4HM7B 3RGAA 4L8OA 3VSYA 1NWWA 2XSOB 5BXQA 4PEJA 3EN8A 2STDA 3GZBA 3B4OA 5AI1A 2UX0A 1OF5B 4HZBB 1GY5A 3NHXA 3GZYB 4XBXA 5DRVA 1A2KA 3BLZA 2BMRB 5IF6A 5KP1A 3CNXA 5D83A 4HM0B 3IPTA 4K1UA 1O7NB 1OHOA 2RGQA 3MG1A 2HMJB 5FW5A 1UUWB 1JKGB 3EN1B 3EX9A 3NM2A 3T8UA 2YFLB 3CNMA 3FF2A 2F99A 1OHPA 1GYBA 1ZX2A 2RFRA 2W2CA 1Z1SA 3EF8A 1ULJB 1O7MB 1W02A 2BMQB 3G0KA 4KVHA 4XB5A 5JPUA 5CK6A 3FF0A 3OWSA 3F7SA 3MYTA 1TP6A 1IDPA 4U13A 5CXOA 1UUVB 3G8ZA 4LMIA 5BVBA 3DXOA 2BNGA 5AIHA 1STDA 2QIYA 3FKAA 3GRDA 3NUVA 1BUQA 5CLKA 5IG4A 3LYGA 5IG5A 3UNLA 1WQLB 4ORLA 2R4IA 3EBTA 2GBXB 3JUPA 4HM4B 1E3RA 5D81A 3DZLA 5KP3A 3ROBA 5AIFA 3OWUA 4RZMA 1NDOB 1OCVA 1S5AA 3EHCA 4J9AA 3STDA 3MSOA 3RGRA 1OUNA 1K41A 1Q40B 3F9SA 3JUQA 3JUMA 3OWYA 4HM5B 3A76A 3Q90A 2GEYA 2HMLB 4OUQA 5AIGA 3VGNA 2GEXA 4XBYA 1W01A 2HMMB 3FSDA 3JUOA 3UJMA 2F86B 4J8TA 3WMDA 7STDA 2YFJB 5IEOA 1OPYA 1Q40A 2JQ5A 3HZPA 3LZAA 1Q42A 3NV0B 4HM6B 4X2OA 4HM2B 1JB4A 4HKVB 2RCDA 2HMOB 4HM8B 4LGQA 1GY6A 1DMMA 1E3VA
chains in the Genus database with same CATH superfamily
1VQK3 2XRXB 1OACA 1RLSA 1KWIA 1RMSA 2O9UX 4G1MB 4OVMA 4BTYA 3EQQB 1T3BA 5CF1A 3BB9A 4KZ1A 1A67A 1MNLA 1RGEA 1SIHA 1I2EA 1RNTA 1IQYA 1O7HB 2F5MA 2WOHA 4GB5A 1LQMB 1YJN3 1BNFA 3OV4A 3UL5A 5A0OB 2CKFB 2OWPA 1IU7A 3LTBA 1I70A 1QMAA 3TDGA 3CCL3 1IQ8A 1Q7Y4 1WMPA 1A90A 3KZTA 1JRQA 1YVBI 3A5EA 3EJVA 1IVVA 4LSOA 3G16A 1HZ1A 3MHEA 3ECFA 4RNTA 2QEX3 3DH2A 1I0VA 1F8NA 1KSIA 2CFKA 4O2HA 1RHLA 1TRPA 1W6YA 2WGOA 1GY7A 1IVXA 2OQEC 3LOYA 3NM7A 3KFQC 1US1A 3K7CA 1BRIA 4L8PA 3SX1A 1JKGA 4XBTA 3VF1A 2W6JH 2Z77A 2XF3A 3KE7A 3KSPA 3NXJA 1VQ43 7RNTA 1SJWA 3LXUX 2YX9A 2I9WA 2KRTA 1LVNA 2W04A 3LH4A 1PYLA 1JB2A 2IY2A 1LQGC 3MKIA 3WA2X 5KP4A 1BOXA 3JUNA 4AEQA 5IG0A 2CFLA 2LYXA 1RN1A 3NBRA 1NU3A 4EXRA 2QGUA 1MWTA 2L1SA 1HKXA 1BRKA 2B24B 4LEHA 1D6ZA 1X1WA 3ALAA 1G96A 3SYUA 1WMNA 1UI7A 3FCSB 2V1LA 4R9LA 3K0ZA 3X40A 2K54A 2BMOB 4Q53A 3G4S3 3QRDA 2SARA 4LZIA 1GS3A 1MWRA 2A15A 2XR8B 4HVNA 5AEWB 5HOHA 2WOFA 3V98A 2MF7A 1D6YA 2D1WA 1SIIA 2GSPA 3VSYA 1NWWA 3X42A 1EQKA 1Y4KA 4BTWA 1RGAA 3LTDA 2CG1A 2W0QA 3GZYB 3WODG 1KC84 1VQ53 1LOYA 2W03A 1MOLA 3CNXA 4HM0B 4QWTA 1WTHA 1B27A 1D6UA 1O7NB 1TIJA 3BNDA 4K1UA 4EV2A 1X1UA 1UUWB 2ML6A 5ELJA 1TRQA 3NM2A 3T8UA 5IF6A 1OHPA 1GYBA 1VQL3 1BRSA 4XB5A 1O7MB 2Y74A 1NB3I 1T2IA 1I3FA 1RNBA 1TP6A 1UUVB 3G8ZA 4HBRA 1STDA 1YIJ3 5CLKA 1YGWA 2M7OA 4HM4B 1KQS2 3JUPA 1M1K4 4BTXA 4R80A 3Q1CA 2IYJA 1TFKA 3S29A 3ZG5A 3EHCA 3STDA 2QA43 1Q40B 1G02A 3F9SA 3DY5A 2OCTA 4MEIA 3A76A 3RNTA 2HMLB 4OUQA 1JNQA 3U97A 1A2VA 3PYJA 3FSDA 3JUOA 2F86B 4J8TA 4O3VA 1JZOA 1GOYA 1Q40A 1BRGA 1GMRA 4HM6B 3NV0B 1Q9EA 3SLUA 3ZG0A 1I0XA 2HMOB 1SPUA 3BLZA 4U13A 1LNHA 5LC7A 1RTUA 1S723 1RSNA 2CWVA 2IMJA 1BNJA 2JDIH 1B21A 1CH0A 3HX8A 1K28A 3N8BA 5IG3A 5G1LA 3V92A 4HM1B 1W2ZA 2E2TA 3S67A 1ZO2A 1U8CB 1HU9A 3H3HA 4HM3B 1OH0A 1ZS7A 4H3UA 3D3LA 1JB5A 4CCVA 5AYSC 3DGOA 2ML5A 3BNBA 2C10A 3ER7A 4HZ9B 1ROVA 4CDLA 3MPHA 1U5OA 4FMCA 1B2UA 2YFIB 3F8XA 4MMZB 1E97A 3AHSA 3FG1A 4K90B 1N5HA 2RSXA 2AAEA 3CXC2 1IV9A 1QJGA 3DGNA 3GZXB 3X3YA 1QAKA 1GOVA 3HI7A 3PXMA 1Q864 3GWRA 1ULIB 3N9HA 3M8CA 1I2FA 1AV4A 4R1KA 1G0TA 4HAAA 8RNTA 2OTJ3 4MJDA 1BSAA 3DM8A 2D42A 3B7CA 1AVLA 5M1AA 4FMAA 4NHFA 2UUGC 3Q2PA 3AMOB 2R41A 1EEJA 2KXGA 3CPOA 5D82A 3CCR3 1C7HA 2CFDA 3RDEA 5IEPA 1W00A 4WP5A 1YVSA 2BIRA 2W56A 2P05A 3MG2A 3FH1A 5G2GA 1CQSA 1BNGA 3L0RA 4NPBA 4J5GA 3T8NA 1BIRA 1TFOA 2F5WA 1BRJA 3H51A 1ASKA 3DGMA 1B2SA 2RNTA 2Z7AA 1LRAA 3OX9A 1BRHA 3OXAA 1UCLA 3JVCA 1JBRA 3RGAA 2XSOB 4N6UA 5JBSA 3EN8A 3T0UA 2STDA 3GZBA 3B4OA 1GD3A 2P0MA 5IW9A 3CCU3 1UCIA 5D83A 1NB5I 1ZGXA 5BU4A 1RGGA 7GSPA 1OHOA 1YNVX 1Q7HA 2RGQA 1Q824 1EKMA 2SBLA 3CNMA 4N6TA 2K3DA 2RFRA 3WMDA 1ZX2A 2P09A 3EF8A 1Z1SA 2FNQA 1W02A 1VQ83 4KVHA 5JPUA 1JJ22 1DE3A 2E2VA 4J5KA 5CK6A 3K63A 3AGNA 3F7SA 1RRHA 3MYTA 3WOFB 1I3IA 1VQM3 2J8XB 4KFFA 4AKZA 2BNGA 3IJEB 3CCJ3 3FKAA 3GRDA 2CH9A 5IG5A 1IQXA 2GBXB 3HIIA 1E3RA 2IA7A 4JF8A 3ROBA 3CC73 4RZMA 3PCSA 5I97A 2C4BA 1GMQA 1OUNA 1K41A 3JUQA 3JUMA 1BNSA 1BUJA 2KF6A 1BU4A 3NBJA 1N8QA 1VQ73 4XBYA 1K8A4 3BNEA 