5IF9A

Crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
251
Chain Sequence
VTRVLAVANQKGGVAKTTTVASIGAALTEQGRRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGDVEPSAALVRTDEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPDLKLLGALPTLYDSRTTHSRDVLLDVADRYELPVLAPPIPRTSVLAGRKSKGAIAYREFADALLRHWKSGRKMPTFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
rcsb
source organism Mycobacterium smegmatis
molecule tags Ligase
molecule keywords Cobyrinic Acid a,c-diamide synthase
total genus 84
structure length 251
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5if9A00
2WTUA 4PAMA 1AK2A 1Z47A 2AK3A 1NBME 1TU3A 3T12A 3UXMA 2CL6X 1LNZA 2D3WA 2GCNA 2WBLC 1K5DA 1WE2A 1XPUA 4GMDA 1Z29A 1QHIA 2W2TA 3BFKA 4TMVA 1NJFA 1KK0A 1N6RA 2Z6VA 4NCIA 4C30A 3FMOB 4M1MA 2FSGA 3NDBB 2B7CA 3ECCA 3R8FA 1ZUHA 3FMPB 5TXGA 3B82A 4PXAA 4NL4H 1KJZA 1IN8A 2RH5A 3B9PA 3GLGB 4B34A 4OL0A 4BZQA 1G6HA 3WXMA 2GDJA 4XJXA 3U4QB 1SXJB 4Q4JB 1G17A 3TUJC 1SKYE 4E5UA 4LJAA 4OI1A 1N6KA 1II0A 4IHQA 2DPXA 3C16C 1NSTA 4CW7A 2G1JA 3IHWA 3WY9A 1E96A 3TQFA 2FFAA 1JB1A 4IFEA 2VP0A 4Q5IA 3OF5A 2GCPA 2WAYA 1UBEA 1F5NA 3RS0A 2FEMA 2OLKA 5CJ2A 1E2JA 4K81B 4GP6A 3EPKA 1T3LA 2J7KA 4XVQA 5FPYA 1UBCA 4ESVA 1NI3A 2V55B 4JLBA 3QVUA 2H7VA 4KSCA 4MGZR 3VNVA 1GDDA 4JLKA 2XJ4A 2AFIE 1UFQA 1RJ9B 3AVYA 3SJZA 5C2JB 4MRVA 1W4BA 5CDFE 3DZDA 1YZNA 5E7JA 1D2MA 1XB2A 2RGBA 2ATXA 2Q3HA 3DMNA 4QFMA 5CLQA 1B0UA 4NBSA 3PUVA 1J8MF 2C95A 2OLJA 4D0NA 2BMDA 2E9SA 4JL5A 3K9LA 3KXIA 4EPRA 4JVLA 2FFHA 5BN5A 4LV8B 3B9QA 1G5TA 3W8RA 2F1JA 1D6JA 1H8EA 3PV0A 4WW0A 3ZS8A 1NIPA 421PA 3A1VA 4IDQA 4HAZA 4DVGA 2PCLA 1DOAA 2OZEA 4R2IA 1Q21A 3QXHA 4GOKA 1E1RD 3CPEA 4TTQA 1FPMA 2F1IA 2R6CA 4PC7A 1GVNB 4WA7A 1Z0KA 1DO0A 3D7MA 2AX4A 3EARA 2RHMA 3CH5A 4DLVA 5JRZA 4US1R 5TARA 4NH0A 4OQMA 4UJ3A 1F6BA 3K0AB 1KAOA 4L9WA 4BFZA 3FKSD 5K8UA 2FDCA 1EESA 2EW1A 1A4RA 1P2VA 1GIAA 3FB4A 1T9HA 3ND9A 5EZ6B 1J7KA 4DIEA 4DWJA 5GADl 4GMXA 4DHEA 4TT3A 5E4FA 2H1LA 1G20E 2HV8A 3K8YA 1XTJA 2D74A 4OJQA 3RAPR 3GPLA 2TMKA 1COWA 3OEED 4TYYA 3KFVA 3I1FA 1OXTA 4KODA 1S2MA 1GILA 2GZDA 1N6NA 2CE2X 1FNNA 1E9DA 3JVVA 3TIFA 2RB4A 1P9WA 2C98A 2RGEA 2WMNB 2WJYA 3LVQE 4YXWA 3OIWA 4CT5A 4EQ6B 1JPJA 2P0EA 3BERA 3IIMA 4A0GA 2P6NA 2C78A 2ZYUX 5IK2A 4MDFA 4IEIA 4LJ9A 3GLIA 1VHTA 4WZBE 4NE2A 1W4RA 1BYIA 1OIWA 1D2EA 4WZAE 3R7WB 4PPQA 3THYA 2QP3A 3HU3A 1E99A 5B64A 4AG5A 1E79A 2IA5A 3KTAA 3K09C 1QHYA 4JBYA 4TYQA 1KZ7B 2R9VA 4B6EA 4NONA 4DLTA 4I1VA 3P27A 3CX7A 2XSZD 3K0EA 1Z3IX 2VP2A 1SULA 3GLHA 1N6LA 2Q21A 3O8RA 3CONA 1OLOA 5B2ZA 3RDPA 5JLJA 3KQLA 4OHZA 2NO9A 4QBIA 4CEIA 1XCMA 4JT4A 3K0SA 1UBGA 4A92A 2KBEA 5L8VA 4N0EA 1AS3A 1YZQA 2GXQA 5CM8B 1R8QA 2ZJYA 4L8GA 1ZP6A 5C4GB 4LX0A 4FMCF 4EQ6A 3HPRA 4DCUA 3QKUA 1XZQA 1IONA 4LJ8A 1VCMA 2LKDA 4M1TA 2FV8A 2QQEA 2WOJA 2GESA 1Z0JA 2LWIA 3QEJA 3DZ8A 4UNQA 3B13B 1D8TA 1FX0B 1SHZA 2ONKA 3H4MA 3Q9LA 2I1VB 1LTQA 3OFNA 1TQ4A 1OB5A 4IJMA 1HTWA 3SZRA 1OPXA 2FFBA 1F2TB 1VIYA 1QVAA 2JEOA 3A37A 1EFRD 5C46F 5DGXA 1R5OA 4Q4JA 3T34A 4URWR 2V4ZA 2DFKB 4V0MA 1UF9A 1ZD9A 2HCJB 3NHAA 3T1QA 5E3HA 4TYWA 2BJVA 3CF6R 4V0OA 2X77A 1GL7A 1F60A 2YNMA 3V4FA 2CNWD 2YKGA 3IQXA 3WBKA 1N6OA 1TUIA 5DE3A 4KLNA 2CVFA 2FPMA 4B74A 1FL9A 2AXNA 4NPHA 2P67A 2O0HA 2RGGA 5L3VA 1LF0A 1G3IA 1E3MA 2ZSAA 1YZLA 2Q9BA 1X8JA 1X6VA 1MO4A 3AQ4A 4A6PA 3A4LA 4B2PA 1DE0A 2ZRGA 2REXB 3I32A 3TVTA 1S3GA 4CRWB 1E9RA 3QF4A 4TQUS 4KAXA 2YC4C 4TTPA 3CZQA 4LHXA 4CEHB 1F3OA 2WWFA 1XMSA 3CPHA 4IDPA 4KLZA 2J0UB 3O8DA 2JGNA 4EFMA 1KSJA 2AD1A 2KB0A 3MCAA 1IN4A 4PPFA 4CZ2A 3TAHA 3U3RA 2XZPA 4RY2A 2YWFA 2WWIA 1G19A 1ZU5A 5JFGA 1NMYA 1G5PA 1ZD8A 2G9NA 2XNDA 5CK4A 5TMPA 4M9ZA 3JVUA 4LCBA 5FOXA 1T5IA 3KKPA 1C9KA 2OXRA 4EJSB 1Q3HA 2FG5A 1W48A 2ZJBA 4GNKA 5DI9A 1OH7A 1W4AA 2G0TA 3AP3A 4XSHA 2NZJA 4KBFA 2A2ZA 3ZVRA 2QE7D 3CNNA 1U94A 5BQ5A 3VFDA 4AKGA 2J59A 1QRAA 2OG2A 2JLZA 2JAQA 3BGWA 2CE7A 2KBFA 1N5JA 2ZXUA 2REBA 4KVGA 4B75A 2YOFA 2V6JA 4C3ZA 2OBLA 4YDSA 3LWNA 3VHLB 3C5HA 5JRJA 3BFVA 4GT1A 1GWNA 3ZQJA 3KTAB 5D3MA 1AJEA 1HEIA 4DKXA 4HATA 3LVRE 4F38A 2IK8A 1J99A 4KU4A 1P9NA 2IYQA 3EWSA 3WRXC 2F1HA 3FKSA 2Z5FA 1Z2CA 3GJXC 2FGJA 4KI0A 3LH5A 5DIFA 1N5LA 1UBFA 3FMFA 4BLSA 5FTLA 4CEIB 1P3JA 5AWFC 1G7RA 4D0GA 1U81A 1ANKA 4HSEA 1E9BA 4BGDA 2Q9AA 3C7KA 2V8OA 1VYUA 4C0HA 1T3SA 2I1QA 1Z63A 1E98A 3H2YA 4D6PA 4ZI2A 3GLGA 1EFCA 3PCRB 1NN5A 3A1TA 4HAYA 2PZEA 4AY2A 1AS0A 1G5RA 1CJUC 4RD3A 4XTRA 2EU8A 3TLXA 2GKSA 1JJVA 2A7QA 5DHFA 2CLDX 3KUCA 5A0FA 5JI2E 5JBQA 3Q8XB 3TW8B 1DAFA 1KYIA 4XWOA 1OV4A 1T4GA 2FNAA 4LV5B 1ZU4A 2GAOA 2ZRBA 3Q72A 4A1FA 1N6IA 3UG7A 1FQJA 1UAAA 3MWLA 3G82C 4KHZA 2WHXA 2QTFA 2WPDD 2XNSA 1DG3A 4BRWA 3Q3JB 3NXSA 5KHOC 2QL6A 2FA9A 1O87A 4OQFA 3QUSA 4KVAA 3BB3A 5FOWA 1X3SA 3BH7A 3BS4A 2Z43A 2XOKD 4HB2A 3UWOA 3SEAA 1BH2A 4Q47A 1GRRA 4DEXA 4C0KA 2O8FA 2DY1A 3E1SA 4RFSA 1HV8A 821PA 3T1TA 1JR6A 2A5JA 4NTZA 3TMKA 3M1IA 1OXXK 2BDTA 1ZJ6A 3DDCA 4B44A 1P4SA 3LNCA 4BUJA 3BB1A 2O8EB 4QM7A 4DLYA 5L3SA 2LCFA 5KO2A 1OHHD 3EIEA 2OFOA 2D2FA 5KDOA 3ZVNA 3ZQ6A 1KK3A 2WWHA 2ZRKA 4PTLA 2WWGA 2ZRJA 2FH5B 3IIKA 2VIIA 