5IFHH

Crystal structure of the bcr fab fragment from subset #2 case p11475
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
178
Chain Sequence
VQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSIISSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARDQNAMDVWGQGTTVTVSSDSASAPTLFPLVSVGCLAQDFLPDSITFSWGFPSVLRGGKYAATSQVVCKVQHPNGNKEKNVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct homotypic B-cell receptor interactions shape the outcome of chronic lymphocytic leukaemia.
pubmed doi rcsb
molecule keywords Heavy chain of the Fab fragment from BCR derived from the P1
molecule tags Immune system
source organism Homo sapiens
total genus 30
structure length 178
sequence length 217
ec nomenclature
pdb deposition date 2016-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifhH02
4IIQA 2D7TL 2YKLL 3NH7H 1E4WH 4OM0H 2FWOA 1HHIB 1UH4A 1T5WB 3K7UA 2VDLH 2EDTA 1CXHA 4GRMB 2F8OA 3WFDL 1WV7T 1C7TA 4MS8C 1ED3B 3QUXC 3TIDB 1SVCP 5E8NA 3WKML 4HF5H 1FL5B 3FO1A 1PDKA 4L4TB 2QHRH 3EKCA 4P4KC 5ICZA 5IOPA 4TPRL 4RGNB 5HDBF 1K85A 2ZUQC 4K3JH 3TYGL 1YYML 4JM2B 2OMBA 4MSWA 4PJEA 1T1XB 1IAMA 4X5WA 5BO1L 2BRQA 4PG9A 5SV3A 2P43B 1M1SA 1IBGL 4I3RL 3ARBC 1RIUH 4HPYL 3V8CA 3GI9H 3G9AB 4YHKL 1IC7H 3FQWA 4MXWH 3TA3B 4JG0H 3Q2CA 4XX1G 5I1GH 3QCUL 1ZHNB 1JTPA 2X4QA 2AS5M 1BZ7B 2PYED 1A6ZA 3UO1H 5EUOB 4HGKC 5J1AA 1H3VA 2XZCH 1HHKA 3ZMRA 3OJMB 2VUOA 1NAMA 4ODTH 3SDXE 1PKQE 4X7TA 5B38B 2EC8A 5I1IH 1WITA 5T3XD 5KS9F 1F6FB 1CDIA 2Z31D 1YY9C 3PIQB 3ZKND 1IGTA 3MV7A 1UCBL 3UTZA 3SE4C 4M5ZH 3QUXA 2CH8A 1WBZA 2X4NA 1SEBB 5I8CA 4XHJD 4YEFA 5LGKA 3GSOA 5DO2C 4L8CA 4NO2A 4P4KA 1UM4L 4FMKA 3LHPL 5E8OA 3WFCH 4H25B 4LCWA 1X4XA 2CSPA 4YIQB 3MRRB 2JJTA 2HLFC 4F3FA 2BJML 2OX5A 4CL7A 5CJ8A 2IBGA 1KCVL 2EO9A 4N1HB 4QTHA 4X6FB 4JB9L 3RVTC 1D5XA 1PGRB 3ZL4H 3ARBA 3TN0A 3AMLA 1MCEA 4YQXL 1Q0XH 3GKWH 1W0WA 5F72S 4U1GC 3ECBA 1RZ7H 1A7RL 5FYJH 1CK0H 4N0RA 5DJ6B 3LB6D 4LEOA 4OLYH 1KCLA 5FYKE 3EFDL 3U7YL 3LN5A 2DD8H 1QLEL 5CBEB 1RUAH 1ULVA 4YDVB 1DP0A 1IJ9A 4OFYA 5F96L 3B2VH 2BSED 3T3MF 1BQUA 4XWOC 3ETBF 4GXVH 3IDYB 1FNGA 4RWYH 5IB5A 4NRYA 2AJUL 3R8BB 1F11A 2AI0L 3WLBB 2J12B 1EO7A 1UXWB 3F58H 1PG7X 2P5WE 3SE4A 2I60H 3TLRA 2B0SH 1IEAA 1BD2A 1LE9A 2DRUA 2R4SH 2EE2A 1VFMA 3T0DA 4HUMB 5D2NC 5FK9A 4QY8B 2C4XA 3K1KC 4Z7UF 1FYTB 1IGCL 2X2YA 1GH7A 3F65A 1U93A 2ESVE 3UROR 2A77H 3MV7D 4NZRH 5DGRA 3H6JA 3WN5C 1JIBA 1EJOL 3QXAB 4LAQL 1XH3A 3BW9B 3L95A 3EOBB 3O2DH 1F45A 1DQQB 1KB5B 1VPOL 3W9EA 3WHE0 4LCWD 3WV0A 4N0CC 5BRZB 2EKSA 2EIDA 3T2NL 2DQIH 2ZCHH 3AXLB 3MO1A 1XIWC 3TN0D 2E5EA 1ORQA 1LEGA 1XR8A 1NBYB 4MXQC 2YXFA 4BKLA 1CD1B 3L5XL 1QQDA 5GHWL 3MLSH 4M4PA 5C0AB 1E28A 2Y07L 4HHAB 2VMFA 2AJ3B 1OAKL 3BHBA 5EU6D 1GZQA 2EEDA 3LKQA 5C3LD 4BM7A 4OFYD 2GCYB 4KAQH 4YNYA 3VRLF 4HAFA 4JFYB 1RUPL 3TZVB 3MLTA 3BOVA 3MV11 1FFPB 2CKBL 3GJFH 3V0WH 5I1AB 1X4ZA 4HXAH 3IDGA 