4ILFA 3UJMA 1AY7A 1YGEA 3V99A 1OPYA 3HZPA 1BVIA 2JQ5A 3LZAA 1Q42A 1N8R4 4HKVB 2RCDA 4I4KA 3AGOA 3LTAA 1BANA 4MMYB 1MWUA 1BNEA 3CME3 1QVF2 1GOUA 1VZZA 2HMNB 3CD63 1O7GB 4X2HA 3AHWA 1CYVA 1FUSA 1QAFA 1YI23 3NV0A 1UI8A 3F8HA 1VQN3 1OHSA 5IERA 1BNIA 3J7Yd 3BU4A 5EQLA 4FCJA 2GXFA 2XGNA 3K5TA 1X1YA 1IT8A 5HGRA 1IK3A 1YJ93 1BGSA 5ELUA 1DVCA 1W6GA 3KCHA 3SOYA 2AADA 2PZVA 4R9KA 1JBTA 1RCKA 1W7CA 2CWUA 1SARA 1FGRA 2BO9B 1V74A 2OQEA 2H0IA 1FGOA 1W5ZA 4O8SA 1K9M4 4BL3A 3CCE3 1ROAA 1DMNA 2Z6BA 6GSPA 2KF5A 3MG3A 2XEPA 1GMPA 1O7WB 4XDWA 1R4YA 1YHQ3 3DGLA 3Q3FA 1K734 3HK4A 1LXEA 1IV7A 1PY3A 2HOHA 3NQYA 1A2PA 1UGHI 2B1XB 4N6V0 2KAAA 2W56B 4RBNA 1FUWA 3EBYA 2F4YA 3PGBA 4TX4A 2CHCA 4KFEA 2KCDA 2XSHB 2F98A 2OOVA 3F14A 3FLJA 3LMLA 4FMDA 4KFDA 3CC23 4WYKB 5M19A 1RJOA 2Q07A 1DMQA 1B3SA 1MWSA 4CJNA 3I553 5AIIA 1FGTA 3PZWA 3KIIA 5AEUB 4CPKA 1FA3A 5JPPA 6RNTA 1RN7A 3SOAA 3NX0A 2GU1A 5AYRB 2IUJA 2CFWA 1O7PB 3D9RA 4IT7A 4WFOA 5LC6A 5TGNA 4EV5A 3WA3A 4DKIA 1BRNL 2WO0A 3AMOA 3I0YA 2PNCA 2ZDJA 4HM7B 3URPA 1BSDA 5G1KA 3I563 4L8OA 4EW5A 4PEJA 2UX0A 1FGMA 2BT3A 1OF5B 4HZBB 1GY5A 1B2XA 5DRVA 1A2KA 4N6NB 1T5YA 2BMRB 3KSED 1W4NA 3UB1A 1BSBA 3WDGB 5KP1A 1M904 2E2UA 1GD4A 4N6OB 1FUTA 3LT8A 2HMJB 1B20A 3EX9A 1JKGB 3EN1B 3FG4A 1YJW3 3FF2A 7STDA 2F99A 2W2CA 4STDA 3G713 1SQWA 2KF4A 1ULJB 2BMQB 3G0KA 2L4VA 2XFSA 1RRLA 4FMBA 4BL2A 2BHMA 2H0GA 1IDPA 4RNYA 5CXOA 1RN4A 3D4AA 4EYCA 1DETA 4LMIA 5EEOA 5BVBA 1KD14 1AVKA 1FGQA 2QIYA 3NUVA 5FGOA 4ZM8A 2XFTA 1M9GA 1LOXA 5IG4A 1VQQA 3UNLA 4FR9A 3N54B 2R4IA 3EBTA 5D81A 1Q814 1V57A 1IVWA 3IMAB 1VQ93 1NDOB 1J2BA 1S5AA 3LT9A 4J9AA 4RNZA 5BIRA 8CHOA 3LTCA 3KN4A 1W6CA 3DGYA 3NBBA 4HM5B 2CK3H 2GEYA 1EUIC 2GEXA 1V58A 1WMOA 1MGRA 2W9QA 3S28A 2YFJB 3BIRA 2CX1A 2K0MA 5AIGA 5FW5A 1DMMA 2CG0A 4X2OA 4HM2B 4HM8B 4BIRA 2C11A 1GY6A 1E3VA 2XGLA 1TU5A 1CYUA 1RDSA 1BNRA 1BSEA 3ZFZA 1DVDA 1TJDA 3CPW2 3EC9A 1STFI 3KKGA 3DUKA 3GZRA 4IIAA 1UCKA 4XDVA 1OGZA 2CC3A 2INXA 5EVHA 5DREA 4WYKA 6STDA 2GBWB 3X3XA 3B4PA 1VQP3 5IENA 2HMKB 4FCMA 1JBSA 1VQO3 2Z76A 1HYFA 4MMXB 3CCQ3 2ZL8A 1UGIA 1ISKA 1FYSA 1OGXA 3FG3A 1RGKA 4AKYA 1NO3A 2RBIA 2LQVA 1EA2A 1WNHA 4OK0A 3CC43 5STDA 3O8YA 1RGCA 1B2ZA 3D5IA 4N3VA 1TUHA 4I5QA 2P0XA 1LNIA 2XH9A 1I2GA 2OTL3 1OF5A 1BSCA 2FGTA 1RCLA 1N9JA 2KF3A 2P38A 3EE1A 4HJLB 3E99A 4NREA 2CW9A 1C54A 1IYYA 1B2MA 3UL6A 1RGHA 2WGQA 2Y73A 3WOEB 1AQZA 3F40A 3SEDA 3CCM3 1YIT3 3FZWA 2IUKA 4IPBA 4WWUC 2O3OA 1VQ63 4XM4A 3SXXA 5M18A 1W2B2 3FGYA 2CWTA 4GSPA 3PS8A 1M1XB 1CEWI 1RGFA 3GAXA 2OOVC 3D79A 1IT7A 4BU4A 3HOHA 5CF2A 1AR0A 1RGLA 4H61A 4N6MA 4K1VA 3CCS3 1NJI4 5GSPA 3F7XA 3HIGA 2CX0A 3X41A 3G6E3 3S5CA 1R4CA 1FW7A 3DMCA 1JZDA 3CU3A 3D5GA 1QVG2 1JN5B 1MGWA 3NQZA 4L7KA 1EG9B 3CMA3 3B8LA 1JN5A 1PU4A 4EBGA 1RKYA 1FZUA 2F56A 5BXQA 3OW22 1PFPA 2FXTA 3MWZA 2GU3A 5AI1A 1TTOA 1UCJA 4LYLB 3NHXA 4XBXA 3WHOA 4EC6A 2W9PA 3IPTA 1JV2B 3WR2A 3MG1A 3QK9A 1UW1A 1DYUA 2YFLB 3CCV3 1GSPA 3BNCA 4K61A 1X1XA 4GHOA 4HYZA 3FF0A 3OWSA 2BU4A 4R4KA 1I8VA 1IVUA 3DXOA 5AIHA 1BUQA 1BAOA 4O02B 4N6LA 1LOVA 3U1WA 4KT3B 2MC8A 3LYGA 1WQLB 4ORLA 9RNTA 3DZLA 5KP3A 5AIFA 3OWUA 2ZA4A 3X3ZA 1OCVA 3K9MC 1UDII 3MSOA 3RGRA 1L5GB 3OWYA 4HOHA 3Q90A 4GL6A 3VGNA 3SVAA 2UGIA 3EB8A 1W01A 2HMMB 4WHAA 3PCRA 3S27A 2CIUA 1T2HA 2CFGA 1LOWA 5IEOA 1QALA 1N9EA 1UUGB 2ZHXB 3GSPA 4FCZA 4JRFA 5RNTA 1JB4A 1NNVA 4LGQA 2H0HA 1N5PA
chains in the Genus database with same CATH topology
1VQK3 2XRXB 1OACA 2O9UX 1KWIA 4G1MB 4OVMA 4BTYA 3EQQB 5CF1A 3BB9A 4KZ1A 1A67A 1MNLA 1SIHA 1IQYA 1O7HB 4GB5A 2WOHA 1N5PA 1YJN3 3OV4A 3UL5A 5A0OB 2CKFB 2OWPA 1IU7A 3LTBA 1QMAA 3TDGA 3CCL3 1IQ8A 1Q7Y4 1WMPA 1A90A 3KZTA 1JRQA 1YVBI 3EJVA 1IVVA 4LSOA 3G16A 3MHEA 3ECFA 2QEX3 1F8NA 1KSIA 2CFKA 4O2HA 1W6YA 2WGOA 1GY7A 1IVXA 2OQEC 3LOYA 3NM7A 3KFQC 1US1A 3K7CA 4L8PA 3SX1A 1JKGA 4XBTA 3VF1A 2W6JH 2Z77A 2XF3A 3KE7A 3KSPA 3NXJA 1VQ43 1SJWA 3LXUX 2YX9A 2I9WA 2KRTA 2W04A 1LVNA 3LH4A 3WA2X 1JB2A 5KP4A 3MKIA 3JUNA 4AEQA 5IG0A 2CFLA 2LYXA 3NBRA 4EXRA 1NU3A 2QGUA 1HKXA 2B24B 4LEHA 1D6ZA 3ALAA 1G96A 1WMNA 1UI7A 3FCSB 2V1LA 4R9LA 3K0ZA 3X40A 2K54A 