4LJ7A 1RZ3A 4PR0A 2J45A 2Q0HA 1D2NA 3D6TB 1Q0UA 4ARZA 5KTYA 1NN0A 4AYXA 2WJVA 1UDXA 1NG9A 3LX8A 4D4JA 3CKLA 5AJXA 3KQNA 1KDOA 1D5CA 4QGHA 1NL3A 2JDIA 3R9IA 4F92B 4CT4B 3ASYA 2ERYA 1RRPA 1M8PA 2ZS7A 5AUPB 2EFGA 4WXPA 5CB6A 5FTKA 4OI0A 1EFHA 1HT2E 3UG6A 1WMSA 4C0LA 1U99A 2OFXA 1IXRC 4LBVA 4LZZA 3KJGA 3U7EB 1G8YA 3FKQA 1SKQA 3KKNA 3EPHA 4XVRA 3CM0A 1XTKA 3L8ZA 2H8KA 5HZKA 1VG0B 2PL3A 3HU1A 4Q48A 2NMVA 5CITA 2O52A 5JEDA 2ORWA 4B2IA 4DCVA 3Q85A 1Q12A 4LI0A 4LWZA 4B76A 2V6IA 2F7SA 1N3BA 1S0UA 2RGAA 2PEYA 3AF4A 1CEEA 1KI6B 4DDWA 2B8WA 4QHYA 1G3MA 3K0CC 2HYDA 4G5GA 4M53A 2PX3A 3DOEA 2O5VA 2BHRA 5AJWA 3K70D 1SVWA 1GOTA 3RVBA 5G3YA 2QORA 2HF8A 3OIVA 1E9AA 3EC2A 4HLDA 1VG9B 1L4UA 4G5QA 3C41J 4PPGA 4Q66C 4RVCA 4F91B 3P4XA 4RFVA 1WQ1R 4OHWA 2GJ9A 1QHSA 1P9RA 1RRFA 3U3OA 3K9HA 1TTTA 2ZSDA 3ADBA 3FOZA 1G6OA 4OQNA 3Q7PA 1AKYA 4MYCA 4B2LA 5JJIA 4JLMA 1BMFD 2G3YA 2ZUBA 3LBHA 4DLRA 3TUZC 1TAGA 4M0LA 5ELXA 3WP1B 1IY2A 3C5CA 2ODBA 2NOAA 3ZZTA 3MFYA 3I4LA 3TUIC 2O8DB 1A5TA 3MJRA 3BORA 4PAOA 4CVNA 4F4IA 2VHQA 3KJHA 2XAUA 3CO5A 2QMUA 3VKGA 1P2TA 1E0SA 4HYYA 3TGPA 1CXZA 1G9XA 2P3SA 6Q21A 2IF2A 3CX6A 1AM4D 2PT5A 4TQ9A 1CJVC 3QXJA 4BQSA 1E1QA 1E2KA 4Z1MD 3LDAA 5EP1A 1NBMA 4TLCA 1W0KD 2DBYA 5FL3A 2ZSFA 4DLUA 2WVJA 2IC5A 3V4RA 1BS1A 2Q3MA 5M04A 5G53C 1YKSA 5DLQC 1AZTA 3LQRA 3E70C 2ZUCA 1NLYA 3ZS9A 2HDNB 1NLZA 3GJ0A 5KSZA 4PZYA 5GJWC 1FQKA 1W1WA 3IO5A 1E6CA 4P4SA 2V1UA 3TH5A 2C9OA 2EWVA 3B85A 2PBRA 3IKJA 2IL1A 1MKYA 5FUWA 2OESA 4ZKEA 2X8AA 1KIMA 4PSKA 4TMXA 2QU8A 2IUTA 4L15A 4II7A 5JMTA 1YZGA 3GFOA 3JZAA 3WYAA 2YYZA 3AVPA 1S9DA 2AR7A 1AGPA 1IN7A 4RFSB 5BYJA 1TU4A 4HDOB 3RHFA 2ZETA 3CR7A 1XJQA 4LBZA 1LV7A 4CIDA 2D06A 1G16A 2YZ2A 4C2UA 1I4DD 3V9PA 4M1WA 2Y8EA 3U2QA 2P65A 1KSGA 2GAAA 3CBQA 1JQJC 1R4AA 4A2QA 4FN5A 2DFLA 1R2QA 4AYTA 1S1CA 3FDIA 2YV5A 2QP4A 4OK3A 5J4VA 3CRW1 1JI0A 3SDZA 5DYIA 2VHJA 3AVTA 1TNDA 2H16A 4QKQA 5JEEA 3IO3A 4P0TA 4PC6A 5H70A 1G4AE 4P31A 3UANA 1BMFA 3VR6A 1GRQA 3SI7A 4HEJA 4ILEA 4EDHA 3CIOA 4JLNA 2QMOA 1QHHB 2QGZA 1II8A 1NG1A 2HXYA 4LHWA 3QKTA 3RANA 1E32A 3OAAD 4A8JC 5F9FA 2ZRIA 3LXRA 2GJSA 2CJWA 2YWHA 3C8UA 2NO7A 2JCSA 3VX4A 4BECA 1HUQA 4Q19A 1AKEA 4GSYA 4RZUA 1IXSB 1VKJA 2QAGB 2WM9B 3BXZA 3KDSE 3QBVA 2BMFA 1KGDA 5KOYA 4UNPA 4XSGA 3TSOA 3J81k 1IJFA 2OCBA 3THWB 2B92A 5EE1A 1R0ZA 2XNDD 4M22A 3KB2A 5AUQA 2ZI9A 1P6XA 2ZR9A 2EFCB 2EFEB 2GEUA 2GXSA 4PO1A 5EXTA 1KOFA 3TBKA 4XOIA 2QRNA 1COWD 4YDHB 3CF2A 3QPVA 3GFPA 3NIBA 2DWOA 3U6KA 1E9CA 3TR5A 4QOSA 3IBGA 4Q00A 3LW7A 2QAJA 3ZJYA 4D80A 2Q3FA 5J4HA 1E2HA 4HZUA 2VHUA 3MJHA 5HTKA 2Q9CA 4QXAA 1MO6A 5KDLA 2XITA 4Q4HA 4D25A 3PUYA 3HPQA 1CKEA 1ZAKA 1VPLA 1TEVA 2ZE5A 4ZCIA 4S35A 2QM7A 1Q57A 1CP2A 2VTKA 2VO1A 1DARA 5LBIA 3F3YA 5EP4A 1G7TA 4PSAA 3T61A 3RRYA 2OO7A 4RZXA 2CHGA 5BW8A 3KJEA 3IHLA 2J7PD 3EASA 4DLZA 1JJ7A 2MSDB 1OW3B 4R98A 4B73A 1VG1A 1NVWQ 4Q02A 1KZGB 1Y63A 2JDID 3B1ZA 4B35A 2O8FB 5DSZA 1RPZA 3MD0A 4GBMA 1H8ED 1IM2A 1R5NA 2J1LA 4JL8A 4IDHA 5SZJA 4LJYA 521PA 3AKEA 1WF3A 1Q1BA 1DAIA 4LJ5A 1OH8A 3ZIAA 3AVWA 221PA 1W44A 3QI2A 1LB1B 1Z0AA 4BFXA 4KFRA 4Q1EA 1Z83A 3SQWA 3I8XA 2ZUDA 4MYUA 2PT7A 5DISB 2CCJA 2FSFA 4B3DA 3L0IB 4YQFA 5JWOA 4AKIA 4LDJA 3W5JA 4Q4HB 3MWKA 4GFDA 1SQ5A 3AF2A 1U90A 1T0JB 4JVMA 5KNCA 1SVKA 4D4LA 3BFXA 4LC0A 1XTIA 4TL8A 5JS8A 3REGA 4IOMA 3PUXA 1KI7A 2FOLA 4BZXA 4FCVA 4BZPA 4URVR 1W0JD 2QN6A 4LJ6A 4PZZA 2YINC 4EFNA 1S9HA 1XP8A 1L7VC 1OJLA 3VR3A 1AQUA 1IXZA 2WPDA 5CB8A 3PUZA 2CXXA 4FMDB 2DCUA 4AIIA 4BLQA 5FBQB 4DDVA 4AD8A 4BLTA 4Z51A 4QBGB 3SE0A 4FWTA 3CH4B 1WBBA 1KO7A 1QHXA 2ONJA 4BFVA 2PX0A 4AKHA 1XZPA 1XX6A 3DHWC 3EXAA 2RCNA 2ZE8A 5EUMA 3PITA 3QG1A 1XD2B 3UMSA 1E0AA 4N0DA 1G64A 1RIFA 5FBLB 3F0TA 2D2EA 1G7CA 2DFTA 2XTZA 3SBEA 5JI3E 2GVZC 2ZVQX 2GCOA 4TMTA 3LA6A 1NP6A 3R20A 4Q03A 3X1ZA 5JHHB 1SXJE 5B57C 4X8HA 4WZ6A 4NYJQ 2HXSA 4A82A 1KMHB 3CUEF 1Z5ZA 3SYKA 3AVVA 2VHCA 3QKSA 1SZPA 1S4QA 1W46A 2JLSA 2RMKA 3HJNA 4QL3A 1GNPA 4D26A 3U4QA 2QMHA 3X1WA 1W0JA 1G4UR 1VYVA 2ZI3A 4M2LA 1J90A 2N1BA 4RD6A 5TDHA 1E2EA 4PHFA 5BXQC 1VHLA 4RZ3A 2ZSEA 2PEZA 3U3JA 2WSSD 4HLCA 3WP0A 1GUAA 3O8CA 1R0YA 5JJKA 1ZNWA 1DAMA 4AK9A 1WBDA 3BBPA 4X8MA 5FUYA 2PZFA 4PQFA 3U7FB 1HE8B 1SXJA 1YJ5A 1ZUIA 2BWJA 5EXPA 2IS6A 1E94E 2ZPTX 3T35A 2JLVA 2IBMA 4PC3A 2OAQ1 4FI3C 1XTSA 3N2EA 4HAVA 4JL6A 5DI3B 1T8UA 3TKLA 4B3CA 2AHOA 2E1RA 4GL2A 3HR8A 3ZVLA 3CNOA 1R0XA 2OE2A 3PXGA 1G18A 2R62A 3K1JA 1KHTA 1E9EA 4URXR 3A36A 3K9GA 1XTRA 4LUCA 1TX4B 2WSSA 2UZ3A 2AFHE 2ZJZA 1T8TA 5FTJA 3OIYA 2J0QA 1N6PA 4QBHA 1ZNYA 5KSPA 1ZNZA 3OEHD 2O8BA 5F9HA 2VP6A 3SJBA 4A8JB 1QZXA 1F2UB 1N2CE 3SYNA 3I61A 2CL0X 5EE9A 4QNRA 3VR2A 2VL7A 5K8IA 1P2UA 2J3EA 5F98A 5EE0A 1K5GA 3LFUA 4A0FA 3TVDA 2P5TB 5HE8A 2YC2C 1ZC4A 3MMPA 3SN6A 1UKVY 4Q9LA 1OFHA 2EYQA 5JCPA 4RZ2A 3GLGE 4JLAA 4M21A 2R6AA 4TWZA 5CIWA 4C7OB 2K5UA 4QGFA 5CM9C 3ZZ0A 3UIEA 5DI3A 1R5BA 1WCV1 4R71A 2GJAA 3I73A 4QGGA 1EG7A 3KL4A 3O47A 3F5FA 3QIAA 4FMBB 2QMEA 1ZUNB 3EA0A 3GLHB 3F8TA 3NTUA 1UDWA 3L43A 2XJ9A 2QY9A 1A2BA 1N25A 4Q4AA 4XWKA 4HLUC 4XTCS 3OFND 4XD7A 2IWHA 3QF4B 3DL0A 3AF1A 2GVDC 4HUQB 2EVWX 