3MCLL 5BVPL 5I19H 1A4KB 3CDGB 3M17B 2NY6D 1BECA 5CWSB 1BD2D 2V9RA 3IFPA 1MJ7H 1C5BH 1K8IB 2CK0L 4L8BB 2CK2A 3RWJA 2J88H 4PJGA 2EDFA 2Q8AH 3KYOB 3EO9H 1M05A 5D5MF 3QUZA 5F70A 1ZHKA 4CKVX 1EK3A 5GGQH 3KPMB 1Z2KA 1N8ZB 4W4OC 3TVMA 5E2UL 3LRGA 5MI0B 3WLWD 2FZ3B 1S9YA 4KUZH 3U1SH 1UKTA 3IXAA 5DMKB 3TJHC 2Q1EA 1MI5A 4X6DF 1J0HA 2Q87A 3D39E 2Z92B 4P9HH 2Z8RA 5C0NC 1FGVL 3OXRB 1GCFA 2CLZB 2X89D 1MHHA 4J3TA 3U7AA 1ZHBB 3B43A 3THML 4L29A 1OAZL 4X4YA 2YPLA 1LEKB 1DANU 4PRBB 3SY0A 4I8DA 1OTUC 2E27H 1TVBB 1NCAH 4JDVB 1JGVH 3W0WB 4S0SD 2ED8A 3P4NB 1BVKA 3DXAB 4NM8H 5E8DH 2OM5A 3VXUA 2R2BA 3QIUC 1YN7B 1HHHA 4Q9CA 3QCVL 4LPTA 2VKWA 4Q97A 4OLVH 4KMLB 5IB4B 1PLGH 1QYGH 2X44D 3U4EB 4ZNCD 1RJYA 1NFIB 3CFDA 5CCKH 4G9FA 1BPVA 2H3NB 3LY6A 4AEIH 3JZ7A 4K7PX 1K6QL 5D1ZB 1I4FB 4NQEA 2OJEB 4HKJA 3ARTA 1VEMA 3CH1A 5EBMA 5ACZA 5DD5L 5GS0D 4JANA 1FORH 3ZDYE 5DVMA 3LKPB 4ZG1A 4X99B 4ZAKC 4JO1H 4HQQL 3QUZD 2D2OA 3PL6C 3ALXA 4RMVA 1JUFA 4WFFE 4XVSL 3TVMD 2BOBA 4UIMB 4JDTH 3T3PF 3KWWA 4R8WL 8FABB 4HKBB 3GRWL 1PY4A 1J05A 4K3EH 5LJYH 4XC3L 1JTTA 2FATH 2PTVA 2LQRA 1YEJH 4P5MA 5JR1H 1JZ2A 1ZT1A 1WT5A 3QQ3A 1CIUA 3W39A 2OI9C 3QXWA 2JCCE 5C0DB 3LV3A 4RQQB 1BX2B 3VXTA 5ENWB 2IF7A 3H3BC 4PJ5E 1TPXB 1H5BC 1TZHB 5BXFB 3VFMB 3QIUA 2IH3B 2YPLD 4OZHA 3NOIA 2Q3ZA 3VFSB 3CXHJ 3MV8D 2FIRT 4NFCA 1TETL 4OCMC 2V6HA 4HC1A 1F6LL 1B0WA 4QHKJ 3L1OH 5CINH 1N4XL 4ZS6D 3VXUD 5ANMA 4L3EE 3SDAB 2QQKH 3U79A 1SY6A 3GMNA 1X9QA 3JWDL 1UWXK 5CJBA 1RZFL 4TSAL 2EDJA 2WWMC 4ZDHB 2VDOH 4CVXA 2D7PA 4NC1E 4NKDB 3SDCC 5HHMD 3PL6A 4G9FD 1M7IB 4Z5RB 3STLB 4YO0B 2WZPD 4UUJB 2ZNWA 2ZPKH 5C0BB 1IKFL 5I1KH 4OZGE 4PUBL 4ZQKA 5HHOA 3NZHL 4P46B 4FOMA 1I7ZB 2QKIB 4XGZB 5DEFB 5F1NB 2B20A 4H88H 2C4FT 3KPLA 4IMLA 3RX5A 1MHPH 1DN0A 5DD0L 3VU2A 3GFUA 5T33H 3SKNA 2VOTA 3ZT6A 4PJ7A 4DK6A 1MF2L 1V7MH 2OXHA 4PTUB 4DEPB 1PEWA 4L3CB 2ZCKL 3BT2H 3RJQB 1H5BA 2X4OB 4LKXA 4Z7WB 2EEBA 4JZJC 1X7QB 4ONFL 4YDIH 2ORBL 3QFJD 4WUKL 4XCEB 5C92A 2ZP0T 5TGBA 3EZJB 1F4HA 3WKNA 3T0VA 3HC4L 5GQBA 5IW1B 4ZOAA 2FCBA 5DJYA 2RHEA 1KCRH 4JQVA 5IJVA 3OKKA 1AO7B 3DETD 3FHQA 1I9RH 4DKEH 5C09E 4HUUA 4FQLL 1F4XH 1TCMA 3RVXC 1P4IH 5EOQH 1QRNE 3SDCA 3AREB 3D9AL 3FO2B 1EO8H 4MD5B 3L3JB 4DZ8A 2B5IB 5KSAB 4ZUVA 2PUQT 1S78C 1KFAH 5DLMH 3R06A 1YYLL 3D3VE 5F9JA 4LLVA 3Q6GL 4HS6B 1ZT4B 1QBMH 4F7TB 1KIQB 4J3VA 3SO5A 3WL9A 1MCDA 1LMKA 1YEEL 4S1RL 1GOGA 4OF6A 2W9DH 4NKOB 4BH7B 3BKYL 2FSEA 5ESQB 3V4UL 1AGEA 5KOMC 1A3RL 5FA3A 2YSSB 4KMQA 4BFIB 1HXYB 2XFXB 1KELH 1WVZA 2X4PA 4LRIC 3CMOH 2CXGA 2AXFB 1OAXH 4M48H 4BELD 4NO0A 4WY7H 4P2QB 4H1LH 3OXSB 2FJGB 4G6KH 2I9LA 3TFKD 1G7MB 3VXRE 4JAMB 5CMAB 5D6CA 5I8KH 2FBJH 3PWPD 1T89A 4BFEA 1OAQL 3KPOA 2G75A 5J9PA 3ARQA 2V9QA 4KI1A 3V8OA 4BQ6A 3UTSB 1U8MB 4K7PL 4JZNB 1N64L 3VXOA 4AENA 4UT7H 4RRPG 5A40E 4Q9RH 5FGSA 3QHZL 1LE5A 2EH8L 2GAZB 4HS8H 4P2YA 4DUVA 1HZHL 2VXVL 1G7LA 3O6KH 1OARL 5JPMA 5ISZE 