2BMOB 4Q53A 3G4S3 3QRDA 4LZIA 5AEWB 1GS3A 2A15A 2XR8B 4HVNA 2WOFA 3V98A 2MF7A 1D6YA 2D1WA 1SIIA 3VSYA 1NWWA 3X42A 1EQKA 1Y4KA 4BTWA 3LTDA 2CG1A 2W0QA 3GZYB 3WODG 1KC84 1VQ53 2W03A 1MOLA 3CNXA 4HM0B 4QWTA 1D6UA 1WTHA 4K1UA 1O7NB 1TIJA 3BNDA 5D83A 4EV2A 1UUWB 2ML6A 5ELJA 3NM2A 3T8UA 5IF6A 1OHPA 1GYBA 1VQL3 4XB5A 1O7MB 2Y74A 1NB3I 1TP6A 1UUVB 3G8ZA 4HBRA 1STDA 1YIJ3 5CLKA 2M7OA 4HM4B 1KQS2 3JUPA 1M1K4 4BTXA 4R80A 3Q1CA 1TFKA 3S29A 3EHCA 3STDA 2QA43 1Q40B 3F9SA 3DY5A 2OCTA 4MEIA 3A76A 2HMLB 4OUQA 1JNQA 3U97A 1A2VA 3PYJA 3FSDA 3JUOA 2F86B 4J8TA 4O3VA 1Q40A 4HM6B 3NV0B 3SLUA 2HMOB 1SPUA 3BLZA 4U13A 1LNHA 5LC7A 1S723 2CWVA 2IMJA 2JDIH 3N8BA 5IG3A 3HX8A 1K28A 3V92A 4HM1B 1W2ZA 2E2TA 3S67A 1ZO2A 1U8CB 1HU9A 3H3HA 4HM3B 1OH0A 4H3UA 3D3LA 1JB5A 4CCVA 5AYSC 3DGOA 2ML5A 3BNBA 2C10A 3ER7A 4HZ9B 1ROVA 4CDLA 3MPHA 1U5OA 4FMCA 2YFIB 3F8XA 4MMZB 1E97A 3FG1A 4K90B 1N5HA 2RSXA 3CXC2 1IV9A 1QJGA 3DGNA 3GZXB 3X3YA 1QAKA 3HI7A 3PXMA 1Q864 3GWRA 1ULIB 3N9HA 3M8CA 1AV4A 4R1KA 2OTJ3 4MJDA 3DM8A 2D42A 3B7CA 1AVLA 4FMAA 4NHFA 3Q2PA 3AMOB 2KXGA 3CPOA 5D82A 3CCR3 1C7HA 2CFDA 3RDEA 5IEPA 1W00A 4WP5A 2W56A 2P05A 3MG2A 3FH1A 5G2GA 1CQSA 3L0RA 3T8NA 1TFOA 3H51A 1ASKA 3DGMA 2Z7AA 3OX9A 3OXAA 3JVCA 3RGAA 2XSOB 4N6UA 5JBSA 3EN8A 3T0UA 2STDA 3GZBA 3B4OA 1GD3A 2P0MA 5IW9A 3CCU3 1NB5I 1Q824 1OHOA 2RGQA 1EKMA 2SBLA 3CNMA 4N6TA 2RFRA 1W2B2 3WMDA 1ZX2A 2P09A 3EF8A 1Z1SA 2FNQA 1W02A 1VQ83 4KVHA 5JPUA 1JJ22 2E2VA 5CK6A 3K63A 3F7SA 1RRHA 3MYTA 3WOFB 1VQM3 4KFFA 4AKZA 2BNGA 3IJEB 3CCJ3 3FKAA 3GRDA 2CH9A 5IG5A 1IQXA 2GBXB 3HIIA 1E3RA 2IA7A 4JF8A 3ROBA 3CC73 4RZMA 3PCSA 5I97A 1OUNA 1K41A 3JUQA 3JUMA 3NBJA 1N8QA 1VQ73 4XBYA 1K8A4 3BNEA 3UJMA 1YGEA 3V99A 1OPYA 3HZPA 2JQ5A 3LZAA 1Q42A 1N8R4 4HKVB 2RCDA 4I4KA 3LTAA 4MMYB 3CME3 1QVF2 1VZZA 2HMNB 3CD63 1O7GB 4X2HA 1CYVA 1QAFA 1YI23 3NV0A 1UI8A 3F8HA 1VQN3 1OHSA 5IERA 3J7Yd 5EQLA 4FCJA 2GXFA 2XGNA 3K5TA 1IK3A 1IT8A 5HGRA 1YJ93 5ELUA 1DVCA 1W6GA 3SOYA 2PZVA 4R9KA 1W7CA 2CWUA 1FGRA 2BO9B 1V74A 2OQEA 1FGOA 1W5ZA 4O8SA 1K9M4 3CCE3 1ROAA 1DMNA 2Z6BA 3MG3A 2XEPA 1YHQ3 1O7WB 4XDWA 1K734 3DGLA 3HK4A 1LXEA 1IV7A 3NQYA 4N6V0 2B1XB 2W56B 4RBNA 1FUWA 3EBYA 3PGBA 4TX4A 2CHCA 4KFEA 2XSHB 2KCDA 2F98A 2OOVA 3F14A 3FLJA 3LMLA 4FMDA 4KFDA 3CC23 4WYKB 1RJOA 2Q07A 1DMQA 3I553 5AIIA 1FGTA 3PZWA 3KIIA 5AEUB 1FA3A 5JPPA 1RN7A 3SOAA 3NX0A 2GU1A 5AYRB 2IUJA 3D9RA 1O7PB 2CFWA 4IT7A 4WFOA 5LC6A 5TGNA 4EV5A 3WA3A 2WO0A 3AMOA 3I0YA 2PNCA 2ZDJA 4HM7B 3I563 4L8OA 4PEJA 2UX0A 1FGMA 2BT3A 1OF5B 4HZBB 1GY5A 5DRVA 1A2KA 4N6NB 1T5YA 2BMRB 3KSED 1W4NA 3UB1A 3WDGB 5KP1A 1M904 2E2UA 1GD4A 4N6OB 3LT8A 2HMJB 3EX9A 1JKGB 3EN1B 3FG4A 1YJW3 3FF2A 7STDA 2F99A 2W2CA 4STDA 3G713 1SQWA 1ULJB 2BMQB 3G0KA 2L4VA 2XFSA 1RRLA 4FMBA 2BHMA 1IDPA 4RNYA 5CXOA 4EYCA 4LMIA 5EEOA 5BVBA 1KD14 1AVKA 1FGQA 2QIYA 3NUVA 5FGOA 4ZM8A 2XFTA 1M9GA 1LOXA 5IG4A 3UNLA 4FR9A 3N54B 2R4IA 3EBTA 5D81A 1Q814 1IVWA 3IMAB 1VQ93 1NDOB 1J2BA 1S5AA 3LT9A 4J9AA 4RNZA 8CHOA 3LTCA 3KN4A 1W6CA 4HM5B 3NBBA 2CK3H 2GEYA 2GEXA 1WMOA 2W9QA 3S28A 2YFJB 2K0MA 5AIGA 5FW5A 2CG0A 4X2OA 4HM2B 4HM8B 2C11A 1GY6A 1E3VA 2XGLA 1TU5A 1CYUA 1DVDA 3CPW2 3EC9A 1STFI 3KKGA 3DUKA 3GZRA 4IIAA 4XDVA 1OGZA 2CC3A 2INXA 5EVHA 5DREA 4WYKA 6STDA 2GBWB 3X3XA 3B4PA 1VQP3 5IENA 2HMKB 4FCMA 1VQO3 2Z76A 4MMXB 3CCQ3 2ZL8A 1ISKA 1OGXA 3FG3A 4AKYA 1NO3A 2LQVA 1EA2A 1WNHA 4OK0A 3CC43 5STDA 3O8YA 4N3VA 1TUHA 2P0XA 2XH9A 2OTL3 1OF5A 2FGTA 2P38A 4HJLB 1N9JA 3EE1A 4NREA 3E99A 2CW9A 3UL6A 2WGQA 2Y73A 3WOEB 3F40A 3SEDA 3CCM3 1YIT3 3FZWA 2IUKA 4IPBA 4WWUC 2O3OA 1VQ63 4XM4A 3SXXA 3FGYA 2CWTA 3PS8A 1M1XB 1CEWI 3GAXA 2OOVC 1IT7A 5CF2A 1AR0A 4H61A 4N6MA 4K1VA 3CCS3 1NJI4 3F7XA 3HIGA 3X41A 3G6E3 3S5CA 1R4CA 3DMCA 3CU3A 1QVG2 1JN5B 3NQZA 4L7KA 1EG9B 3CMA3 3B8LA 1JN5A 1PU4A 4EBGA 1RKYA 5BXQA 3OW22 1PFPA 2FXTA 3MWZA 2GU3A 5AI1A 3NHXA 4XBXA 4EC6A 2W9PA 3IPTA 1JV2B 3MG1A 3QK9A 1UW1A 1DYUA 2YFLB 3CCV3 4K61A 3BNCA 4HYZA 3FF0A 3OWSA 4R4KA 1IVUA 3DXOA 5AIHA 1BUQA 4O02B 4N6LA 3U1WA 2MC8A 3LYGA 1WQLB 4ORLA 3DZLA 5KP3A 5AIFA 3OWUA 3X3ZA 1OCVA 3K9MC 3MSOA 3RGRA 