2GXUA 1KDPA 2FZ4A 3RSLA 5ANRB 1TQ6A 3KKOA 1KSFX 1VCOA 4N3NA 4QHTA 4PC2A 2BBWA 3AP1A 1JEDA 1KNQA 1T91A 2IWRA 3FE2A 4MGYR 4MKFA 4PX9A 1E2PA 2XGJA 1XDBA 3CLVA 2GNOA 3QEOA 4D4MA 4JLVA 1OKKD 2IHBA 2RHDA 1JXOA 4NMMA 1Z8FA 4I1UA 2BBOA 3OHMA 2BMJA 4LBYA 4NYMQ 2HCBA 1W4CA 4EJSA 1U2RA 3SJAA 1N0WA 1RKBA 4L5BA 2GEVA 3UMFA 1LS6A 2QA5A 2BOVA 4DSUA 4Q01A 2HT1A 1Q1EA 2R8RA 1GG2A 1N5KA 1S3SA 1Z22A 4BLRA 3ZLJA 2A5GA 1YR8A 2WJHA 1DPFA 1KK1A 1S96A 2B8TA 4US2R 2Z4SA 4OJKA 2QNRA 4M9XA 1G41A 1TF5A 1JR3A 4DDUA 4LHYA 4XH9B 1P75A 2JATA 3T1OA 3RC3A 2GXAA 4OI2A 5K8TA 2ODEA 1ZW6A 3KFXA 2I4IA 2IYZA 4HZUB 3HDTA 3P20A 5B30A 4WBSA 1TF2A 4CGZA 1XD9A 1VG8A 1OE0A 1YR7A 1V43A 2YOGA 3WNBA 1DELA 3AKYA 4W5JA 1MABA 2J0VA 1FX0A 1G3QA 2OHFA 2X1VA 2OILA 2CK3D 4LYHA 4NHOA 4X8LA 1NN1A 4G0NA 4IDNA 2GK7A 4OQXA 3MAAC 1U8AA 4RSGA 3Q5EA 1OKKA 5F3WB 2W58A 3B7GA 4HLQB 1F2TA 1J8YF 4MQBA 1AGRA 3NBXX 2VSFA 4WVFA 4D82A 1MV5A 1YZKA 2QPAA 3AF3A 3ZDQA 3RS5A 1FW6A 4L9SA 3SHWA 3LY5A 3PEWA 2Q6TA 3PG5A 5J5CA 4DSNA 1XD8A 1LS1A 1N0VC 4DRZA 2VPPA 3MG9A 2OCPA 1R8SA 2WKQA 4M9QA 4DDTA 1XXHE 3NBYC 4PO9A 5B58C 4CEHA 1T3HA 4JLOA 1KO5A 1QF9A 1CF4A 2IYUA 1FUKA 3AGPA 3H1TA 2OCYC 2OM2A 4Q1BA 1YHNA 4TL6A 4KXFB 2N46A 3NKVA 4UXHA 5KYKA 2WJIA 1S1MA 2IYWA 4YLGA 2QTVB 2XSZA 2IEZA 4LRWA 1Z08A 3W6NA 1JEEA 5AUNB 3RRZA 2JIZD 1KAGA 1X8LA 2ZIAA 4UNNA 1GZSA 2B6HA 4Y0VA 5FOSA 4A8JA 1B23P 2ZI6A 1WDTA 3NH6A 5J47A 4OHYA 1QG4A 4MRNA 4OK5A 4G5RA 1OHHA 5JSZB 1AQYA 1CR2A 2BKUA 3AP2A 3CX8A 3WMGA 4BEJA 1NN3A 3IUYA 4QJ3A 4LHZA 5LD2C 4TZ0A 1RYHA 5HKKA 2J7PA 1CRPA 4QNMA 1Q1QA 4IRUB 2MSEB 3ZGXA 2GWHA 4OK6A 2ZREA 4DJTA 2XTNA 3LLUA 1ZBDA 2R6FA 1S8FA 2XOKA 5JWHA 1GITA 2QT0A 4MDEA 3I3SR 2YVUA 1SVSA 4EAQA 4O3MA 2OXCA 3W9YA 4JKYA 3KJIA 4V0KA 2FF7A 3OEEA 5AJZA 2F55A 1NVVR 3I8SA 4AG6A 5HZHA 1FZQA 1M7HA 2PLRA 1SXJC 2H18A 3P4YA 2WJJA 4I99A 1Z6TA 4AYWA 1HA3A 3QJYA 2A5DA 2UVQA 4IVQA 5DH9A 3R9WA 1TQ2A 4MKHA 1H8HA 2VLIA 4MRSA 3RWMB 4KITB 1FMLA 3BB4A 3UATA 2REOA 4KFSA 2NO1A 3G5UA 2FGKA 2P6UA 2FX3A 4B3GA 1UPTA 3QKSB 4U5XA 3WHKA 5IK2D 2PJZA 1KI4A 3LW8A 4MUAA 2J46A 4NYMR 5BN4A 3FMIA 1NY6A 5DYGA 3QPUA 1IY1A 4IOLA 3MWJA 4XD7D 4R9UC 2VRWA 1SXJD 3K70B 1NLFA 4EPXA 1KSHA 2FPKA 5J40A 4HB3A 2NPFA 5TB5A 1E9SA 3B1WA 2QE7A 1E1QD 5HCNA 4DB4A 4YMSA 3KKQA 3KX2A 2A5YB 2ZR7A 4IEEA 4U00A 2C04A 2NG1A 1KY3A 4EFLA 1DAHA 2BV3A 1A2KC 1XJCA 3RABA 4AC9A 2O8BB 3U44B 2FEOA 1TMKA 2ZRNA 3CWZA 3EZFA 3TE6A 4B6FA 1MO3A 4WAUA 2HUPA 3BH0A 1D9ZA 2O8DA 1YRBA 1X8KA 1NIJA 1U0JA 1EGAA 2DWPA 4IW3B 1HY3A 4ON9A 2HT6A 3M4YA 4M1YA 1CJTC 2O8CA 1WXQA 2N42A 3D3QA 1GM5A 3BE4A 3U5ZB 3RS2A 4C7OA 2HLDD 2XB2A 4Z8XA 2BEJA 4M8NE 2D7DA 5G3ZA 2A9KA 3QY0A 3K9NA 1N6HA 4B71A 1Z2AA 3GJ3A 5C1BA 4Q1CA 1EWRA 4B3FX 2NO0A 3RSOA 4MA4A 2EYUA 1UEJA 2VQSA 2QTHA 2OSBA 4IVRA 4JVSB 4M1KA 4Z54A 4V0NA 1LVGA 1ZM7A 4KYUA 1C4OA 1HQCA 2QQ0A 5CYPA 2VBCA 3ETLA 5FBWB 2NIPA 4U02A 5HKKD 3L82B 4URUR 4PPNA 3TQCA 4FCWA 3AVOA 1IN5A 3HP1A 1P72A 3B1XA 1IN6A 1FTSA 5IT5A 4AURA 2JJ2A 5BYKA 2BJWA 4GRAA 1MT0A 3RC8A 2I3BA 4UQOA 3AB3A 4MUBA 1KKLA 1T0HB 2ZI4A 3SJCA 1TADA 1TEXA 2W2VA 3HR7A 3H86A 2J9RA 1JAIA 2DYKA 5FR1A 2ODWA 3SYLA 1E2LA 4A2WA 2CBZA 2HF9A 1AA9A 4FMCB 1Z6YA 1KI3A 4TQAA 4MITA 5IF9A 2CHQA 1QBKC 1NVXQ 4G1UC 3PR1A 3AV0B 4MH0R 2FE4A 4OHVA 3ZIAD 2D4HA 2H57A 2JJ1A 4RCZA 5GJVC 3A4MA 2W0MA 1ZC3A 4XIGS 5KUTA 3TNFA 4RJLA 4HI0E 4TLBA 2R6DA 1W2HA 1I2DA 4DBLC 1UADA 4YMUA 5SZKB 2QI9C 3LBNA 1GAJA 1MRSA 4G3XA 2EWWA 2ZRHA 3ASZA 2CLSA 2IT1A 4ESHA 3ADDA 4B3BA 3IILA 3GJ7A 1NNEA 1W5TA 2NZ8A 4C4PA 1DADA 3QOFA 3GJ8A 4ZPXA 3NG1A 1DAKA 2JJ8A 2NTYC 4PFSA 5F2EA 2W6JA 4A0RA 2KSQA 3K0FA 3AM1A 1CJMA 4KBGA 5G41A 5FTNA 2QAGA 1L2TA 2DR3A 4TMKA 2VSXA 1SKYB 4Q7JB 2VP4A 3RRNA 1KO4A 1OH6A 2W6ID 1CRQA 2FJUA 1UKEA 2HLDA 1KTVA 2OT3B 4NP6A 2CEAA 1IJEA 3AVXA 4EIWA 4HAXA 1QHHA 1II8B 2W00A 3IPXA 1QDEA 3BOSA 1E0KA 3EZ7A 2RGCA 5HE9A 4TT3D 1PLJA 5DHAA 2WMOB 4H1UA 2LKCA 4MKGA 4PANA 2W6JD 5LD2B 4M1SA 1FP6A 3LV8A 1CTQA 3AGQA 4V02A 1P62B 2ZJAA 5FPSA 3AVQA 4B43A 3QXSA 4MGIR 2VEDA 4JLPA 5GVSA 1NKTA 1XU4A 4JYCA 3P32A 4WOPA 5AR1A 2J5XA 1VCIA 4FIDA 4TLEA 4W9MC 4HDQB 2J41A 3QXXA 2ZI5A 3UK6A 1PUJA 3RS4A 4GDFA 4OBEA 3VMFA 3PUWA 1ETUA 4A2PA 2O8EA 5L3SB 1CBUA 4YMTA 4HLUA 3VAAA 3VX3A 3X1XA 1JNYA 4P3YA 3LAWA 2V1XA 1OB2A 1GNRA 4E22A 1GNQA 2Z83A 4LPKA 1GKYA 2G1KA 3MWYW 3AKCA 5FL7A 1HURA 2EFHB 1XMJA 4F93B 4JSYA 2IYTA 2GF9A 3V00A 4Y0AA 1YR6A 4Q1FA 2ZANA 2PCJA 4JMPA 3TRFA 1YE8A 5CLLA 5J4YA 3IBYA 3DPUA 1NRJB 4WXRA 5UKDA 3W34A 1I4LD 4XVUA 4HUQA 5E95A 4DCNA 4US0R 3RNLA 4DLWA 3AUYA 4AI6A 3PENA 2ZVPX 3K0AA 4IXNA 3GCGA 4OKSA 3EC1A 4ACAA 3Q5DA 3AH8A 1OYWA 3H0KA 1UKYA 4A6XA 3IGFA 3R7WA 3OEHA 2HJVA 4DCSA 1CS4C 4GI7A 2GA8A 3I62A 2ORVA 1Z6AA 3DKPA 3ONWA 1E2QA 1LW7A 3K09A 2D62A 1J2JA 3NVAA 2ZRDA 4KFTA 3I72A 3T5GA 1Z6XA 3WNDA 2WIBA 1TUEA 4LHVA 4A0HA 4Z8YA 1KNXA 2VHTA 4URYR 1L4YA 1XCGB 1W0KA 2FSHA 2QT1A 3OZXA 3QPWA 1G8FA 3QKRA 2GHIA 2V54A 1KDRA 2P5SA 2JIZA 2IS2A 2C5LA 2IYLD 2IF0A 3AKDA 4DUGD 4TMZA 3TJZA 3N2IA 5EP2A 1NBMD 2BBSA 1CU1A 1SHKA 4S2EA 1MOZA 2OAP1 3K0FB 4E07A 1RC8A 5P21A 2IUUA 2MSCB 5IHPA 3B6EA 3TK1A 1N5IA 