4XCYA 3LH2H 4HIXH 3VRJB 1YMHA 4NRXA 4LNRA 4XBPA 3RTQC 1E4XL 2XN9A 2WLZA 2G5BB 4O2FA 1WBXA 4F8QA 3BEVB 5GGTL 3O2VH 1Q72H 4LSRH 2O26U 2P5ED 5K9OA 5KVFL 4DN4H 3SE9L 3E6HB 4TSBH 3GSNL 1NLBH 2ZG1A 2A6IB 4OLUL 8CGTA 1ONQA 3KLSA 3S5LG 2YEZB 3OGCA 4KJQC 1N59B 1XEDA 2VXSL 3FL7A 4UV7L 4X0KB 2HRPH 4UAOB 1CZ8H 2A9MH 5DJDA 5I17A 2I27N 1FG2A 2ITDB 3O4LA 3S6CA 4XPFH 3DUUB 4X5XA 1RZKC 1IC5L 1CLCA 4NO0D 4WTWA 1OCWH 3ZE2F 2OJZL 5EBWA 4P48A 3ZO0A 4MAYB 1XCQB 1F3DJ 2DYPA 5D1QD 3LN4B 2BHUA 1X5ZA 4IJ3C 1YEDA 5BJTA 4YGVA 1QSEB 4JJHA 4CNIB 5F3BB 1MQKL 2VDKH 4KKCC 3BN9D 3U2SB 3VJ6A 3C5SA 2FGWL 1CG9B 3ZTNL 3MBED 4X98B 2VDRH 3LDBB 2ATKB 5D2LF 1U2HA 1DQDL 5IR1A 1AGBB 5DT1H 3VMOA 2R69L 4X83A 2C5DC 3U30C 5BOZG 3D1MC 5IBTL 1SYSA 2FWOB 1TQBB 4KQ4L 1INEH 2G60H 4DN3H 3K2UL 3CVHA 1AI1H 3LOWA 4L8DA 4QEGA 5E8NB 3OJDA 1ZGLA 4XMKH 3WD5L 1CICA 1FHGA 3FO1B 1PZUB 2XN9D 2FIKA 2Z8SA 3TBTB 5H2BA 4EI5D 3DIFA 2FRGP 4N9GA 2X4SA 5IOPB 3MQIA 5C6TH 1HSAA 1NFDE 5EFIA 3MA9H 4WV1B 5ADPH 4BZ2H 4TUKL 2Y5TA 4PG9B 1UM6L 4RFOL 3RKDC 4P5KA 5I2IA 5EWIL 1I8MA 3SGEI 5IMMA 1NCNA 3CZJA 1TJHL 4Z7QE 5AZ2H 3FQWB 3EW3B 2IAMD 1V05A 2MCPH 5F93C 4TULH 3O4LD 3MUGB 1BAFH 2DM2A 2X4QB 1A6ZB 2IQAA 5J1AB 1N7MH 1JI1A 1FBIL 4PRIA 1HHKB 2DYPD 2PTTB 1NAMB 1AHWC 5KTEL 4JKLA 2XTLA 4X7TB 4NUJA 4XMLH 2HT3D 3HNSL 3AROA 5I18H 3U48A 1A1MB 2HVJA 4UDUA 3V6ZA 2F53D 5IF0A 1IGTB 2NMSA 3MV7B 3UTZB 4CW1A 4Y4HC 5A1AA 4R26H 4FXLA 1JF1B 2XTJE 1F90H 3I50H 3JSSA 3QUXB 3WS3A 5F44A 4CMHC 4D0CB 1WBZB 2X4NB 5BZDA 5I8CB 1CU4H 2OBGA 4I0PC 4Q2ZA 3GSOB 4L8CB 4NO2B 4P4KB 5JA9A 5FO9A 4HJ0C 3RBGA 4Y2DC 1ITCA 2BRRH 2IBZX 2VUYA 4JE4B 3WO4C 1NLDL 1NBZA 3V52L 3BH9A 4F3FB 1RULL 5TQ0H 4QTHB 1U95A 1CICD 4UDTA 5K93A 1CF8H 4ZYKA 3NAAL 3QXTA 3ARBB 3TN0B 1P69B 4HMDA 5DRXA 3JWNC 4X9IA 4LVOC 3ESVF 4LEOB 4LSUH 2GFBB 2RB8A 1H8OA 3TBWA 3CIQA 1DQJA 3S35L 1JCKA 1GHFL 4OFIA 4X6EA 5HD8D 3WMSA 1SJXA 1KB5H 5C0RH 4FP8L 5FECA 1AHWA 3STZA 5F9AC 1B2WL 1HKLL 2AW2A 1PKQA 3VWJC 3QUYC 2A9NH 5DVLA 5JO5A 1FNGB 1R3IL 5IB5B 3T4AA 3RP1A 1EFXA 1S7WB 4NRYB 4FQIH 1F11B 1BFSA 1MJUH 3IETA 4R90H 4DQOH 1H9VA 5TQ2L 4BSJA 4PRID 4JQIL 2NY6B 4UOW0 4JVPA 2AXHA 1IEAB 1KC5H 4PJ9A 1BD2B 1A9EA 1LE9B 4G8EA 1X5YA 5MEQA 1DUYA 2B2XH 2OZ4L 4JFHD 2IGFL 5FK9B 4PB0H 1MUJA 3L3DB 4RMTA 5TJWK 4HV8A 1I75A 3FZUD 1U93B 1OM3H 3PWNA 3UX9B 2FR4A 4NYLA 1MFNA 1MJ8L 4PJHF 4F57H 3IXTA 4ETQA 4OCYL 4PJIA 5H37H 2VZVA 1G6RB 4JGMA 1XH3B 1A7PH 3L95B 1L7TL 4M9OA 3OAZK 5EC1A 1C1EL 1FZKA 3W9EB 4HCRA 4U1GB 2V2XA 1F8TL 2R2HB 4PY8J 1YUHA 2VR9A 2EKSB 4FXGB 3MO1B 1WIPA 3U9PH 1ORQB 1LEGB 5H94A 2A6DA 4BKLB 4O4YL 1QQDB 3VWJA 3TESA 4PJAA 1E28B 3DX9B 4PREA 3V95A 4OTXL 2EH7L 4FFWD 5KSVB 3BHBB 5GZNC 5FGCE 1PX4A 1GZQB 2QL1A 3LKQB 4YXHH 5L2KA 5IFHH 1P5VA 4Q6IA 3RWHA 3CAFA 1NMAL 4WFHE 3QZWA 2R9HC 1O5DT 5D2NB 4DKFL 3EJZD 1AXSA 3MLTB 2AQ1A 3PP3H 2HMIC 5GJSL 4M00A 3U82B 1EEZA 1RK0B 3IDGB 4KQ3L 5E2VL 3L3KA 