1L5GB 3OWYA 3Q90A 4GL6A 3VGNA 3SVAA 3EB8A 1W01A 2HMMB 4WHAA 3PCRA 3S27A 2CIUA 2CFGA 5IEOA 1QALA 1N9EA 4FCZA 4JRFA 1JB4A 4LGQA 1DMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRX B;  4OVM A;  2IMJ A;  5AEW B;  1VZZ A;  3EQQ B;  2HMN B;  3EC9 A;  3KKG A;  3HX8 A;  3DUK A;  5CF1 A;  5IG3 A;  3BB9 A;  1O7G B;  3GZR A;  4X2H A;  4IIA A;  4HM1 B;  4XDV A;  1OGZ A;  2INX A;  5EVH A;  4STD A;  3NV0 A;  3F8H A;  4WYK A;  1O7H B;  1ZO2 A;  3H3H A;  2GBW B;  4GB5 A;  5DRE A;  6STD A;  1OHS A;  3B4P A;  3OV4 A;  4HM3 B;  1OH0 A;  2HMK B;  2CKF B;  2OWP A;  4FCM A;  4H3U A;  1JB5 A;  5IER A;  5IEN A;  1QMA A;  2Z76 A;  4FCJ A;  3ER7 A;  4HZ9 B;  1ISK A;  1OGX A;  2GXF A;  8CHO A;  4CDL A;  3KZT A;  1U5O A;  5HGR A;  1EA2 A;  3EJV A;  2YFI B;  3G16 A;  3F8X A;  3MHE A;  3SOY A;  1E97 A;  2PZV A;  3ECF A;  4R9K A;  5STD A;  4N3V A;  1TUH A;  4I4K A;  1W6Y A;  1GY7 A;  1OF5 A;  1QJG A;  4HJL B;  3GZX B;  3E99 A;  3K7C A;  1DMN A;  3MG3 A;  4L8P A;  1O7W B;  4XDW A;  1JKG A;  3HK4 A;  3GWR A;  4XBT A;  1ULI B;  2Z77 A;  3F40 A;  3KE7 A;  3FZW A;  3KSP A;  3M8C A;  3NXJ A;  4R1K A;  1SJW A;  4WWU C;  2B1X B;  4XM4 A;  4MJD A;  3DM8 A;  3EBY A;  2I9W A;  3FGY A;  2CHC A;  2XSH B;  3B7C A;  2F98 A;  1JB2 A;  5KP4 A;  3F14 A;  3FLJ A;  3MKI A;  3JUN A;  5CF2 A;  1AR0 A;  3CPO A;  4WYK B;  5D82 A;  5IG0 A;  1C7H A;  3NBR A;  1NU3 A;  4K1V A;  1DMQ A;  2QGU A;  5IEP A;  1W00 A;  1HKX A;  4WP5 A;  2B24 B;  4LEH A;  3SED A;  3MG2 A;  5AII A;  3F7X A;  3FH1 A;  5G2G A;  3S5C A;  1CQS A;  3DMC A;  3CU3 A;  5AEU B;  5JPP A;  3T8N A;  1JN5 B;  4R9L A;  3K0Z A;  3SOA A;  2K54 A;  2BMO B;  3H51 A;  4L7K A;  4Q53 A;  3D9R A;  1ASK A;  1EG9 B;  1GS3 A;  1O7P B;  2A15 A;  2XR8 B;  2Z7A A;  4HVN A;  5TGN A;  3OX9 A;  3B8L A;  1JN5 A;  3I0Y A;  3OXA A;  4HM7 B;  3RGA A;  4L8O A;  3VSY A;  1NWW A;  2XSO B;  5BXQ A;  4PEJ A;  3EN8 A;  2STD A;  3GZB A;  3B4O A;  5AI1 A;  2UX0 A;  1OF5 B;  4HZB B;  1GY5 A;  3NHX A;  3GZY B;  4XBX A;  5DRV A;  1A2K A;  3BLZ A;  2BMR B;  5IF6 A;  5KP1 A;  3CNX A;  5D83 A;  4HM0 B;  3IPT A;  4K1U A;  1O7N B;  1OHO A;  2RGQ A;  3MG1 A;  2HMJ B;  5FW5 A;  1UUW B;  1JKG B;  3EN1 B;  3EX9 A;  3NM2 A;  3T8U A;  2YFL B;  3CNM A;  3FF2 A;  2F99 A;  1OHP A;  1GYB A;  1ZX2 A;  2RFR A;  2W2C A;  1Z1S A;  3EF8 A;  1ULJ B;  1O7M B;  1W02 A;  2BMQ B;  3G0K A;  4KVH A;  4XB5 A;  5JPU A;  5CK6 A;  3FF0 A;  3OWS A;  3F7S A;  3MYT A;  1TP6 A;  1IDP A;  4U13 A;  5CXO A;  1UUV B;  3G8Z A;  4LMI A;  5BVB A;  3DXO A;  2BNG A;  5AIH A;  1STD A;  2QIY A;  3FKA A;  3GRD A;  3NUV A;  1BUQ A;  5CLK A;  5IG4 A;  3LYG A;  5IG5 A;  3UNL A;  1WQL B;  4ORL A;  2R4I A;  3EBT A;  2GBX B;  3JUP A;  4HM4 B;  1E3R A;  5D81 A;  3DZL A;  5KP3 A;  3ROB A;  5AIF A;  3OWU A;  4RZM A;  1NDO B;  1OCV A;  1S5A A;  3EHC A;  4J9A A;  3STD A;  3MSO A;  3RGR A;  1OUN A;  1K41 A;  1Q40 B;  3F9S A;  3JUQ A;  3JUM A;  3OWY A;  4HM5 B;  3A76 A;  3Q90 A;  2GEY A;  2HML B;  4OUQ A;  5AIG A;  3VGN A;  2GEX A;  4XBY A;  1W01 A;  2HMM B;  3FSD A;  3JUO A;  3UJM A;  2F86 B;  4J8T A;  3WMD A;  7STD A;  2YFJ B;  5IEO A;  1OPY A;  1Q40 A;  2JQ5 A;  3HZP A;  3LZA A;  1Q42 A;  3NV0 B;  4HM6 B;  4X2O A;  4HM2 B;  1JB4 A;  4HKV B;  2RCD A;  2HMO B;  4HM8 B;  4LGQ A;  1GY6 A;  1DMM A;  1E3V A; 
#chains in the Genus database with same CATH topology
 1VQK 3;  2XRX B;  1OAC A;  1RLS A;  1KWI A;  1RMS A;  2O9U X;  4G1M B;  4OVM A;  4BTY A;  3EQQ B;  1T3B A;  5CF1 A;  3BB9 A;  4KZ1 A;  1A67 A;  1MNL A;  1RGE A;  1SIH A;  1I2E A;  1RNT A;  1IQY A;  1O7H B;  2F5M A;  2WOH A;  4GB5 A;  1LQM B;  1YJN 3;  1BNF A;  3OV4 A;  3UL5 A;  5A0O B;  2CKF B;  2OWP A;  1IU7 A;  3LTB A;  1I70 A;  1QMA A;  3TDG A;  3CCL 3;  1IQ8 A;  1Q7Y 4;  1WMP A;  1A90 A;  3KZT A;  1JRQ A;  1YVB I;  3A5E A;  3EJV A;  1IVV A;  4LSO A;  3G16 A;  1HZ1 A;  3MHE A;  3ECF A;  4RNT A;  2QEX 3;  3DH2 A;  1I0V A;  1F8N A;  1KSI A;  2CFK A;  4O2H A;  1RHL A;  1TRP A;  1W6Y A;  2WGO A;  1GY7 A;  1IVX A;  2OQE C;  3LOY A;  3NM7 A;  