2JLQA 3REFA 3THXB 2V7QD 3I92A 1O3YA 4P32A 1OH5A 5E7IA 3L0OA 3LQQA 4R2HA 1KMHA 5FUXA 3ND8A 4Q9KA 2ZM5A 3ZVMA 4UNRA 2CNWA 2C77A 4V03A 1M7GA 1RVDA 5JWRA 2KJQA 3U6BA 1ZIPA 3GQBA 1E2FA 4AWXA 1TL7C 5JCZA 2ZRLA 1ONBA 5EJEA 5J4KA 4U7DA 1ZINA 3EG5A 4KCGA 1PZNA 3QE0A 3W8NA 3GLHE 4EPVA 4RCYA 1G8HA 1PLKA 4J0QA 3PJRA 5CYOA 1KJYA 4DSTA 4W5HA 5JSZA 1MO5A 1NVUQ 5LB4A 4BEBA 2G77B 1XPOA 4LC1A 1OFTA 4Q18A 1IY0A 4JSTA 4PHTA 1RYFA 1EX7A 4UXJA 2IYRA 4O0MA 3FWYA 4GP7A 2JLYA 1U0HC 2IXEA 1M1YE 3ADKA 2BMEA 2F9LA 2CDNA 4C0SA 3ICQB 1DBSA 1SVIA 2QP9X 2FSIA 3T1VA 1OT3A 3B78A 4RD1A 5H68A 5LB2A 4PHGA 5FOTA 3BC1A 3X1YA 1XEXB 1IBRA 3FYHA 4K8OA 2QUZA 3CRQA 2FWRA 1ZIOA 2PMKA 2KE5A 2XX3A 4EPYA 4ZO4A 3QF7A 1SVOA 3FVQA 4BLPA 1XFAA 4L4UA 2YHSA 3PVSA 3HWSA 5KNBA 1Z07A 3K53A 5C18A 4PZLA 5L3QA 4ASUD 4OQLA 4F4CA 3CW2A 2NPIA 4JLDA 3UMRA 4DZZA 2AD5A 4X8OA 2OEPA 4B48A 4EUNA 2NQ2C 4BRUA 4P4UA 1F2UA 2AN9A 2BCJQ 2G6BA 4MKIA 3PIRA 3QXCA 5AK0A 5FOUA 4JIMA 4M9SA 3OE7A 2MMGA 3VHXA 4DC9A 5JS7A 4TTRA 3NC0C 5SZHB 4P33A 3TAUA 1VIAA 5AJVB 2J0UA 5KDDA 3T5DA 1E2NA 4LK2A 4RD2A 3QG5A 1R10A 3SBDA 2WV9A 5G40A 2HJGA 4HDCA 3GLIB 2WWXA 1ELOA 3M6AA 1FUUA 4ZI3A 3NBZC 4NCHA 4NKRA 1EFUA 1VYTA 2F3TA 2VSOA 4HAUA 4BFYA 2OFWA 4OYHA 3UWKA 3DM9B 4BLOA 5EP3A 5FPKA 3CRMA 2ZRFA 2P6RA 1MH1A 5EXSA 4TYNA 4YMVA 5KSOA 3EPLA 1DAGA 1G291 4QGAA 3IQWA 4UNSA 3RYTC 2JLRA 3SOPA 4CEJA 3VU9A 4FINA 1XF9A 1ZVQA 3GMTA 2QSZA 4M4SA 1IAQA 2IYVA 1JXMA 3CZPA 3CRRA 3I5XA 2ZTSA 4ZDWA 3C15C 4A4DA 3BAFA 3B5JA 5FH9A 1U0LA 1A7JA 1G21E 3TW4A 1NKSA 3KQKA 1I4TD 4C0BA 2UKDA 4DT1A 3S1AA 5J4LA 4G01B 4KO8A 5AUOB 4KFUA 4NZYA 2O8CB 1BO6A 5EUQB 4BFWA 4Q7KA 5BN3A 2ZYWX 4B32A 3EAQA 2F6RA 1KI2A 4LPSA 3QNUA 3GFTA 2QBYB 4O25A 4AKEA 1PLLA 3B1VA 2ZJ8A 4GPTA 4UJ5A 2CMKA 1H65A 3EIQA 5KPDA 4Q9JA 1R0WA 1SVMA 4QC2A 2FU5C 2RGXA 4LSGA 3UPUA 4D81A 1UJ2A 3PEVA 1DAEA 1R6BX 4MYHA 1Z06A 2C9YA 2AK2A 1BYUA 5FFMA 3MUFA 1VCNA 2XB4A 4GZLA 3SC3A 3ZYCA 2QZ4A 1JR3D 2UZIR 5CIQA 4FCTA 1YU9A 4JJKA 1CIPA 3B2EA 4YC7A 3PQCA 1Q22A 4K46A 4YXWD 3ICEA 1U8ZA 2V9PA 4IXMA 2GTPA 2DWQA 3FPAA 3WBJA 3DMDA 2IYSA 2ATVA 8OHMA 1GL6A 1JQLB 2ODNA 4I1OA 4TL7A 2ANBA 4C0JA 1OFIA 2JLXA 2ZRAA 3PEUA 1GKUB 2RAPA 3KQUA 5C4MA 4URZR 3CWQA 3R9XA 1SGWA 1P7CA 4TL9A 3GD7A 1YR9A 3DO6A 3QVVA 3NC1C 4HB4A 1JAHA 2SHKA 1L8QA 1U9IA 3NEYA 5GJBA 2C8VA 1LFDB 4PC1A 5KU1A 1C1YA 2R6GA 5JECA 1FMJA 1VMAA 3VR5A 4NU0A 3GP8A 1XBTA 2O0JA 3NEJA 2BBTA 1QVRA 4CYMA 1GTVA 5FPHA 1JR3E 2JLUA 2XTMA 1UM8A 4D4KA 3IEVA 4HAWA 1G1MA 2BM0A 5EE5B 1NF3A 1MRNA 1ZM3A 2WICA 1W36B 3AEZA 3W6OA 3KQHA 3A1UA 5AJYA 2OBNA 721PA 1G3UA 3LX5A 2DHRA 1XTQA 1YZUA 3FTQA 4ZKDA 2CLCX 3LXXA 121PA 2CCKA 3EA5A 2FN4A 1P73A 5JJLA 1E9FA 2CVHA 5FR2A 4P4SB 4RD0A 3BD9A 1EK0A 3AVUA 2OCAA 4Q4AB 5EZ5A 2VYFA 2G83A 3K70C 3A58B 4ZDIA 3VR1A 2R65A 2ZU0C 4MYTA 4DLSA 2C96A 5HCIA 2VF7A 1WB9A 3QBTA 3EW9A 3LO5A 4H1VA 1IHUA 1CJKC 3VTKA 1E2GA 2IEYA 3VNUA 1OFUX 4P4TA 4ACBA 2MMCA 2ZE6A 1G3RA 2X19A 4JS0A 2ZRPA 1Z0IA 3GLFB 4BASA 1P5ZB 4LBWA 5BWMA 3GEHA 1CR0A 4GOXA 2W6IA 4BFSA 1K6MA 4G5SA 5A4JA 3QKRB 3THXA 2ORIA 2CHVA 2C2HA 2ZAOA 2ZE7A 3TSZA 1KKMA 1E2IA 4DEYA 3S1AB 2QROA 5EQTA 1OF1A 4QHSA 5D3MB 4Q1AA 5SZIA 2AL7A 2O0KA 4LV6A 1LF5A 1W49A 1GP2A 1XJ0A 2F1RA 3C14C 3FFAA 5EE3A 5FL7D 3SFZA 4TYPA 3B1YA 1XCPA 3LBIA 1KMQA 3SU8A 4FWIB 2H17A 1E69A 3H84A 3W5IA 1GRNA 4BFUA 1KO8A 2A78A 1RRCA 4LYJA 1P2SA 4ZV4A 3VU9B 3GJ4A 2WWWA 3U60B 5LDDC 4ERNA 4A9AA 3ZD7A 3U3KA 2JASA 2ZRCA 3NDPA 1M34E 1OIVA 1K8RA 1XMVA 5FBRB 2FPLA 5TVKA 3WMFA 3P26A 2BKEA 4DT1B 1ZRHA 4Z1MA 3CF0A 4TN1A 2J0SA 2H5EA 2HEIA 2WKPA 2H92A 3BIFA 3EX7C 1X1SA 4HZIA 1XRJA 2JA1A 2KWIA 4DIDA 3AUXA 2QBYA 2QPTA 4JYBA 1AZSC 2ERXA 2DB3A 3BK7A 3CNLA 2GBLA 5FTMA 4MRRA 1ESNA 3WYGA 4E09A 3DVLA 2WIAA 4Q7LA 2WAXA 4C2TA 4MGKR 4MRPA 2ANCA 3N5CA 1T6NA 2VP9A 5TY0A 3VR4A 4ARZB 3KZ1E 1NVVQ 2JLWA 2BM1A 4ASUA 5TV2A 2FZLA 3TSWA 1KI9A 3RS3A 2BIFA 2EFDB 5CK5A 4ZIRA 1JPNA 1U8YA 1Z6GA 2GILA 3G0HA 2ZAMA 1HE1C 3P1JA 2C9CA 4ZDKA 3SQXA 3EIHA 1GL9B 4TLDA 1ESMA 1OIXA 4YMWA 5FI1B 2WSMA 3K0CA 4IVPA 4JBXA 3WNCA 3GLIE 1R7RA 1UKZA 2ECKA 4DLXA 1TPZA 3L8YA 1JECA 4Q9IA 3SR0A 1Q20A 3T06B 4E03A 1NMZA 3CRVA 5JZVA 1HYQA 3WRYC 4FW9A 2W0SA 1DTSA 2QPOA 4OI4A 2W83A 1UEIA 1XNJA 3E5HA 3JZMA 2XXAA 1ZCBA 1LY1A 1DEKA 1J70A 1OYYA 3OAAA 5HR5A 5KNDA 2ZYVX 3DOFA 2IS4A 2X2EA 3RWOA 1P61B 4PO8A 4QM6A 4EKDA 3THOA 2XZLA 3W90A 2JJ1D 2GJ8A 4YONB 4A15A 2Z0MA 1TF7A 3NHBA 4N1AA 5DN6D 3EPJA 3U61B 1QHGA 3EZ2A 3KB1A 4W5WA 3TR0A 2KI5A 1II9A 2A30A 3GEIA 4TSFA 1YVDA 3R8CA 4LYAA 4PSVA 4IOJA 3B60A 3NBFA 1GFIA 4DSOA 4OHXA 4QJ4A 3C4JA 3D31A 3IEUA 3VKHA 1E4YA 1HT1E 3GLFE 4BPBA 2IXFA 4O2LA 4JJZA 4RKEA 3OIUA 1Q3TA 3LRPA 3M0EA 1KK2A 4NCJA 1NMXA 4EJSC 2CK3A 3U7GA 3VKWA 2QENA 1Y3AA 1PJRA 2C03A 5D3QA 4JZKA 1P60A 1XEWY 3CB4A 2AKAB 2NO6A 2FFQA 1F48A 1E79D 2PMDA 1OXVA 3BRWD 1X1RA 5CJPA 5KPJA 2QEQA 1FNMA 2E87A 3A6PC 1U9IC 3QQ5A 2B21A 4TMWA 3MSXA 1G8GA 3IIJA 1H8HD 3LD9A 2VF8A 4CDGA 1V5WA 3U3MA 4C0AC 2F3RA 4F4JA 2QM8A 3KKMA 4KSBA 1GSIA 3L0SA 2VP5A 4UXIA 3DEFA 4ZDJA 3D8BA 4Q1DA 1RW4A 4B47A 1HH4A 1CLUA 4D2IA 2GCOB 1M7BA 3NWJA 3LLMA 2ZS9A 2BEKA 