1QNZL 3SDDC 3VW3H 3VCLB 4PJ9D 3VG9C 3WN5B 4X6CE 3IFPB 4HUXB 3V5KA 2SEBA 4NNPH 1RHFA 1J11A 3LCYA 3MLWH 3MJ9H 4WNQA 4QRRA 5FHAH 3TH2T 3QUZB 3EYOB 1ZHKB 1T21A 1NBVL 4R4NC 2WBWB 5D7IF 3TVMB 4GUPB 4ZFFA 3C8DA 1DBBH 5DSCB 5EA0L 1TENA 4ZTPL 3U0WH 2PW2B 5SWSE 1S9YB 4OGYH 2NTSP 2R4RH 3VFGL 1AC0A 1UGNA 3IXAB 1TTGA 4TVPH 5EU4B 1MI5B 2OR9L 4JFXA 2D31B 4PS4L 3HFML 2Q8BH 2IFFH 2A6KA 5FYKD 1HYSD 1MHHB 3GB7B 5EO9A 3VGGA 3FTGA 4POUB 4L29B 5LBSH 4X4YB 5ILTL 1R3HA 5GZOC 2GW5A 1N3NA 3CC5A 5J13B 4H20L 1S7TA 1IT9H 3IJYA 1ZMYA 5E2JA 2RFXA 5FM5M 4QOKA 4QTIH 4ZO9A 3GMQA 5L2KD 1ZT7A 2P5WD 1BVKB 2BSRA 4D0DA 1DQLH 4JKPH 3ILQC 1HHHB 4Y5YC 4KMTH 5M7QA 5F7NC 2MMXA 1IGIL 4K71C 2WM0A 1RJYB 5IVXE 4APQC 1T4KA 3MLZL 1HQRA 4G9FB 4OCNC 2ESVD 3O3DA 4WUUE 4GW4B 4NQEB 4WI5A 4HKJB 1LO3H 1YJDH 5ACZB 1MCLA 4JRXE 5EIIA 4JANB 3DO3A 2FGZA 4QRRD 3I3EA 3RKPA 3ALPA 3QJHA 2XQYK 4Y16C 3GDBA 4OZIE 3LPFA 1JUFB 4LMQE 2BOBB 2FO4B 3GBML 3NCYS 5JW3L 2BVQA 3KWWB 3QCTL 3W82A 2R39A 5AG9A 4RMUA 1LDSA 3U6RA 5DJXA 2IG2H 4PJ8A 1ZT1B 5C2BH 3L5JA 3QQ3B 2OYPA 3W39B 3OG6B 2V17H 2W9EH 3FQTA 3LV3B 3BJ91 4MXVF 1L7IL 1ZE3C 3ARFA 3HZKA 2VDPL 43CAA 3QWRA 1YEGL 1NCWH 4M7JH 3QIUB 4MB4A 2MWCA 5CGTA 1WEJH 5ICYA 4OZHB 1RPQA 5AWNL 3DRTA 3MROB 1QVOA 4M6AA 2DBJA 3WFEH 5JUEL 1K4CB 4NZTL 2IPTL 3Q6FA 3ZYOA 2NYYC 3MCKA 1AXTL 2DTSA 4JHWL 4S1QH 5I73C 3GMNB 1MHEA 2EXWD 3QRGH 4ZAKB 1X6LA 4CVXB 4U7MA 4RAHA 2WV3A 4ONHA 5I1EL 4I3GA 5JMRA 3PL6B 2VZSA 1EHLL 2ADIB 2W92A 2FLRT 2OTPA 3O4OC 5HVWA 1W72A 5I30H 3EYQD 5HHOB 1NL0H 3NIFE 3QH3B 4M43H 3KPLB 3P3YA 4G3YH 4IMLB 5F6HJ 1DN0B 3BGMB 4AEFA 1FZJB 3HI6H 5DA4A 2J4WH 2OI9B 3SGKC 3SKNB 3D39D 3W81A 4PJ7B 4QT5A 5FYJE 2HWZL 2JCCA 3HAEG 4FZEL 3GO1L 1H5BB 2YXMA 4R96A 1KTLA 4PJ5A 1YY8A 1KTDA 3B4NA 3MGTA 3TC9A 4PJ8D 2KDGA 5E95B 2NY0D 5B8CA 5TGBB 2NNAA 4UILH 4PJCE 4U49A 5TE6H 5TE7L 3ARFD 5DJYB 2Z4QA 4PGEA 3TBVA 5IJVB 3OKKB 2QQQA 3MPCA 3FQXA 2Y1VA 4BSVA 1MWAA 1D9KC 3WUWG 1JZ4A 3HNTL 3B5HA 1BVLA 3CX5J 4L3EA 1JGLL 1ROWA 3MA7A 5E9DA 4HUUB 4C55A 5JIKA 2I24N 3UBXA 2A74A 2I5YL 1JGDA 3SDCB 3SGEH 4LCYA 4RGOH 4GQPH 3RVUC 4ZUVB 2W38A 4C58B 2BERA 2CKBA 2DQHH 4P4RA 1RZGA 1UYWL 3R06B 5FOBA 1BBDH 4LLVB 3UJJH 1KJ2A 1MLBA 4OZGA 4XNQA 2NZ9D 2NX5E 4U0RC 1DE4B 2R0KH 2H6PA 2GUOA 1RU9L 1NC2D 2FSEB 3SGKA 1F4YL 1DANT 2JJSC 4OD2A 1AGEB 4WFFD 4HMEA 4OFKA 3RUGF 5FA3B 1IGML 5E5MA 4HULB 3KPRB 1A6UH 1UWEL 2X4PB 3ZZ1A 3H42H 3IRPX 3QDGB 4Y8DC 2X05A 3KXFE 3QO0B 4U1IA 3JWOL 1CR9L 3S37H 2I9LB 4LNVA 2HKHL 5D6CB 1FGNL 2VSCA 3D0LA 4MD4A 2D7MA 4V2BA 4ZOEA 1RZIA 3KPOB 2G75B 2GY5A 4OGAD 5J9PB 4PJ5D 2WUCH 3PP4H 3MACL 1D9KA 5KSUB 2AJXL 3NCYP 4B41A 3VXOB 1KIUA 3MREA 2XRAL 1D3CA 1T1ZA 5EUKA 1QRNA 5GGSA 5GRJL 1LE5B 1FAIL 1G7LB 4PRHE 3WDIA 4LRNL 4YBLC 4E42B 5JPMB 4L3ED 4XCYB 4JO2H 1MCIA 4LNRB 4XBPB 3GJEA 1I9JH 4X4ZA 2XN9B 3BP4A 3BP7A 4O2FB 2VR5A 1WBXB 3I2CH 2HT4C 1NAKH 1Q9KB 4MNQE 2L0DA 5K9OB 3RPIB 5J3HD 