3KFQ C;  1US1 A;  3K7C A;  1BRI A;  4L8P A;  3SX1 A;  1JKG A;  4XBT A;  3VF1 A;  2W6J H;  2Z77 A;  2XF3 A;  3KE7 A;  3KSP A;  3NXJ A;  1VQ4 3;  7RNT A;  1SJW A;  3LXU X;  2YX9 A;  2I9W A;  2KRT A;  1LVN A;  2W04 A;  3LH4 A;  1PYL A;  1JB2 A;  2IY2 A;  1LQG C;  3MKI A;  3WA2 X;  5KP4 A;  1BOX A;  3JUN A;  4AEQ A;  5IG0 A;  2CFL A;  2LYX A;  1RN1 A;  3NBR A;  1NU3 A;  4EXR A;  2QGU A;  1MWT A;  2L1S A;  1HKX A;  1BRK A;  2B24 B;  4LEH A;  1D6Z A;  1X1W A;  3ALA A;  1G96 A;  3SYU A;  1WMN A;  1UI7 A;  3FCS B;  2V1L A;  4R9L A;  3K0Z A;  3X40 A;  2K54 A;  2BMO B;  4Q53 A;  3G4S 3;  3QRD A;  2SAR A;  4LZI A;  1GS3 A;  1MWR A;  2A15 A;  2XR8 B;  4HVN A;  5AEW B;  5HOH A;  2WOF A;  3V98 A;  2MF7 A;  1D6Y A;  2D1W A;  1SII A;  2GSP A;  3VSY A;  1NWW A;  3X42 A;  1EQK A;  1Y4K A;  4BTW A;  1RGA A;  3LTD A;  2CG1 A;  2W0Q A;  3GZY B;  3WOD G;  1KC8 4;  1VQ5 3;  1LOY A;  2W03 A;  1MOL A;  3CNX A;  4HM0 B;  4QWT A;  1WTH A;  1B27 A;  1D6U A;  1O7N B;  1TIJ A;  3BND A;  4K1U A;  4EV2 A;  1X1U A;  1UUW B;  2ML6 A;  5ELJ A;  1TRQ A;  3NM2 A;  3T8U A;  5IF6 A;  1OHP A;  1GYB A;  1VQL 3;  1BRS A;  4XB5 A;  1O7M B;  2Y74 A;  1NB3 I;  1T2I A;  1I3F A;  1RNB A;  1TP6 A;  1UUV B;  3G8Z A;  4HBR A;  1STD A;  1YIJ 3;  5CLK A;  1YGW A;  2M7O A;  4HM4 B;  1KQS 2;  3JUP A;  1M1K 4;  4BTX A;  4R80 A;  3Q1C A;  2IYJ A;  1TFK A;  3S29 A;  3ZG5 A;  3EHC A;  3STD A;  2QA4 3;  1Q40 B;  1G02 A;  3F9S A;  3DY5 A;  2OCT A;  4MEI A;  3A76 A;  3RNT A;  2HML B;  4OUQ A;  1JNQ A;  3U97 A;  1A2V A;  3PYJ A;  3FSD A;  3JUO A;  2F86 B;  4J8T A;  4O3V A;  1JZO A;  1GOY A;  1Q40 A;  1BRG A;  1GMR A;  4HM6 B;  3NV0 B;  1Q9E A;  3SLU A;  3ZG0 A;  1I0X A;  2HMO B;  1SPU A;  3BLZ A;  4U13 A;  1LNH A;  5LC7 A;  1RTU A;  1S72 3;  1RSN A;  2CWV A;  2IMJ A;  1BNJ A;  2JDI H;  1B21 A;  1CH0 A;  3HX8 A;  1K28 A;  3N8B A;  5IG3 A;  5G1L A;  3V92 A;  4HM1 B;  1W2Z A;  2E2T A;  3S67 A;  1ZO2 A;  1U8C B;  1HU9 A;  3H3H A;  4HM3 B;  1OH0 A;  1ZS7 A;  4H3U A;  3D3L A;  1JB5 A;  4CCV A;  5AYS C;  3DGO A;  2ML5 A;  3BNB A;  2C10 A;  3ER7 A;  4HZ9 B;  1ROV A;  4CDL A;  3MPH A;  1U5O A;  4FMC A;  1B2U A;  2YFI B;  3F8X A;  4MMZ B;  1E97 A;  3AHS A;  3FG1 A;  4K90 B;  1N5H A;  2RSX A;  2AAE A;  3CXC 2;  1IV9 A;  1QJG A;  3DGN A;  3GZX B;  3X3Y A;  1QAK A;  1GOV A;  3HI7 A;  3PXM A;  1Q86 4;  3GWR A;  1ULI B;  3N9H A;  3M8C A;  1I2F A;  1AV4 A;  4R1K A;  1G0T A;  4HAA A;  8RNT A;  2OTJ 3;  4MJD A;  1BSA A;  3DM8 A;  2D42 A;  3B7C A;  1AVL A;  5M1A A;  4FMA A;  4NHF A;  2UUG C;  3Q2P A;  3AMO B;  2R41 A;  1EEJ A;  2KXG A;  3CPO A;  5D82 A;  3CCR 3;  1C7H A;  2CFD A;  3RDE A;  5IEP A;  1W00 A;  4WP5 A;  1YVS A;  2BIR A;  2W56 A;  2P05 A;  3MG2 A;  3FH1 A;  5G2G A;  1CQS A;  1BNG A;  3L0R A;  4NPB A;  4J5G A;  3T8N A;  1BIR A;  1TFO A;  2F5W A;  1BRJ A;  3H51 A;  1ASK A;  3DGM A;  1B2S A;  2RNT A;  2Z7A A;  1LRA A;  3OX9 A;  1BRH A;  3OXA A;  1UCL A;  3JVC A;  1JBR A;  3RGA A;  2XSO B;  4N6U A;  5JBS A;  3EN8 A;  3T0U A;  2STD A;  3GZB A;  3B4O A;  1GD3 A;  2P0M A;  5IW9 A;  3CCU 3;  1UCI A;  5D83 A;  1NB5 I;  1ZGX A;  5BU4 A;  1RGG A;  7GSP A;  1OHO A;  1YNV X;  1Q7H A;  2RGQ A;  1Q82 4;  1EKM A;  2SBL A;  3CNM A;  4N6T A;  2K3D A;  2RFR A;  3WMD A;  1ZX2 A;  2P09 A;  3EF8 A;  1Z1S A;  2FNQ A;  1W02 A;  1VQ8 3;  4KVH A;  5JPU A;  1JJ2 2;  1DE3 A;  2E2V A;  4J5K A;  5CK6 A;  3K63 A;  3AGN A;  3F7S A;  1RRH A;  3MYT A;  3WOF B;  1I3I A;  1VQM 3;  2J8X B;  4KFF A;  4AKZ A;  2BNG A;  3IJE B;  3CCJ 3;  3FKA A;  3GRD A;  2CH9 A;  5IG5 A;  1IQX A;  2GBX B;  3HII A;  1E3R A;  2IA7 A;  4JF8 A;  3ROB A;  3CC7 3;  4RZM A;  3PCS A;  5I97 A;  2C4B A;  1GMQ A;  1OUN A;  1K41 A;  3JUQ A;  3JUM A;  1BNS A;  1BUJ A;  2KF6 A;  1BU4 A;  3NBJ A;  1N8Q A;  1VQ7 3;  4XBY A;  1K8A 4;  3BNE A;  4ILF A;  3UJM A;  1AY7 A;  1YGE A;  3V99 A;  1OPY A;  3HZP A;  1BVI A;  2JQ5 A;  3LZA A;  1Q42 A;  1N8R 4;  4HKV B;  2RCD A;  4I4K A;  3AGO A;  3LTA A;  1BAN A;  4MMY B;  1MWU A;  1BNE A;  3CME 3;  1QVF 2;  1GOU A;  