4JKIA 3MLEA 5DO9A 1FFHA 5GJCA 4C0QC 5K8LA 1EWQA 3KUDA 1US8B 3B8HA 4GOJA 5IDVA 3ZZUA 3W3ZB 1DS6A 5DNYB 4D0LB 4DCTA 1FTNA 2GBLC 2Z4RA 3CR8A 3SHFA 2IX3A 2A5FA 1MABB 4NYJR 1ZYUA 2DFNA 2YWEA 1Q1ZA 3QENA 3EZ9A 1W5SA 3ZH9B 3SS8A 3UKDA 2ASEA 3I5YA 2QAGC 2AKYA 2ZS8A 1ZM9A 2RKOA 3FGNA 1AS2A 3KXKA 1E2DA 4B3XA 3A1WA 2WJGA 3W3AA 5DN6A 5JHGB 4I4LA 2WOOA 2GJKA 2ZSBA 5FOVA 1RFLA 1RJ9A 1NSFA 2IYYA 2ZITA 4JBWA 5FBVB 3WYFA 1E1RA 1M74A 4Q21A 2IW3A 2OV2A 4DUGA 4PHHA 1W7AA 1CR1A 1W47A 2A3RA 2ZQ5A 1JALA 1VECA 3N70A 5EXXA 2RGNA 1YZTA 1HQYE 1KI8A 2QSYA 2IXGA 3HYRA 1MR3F 1N0UA 4Q9HA 1AN0A 4EPTA 2HYIC 3X1DA 2G0NA 1WRBA 5FUVA 4TLAA 1ODFA 3PFIA 5FI0B 1BIFA 1G7SA 1YRAA 2PLFA 4QG7A 2WKRA 2AWNA 5H1YA 4TSFD 4UKDA 3BJIC 2V7QA 2ZEJA 1NY5A 4KYIB 1WA5A 5KSYA 4QRHA 1RE0A 3RLFA 4IOKA 4L16A 5LPNA 1PV4A 4EPWA 2YJTD 1KI6A 3Q7QA 2VH5R 1XXHB 1EFTA 3HYTA 3L2OB 4W7SA 4B33A 3WHLA 2BCGY 4ZCLA 1DG1G 1ZMXA 1ZNXA 2B7BA 1QHNA 4FXPA 4LYFA 4QBFA 4CEJB 1XD2A 5HPYB 2AWOA 4KV9A 4IDOA 1E2MA 1PUIA 2VA8A 2ZROA 4FMDF 3THWA 4GZMA 2L0XA 2XXAB 4XWAA 2FMXA 1E0JA 3WMEA 1D9XA 2GK6A 3IDQA 2ZYTX 4R7ZA 1TQDA 2OBMA 5CDFA 1W2GA 4V0LA 2W2XA 4PAQA 1T5LA 4WIAA 1KJWA 4I81A 4NCNA 3RRMA 2ZI7A 2ZR0A 1WP9A 4TZ6A 1BKDR 3THYB 1XMIA 3AF0A 4NYIR 3VQTA 3A1SA 4G5OA 1CR4A 2C99A 1YQTA 2WWYA 1RRGA 3FHCB 3KXLA 2R2AA 2BVNA 1XPRA 4JVNA 2R44A 1XEFA 1BOFA 4Q7MB 2IYXA 2X2FA 3BWDD 4RKFA 3GLFA 3DKVA 1FP7A 2XZOA 1GKIA 1OXSC 4QJ5A 4DB2A 3ZD6A 4HUTA 3A8TA 4FD2A 3OE7D 2D7CA 1Z0FA 3PEYA 3EWAA 1XWIA 1EX6A 1Z28A 2YWGA 3CPJB 4CF7A 3GJ5A 2NGRA 3RS7A 3FFBA 2PJRA 4IKEA 2ZU6A 1ZM4A 2BC9A 4BFTA 1KI1A 2PZGA 1FOEB 1US8A 3HU2A 3E2IA 4M1OA 3A4NA 1KDTA 4A36A 1Z0DA 1U98A 3GJ6A 3MGCA 3W6PA 4PQYA 2G88A 4ZCMA 2CCGA 2CL7X 1I2MA 2IUSA 1EFRA 1NJGA 2OUKA 3U44A 2JJ2D 1X86B 2ZRMA 2RGDA 3OESA 5GVRA 3U7HB 3DM5A 3FHOA 3MRSA 4ABYA 2GEDA 2GRJA 4DXAA 4F7WA 4LY6A 2F9MA 2PH1A 1EXMA 5IRCD 5FPTA 1OSNA 3L0PA 5H8WA 1G8PA 2F43B 1M6NA 1VDZA 2QG6A 3X2SA 1OXUA 4JLJA 2IS1A 4NCKA 4KJZA 1JBKA 5E7MA 4V0ME 1AIPA 1W36D 2V3CC 4JT2A 2RGNC 2ZJ5A 1M2OB 1IQPA 1QG2A 4ITRC 4LGMA 2XEXA 1ZCAA 3QSYA 4O2RA 3O8BA 4IFBA 2ZJOA 1DVRA 1A82A 4BWYA 1ZM2A 3BH6A 2P2LA 4NYIQ 2YOHA 1CULC 4RD4A 1IOZA 3SNHA 2GZHA 1E4VA 1SVLA 3IPYA 4C9BA 2ZJ2A 2AXPA 2GETA 2GF0A 3SFVA 5L3QB 1VTKA 4ZIRB 3EZ6A 2IHYA 3GEEA 2WZQA 1DO2A 2EQBA 4PQRA 4POAA 1A1VA 4Q4LA 3T15A 4BE7B 4LJ4A 3ADCA 1KO1A 1XXHA 2GZAA 4NDZA 2QGNA 1KY2A 1ZD1A 3FHTA 2F43A 2CJWB 5A5GA 4H9GA 1W36C 2QRZA 1Q44A 1XEWX 621PA 4LOAA 2J87A 5L3RA 1XEXA 1PVOA 3NH9A 4I1SA 4HB0A
chains in the Genus database with same CATH superfamily
1IDOA 3ZCPA 4P4GA 2RH9B 1XI2A 3I6YA 4XQCA 5IJWA 2CLOB 1RFGE 1Z47A 3LQ1A 1HWYA 5LM3A 3SWWA 2P7IA 1NBME 1O96A 5CA0F 1PKEA 5IG2A 2GCNA 1SH7A 3NDJA 3BZUA 3M1AA 3NVDA 4IHJF 3L7BA 2GO1A 3DA8A 3GYGA 4ZRNA 4LE0A 2W2TA 4RY0A 4C4ZA 1Z7WA 1UMKA 2RK4A 5IVDA 2P7HA 3CGWA 5K1ZA 1GZVA 3FMOB 4QT0A 5T4FA 3NDBB 2C7BA 2B7CA 2BFEB 2V0CA 4I6EA 1A77A 3B82A 1QUEA 4HUJA 3G17A 2QV0A 1PD0A 2ASVA 5I45A 4BO0A 3OQOA 1G6HA 3OCJA 3WS7A 1ZSYA 1TC2A 7YASA 1UOQA 5EZYA 2X40A 1U1FA 2GDJA 3GFBA 4XJXA 5AXBA 4LXIA 1WV1A 3R7FA 4CLEA 5KVCA 1DLIA 1OBVA 5ITZB 3WY9A 5LKRA 3LECA 5FWDA 3C3MA 2FFAA 2VP0A 3X1JA 3QKWA 1T15A 1UBEA 4FHGA 1WPGA 4Q3EA 1JDUA 1N36B 1E5LA 3QLUA 5K6AA 1L7EA 1H93A 4K81B 1RCTE 2XBMA 1I6LA 1UBCA 4X3CA 3P71T 4TGLA 1L5OA 3VNVA 1GDDA 2J3IA 2SCUA 1UFQA 2HIHA 3PUKA 4ILKA 1RRMA 2D1YA 2PKYX 4WZZA 4AJNA 3TCNA 4MRVA 1W4BA 5C2JB 1VRCA 3OZAA 5E7JA 4TS4A 1G5HA 1D2MA 1XB2A 4DA9A 1KVTA 1OZHA 2RHCA 1FQOA 4NBSA 4AP9A 1EA5A 1OX5A 3PUVA 5IABA 1NVAA 3CTPA 4XOUA 2JG3A 1YJ8A 1J9GA 3HY3A 1NRXA 2CNLA 3I64A 4JVLA 2QYHA 1L4HA 1EXNA 3B9QA 4GHWA 2OFPA 3WGUA 2Z8YA 4S0XA 3SF0A 1IULA 4CQMD 1J8DA 4F1KA 1NIPA 2YBDA 3A1VA 5AIAA 1DOAA 1UFRA 1UZNA 4C4OA 2Q8PA 2KM1A 1IXKA 3OQBA 1NJ8A 1W2WB 3QXHA 3S81A 3AR5A 1AF4A 2JAUA 3DE0X 2SNIE 3L7KA 1FPMA 2F1IA 5BQOA 3TPZA 1EZZA 1JHUA 1Z0KA 4DWWA 1Y7IA 2Y2UA 2BI8A 2C5HA 2VBIA 2ZIXB 4IIYA 4ER5A 3WLJA 1POXA 4MLDA 3QX8A 2W8BB 2ZTMA 5IC6A 5TARA 4NH0A 1BEUB 1Z73A 2VG8A 3BVPA 3UMVA 1P4GA 3DTNA 1F6BA 1ODJA 3K0AB 4I55A 4UQLA 2FDCA 4TRNA 5CW2A 2ZBFA 5LUAA 2BE9A 1BVYF 3F47A 3C2QA 4KGVA 4L85A 5IAJA 4ZMSA 4LF9B 2EW1A 4U7TB 1T9HA 1LXCA 1T6BY 3EVCA 4GMXA 3WOVA 4J2TA 4CCSA 5LQNA 2AKEA 1F8XA 5E4FA 2PD4A 3T5PA 1VBFA 2HV8A 2NZWA 2VC2B 3IODA 3KP1A 3KSAC 2QR2A 2D74A 4OJQA 2V9CA 3I1YA 3M6FA 5CT6A 3GJSA 1O9GA 1WDKA 2ODQA 5D2CA 1BHJA 3H0CA 3NIFB 1MCZA 4MA5A 5T41A 4MYRA 3AT1A 3RK4A 1N6NA 4I3FA 3TLGA 3ANLA 4MO9A 4LDZA 1PR1A 4MW9A 1BGXT 3ISVA 2RB4A 1M1YB 2C98A 2H52A 1KBOA 1MRZA 3G2OA 1P5JA 2AFIB 5K8VA 3UM9A 4LFCB 4YNBA 1Z0UA 1MGOA 3L7AA 4ZANA 2P6NA 2OHVA 5SV2A 1BMTA 5ILQA 4DYVA 5IDWA 3Q8KA 4MPRA 1OBCA 4EB6B 1W4RA 3I1IA 4WZAE 2IPXA 4OB7A 3GFGA 2YWBA 5KTOA 1H2ZA 4BQEA 4PPQA 2ZIVB 4G86A 1E99A 4XIYA 3SMVA 1J2TA 1P3Y1 1T9BA 4AG5A 3I34X 4K9KA 2BFDB 3DBLB 1ZXXA 4DCPA 3UJ8A 1KZ7B 4DLTA 3QVGA 4RXTA 3CX7A 3PPWA 1PJTA 2WD7B 3QHQA 1Z3IX 3GLHA 3B3FA 2YIMA 1I3NA 1EFLA 1K3TA 3O8RA 2JI6A 3RDPA 5JLJA 1CFJA 1WDLA 3MT8A 4MVJG 1CSEE 4LKRA 3I2HA 1V8ZA 2IPMA 4A92A 5JPDA 1JVSA 2FY8A 2KBEA 3COPA 4ONEA 2UUOA 2V58A 