4PGDB 3F7YA 1I1CA 4ZUWA 1U92A 4YFLI 2WBKA 5C0CB 3GMMA 1ONQB 4NN6C 3OGCB 3WFHA 4NDMA 4QO1A 2YD4A 3RNKA 3TO4C 3K8KA 2UWEE 5JZ7C 3CSGA 3JWDC 2VLMD 4ODSH 4GRWB 3TGXA 4BUGA 2ITCA 3ORJA 5DJDB 3VXRA 5I17B 3GHBH 1FG2B 2P8LB 3O4LB 4PRNA 3C2SA 4X5XB 3V5HA 5JHLL 2BMKA 4P59L 2DQTL 3DO7A 5I6XC 4FFYL 4OLZL 2W0LA 4Q0XL 5I1HL 2WAHA 3OF6D 3IDXH 3GRWA 4QHKI 5D70H 5I15L 1YEDB 3NPSC 5BJTB 4YGVB 4Y4FC 4N8VG 1QP1A 1RURL 2J5LC 5DEGA 3VJ6B 3N1MC 5IHZA 2LU7A 3QDME 5I1CH 2HKFH 4UINH 4ZSOE 3BKJH 4EQ2A 1S9XA 2E7BA 1H0DA 3O3AA 5IR1B 5C09D 1VFBB 3RWDA 3T8XA 1QRND 4S1SL 3W9DA 3UTTB 1SYSB 3HPLA 3CDYA 5D9SA 4ZS7L 1JZ3A 3ULVH 2CRYA 1S8DA 3ZKXC 5JTWA 3CVHB 3D3VD 3QPQC 3IFLH 4L8DB 4U7SA 1NAMH 1NANI 3DYPA 3OJDB 1ZGLB 1CICB 4N0UB 4KJPC 5H2BB 3TO4A 4ODUB 2E6PA 4Y5XC 3I6GA 3DIFB 5TDNA 2ADFL 4N9GB 2X4SB 4O2CA 4AL8H 1PX3A 2ICWI 2W9LA 2X40A 1TMCB 3A6BH 1NGZB 3HNVH 4JY5L 5HYSB 1MRCL 2Y5TB 4FQJH 1PZ5A 3MJ6A 4P5KB 5I2IB 1I8MB 3D48R 5IMMB 3PV7A 5JXED 5TF0A 1OP3K 3QNZA 4TYUA 3WIHL 4IJ3B 2GSIA 4YHYB 2ARWA 4Y4FA 3VXRD 5HHQA 4HFUL 4OZFG 5JORA 5SWZB 1KBGH 3CXHK 3D2UA 4XPGH 5C0EB 2D9CA 4PRIB 3QG6B 2H2SC 2PXYC 3LIZL 4KKAD 1MNUL 1IAII 4X9HA 3I02A 4GLRI 5CJXA 4NUJB 3KDMB 1PSKH 2R1YA 3U30B 1UQSA 1FNHA 5KSBB 2HVJB 3V6ZB 5IF0B 4MA1B 3WUZA 43C9B 3VGEA 1U8QA 1HHJA 4ODHH 1CXIA 2BXYA 5JIIA 4G6ML 5ISZD 4HSQA 1B4JH 2ENYA 3I3DA 3WS3B 4PRPE 5BZDB 4OD3L 4Q2ZB 3KG5A 4IMKA 1FC2D 4EN3A 1SM3H 3EYUL 4Y5XA 3QG7L 2QQNL 3S36X 4DFIA 1I9IL 2VLRE 4IBLT 1QLFA 3AY4C 3RVVC 5B4MD 4ZXBC 4DZBA 3BH9B 3E2HC 5C0JA 3VI4E 1NFDA 1U95B 4K94H 4NT6A 4UDTB 3FB8B 2P8MA 4XZUA 2ZUTA 5DRXB 3OQ3B 4IRZL 5DI8A 2BX5A 5CILH 2QBWA 3TBWB 3ILPA 2VLJE 1DQJB 3MX0A 2UZIH 2DM3A 4NJ9H 2GYSA 4K9EL 1G6RH 4X6EB 4OCWL 2PXYA 5E99L 2YD9A 5F21B 5BMFL 4QNPE 5FECB 1AHWB 2HJFB 4PPTA 3F12A 5SV4A 3H7BA 1JNLL 2J8HA 4E41E 1PKQB 3NCJH 5JO5B 3RPKA 3T4AB 5HDQH 1EFXB 2PETA 5AYUH 1S7UA 1U8IB 2QSTA 4CMHB 1A9EB 2HH0L 2PO6A 5JHDA 4G8EB 3ULUF 1LO0L 2BVOA 4W68A 1YN6A 1MUJB 1CLYH 1KJVA 3CFCH 5DHXB 4HV8B 1H8NA 1UJ3C 4MA3A 3AY4A 2VAAA 4JGUA 4Y2DB 3QDHA 4ZO8A 3PWNB 4JPWL 4KVNH 2FR4B 2R15A 4NYLB 1PQZA 3IXTB 2IQ9L 1R5WA 4PJIB 3M1BA 4O58H 1EZVY 3B9KC 3KAAA 5HGAA 4EN3D 5K9KB 3QEHB 5EC1B 3BQUD 4Z7NE 1MCCA 1FZKB 2D9QB 4GAGH 4KZDH 2FX8L 4LVOB 4I77L 3O6MH 1YUHB 4J8RA 2EDEA 4J4PA 1TTUA 1FRGL 5ECJE 2BVUA 4JZOA 3L5WB 2BVTA 2R56H 3QO1A 5GS0H 2XG4A 5LGHL 1TLKA 3DV6A 3HMXA 2A6DB 1A7OH 4FMFA 1HNGA 1A3QA 3VWJB 1T0MA 5TDPA 4PJAB 4PREB 1QR4A 3MRLA 1FCGA 1B9ZA 2DIJA 2HTKD 4OFVA 1GSMA 5L2KB 4LPVA 4Q6IB 1QO3A 1A6TA 3RWHB 2Z0BA 1SJEA 3QZWB 3BRGC 4R7DA 1AXSB 2AGJL 3V6OC 2RR3A 3MRHA 1NCBH 3EO1B 3EDKA 1EEZB 3L3KB 3RIAF 4POYA 2WWKT 1KYOJ 1JHTB 1NDGA 4OLWL 4MA7L 3ZE1F 4JFQA 3CFEA 2PO6D 2XTJD 3V5KB 2SEBB 4M9PA 1JF5A 1CQYA 3RRQA 4JQXC 4QRRB 4WNQB 4NNXA 5CKGA 4JPVL 3FOLA 3LS5L 5I8OL 4GBXC 4G8GB 5B39G 1NFKA 4ZFFB 5KOVC 4XCCL 4QCIA 1A6VH 3VWKD 1SMOA 2YA0A 4HWEL 5EULV 