1VZZ A;  2HMN B;  3CD6 3;  1O7G B;  4X2H A;  3AHW A;  1CYV A;  1FUS A;  1QAF A;  1YI2 3;  3NV0 A;  1UI8 A;  3F8H A;  1VQN 3;  1OHS A;  5IER A;  1BNI A;  3J7Y d;  3BU4 A;  5EQL A;  4FCJ A;  2GXF A;  2XGN A;  3K5T A;  1X1Y A;  1IT8 A;  5HGR A;  1IK3 A;  1YJ9 3;  1BGS A;  5ELU A;  1DVC A;  1W6G A;  3KCH A;  3SOY A;  2AAD A;  2PZV A;  4R9K A;  1JBT A;  1RCK A;  1W7C A;  2CWU A;  1SAR A;  1FGR A;  2BO9 B;  1V74 A;  2OQE A;  2H0I A;  1FGO A;  1W5Z A;  4O8S A;  1K9M 4;  4BL3 A;  3CCE 3;  1ROA A;  1DMN A;  2Z6B A;  6GSP A;  2KF5 A;  3MG3 A;  2XEP A;  1GMP A;  1O7W B;  4XDW A;  1R4Y A;  1YHQ 3;  3DGL A;  3Q3F A;  1K73 4;  3HK4 A;  1LXE A;  1IV7 A;  1PY3 A;  2HOH A;  3NQY A;  1A2P A;  1UGH I;  2B1X B;  4N6V 0;  2KAA A;  2W56 B;  4RBN A;  1FUW A;  3EBY A;  2F4Y A;  3PGB A;  4TX4 A;  2CHC A;  4KFE A;  2KCD A;  2XSH B;  2F98 A;  2OOV A;  3F14 A;  3FLJ A;  3LML A;  4FMD A;  4KFD A;  3CC2 3;  4WYK B;  5M19 A;  1RJO A;  2Q07 A;  1DMQ A;  1B3S A;  1MWS A;  4CJN A;  3I55 3;  5AII A;  1FGT A;  3PZW A;  3KII A;  5AEU B;  4CPK A;  1FA3 A;  5JPP A;  6RNT A;  1RN7 A;  3SOA A;  3NX0 A;  2GU1 A;  5AYR B;  2IUJ A;  2CFW A;  1O7P B;  3D9R A;  4IT7 A;  4WFO A;  5LC6 A;  5TGN A;  4EV5 A;  3WA3 A;  4DKI A;  1BRN L;  2WO0 A;  3AMO A;  3I0Y A;  2PNC A;  2ZDJ A;  4HM7 B;  3URP A;  1BSD A;  5G1K A;  3I56 3;  4L8O A;  4EW5 A;  4PEJ A;  2UX0 A;  1FGM A;  2BT3 A;  1OF5 B;  4HZB B;  1GY5 A;  1B2X A;  5DRV A;  1A2K A;  4N6N B;  1T5Y A;  2BMR B;  3KSE D;  1W4N A;  3UB1 A;  1BSB A;  3WDG B;  5KP1 A;  1M90 4;  2E2U A;  1GD4 A;  4N6O B;  1FUT A;  3LT8 A;  2HMJ B;  1B20 A;  3EX9 A;  1JKG B;  3EN1 B;  3FG4 A;  1YJW 3;  3FF2 A;  7STD A;  2F99 A;  2W2C A;  4STD A;  3G71 3;  1SQW A;  2KF4 A;  1ULJ B;  2BMQ B;  3G0K A;  2L4V A;  2XFS A;  1RRL A;  4FMB A;  4BL2 A;  2BHM A;  2H0G A;  1IDP A;  4RNY A;  5CXO A;  1RN4 A;  3D4A A;  4EYC A;  1DET A;  4LMI A;  5EEO A;  5BVB A;  1KD1 4;  1AVK A;  1FGQ A;  2QIY A;  3NUV A;  5FGO A;  4ZM8 A;  2XFT A;  1M9G A;  1LOX A;  5IG4 A;  1VQQ A;  3UNL A;  4FR9 A;  3N54 B;  2R4I A;  3EBT A;  5D81 A;  1Q81 4;  1V57 A;  1IVW A;  3IMA B;  1VQ9 3;  1NDO B;  1J2B A;  1S5A A;  3LT9 A;  4J9A A;  4RNZ A;  5BIR A;  8CHO A;  3LTC A;  3KN4 A;  1W6C A;  3DGY A;  3NBB A;  4HM5 B;  2CK3 H;  2GEY A;  1EUI C;  2GEX A;  1V58 A;  1WMO A;  1MGR A;  2W9Q A;  3S28 A;  2YFJ B;  3BIR A;  2CX1 A;  2K0M A;  5AIG A;  5FW5 A;  1DMM A;  2CG0 A;  4X2O A;  4HM2 B;  4HM8 B;  4BIR A;  2C11 A;  1GY6 A;  1E3V A;  2XGL A;  1TU5 A;  1CYU A;  1RDS A;  1BNR A;  1BSE A;  3ZFZ A;  1DVD A;  1TJD A;  3CPW 2;  3EC9 A;  1STF I;  3KKG A;  3DUK A;  3GZR A;  4IIA A;  1UCK A;  4XDV A;  1OGZ A;  2CC3 A;  2INX A;  5EVH A;  5DRE A;  4WYK A;  6STD A;  2GBW B;  3X3X A;  3B4P A;  1VQP 3;  5IEN A;  2HMK B;  4FCM A;  1JBS A;  1VQO 3;  2Z76 A;  1HYF A;  4MMX B;  3CCQ 3;  2ZL8 A;  1UGI A;  1ISK A;  1FYS A;  1OGX A;  3FG3 A;  1RGK A;  4AKY A;  1NO3 A;  2RBI A;  2LQV A;  1EA2 A;  1WNH A;  4OK0 A;  3CC4 3;  5STD A;  3O8Y A;  1RGC A;  1B2Z A;  3D5I A;  4N3V A;  1TUH A;  4I5Q A;  2P0X A;  1LNI A;  2XH9 A;  1I2G A;  2OTL 3;  1OF5 A;  1BSC A;  2FGT A;  1RCL A;  1N9J A;  2KF3 A;  2P38 A;  3EE1 A;  4HJL B;  3E99 A;  4NRE A;  2CW9 A;  1C54 A;  1IYY A;  1B2M A;  3UL6 A;  1RGH A;  2WGQ A;  2Y73 A;  3WOE B;  1AQZ A;  3F40 A;  3SED A;  3CCM 3;  1YIT 3;  3FZW A;  2IUK A;  4IPB A;  4WWU C;  2O3O A;  1VQ6 3;  4XM4 A;  3SXX A;  5M18 A;  1W2B 2;  3FGY A;  2CWT A;  4GSP A;  3PS8 A;  1M1X B;  1CEW I;  1RGF A;  3GAX A;  2OOV C;  3D79 A;  1IT7 A;  4BU4 A;  3HOH A;  5CF2 A;  1AR0 A;  1RGL A;  4H61 A;  4N6M A;  4K1V A;  3CCS 3;  1NJI 4;  5GSP A;  3F7X A;  3HIG A;  2CX0 A;  3X41 A;  3G6E 3;  3S5C A;  1R4C A;  1FW7 A;  3DMC A;  1JZD A;  3CU3 A;  3D5G A;  1QVG 2;  1JN5 B;  1MGW A;  3NQZ A;  4L7K A;  1EG9 B;  3CMA 3;  3B8L A;  1JN5 A;  1PU4 A;  4EBG A;  1RKY A;  1FZU A;  2F56 A;  5BXQ A;  3OW2 2;  1PFP A;  2FXT A;  3MWZ A;  2GU3 A;  5AI1 A;  1TTO A;  1UCJ A;  4LYL B;  3NHX A;  4XBX A;  3WHO A;  4EC6 A;  2W9P A;  3IPT A;  