4IZ6A 1GA6A 3QA3E 4KO1S 4G84A 2ZCJA 2VDRB 2VT6A 1T3GA 1JSZA 1PWXA 3D4IA 1DBWA 3EIWA 4GS5A 2Q46A 3FNHA 1V8OA 1XQWA 1I01A 4MV4A 1VHWA 3EIUA 3CH7A 1X2EA 2XUPA 4LX0A 3GARA 4FMCF 3GRZA 3QKUA 4LJ8A 1EUDB 3K71B 2MHCA 3N28A 2P5YA 3E1KA 2FV8A 2WOJA 1AQLA 4HX5A 1X1DA 5HRCA 2LWIA 4RA9B 4UD6A 5ECGC 5JCXA 3B13B 5AKLA 1D8TA 1OQAA 1EM8B 1QE3A 2QRKA 3ETGA 3OZWA 1R88A 4OGWA 4XQ0A 4BXOA 1SHZA 1JIIA 4EHAA 3G5TA 1GGVA 1NNI1 3JRXA 3KJFA 3OQIB 3CE6A 4D96A 2H63A 2A88A 3X43A 4ZOCA 1P7VA 1EA7A 2ETXA 2ZBEA 2FFBA 3HYCA 3ORYA 3NJRA 4O02B 4TMFA 3S0JA 3TWOA 3U7RA 4CG0A 1QVAA 2C4TA 2JEOA 1ISIA 3A37A 5C46F 1YZVA 3ILHA 1R18A 1DQNA 1PFKA 3UB3A 1SRQA 3DXXA 3D1LA 4V0MA 2IU0A 1Y7HA 5LYJB 1ZD9A 3QUBA 3T1QA 3VI3B 5E3HA 4I8DA 3ZV5A 5I8WA 1FF9A 3U16A 4GF5A 1SO8A 1GL7A 2QRVB 2YNMA 3V4FA 3GRVA 3IQXA 5BN1A 1N6OA 1H2RS 4YP9A 2EBFX 4AMBA 1ECLA 3M1YA 4NQRA 2O0HA 3PK0A 5BT9A 4AJ2A 1MVOA 1IQRA 4R81A 1QC5A 3C3XA 1X6VA 1PJLA 3D8UA 4RENA 1T2EA 1DI0A 3A4LA 4B2PA 1DE0A 4Z9BA 4FBGA 2EX1A 4Z6KA 5KMGB 5LLTA 3TVTA 5L7TA 3TZCA 4L7QA 3KD2A 3NW9A 3P0IA 5JSYA 1U0EA 1MF7A 1OOEA 2YC4C 3N2YA 1XTPA 4FC7A 1FDTA 2FZEA 4TTPA 4U39A 3LLSA 3ENQA 4CEHB 4CE6A 2V7GA 4MMXB 3L0CA 4X6YA 4BQQA 1Y4SA 2J0UB 3CR3C 4XEHA 3T3MB 2CUNA 3TECE 4B1FA 2PBZA 1KSJA 2AD1A 5HFJA 4B3TB 1IN4A 2XIJA 3C6YA 1N2SA 3DFFA 3FPJA 2XZPA 3UOGA 3ZCXA 1VE7A 2YWFA 1G19A 1GQQA 2ZSKA 3FBTA 1U3WA 3MTGA 3EFOA 1G5PA 1P1RA 4QQ8A 2G9NA 3U4DA 3M4ZA 2C2BA 2J85A 5TMPA 4M9ZA 1CEYA 2KS6A 2V5UA 3OPVA 4I4NA 4LCBA 1ZGCA 3MEQA 2QTNA 2YIDA 1C9KA 1QNLA 1EDBA 2HD4A 4ZYVA 4GNKA 5DI9A 3EULA 3PWZA 1W4AA 4PG5A 2G0TA 2G5GX 3LNTA 5GAJA 1KYWA 1N3IA 1NA5A 1NR7A 4FK8A 2QYOA 1ZOOA 2WT4A 3PRHA 3G0BA 4AF7A 5B3AA 1BA3A 1QRAA 3P0EA 5BNIA 2JAQA 2CE7A 1N5JA 2N3ZA 4KVGA 3WLLA 3PICA 3GFFA 1E6MA 2GYWA 2J6HA 1BCSB 1X7ZB 2V6JA 4M54A 2FUCA 3U9SA 3EXFB 2XMZA 2Z2XA 2OBLA 4QUKA 4C1BA 4YT4A 3K20A 4BGIA 1M5RA 3AEQB 1CQZA 1FP2A 3MRTA 3ANXA 4ENUA 5EKSA 3FHJA 4D7AA 4EUKA 2VJKA 1AT1A 1YDGA 1QH9A 3P9YA 3RVOA 4ZV7A 3EXEA 4MS1A 1HEIA 3IVCA 2RBGA 3KLMX 3NAGA 4WFJA 2GN8A 4PLTA 4K6MA 4DKXA 1QGDA 3WAKA 1P9NA 1YONA 4ETMA 2F1HA 1X7HA 4KI0A 1OI4A 4DLAA 4CNBA 4WWHA 1N5LA 4IDGA 2I2XB 3EB9A 1TM4E 4LZOA 4LOHA 2VSYA 3FCOA 5FTLA 1HNXB 5CLGA 1MTOA 1PFWA 3VSBA 1Y1PA 1Y8RB 1QIHA 2RSLA 4RHEA 2Q9AA 3HYNA 4G0YA 4GPZA 5C8XA 3O92A 1WM1A 2V8OA 1W4ZA 4OXQA 4XASA 4PBTA 3BGVA 1T3SA 3NOVA 1MN6A 3UTCA 1JHZA 2O2IA 2E85A 4ZI7B 1E98A 1NAHA 1N2BA 5GONA 4ZI2A 1EFCA 3VAYA 1C80A 4LSMA 3FI9A 4BMOB 1NN5A 5K0LA 2PZEA 2W7TA 5HXAA 4FEGA 1S3FA 1CJUC 1XLTA 4Q4CA 1A8QA 2YY5A 2EU8A 3TLXA 1JJVA 4G8BA 3F6CA 3F5MA 5DHFA 3GNQA 3EZNA 4G5YA 3E6AA 5A0FA 1EEXB 4NE9A 3IE0A 3Q8XB 3D4NA 4BOYA 5FA8A 1N75A 1RNLA 4O1HA 3OQIA 4MYDA 1B3RA 3BWVA 5EIAA 5KHAA 1J42A 1Z35A 4GQIA 5DM4A 3H2IA 4MPTA 3RYCA 3MZ0A 1CZRA 3FYUA 1U7ZA 3HA2A 1OC2A 1W52X 2I2WA 1YQXA 3O8LA 4KH1A 4L76A 3MWLA 2KW5A 5FHRA 3G82C 1EB9A 5HA5A 2R5FA 1B74A 2WHXA 3GJYA 4AZTA 1L9KA 3JWIA 4BRWA 5KTKA 1P1IA 2VYND 2Y1WA 3NXSA 1P19A 1IK6A 4UU0A 4KKXB 1P4RA 5JDCA 2XKKA 1O87A 2R66A 3T99A 2E2WA 2NV2B 4DXDA 2WIDA 4KVAA 1GTSA 4HOYA 1OY1A 3SNKA 1NPTO 4IUDS 4F3YA 1KDZA 3BH7A 1NXXA 3BS4A 3FVVA 3GF4A 3KO8A 3FCUB 1PHPA 4HB2A 3UWOA 3SEAA 4TV8F 1OCEA 4JEUA 4Q47A 4E1VA 2JAOA 1P4AA 1W34A 5KOIA 1X92A 3SMQA 1A5ZA 1THTA 2A5JA 3ER6A 3F6PA 3ONDA 4OM8A 4QODA 5JH7B 3DDCA 1KIAA 1NOKA 1P4SA 5CFQA 4KVFA 1NW3A 4KREA 3ZW8A 4QM7A 5EQJB 1FYWA 1ZQ1A 2LCFA 3A11A 4GICA 3LWDA 5AXAA 5L3SA 2OFOA 5KDOA 3KLPX 3NWPA 1GR0A 1KK3A 1QH1A 2NTJA 4U3JB 3ZQ6A 1DUIA 2WWHA 2ZRKA 2PKQP 3GVXA 4HDMB 1MDFA 2FH5B 3COSA 3WNQA 2NP7A 1Q1AA 1V7QA 4G6ZA 1TVEA 4A0SA 4JB3A 1RJGA 4JJGA 9LDTA 5KVAA 1ZNQO 1E8MA 4HNUA 1S6YA 3T5CA 3K5IA 3Q7TA 5KQSA 1DQSA 2BHLA 4V3CA 1M2KA 1WHTB 2AG8A 3D6TB 5LJIA 1T3ZA 2OZVA 2FTKE 1M1NA 3UMJA 1A8IA 3LX8A 4D4JA 3QE2A 3C7CB 5AJXA 2WK1A 1HSZA 4LJRA 3HTXA 3VVLA 1AMOA 4KVZA 2H9IA 2QTWB 4EKYA 4YV2A 1TRHA 4C21A 2XMSA 1ADGA 3ASYA 3H5WA 1SD5A 3MGGA 1RRPA 2VQEB 1M8PA 3H5RA 4ZCRA 2LBPA 4WXPA 2YQ4A 1USKA 1DOZA 3PSAA 2NSJA 3L04A 1GCOA 3UG6A 3WLSA 2XDWA 5DN9A 1L8XA 1IXRC 2GD1O 2OFXA 2ZLBA 4LBVA 4GI3A 3FKQA 4PLHA 3S2EA 4CQNA 4YUXA 4PN3A 4FZVA 3HU1A 2GLUA 3LKBA 5FD8A 5I48A 5CITA 1UOEA 2VPIA 4MS1B 1IG3A 5DYWA 3ZCVA 4HBGA 5M2QA 4FW8A 3FVWA 4D4HA 4LI0A 2VF4X 4QYMA 2L17A 3K1TA 2VOJA 4L4YA 2C8LA 3NUGA 3DMTA 3PDHA 3VU3A 3PLNA 1U11A 1HKUA 2PEYA 3AF4A 3E15A 4MWBA 2QMYA 1NYTA 2X9VA 4B40A 4PNEA 5G0WA 7REQB 2P6MA 4DDWA 1QZTA 1QLJA 4QHYA 1G3MA 4QYXA 4DQ0A 1MX5A 4P8RA 1QKKA 1YJCA 4HY3A 4TLLB 3C3JA 4WJLA 2BGWA 5LL6P 2HYDA 3D4OA 3STWA 1JILA 4NK5A 3RSCA 2JGKA 2FZWA 5AJWA 3R75A 4FHEA 4F11A 1SVWA 3JD2A 5THXA 5EUBA 1D09A 3UH0A 4TKMA 3OUZA 2HF8A 2BEVB 3OIVA 1E9AA 2PWYA 4E08A 4HLDA 1NATA 4B0PA 3DMYA 3S7ZA 1WPRA 4BP1A 4R0NA 4RVCA 1M6YA 4RFVA 2UUBB 2CJPA 4KXXA 2QY6A 2F9FA 1JH8A 2ZBVA 3D3EA 4OHWA 1P9RA 1L8OA 1XRSB 3GROA 3K9HA 1X19A 3AEUA 3U3OA 4YCSA 3J80A 5BQ3A 3ADBA 1RXIA 4KR2A 2CNOA 4XKJA 3OG9A 5K3SA 3O75A 2CLFB 2IXDA 2PXHA 4YK7A 2CD7A 4ND5A 2G3YA 2ZUBA 1BXKA 4W8GA 3EGCA 4MARA 1M2HA 1TAGA 2A1IA 3FB1A 2EP7A 4MNTA 4YRCA 3TUZC 7ABPA 3OLYA 1QGYA 1M8GA 1IY2A 2W4IA 1FS5A 