3C60D 1OPGH 3G5VB 3DGGB 2F5BL 3EOYG 4YDKH 5JDJA 4PP1D 5IBLD 1WK0A 2A6KB 2YUVA 1A5FH 4J4PD 2CIIA 2OCFD 4UU9A 1DDHB 5EO9B 4F9LC 3DPBA 3FTGB 1DBKH 2DLEA 1EV2E 4L4TE 3KYNA 2O93L 1R3HB 3V6OA 5FGBA 1N3NB 2BY2A 3CC5B 1EXUA 3HUJF 4QRQA 1S7TB 2VXQH 2DLHA 4MQXD 2RFXB 4RGNE 4CVUA 3QJFA 4QOKB 2DJSA 4UV4H 3RNQA 3GMQB 3SDDB 1ZVYA 1ZT7B 4OV6F 4TN9A 5CEXB 2BSRB 4YH6A 3VG9B 3WXVL 1UWGH 3M45A 1E6OL 4DTGL 4JQXA 4IOFC 4IRJC 3E8UH 3WSQL 5CEZL 2APXA 2KBGA 3S4SG 1FDLL 1JFQH 1HQRB 4NCDA 3AFLA 3O3DB 2W60A 1F4AA 1QBBA 1J1OH 3FMGH 4JVWA 4DGVL 5CD5C 5EUOE 3BWUC 4J6RH 5EIIB 1MFEL 3GEWB 4NKIL 2E7HA 4C54A 4QGTA 4F9PA 5K59F 3F6IA 4RNRA 4U2YA 4IOSD 2BCKA 1VACB 3NFPA 1BWWA 1ZXQA 3RGHA 2Y06L 4U6VL 4MHHI 2BVQB 5AUMB 1SY6H 3HI1B 1CYGA 4G5ZH 4I18C 3IDIA 4WEBL 3U6RB 5DJXB 4PJ8B 1P7KA 5ADOH 4HPOH 1UFUA 2VLKA 4KI5E 3H0TA 2XZQH 3HZKB 1UM5L 43CAB 3VE0A 4M93C 4YBQD 2EC9U 1KG0A 4UZGA 2X10A 4K3DL 3SO3C 3VFOA 1F58L 4WFHD 1TJGH 2GQHA 3DRTB 4K71B 1QVOB 2UUDH 3TEUA 3O9WA 5IQ7L 4U6XB 5JQ6H 1G7PA 3GIVB 3Q6FB 3MCKB 3NN8A 1U9KA 3BPOB 1I3GL 1MAMH 1Z6JT 4KRLB 5ITBH 1DL7H 1YNKL 4WUUA 1ZAGA 2DQJH 3TNNA 4HXBH 1VFAA 3GMRA 4LCIH 1WFOA 4JRXA 3FT2A 4DOHB 4ONHB 1I3RB 4Y16B 3DHJA 2OZ4A 2HFFA 2LV4A 4M5YL 4OZIA 5FKPB 1KUMA 1IGFH 1W72B 4PB9H 1IKNC 5TPWL 4XNMA 1QACA 3NFNA 2ID5A 1GJIA 4PBXA 5SWSD 3VFNA 4MA8H 1U3HA 4LGPB 3ZE0E 1LO4H 4LLAA 1JBJA 2CQVA 3R0MA 1OW0C 1FYTE 3KLHD 2BDNL 4QT5B 2F19H 3RX8A 4XBGA 5JQHC 3FT4A 3MRKA 5DR5H 1BFOA 2HTLC 3UAJD 4R96B 4OLXL 1KTLB 1KJMA 4PJ5B 4X6BA 4XVTH 1GGCL 3LAFA 5L6YL 3S88H 1C12A 1KTDB 3MGTB 3N1QC 3MR9A 4KGJA 1N6QL 1BQLH 3IU4H 1OTSD 1E6JL 5B8CB 2WP3T 2NNAB 1BEYH 2VJXA 3N50A 1QFWL 4Q9QH 2Z4QB 4PGEB 5E7BA 3TBVB 2X4TA 5EO1A 5BRZE 5FDWB 3E3QE 3FQXB 1QKZH 1MWAB 4BSVB 1J0YA 1BVLB 1P4LA 1CFSB 4L3EB 5E9DB 3TV3H 2GSGA 1EO5A 3H9HA 4JFEE 2A74B 1JGDB 3O9WD 1QZ1A 4LCYB 4DGIH 1FNLA 2NW3A 4JDZB 1OGTA 1CFNA 3ZYZA 5C0AE 2CKBB 4P4RB 1RZGB 5FOBB 4NOBA 1F97A 4WUUD 5LKNA 1AQDA 1KGCE 1TNNA 1DBJH 1KJ2B 3FN0H 1I7RA 1MLBB 4OZGB 1MY7A 3WHXA 4JRXD 2IANA 4XNQB 2NLJA 4D0BA 2GK0B 4X4XA 2H6PB 2DQDH 4U6YA 3FCTA 2NW2B 1IAIH 1P84K 4GLRH 4AK1A 1DFBL 4XBEL 4OD2B 3HR5A 5E7FA 2DL2A 2BFVH 5E5MB 5IESL 3JTTA 1YQ2A 1U8NA 4JRYA 4U1IB 5E5RB 4BYHA 2R8SL 1KCUL 4JJ5A 4M1DH 3T09A 4LLYB 5SX5H 2C1OB 5J6HA 3D0LB 3R4DA 4MD4B 4OCRL 4PJCA 1RZIB 1S7QB 4PLKC 1D9KB 3WFBH 1JRHH 2JIXA 1Q1JL 4I3SH 1T6WA 1OGAB 3VRIA 3IJSA 3N9GH 4GRWH 4FQXA 3MREB 1YECH 1T1ZB 1QRNB 5GGSB 4QF1A 3C2AH 5HVHB 1LDPH 5J12B 4PYGA 5IJKA 3AB0C 4ELME 3ARPA 3GJEB 1WTLA 3MODH 5F1IA 4B50A 5CP7A 1J5OH 3BP7B 4U0RB 5F9WC 1KN2L 4XPTH 2NX5A 3PWUA 5I9QC 3O2DA 4HJGA 3VXQB 4LCUA 5F1KC 3W0WE 1UG9A 2EE6A 2YWZA 3F7YB 5B22A 5IMKA 1HOCA 4LSVL 1OSPL 1U92B 15C8H 4ZUWB 3UTOA 3C08H 3L6FB 4F7CA 4A6YL 4PBWD 5AG8A 1RJCA 1DVFA 2Y25A 4NDMB 5KZCD 2NY5L 3RNKB 4U31A 1NMBL 4FFZH 1BP3B 2AK4E 2NR6C 2MHAA 1KEML 4JO3L 5E8EA 2CGRH 3SKMA 4HIJA 3SCMC 4TVPE 