1JV2 B;  3WR2 A;  3MG1 A;  3QK9 A;  1UW1 A;  1DYU A;  2YFL B;  3CCV 3;  1GSP A;  3BNC A;  4K61 A;  1X1X A;  4GHO A;  4HYZ A;  3FF0 A;  3OWS A;  2BU4 A;  4R4K A;  1I8V A;  1IVU A;  3DXO A;  5AIH A;  1BUQ A;  1BAO A;  4O02 B;  4N6L A;  1LOV A;  3U1W A;  4KT3 B;  2MC8 A;  3LYG A;  1WQL B;  4ORL A;  9RNT A;  3DZL A;  5KP3 A;  5AIF A;  3OWU A;  2ZA4 A;  3X3Z A;  1OCV A;  3K9M C;  1UDI I;  3MSO A;  3RGR A;  1L5G B;  3OWY A;  4HOH A;  3Q90 A;  4GL6 A;  3VGN A;  3SVA A;  2UGI A;  3EB8 A;  1W01 A;  2HMM B;  4WHA A;  3PCR A;  3S27 A;  2CIU A;  1T2H A;  2CFG A;  1LOW A;  5IEO A;  1QAL A;  1N9E A;  1UUG B;  2ZHX B;  3GSP A;  4FCZ A;  4JRF A;  5RNT A;  1JB4 A;  1NNV A;  4LGQ A;  2H0H A;  1N5P A; 
#chains in the Genus database with same CATH homology
 1VQK 3;  2XRX B;  1OAC A;  2O9U X;  1KWI A;  4G1M B;  4OVM A;  4BTY A;  3EQQ B;  5CF1 A;  3BB9 A;  4KZ1 A;  1A67 A;  1MNL A;  1SIH A;  1IQY A;  1O7H B;  4GB5 A;  2WOH A;  1N5P A;  1YJN 3;  3OV4 A;  3UL5 A;  5A0O B;  2CKF B;  2OWP A;  1IU7 A;  3LTB A;  1QMA A;  3TDG A;  3CCL 3;  1IQ8 A;  1Q7Y 4;  1WMP A;  1A90 A;  3KZT A;  1JRQ A;  1YVB I;  3EJV A;  1IVV A;  4LSO A;  3G16 A;  3MHE A;  3ECF A;  2QEX 3;  1F8N A;  1KSI A;  2CFK A;  4O2H A;  1W6Y A;  2WGO A;  1GY7 A;  1IVX A;  2OQE C;  3LOY A;  3NM7 A;  3KFQ C;  1US1 A;  3K7C A;  4L8P A;  3SX1 A;  1JKG A;  4XBT A;  3VF1 A;  2W6J H;  2Z77 A;  2XF3 A;  3KE7 A;  3KSP A;  3NXJ A;  1VQ4 3;  1SJW A;  3LXU X;  2YX9 A;  2I9W A;  2KRT A;  2W04 A;  1LVN A;  3LH4 A;  3WA2 X;  1JB2 A;  5KP4 A;  3MKI A;  3JUN A;  4AEQ A;  5IG0 A;  2CFL A;  2LYX A;  3NBR A;  4EXR A;  1NU3 A;  2QGU A;  1HKX A;  2B24 B;  4LEH A;  1D6Z A;  3ALA A;  1G96 A;  1WMN A;  1UI7 A;  3FCS B;  2V1L A;  4R9L A;  3K0Z A;  3X40 A;  2K54 A;  2BMO B;  4Q53 A;  3G4S 3;  3QRD A;  4LZI A;  5AEW B;  1GS3 A;  2A15 A;  2XR8 B;  4HVN A;  2WOF A;  3V98 A;  2MF7 A;  1D6Y A;  2D1W A;  1SII A;  3VSY A;  1NWW A;  3X42 A;  1EQK A;  1Y4K A;  4BTW A;  3LTD A;  2CG1 A;  2W0Q A;  3GZY B;  3WOD G;  1KC8 4;  1VQ5 3;  2W03 A;  1MOL A;  3CNX A;  4HM0 B;  4QWT A;  1D6U A;  1WTH A;  4K1U A;  1O7N B;  1TIJ A;  3BND A;  5D83 A;  4EV2 A;  1UUW B;  2ML6 A;  5ELJ A;  3NM2 A;  3T8U A;  5IF6 A;  1OHP A;  1GYB A;  1VQL 3;  4XB5 A;  1O7M B;  2Y74 A;  1NB3 I;  1TP6 A;  1UUV B;  3G8Z A;  4HBR A;  1STD A;  1YIJ 3;  5CLK A;  2M7O A;  4HM4 B;  1KQS 2;  3JUP A;  1M1K 4;  4BTX A;  4R80 A;  3Q1C A;  1TFK A;  3S29 A;  3EHC A;  3STD A;  2QA4 3;  1Q40 B;  3F9S A;  3DY5 A;  2OCT A;  4MEI A;  3A76 A;  2HML B;  4OUQ A;  1JNQ A;  3U97 A;  1A2V A;  3PYJ A;  3FSD A;  3JUO A;  2F86 B;  4J8T A;  4O3V A;  1Q40 A;  4HM6 B;  3NV0 B;  3SLU A;  2HMO B;  1SPU A;  3BLZ A;  4U13 A;  1LNH A;  5LC7 A;  1S72 3;  2CWV A;  2IMJ A;  2JDI H;  3N8B A;  5IG3 A;  3HX8 A;  1K28 A;  3V92 A;  4HM1 B;  1W2Z A;  2E2T A;  3S67 A;  1ZO2 A;  1U8C B;  1HU9 A;  3H3H A;  4HM3 B;  1OH0 A;  4H3U A;  3D3L A;  1JB5 A;  4CCV A;  5AYS C;  3DGO A;  2ML5 A;  3BNB A;  2C10 A;  3ER7 A;  4HZ9 B;  1ROV A;  4CDL A;  3MPH A;  1U5O A;  4FMC A;  2YFI B;  3F8X A;  4MMZ B;  1E97 A;  3FG1 A;  4K90 B;  1N5H A;  2RSX A;  3CXC 2;  1IV9 A;  1QJG A;  3DGN A;  3GZX B;  3X3Y A;  1QAK A;  3HI7 A;  3PXM A;  1Q86 4;  3GWR A;  1ULI B;  3N9H A;  3M8C A;  1AV4 A;  4R1K A;  2OTJ 3;  4MJD A;  3DM8 A;  2D42 A;  3B7C A;  1AVL A;  4FMA A;  4NHF A;  3Q2P A;  3AMO B;  2KXG A;  3CPO A;  5D82 A;  3CCR 3;  1C7H A;  2CFD A;  3RDE A;  5IEP A;  1W00 A;  4WP5 A;  2W56 A;  2P05 A;  3MG2 A;  3FH1 A;  5G2G A;  1CQS A;  3L0R A;  3T8N A;  1TFO A;  3H51 A;  1ASK A;  3DGM A;  2Z7A A;  3OX9 A;  3OXA A;  3JVC A;  3RGA A;  2XSO B;  4N6U A;  5JBS A;  3EN8 A;  3T0U A;  2STD A;  3GZB A;  3B4O A;  1GD3 A;  2P0M A;  5IW9 A;  3CCU 3;  1NB5 I;  1Q82 4;  1OHO A;  2RGQ A;  1EKM A;  2SBL A;  3CNM A;  4N6T A;  2RFR A;  1W2B 2;  3WMD A;  1ZX2 A;  2P09 A;  3EF8 A;  1Z1S A;  2FNQ A;  1W02 A;  1VQ8 3;  4KVH A;  5JPU A;  1JJ2 2;  2E2V A;  5CK6 A;  3K63 A;  3F7S A;  1RRH A;  3MYT A;  3WOF B;  1VQM 3;  4KFF A;  4AKZ A;  2BNG A;  3IJE