2ODBA 1ETHA 3AW8A 3C98A 3MFYA 2PQ6A 1A5TA 3AIIA 3MJRA 2DBRA 3BORA 4P35A 3HCAA 4NHEA 3ITKA 4YJHA 4L0MA 1YRYE 2VHQA 3KVRA 1RBMA 3V4LA 3DWEX 2PU5A 2XAUA 2YV2A 5GIOE 3CSSA 4BTVA 2QMUA 1PTJC 1TLTA 2ZAGA 5DM60 1DEAA 2WD8A 2X1LA 4I1SA 4RPIA 1G9XA 2J3KA 4OMCA 4HWGA 2FK8A 3CX6A 3QMMA 6Q21A 1AM4D 2PT5A 4Z1MD 1I32A 3LDAA 3SP1A 1PSDA 4AMVA 5F4BA 4BDTA 1U2DC 3C4QA 1C9YA 2WVJA 2ZQYA 4D56A 2CZQA 2Q3MA 3OZGA 4G0PA 3EXHB 4KZPA 5G53C 4Q1VA 2VDJA 5ETJA 3E70C 3WWYA 2ZUCA 1NLYA 4OO3A 1F12A 1ZMRA 2IHUA 4YCBA 5GJWC 3IO5A 1Q2XA 2K6GA 4KIGA 5A7GA 3TH5A 3A27A 4XE5A 2PBRA 4EFDA 1VI2A 4WHMA 5FP0A 2OAEA 4DR5B 5FUWA 1OLSA 2Y77A 2X4LA 4PYLA 2O54A 2JI4A 4Y2TA 2G8LA 3CRZA 4PSKA 5HMMA 2QU8A 2JAPA 2FEKA 1MOSA 2D6FA 4L15A 2CVQA 5I9LA 3IV9A 4HP8A 5KS2A 3DOHA 1HEUA 5F5LA 3UHPA 2YYZA 3AVPA 1UFVA 3HFSA 4MR8A 1BE6A 4XYEA 1Z0ZA 4QAQA 1AGPA 3RFVA 1P0PA 5HIJA 3RHFA 1XJQA 4LBZA 4CIDA 1IJBA 4Y9TA 4B8YA 2D06A 2DHDA 1G16A 4KIWA 5FKJA 2J33A 3F6RA 3QJGA 3CLKA 4K3VA 2O2YA 1A8SA 3DD5A 3S1LA 1K8XB 4HWTA 1J06A 3U2QA 2P65A 3A6HA 1P0IA 2GAAA 2OD9A 4HWKA 3GV0A 2JB9A 2GPTA 4OPMA 3ZLTA 1RKUA 1C8BA 3G8CA 3LCJA 1S1CA 3NOXA 1DXYA 2YV5A 3A4TA 2MDTA 3ADOA 3HA7A 3CRW1 2JFUA 4UHCA 3UMCA 1THZA 4AY3A 1CLEA 3SDZA 4CQLA 3PKZA 3G68A 4DBLE 1TNDA 2GM4A 2H16A 1X7ZA 2P40A 3QJ5A 4BX8A 1RWXA 2JHFA 5EOVA 3EEYA 5E2BA 5JEEA 5H70A 4AT1A 2JLAA 1GEEA 1BMFA 3Q3HA 1KY5A 2DPGA 1PFUA 2WSYB 1V45E 3K73O 4HYEA 2QRLA 3RODA 1V8PA 3A9UA 4EDHA 5BPFA 2WTXA 4L9AA 4JLNA 3ABZA 4I1YA 2HRRA 4UATA 5C37A 1II8A 2VAWA 3JQDA 4LHWA 3Q6IA 1E62A 4QDUA 4DG9A 5JD6A 1ZH2A 5L9AA 1L5VA 4A8JC 4CI9A 3LXRA 3BCUA 3O8OB 2CVOA 2A9RA 4ZT5A 3ERCA 3ZCRA 2V7VA 4LF5B 3GA0A 1C3EA 3D5TA 4LQLA 2NO7A 2IZ5A 4YP0A 3V2GA 3V7UA 3ASUA 3HCOA 1WL8A 1CF2O 4BECA 2XCRB 4Q19A 1P77A 4LOKA 4QXOA 3KDSE 1VKJA 4RZUA 3LLCA 4UCXA 1LWNA 2FZKA 4BO4A 1EE9A 2H0QA 1DUSA 5KOYA 1EWYA 1VMKA 3J81k 3HK2A 3THWB 4OSPA 5IKMA 3WGOA 2CFTA 2XNDD 2CNDA 3ANYB 2YZ7A 4M22A 5D7NA 1NBAA 5C0OE 2W11A 4IQ4A 3TTSA 2LW7A 2ZI9A 3GMIA 1P6XA 4A10A 2FPIB 2VJBA 4WLNA 2IKQA 4E5SA 3EDCA 4EGQA 3L0BA 3DBHB 3BCSA 4KXVA 5DBFA 4AY4A 1BS9A 1T5OA 1MZPA 4LYYA 4YO7A 1RQ7A 2O2EA 4GAEA 4OXNA 5DK6A 3RSGA 4DUYB 3GFPA 5EKXA 3TRHA 4XDZA 4DWOA 4ZI7F 1A71A 1V6SA 4YMHA 3IBGA 1B16A 1J8VA 3HZHA 3LK6A 4Q00A 3LW7A 2QAJA 1PWEA 3RVRA 1P9LA 4D80A 3IDAA 3UJ6A 4ENRA 5J4HA 5K01A 1G1AA 2B4YA 5BSMA 2JH3A 3RFUA 4O29A 1JLSA 5HTKA 5KDLA 4U6SA 3Q2IA 4LRTB 3VR4H 3PUYA 1E6WA 1Z12A 2BE7A 4IUCS 1E3QA 2ZE5A 2MJLA 1EKXA 4ZCIA 3S2SA 4S35A 3W5BA 4CIYA 5E0KB 4MVJM 1HRDA 3F3YA 2KLBA 4PZPA 5LBIA 5TJ9A 5J23A 2Q62A 2EBHX 2R8YA 4PSAA 3T61A 1YC5A 2JFPA 4X63A 3RV4A 5I5GA 4J1TA 3T5AA 4G5XA 2X22A 4U2DA 4DG5A 1Y4ZA 5G4LA 1BKSB 1VP3A 2MSDB 2WWTA 4LWOA 4DLZA 5C80A 5C8ZA 5CCXA 3MN1A 1UKBA 1BXRA 3RS8A 1KZGB 1DJLA 2J08A 2ZTUA 2X8WA 3BM5A 3HWX1 4JJ7A 3V8EA 2IDKA 4B35A 4I5GA 3DCJA 2W6OA 1H8ED 1TAQA 3I9V6 3R5XA 4LHSA 3WWEA 4BO9A 5SZJA 521PA 3AKEA 5C5IA 1Q1BA 5C7LO 1OH8A 221PA 1GZ3A 4RPKA 2WRZA 4PZUA 2ZYDA 2BGRA 5AVTA 3G5AA 3EIOA 4XJTA 2WNHA 4R54A 1DBIA 1Z83A 1SJ9A 2I3AA 3JV7A 4UZEA 2PZAA 4CTMA 4PWYA 1A98A 1HETA 2QUHA 3BMXA 3A06A 1D0VA 5JO9A 4PLCA 2CCJA 1Q7CA 4ZOQI 5AT1A 1LLCA 4LDJA 5DBEX 1TAUA 1ENZA 3CZMA 1CVLA 1A9YA 3MWKA 4GFDA 1WQ3A 3V8VA 3BDIA 3KEMA 1U90A 1T0JB 4JVMA 1T1EA 3FX2A 3A6ZA 3MXTA 4B6PA 5KNCA 1AGNA 1U7XA 1WMDA 1X42A 3HXKA 5BNWA 1RAAA 5TE9A 3TTXA 1WXHA 1I9CA 1J1IA 2H9AA 3EIXA 5K45A 5K6RA 3RO7A 2IELA 2FOLA 4KMRA 1FBTA 2HREA 1CB7A 2FQXA 1I1QB 2HU2A 4WT7A 2J30A 4URVR 1W0JD 4I1RA 3F74A 2WV7A 3WFIA 4YAIA 3DQZA 1U5BA 2H1FA 3GQVA 4PZZA 3DAFA 3W05A 3IURA 4ZYZA 1XP8A 1ZA1A 2HRZA 4Z7JA 3MBKA 1OJLA 1OD6A 3VR3A 1AQUA 5F5XA 4QIHA 4OHMA 2Q8QA 2DCUA 3AB7A 1DQPA 3OCUA 5FBQB 4UZSA 4Z51A 3ZJ4A 2WYUA 3SE0A 1Q91A 4ARAA 3I3OA 1URPA 2PKQO 3KSZO 5I9IA 1L7DA 1QHXA 3DNFA 5H3LA 1O8BA 1XZPA 4BNLA 4U7PB 1F0PA 2X7HA 1XX6A 2IHNA 5BUZA 3TZQA 1B8VA 1WABA 3G7UA 2V45A 3PITA 1GQOA 1JQDA 1HDZA 2GD6A 3R6WA 4CHTA 3IQDB 1RIFA 4PXYA 4WK2B 1TIBA 2WD9A 2PN1A 3F0TA 3EMBA 4O4HB 3G49A 4P80A 1CZOA 4E94A 5LZ2A 5C5CA 3DBIA 1T4BA 2DFTA 2XTZA 2GVZC 4KWHA 4Q03A 3R20A 4BP3A 1S5PA 1HE3A 4YI3A 5B57C 1ZN7A 4U0JA 4X8HA 4B5KA 3SZUA 1YQ9A 4KAJA 4A82A 1EYZA 4BQPA 4BZZA 1Z5ZA 1E7QA 4YRFA 4A26A 3QKSA 2CZCA 4MVJP 2JLSA 2EL9A 3VC7A 3VJMA 4RJ2A 3B1KA 3X1WA 1UWCA 1G4UR 1VYVA 3ESBA 4FYPA 4HQFA 5SYNA 3H8WA 5B6IA 1YL7A 2QN1A 1I80A 3NBMA 5C1IA 4CUJA 1B1CA 3LL7A 3GDWA 1OWMA 3ESQA 1N0IA 1VHLA 5BMVF 4RZ3A 2FN3A 4W99A 3M5WA 1OI3A 3DF9A 2HAEA 3JR3A 4BX2A 3L7MA 1GGJA 1UDAA 1PG0A 1Q5PA 4CIXA 4BE4A 2OCIA 4IGEA 1ZNWA 3PQDA 4ZICA 1DBPA 3M9WA 3ROMA 1WPXA 2FMTA 4X8MA 2YV4A 1OYVA 8GPBA 3KIPA 2RKWA 2YR0A 3ABOB 1SXJA 3X1MA 5EXPA 4DIKA 3UXHA 1E94E 1DG9A 3EGWA 2ZPTX 4EB0A 3T35A 3AUJB 3D2BA 4PC3A 3MOGA 3N2EA 3OOWA 1DB3A 5LQSA 5DI3B 1LRKA 4X1IA 3GHHA 3TKLA 2BELA 3BG5A 3JD3A 3ZVLA 1UBOS 2O5EA 1G18A 1R0SA 2JFBA 3K1JA 4N7BA 4R9VA 4URHA 4HDRA 4AZVA 4URXR 4KFCA 4EGJA 3DCNA 4NBTA 3UJ9A 1NXTA 4QFDA 1XDUA 1BDHA 1T8TA 3ZH2A 1D8AA 5LA6B 3STTA 4TVOA 3USES 2JW5A 2Q3JA 5TC4A 3GB9A 4GR5A 2QX7A 3NAQA 1Y82A 3NTQA 1ZNZA 2O8BA 2V6MA 4F4UA 4A8JB 3ZHYA 4FHFA 2NVUB 