3MV9B 2NXZC 5FYJD 3V5HB 1DQMH 2BMKB 2DS4A 4K23H 4HUVB 5T3ZL 1AQKH 2C3VA 3EGSA 2R2EA 4ZD3H 3V2AR 4KHTL 3DVFA 4RFNB 4XNYH 3GBNH 5D8JH 3ULUL 3P0GB 4G8IA 1S9VA 3NIDF 5DK0A 5DEGB 1CDCA 4OGXH 2QSCH 1RZKH 5F7YC 1FYHB 4YBLB 3B5GA 3CFIC 4BZ1L 5JOPE 5F6IC 1SJVA 1OP5K 1S9XB 4FABL 2CJUL 1F3DH 3INUH 3RWDB 2I07A 4FQXD 5GJTH 4AEHL 3W9DB 4AEEA 4OB5L 3HPLB 3KYKL 4EOWL 5D9SB 1I8KA 1VSCA 5IM7A 5FYLH 1S8DB 2YUWA 4P5TD 2DBLH 4XVUD 5F6HI 1E4WL 3BDYL 2A1WH 4NN6B 4OQTL 3ESUF 2D0HA 1ZS8A 3TO4B 4X80L 3WNNA 3I6GB 5TDNB 2NX5D 4O2CB 3HZMA 4NGHL 4HF5L 4GJTB 2UWEA 1VGEL 2QHRL 1FG9C 2BNUA 4TRPH 4Y5VC 3RHWF 5HI4C 3SCMA 1UB5A 1HINL 4XPHL 4JN1H 4NUGH 4H1LG 1PZ5B 5DMJB 1ZLSL 3U83A 4K3JL 5I6XB 1DVFD 4LSSH 2BOCA 4LKCB 2J8UF 4EDWH 1A7QL 4OM1L 1XF1A 3QNZB 2X1WL 3VFPA 3NPSB 4Y4FB 5GGVY 2ZUYA 1A22B 4KJYA 2DLGA 5HHQB 3VFWA 2J5LB 1IC7L 1LK3H 4PJFF 4MXWL 3GHEL 5JORB 25C8H 4JG0L 5DUPL 2PR4H 1I7TA 3BPNC 1UZ6E 3D2UB 4P3CH 4YHLH 1HH6A 3GM8A 4BSWA 4YFLF 2XZCL 5E6YA 4LSPH 6FABL 1IAIM 2H2PD 5KW9H 1UQSB 5D2LA 3O6LL 1JHKH 4N5EC 3NA9L 3ZKXB 2BVPB 1U8QB 4KK9C 1HHJB 5D1XA 5TE4H 5D96C 1DR9A 2COQA 4M5ZL 2IBBA 4XI5D 4Z7WE 2P42B 5D6DC 4Y5XB 4BK5A 3LRSA 1QLFB 4Y1AA 3U4BH 3GGWA 3JV6B 2X4RB 5CJOL 4Y5VA 4MNQD 4FFVD 2CPCA 4LCCA 4KH2A 5C0JB 1BQSA 3WFCL 3MSPA 3FHAA 4XVJH 2AABL 2P8MB 4ORZC 4QXUL 1AO7E 3DBXA 4XZUB 3UYRH 3REWA 2PW1A 4G7VL 4MD0B 4YUEH 2E6JA 1JPFA 3AUVA 1CD9B 5FM5O 3ILPB 5IP4A 3WFZA 5FYJL 1CK0L 2OMNA 3BVNB 5CAYB 4DAGH 4OLYL 4M7KH 3RU8H 3MRQA 1FVCA 1BREA 2PXYB 3VMNA 1YEIL 2V5RA 3H7LA 3HMWL 1RUAL 5CBAA 4HCRH 4PV8B 35C8L 3F12B 2HP4A 5LCVL 3TO2A 4WU7A 3P73A 2HFTA 2MNUA 3ELAT 4UMGA 3B2VL 3C5ZA 2DJUA 3CCHA 1MFDL 3QNXA 5ALBH 4YHNA 1S7UB 2J3SA 3QDMD 3QHTC 4OSUL 3BKMH 5D71L 5KS9B 1R3JA 2XQBH 2PO6B 4GG6F 5JHDB 3U46A 2ARJA 3F58L 5M94B 4PRPA 2I60L 2HA1A 5FO7A 4WWKC 5D6DA 1XF5A 1YN6B 1KJVB 4P2QE 3MOBH 4P2OC 2VAAB 4KRPC 1CQKA 4PD4J 5E4EB 4JM2F 5AZEL 2YMXH 3E2HB 2VH5L 5D1XD 1PQZB 3ARGA 1ZLWH 4HUWB 1ZGLM 1PYWB 3M1BB 2A77L 5MP6H 4NO5A 2EIZA 4RA3A 5HGAB 3DX6B 4UIKH 4KWUA 1Z3GL 2ZNXA 4Z6AT 3UTSE 4G7YL 1V3JA 3O6FC 4J8RB 4LHUA 3K8MA 4L3AA 3SOBH 4HW6A 2E9IA 4Z7VF 1XF2A 3A6CH 1U41A 4OI9A 4KGLA 1NGPH 2XNAA 3QDJE 1JGUL 4KK6C 1X4YA 1T0MB 2BP3A 4E41A 2W0PA 2W07A 2YKLH 3MRLB 3MLSL 4NN7B 3X13A 2EDKA 3Q48A 4JPKH 3QA3A 2XZZA 4M02A 3WFDH 1QO3B 4WENB 1A6TB 4XPBL 3ZHLA 1SJEB 1MCQA 3WKMH 2NY3D 5E6ID 4WWKA 4WGWB 4R7DB 2VYRE 4RAUA 4U1KA 3C5ZD 2AEPL 3MRHB 1UJ3B 1MJJA 5C07B 1IGYA 3V0WL 3HG1A 1NDGB 1YYMH 5B3JF 4JFQB 4Z7UB 4D94A 5I19L 5BO1H 3B2UD 4YK4B 3WIFA 4PRPD 4AIXA 3IF1A 4I3RH 3DHMA 4NNXB 3ZKSD 2VLRD 1P9MA 3RQ3A 3QCUH 1BGXL 3ARGD 1QSEE 2XA3A 1JHLL 5IEKA 4OV5A 5HDLA 5GGQL 3QQ9D 4QCIB 1A4JA 3CFKA 1MFAL 4MB5A 3GSRA 1ITBB 2A6JA 3K74B 3EYVA 4CADB 3RY6A 3HC3L 3QUKA 2XWJA 1UEYA 4LSQL 4NWUH 3F5WA 4UU9B 4RMQA 4P9HL 2JJVA 3OKMB 3G9VA 1KTRL 5FGCB 1MVUA 1LO2L 4WU5A 5HYIA 1KOAA 3KYNB 4E41D 3DRQA 1UM4H 