B;  3CCJ 3;  3FKA A;  3GRD A;  2CH9 A;  5IG5 A;  1IQX A;  2GBX B;  3HII A;  1E3R A;  2IA7 A;  4JF8 A;  3ROB A;  3CC7 3;  4RZM A;  3PCS A;  5I97 A;  1OUN A;  1K41 A;  3JUQ A;  3JUM A;  3NBJ A;  1N8Q A;  1VQ7 3;  4XBY A;  1K8A 4;  3BNE A;  3UJM A;  1YGE A;  3V99 A;  1OPY A;  3HZP A;  2JQ5 A;  3LZA A;  1Q42 A;  1N8R 4;  4HKV B;  2RCD A;  4I4K A;  3LTA A;  4MMY B;  3CME 3;  1QVF 2;  1VZZ A;  2HMN B;  3CD6 3;  1O7G B;  4X2H A;  1CYV A;  1QAF A;  1YI2 3;  3NV0 A;  1UI8 A;  3F8H A;  1VQN 3;  1OHS A;  5IER A;  3J7Y d;  5EQL A;  4FCJ A;  2GXF A;  2XGN A;  3K5T A;  1IK3 A;  1IT8 A;  5HGR A;  1YJ9 3;  5ELU A;  1DVC A;  1W6G A;  3SOY A;  2PZV A;  4R9K A;  1W7C A;  2CWU A;  1FGR A;  2BO9 B;  1V74 A;  2OQE A;  1FGO A;  1W5Z A;  4O8S A;  1K9M 4;  3CCE 3;  1ROA A;  1DMN A;  2Z6B A;  3MG3 A;  2XEP A;  1YHQ 3;  1O7W B;  4XDW A;  1K73 4;  3DGL A;  3HK4 A;  1LXE A;  1IV7 A;  3NQY A;  4N6V 0;  2B1X B;  2W56 B;  4RBN A;  1FUW A;  3EBY A;  3PGB A;  4TX4 A;  2CHC A;  4KFE A;  2XSH B;  2KCD A;  2F98 A;  2OOV A;  3F14 A;  3FLJ A;  3LML A;  4FMD A;  4KFD A;  3CC2 3;  4WYK B;  1RJO A;  2Q07 A;  1DMQ A;  3I55 3;  5AII A;  1FGT A;  3PZW A;  3KII A;  5AEU B;  1FA3 A;  5JPP A;  1RN7 A;  3SOA A;  3NX0 A;  2GU1 A;  5AYR B;  2IUJ A;  3D9R A;  1O7P B;  2CFW A;  4IT7 A;  4WFO A;  5LC6 A;  5TGN A;  4EV5 A;  3WA3 A;  2WO0 A;  3AMO A;  3I0Y A;  2PNC A;  2ZDJ A;  4HM7 B;  3I56 3;  4L8O A;  4PEJ A;  2UX0 A;  1FGM A;  2BT3 A;  1OF5 B;  4HZB B;  1GY5 A;  5DRV A;  1A2K A;  4N6N B;  1T5Y A;  2BMR B;  3KSE D;  1W4N A;  3UB1 A;  3WDG B;  5KP1 A;  1M90 4;  2E2U A;  1GD4 A;  4N6O B;  3LT8 A;  2HMJ B;  3EX9 A;  1JKG B;  3EN1 B;  3FG4 A;  1YJW 3;  3FF2 A;  7STD A;  2F99 A;  2W2C A;  4STD A;  3G71 3;  1SQW A;  1ULJ B;  2BMQ B;  3G0K A;  2L4V A;  2XFS A;  1RRL A;  4FMB A;  2BHM A;  1IDP A;  4RNY A;  5CXO A;  4EYC A;  4LMI A;  5EEO A;  5BVB A;  1KD1 4;  1AVK A;  1FGQ A;  2QIY A;  3NUV A;  5FGO A;  4ZM8 A;  2XFT A;  1M9G A;  1LOX A;  5IG4 A;  3UNL A;  4FR9 A;  3N54 B;  2R4I A;  3EBT A;  5D81 A;  1Q81 4;  1IVW A;  3IMA B;  1VQ9 3;  1NDO B;  1J2B A;  1S5A A;  3LT9 A;  4J9A A;  4RNZ A;  8CHO A;  3LTC A;  3KN4 A;  1W6C A;  4HM5 B;  3NBB A;  2CK3 H;  2GEY A;  2GEX A;  1WMO A;  2W9Q A;  3S28 A;  2YFJ B;  2K0M A;  5AIG A;  5FW5 A;  2CG0 A;  4X2O A;  4HM2 B;  4HM8 B;  2C11 A;  1GY6 A;  1E3V A;  2XGL A;  1TU5 A;  1CYU A;  1DVD A;  3CPW 2;  3EC9 A;  1STF I;  3KKG A;  3DUK A;  3GZR A;  4IIA A;  4XDV A;  1OGZ A;  2CC3 A;  2INX A;  5EVH A;  5DRE A;  4WYK A;  6STD A;  2GBW B;  3X3X A;  3B4P A;  1VQP 3;  5IEN A;  2HMK B;  4FCM A;  1VQO 3;  2Z76 A;  4MMX B;  3CCQ 3;  2ZL8 A;  1ISK A;  1OGX A;  3FG3 A;  4AKY A;  1NO3 A;  2LQV A;  1EA2 A;  1WNH A;  4OK0 A;  3CC4 3;  5STD A;  3O8Y A;  4N3V A;  1TUH A;  2P0X A;  2XH9 A;  2OTL 3;  1OF5 A;  2FGT A;  2P38 A;  4HJL B;  1N9J A;  3EE1 A;  4NRE A;  3E99 A;  2CW9 A;  3UL6 A;  2WGQ A;  2Y73 A;  3WOE B;  3F40 A;  3SED A;  3CCM 3;  1YIT 3;  3FZW A;  2IUK A;  4IPB A;  4WWU C;  2O3O A;  1VQ6 3;  4XM4 A;  3SXX A;  3FGY A;  2CWT A;  3PS8 A;  1M1X B;  1CEW I;  3GAX A;  2OOV C;  1IT7 A;  5CF2 A;  1AR0 A;  4H61 A;  4N6M A;  4K1V A;  3CCS 3;  1NJI 4;  3F7X A;  3HIG A;  3X41 A;  3G6E 3;  3S5C A;  1R4C A;  3DMC A;  3CU3 A;  1QVG 2;  1JN5 B;  3NQZ A;  4L7K A;  1EG9 B;  3CMA 3;  3B8L A;  1JN5 A;  1PU4 A;  4EBG A;  1RKY A;  5BXQ A;  3OW2 2;  1PFP A;  2FXT A;  3MWZ A;  2GU3 A;  5AI1 A;  3NHX A;  4XBX A;  4EC6 A;  2W9P A;  3IPT A;  1JV2 B;  3MG1 A;  3QK9 A;  1UW1 A;  1DYU A;  2YFL B;  3CCV 3;  4K61 A;  3BNC A;  4HYZ A;  3FF0 A;  3OWS A;  4R4K A;  1IVU A;  3DXO A;  5AIH A;  1BUQ A;  4O02 B;  4N6L A;  3U1W A;  2MC8 A;  3LYG A;  1WQL B;  4ORL A;  3DZL A;  5KP3 A;  5AIF A;  3OWU A;  3X3Z A;  1OCV A;  3K9M C;  3MSO A;  3RGR A;  1L5G B;  3OWY A;  3Q90 A;  4GL6 A;  3VGN A;  3SVA A;  3EB8 A;  1W01 A;  2HMM B;  4WHA A;  3PCR A;  3S27 A;  2CIU A;  2CFG A;  5IEO A;  1QAL A;  1N9E A;  4FCZ A;  4JRF A;  1JB4 A;  4LGQ A;  1DMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...