2PT9A 2B78A 1CY4A 1CV2A 3IEMA 2HMAA 3SM9A 3I61A 1P2UA 1Q7GA 4D02A 2J3EA 3KOYA 1LLFA 5D3ZA 1OAOC 4KYTA 5JUWA 4UEQA 3TVDA 4O4IA 2VR1A 5ALKA 5A6SB 1QHEA 4PLFA 4HN4B 5KBYA 5A62A 2YC2C 3MMPA 1KZHA 1CUWA 5IZCA 5BVGB 3AHHA 1ADBA 4LCEA 2FJPA 2AC7A 1JIQA 5IAEA 3WICA 5DWVA 4M21A 4BE9A 2VXCA 5LQMA 4RO0A 5CIWA 4YEDA 5GY7A 2K5UA 3QMPA 1J0EA 3WRYA 1SBTA 4I08A 2HB6A 4OXKA 5DI3A 3V7NA 3MJDA 3IVXA 3WKCA 4R71A 3OOYA 1FUIA 2GJAA 2W37A 4PG7A 4HJXA 2C97A 2QMEA 1ESCA 2AFHA 3GAMA 3ZD9A 4KPUB 4BP9A 3NM6B 1ZUNB 2NZ2A 3ZHVA 1AUPA 1ZH6A 3CWCA 4QWWA 2BM9A 5DVZA 2XJ9A 3VI4B 1N8KA 4CLOA 5HCUA 2QY9A 1FZTA 4YRGA 1N25A 4FKBA 5AVVA 4G8CA 1V48A 1BD3A 1YDMA 3A2KA 1DFIA 2YWXA 3QF4B 3OEWA 4DXHA 3ZKAA 1JQ5A 2GVDC 4WCFC 3SY8A 3QBEA 3H04A 5LR6A 2X13A 1P80A 4JYZA 3PQEA 3RSLA 4GWLA 4ADSG 2PUBA 4LTDA 2OSVA 2VJYA 4BUCA 4E5MA 4M7RA 5ARBA 5GTDA 5JAUA 4NAUA 3LPDA 1KNQA 2HMSA 2JGMA 2YYAA 1D0SA 4LFBB 1JMVA 2HQRA 3N7UA 4DV1B 3CLVA 1SM4A 4LVNA 1V3QE 3FPCA 4JLVA 1OKKD 4MB2A 4WECA 4Y2HA 5GV7A 3RTCA 5K3FB 4I1UA 3R1IA 3WGTA 1JT9A 2BMJA 4H3VA 3FM9A 2UV8A 3SJAA 2MINA 4L5BA 3UMFA 1UOPA 4RL6A 2XWQA 2R60A 4J3FA 4Q01A 3DULA 1FQWA 1B6TA 2VHWA 1K4MA 5EEHA 4YMLA 1Z22A 4P36A 3RF7A 3ZLJA 2A5GA 4POOA 2D5LA 1N9ZA 1QOQB 4IFTA 2GBPA 3I6BA 1S96A 1F1JA 1KEKA 2G36A 2B8TA 4N49A 2C5SA 3GGDA 1PVVA 4KOAA 4QYIA 5DNVA 1JG4A 2LXNA 4FFPA 4NJEB 2H1HA 1A9QA 5F2KA 2C57A 4LHYA 4XH9B 3U19A 2VDWA 4BMXA 1U3CA 1QG6A 3RC3A 4OI2A 5ITZA 4ZXPA 1ML3A 5AKZA 1Z74A 3GOHA 1QQ6A 4IIFA 3ZX5A 1TGYA 1ZW6A 2I4IA 5I5EA 4Y2YA 1I5OA 1DX4A 2OZPA 1T0UA 3BZBA 2DBVO 1CY0A 1W59A 4WBSA 1E3DA 2PH3A 2Y1CA 4QUHA 2R8PA 1IUPA 4F71A 1DJMA 3F1LA 1V43A 2I4MA 3KQWA 3WNBA 2FR8C 1DELA 2N1MA 3AKYA 4W5JA 3UH1A 1MABA 2FI1A 2ZBUA 1QYIA 1G3QA 1GPYA 2QRMA 2X1VA 2ZIXA 5LP6A 2CK3D 2BJHA 2Z5GA 3O91A 3PC2A 4X8LA 3UK7A 2I22A 2C29D 5DLPA 3NCHA 3K31A 3LC7O 3ZU3A 3H7IA 1U8AA 2RE8A 4RSGA 1I5EA 3GDGA 4BJ1A 2NAPA 2DKNA 1FBNA 2PLWA 1CQJB 4BCDA 4GOMD 3ESXA 1MV5A 1YZKA 3RS5A 3A0RB 3EDMA 2XMDA 1RIIA 4CDMA 3FIJA 2Q6TA 4WY2A 2UU9B 1S02A 1Y3CE 1U9ZA 2VXBA 1N0VC 1Z5WA 2FRDA 1M10A 3MG9A 4A8PA 2WKQA 4M9QA 4DDTA 5K4GA 4PO9A 3NBYC 1X1TA 3H9BA 4XLTA 5B58C 4JLOA 5CFZA 4CEHA 2PSSA 1RE1A 4U2BA 4RADA 3D64A 2PL5A 3UJAA 1RJEA 2W8BA 4IIVA 1UAYA 3BTUA 1YHNA 2OXIA 3VYTB 3NKVA 2R7LA 3N0XA 5KYKA 1A4XA 1S1MA 3G2KA 4HGZA 4YLGA 2FZ5A 2XSZA 2IEZA 4ZEXA 3W6NA 1IDN1 1MXFA 3B2QA 3EISA 4RZQA 2JAXA 3RRZA 4CETA 1H2EA 1V16A 1X8LA 3STUA 4Z3OA 1VE9A 2Y1OA 4EYEA 5J2TA 4BCBA 5L7YA 3L7DA 1QG4A 4QPDA 2W6MA 4MRNA 2HPAA 2QD5A 4G5RA 1XQ1A 5JSZB 1AHNA 2Z30A 2WIJA 1AXGA 1QZZA 3MTAA 5CAEA 4E88A 4TZ0A 4I0WB 1NN3A 4WTOA 3ZHZA 4LHZA 3UHAA 4TTTS 2DFPA 3KDAA 1R0KA 2NVBA 5KC9A 3NLLA 2GWHA 1JG2A 3M3DA 1N5RA 3L9XA 1J4AA 2ZREA 2XTNA 5B5SA 1FIUA 1UBJS 3LLUA 3VJRA 1SAYA 1S8FA 4NENA 3AEQA 5CNKA 1RM4A 1GITA 3TPCA 3I3SR 3NDIA 3O4FA 3O8QB 5IBRA 1QR6A 1THMA 4HNAA 4EAQA 3JWGA 1GEGA 5ITWA 1C9JA 2M1ZA 2XMGA 3VPAA 2FQWA 1IC6A 3H1EA 4RF3A 3GFRA 1L1EA 1LK5A 4MP6A 4F4HA 5A5EA 3P4YA 4BNFA 2QJFA 2WNIA 4RPCA 1J09A 3U1VA 1HA3A 5BR4A 2D5CA 2Q2WA 2A5DA 2UVQA 4P3PA 1SKBA 4B3JA 5DH9A 2O14A 2WI8A 5TQJA 2Y93A 4KPGA 3N7TA 1IWBB 2VLIA 1BXGB 1T5DX 4EW6A 1VXRA 4KITB 3Q3EA 1EVYA 3ORSA 2REOA 4BWFB 2PK3A 5AI8A 2HR1A 5AVJA 4M99A 3OLVA 3IA7A 3TFQA 4PQGA 5BSGA 3QKSB 4CL3A 1E6LA 1NONA 5IK2D 4W9NA 1K7SN 5BN5B 2QN7A 4LCJA 2WVHA 2GHRA 3D5EA 2Q5FA 3A7DA 3HS3A 3ONEA 4GP9A 1XA3A 5J5VA 3VSEA 3FMIA 1ARZA 1DDOA 2BY4A 2CFSA 3GRKA 4I19A 1IY1A 1FSGA 4FFVA 3VH3A 4AJHA 4R9UC 4B3RB 1ZZEA 1T2NA 1XHLA 3O3CA 2OCLA 2VZ9A 4F56A 2M6KA 4EPXA 4F4FA 3K70B 1D04A 4KQ2A 1OV6A 3W3AH 3UFXB 1SG6A 2Q49A 4HB3A 1DBRA 1PX2A 2Q3BA 1IOLA 2XGSA 2O2ZA 2Q5EA 2A5YB 4K88A 1NFRA 4BNDB 2JFVA 2C04A 3ABIA 3FSGA 1WZUA 4FSXA 3ROKA 4EFLA 4P1ZA 3ZK7A 1DAHA 1XJCA 1HZJA 3JTEA 4YAJA 1Y9JA 3U44B 3O0DA 4FNAA 4FSHA 1ZHFA 2BT4A 2FLVA 4YQZA 1LZLA 3TIGA 4BVJA 5FUBA 4MK4A 4B6FA 3UYLA 3BH0A 4HDRB 2O8DA 5EIHA 2Z8XA 1U0JA 1HY3A 3FNEA 2JKZA 1SUEA 3DTVD 3PXBA 1ESZA 1NVDA 2POCA 4EA7A 2AJTA 1CJTC 4PF1A 3QFHA 3JRNA 2X6QA 3D3QA 3PNYA 4R7TA 1ISFA 3RS2A 2W42A 4C7OA 1MC5A 3NCTA 4DNOA 4BEWA 3E9QA 3KZXA 2A9KA 2NP6A 4B71A 2NV0A 3ZGYA 4Q1CA 5ALZA 3RSOA 4WDRA 1JZSA 1UEJA 2EYUA 3AXTA 3P94A 3AHCA 4M1KA 2EATA 1U9YA 2X58A 5IYZF 1HQCA 4NH4A 3GRAA 3T3PB 4AUKA 3NFRA 4X94A 4OHCA 3BWYA 4DMFA 4MHTA 4U02A 2AYYA 1OLUA 1ISGA 2JBAB 4FCWA 3EAFA 3RRFA 4YXFA 3WLNA 4JHXA 1GAEO 4UHKA 5DLDA 1FFDA 4G4IA 2JF0A 4OFZA 4ZXFA 2JJ2A 2X0FA 1R4MB 4MVJD 2D1RA 4GRAA 4FLFA 3W2FA 2VBGA 1B0PA 4P7GA 3SDBA 2V0GA 1JH9A 4RACA 3RC8A 1R8YA 3MT7A 1RPAA 4UQOA 3ZTYA 4MUBA 1KKLA 1IBSA 1WVGA 2HL6A 4NESA 4RHXA 4D9EA 3DQPA 1QFXA 3D6UA 1UMCB 2XHZA 1Y1QA 2W2VA 1SB9A 1Y3IA 3H75A 4DNQA 4G23A 2P9QA 1EQAA 4N4AA 2HEGA 3T6KA 4MA0A 5EHXA 1E2LA 3THXA 3IR7A 4A2WA 1FUEA 1NVEA 3WIVA 1KH3A 1V4NA 2V7EA 3SVLA 1KI3A 1VLMA 2JFYA 4C4SA 2QXYA 2V4UA 2BHSA 2PMEA 3R74A 3LS2A 2V6GA 1QF6A 1QH0A 5ERXA 1TZMA 4MITA 4RGVA 1GTJ1 1G2IA 1QBKC 3QX7A 1MX3A 1XVVA 4X45A 4G1UC 2ETVA 4CLXA 5IU6A 3HKCB 4LF6B 2FSVC 4ZK6A 1PJ2A 2DY0A 4OHVA 3ZIAD 4NLLA 2D4HA 4RCZA 5E3JA 3TL2A 3F6EX 3L07A 1CT9A 4JGIA 2PQMA 2QN9A 4HI0E 1D2RA