3FQRA 4LPWA 4QRQB 4Y88A 3LHPH 3FFCA 3WIHA 4D3CL 2P49B 3FQNA 3QJFB 3S97C 2WP3O 3RNQB 2BJMH 1JGVL 1D5IL 4K9EC 2F74B 4JB9H 4CAGA 1T0PB 4XP9L 5AYQA 1OTTC 4NM8L 5E8DL 3MBXL 3FB5A 5ACLA 5H37G 1I3UA 4JKMA 4OLVL 1A7RH 5HYEA 2W60B 3HG1D 4ZODA 5D7SL 5DJ8A 2Y36L 3EFDH 3RIFK 3U7YH 1E4JA 2OTWA 5JW4M 3ULVE 3IDUA 3IKKA 3ZDXF 1QLEH 1E4XI 3O0RL 2NY1C 4U1LA 3NCFB 4C59B 4GKNA 1TZIA 5F96H 3PDGA 1T6VN 3G6JE 4OUOA 4X9GA 4RNRB 4G42A 2BCKB 4PJXF 3V7AE 3NFPB 3OAUH 2AJUH 1XR9A 2AI0H 3C6LD 2VISA 1T1WB 3QI9D 3KS0J 1KULA 4NPYA 4J3WA 3IDIB 5CSGA 5D72H 1P7KB 2B8OT 1FL5A 4L4TA 2FATL 2VLKB 1IGCH 3DNKA 2VDNH 1W72H 1U8JA 1WWCA 3UZEA 3H0TB 3V9FA 4XWGL 4UT9L 1KG0B 4C83A 4LFHD 3VFOB 4BA8A 1EJOH 3IS0X 1R5IA 3N85H 2IWGA 4LAQH 2YR3A 2FX7L 4NZUL 5CP3A 1VPOH 3FFCD 1AC6A 3O9WB 4LU5L 3T0EC 1G7PB 3CX2A 2D7QA 1FFQA 3FAWA 3NN8B 4WI4A 3TA3A 2J6EL 2H8PA 2R2CA 3MGAA 4ZTOH 1N0XL 5CKAA 1RZJL 4WUUB 1KPVA 2AJVH 5JW4N 3TNNB 1DUZA 5EU3B 1VFAB 3AS0A 3GMRB 4JRXB 4LLWA 2B1AL 4HKXA 1PJ9A 3L5XH 2ILLA 3RL2A 1KJ3L 1BHGA 2VDOL 2Y07H 4Z76A 5B38A 3RWEB 3W11D 2C9AA 4W81A 4XNMB 3NFNB 4ENEC 4KTYA 1MHCA 4LEXL 1BD2E 1ETZA 1U3HB 1J1XL 4JFDE 3O45A 1RUPH 4YFEA 2XICA 4OFPA 1TTFA 2CKBH 3OKEA 4XBGB 5D93C 3FT4B 1A7NH 3MRKB 2X1PA 1BFOB 1KJ2H 2C3HA 3MRRA 4M93B 5CLTA 4LQ1A 2E9WA 1V7ML 1C12B 5JW4R 1A9BA 3MR9B 4GRLC 5IIEA 4L4TD 2YK1L 3AC0A 1WAAE 4QRPB 7CGTA 1A7BA 3QULA 2QLVB 2OL3L 2X4TB 5DJ6A 5E2UH 3DVNA 1P4LB 4YWGH 3ZDZE 1KCRL 2GSGB 4OKVA 3H9HB 2X5PA 4WO4A 4GO6B 2IBZY 3IAGC 1I9RL 2VO5A 1OWWA 4LARL 1J8HE 1OGTB 1CFNB 3VA6A 3TA3D 5EOQL 1MOEA 1EO8L 5GIRA 3S3SA 3U7WH 1IC1A 4GW1A 1FGVH 4IHOA 1AQDB 2W1NA 1KFAL 2P48B 3IDNB 4DW2L 1I7RB 5DLML 3WHXB 3CNKA 2IANB 4D0BB 2NLJB 5F9OH 4X4XB 2F5AH 2GTZB 3VXSA 5I76A 1S9KC 1OB1A 4U6YB 5DQ9A 5D2NE 3KYMA 3QIBA 1RUQL 1ZLUK 1A14H 1IM3A 1OD7A 1U8NB 1WCQA 3MRPA 4JFPA 4JRYB 4U3HA 5EBGA 4UQ2A 4JJ5B 1OAXL 4GRLA 3AM8A 5HI3C 3QCVH 5J6HB 2RQ8A 1HKFA 1DQQA 1VA9A 2YHGA 3BPLB 4KI5D 4U1JA 3JVGC 4PJCB 4IDJL 5I8KL 3ZT7A 1B3JA 3FRPG 1MCNA 3WJJA 5CZVL 1T80A 1I1YB 2JIXB 1WBYA 3VRIB 5DUML 5BQ7B 3IJSB 4JFEA 4FQXB 5E2WL 2RBLA 3DMMC 4HQQH 4MCYA 1NBYA 4QF1B 1MI5E 4LL9A 3GI8L 3LZFH 1VESA 4Q9RL 5C0AA 4F7EA 4FA8A 4PJBE 4QRSB 4WW2A 4HS8L 1RQ5A 2Z35A 3O6KL 1T83C 4WO4D 3MNVB 2Y7QB 4NZDA 3NABL 3GRWH 5F1IB 4XC3H 5CP7B 2C4FU 4HIXL 4LF3A 4IRSA 5CIPA 5CGYD 5C08B 3PWUB 3MLUL 4BH8B 2EE9A 1MRDL 3BESR 4HJGB 4ONGH 1ZLVK 4LCUB 4BQ8A 5F1OB 2DLFH 2BVEA 1HOCB 5I1AA 1Q72L 5IMKB 5J1TC 2DM7A 4DN4L 5EORL 4F7CB 4EI6A 3WUWA 3M17A 1H3UA 3O8XC 3SE3C 4NQCA 1DVFB 4X7FC 5J56B 4R97C 5ACMA 2MHAB 3AGVA 1GZPB 4BFBD 2VC2L 1LGVA 1S5IL 5E8EB 4HIJB 3SKMB 3OPZH 5FXCH 1FYTD 1TETH 1MELA 2HRPL 3CK0H 2XKSA 3MJ7B 2VERN 3VDAA 4NQEE 1YMME 2C3VB 4P3DA 5LQBL 2R2EB 3EYSH 3JWDH 1AH1A 1RZFH 4TSAH 2FZ3A 4YZFE 3WDHA 5DMGC 4QWWC 5DMKA 2W0FA 3C87A 2M1KA 5FCUH 1TQCC 5IBLC 3PNWA 5BRZD 1IKFH 3K0WA 2OR8A 2VXTL 4PUBH 3NZHH 2D7OA 4PJDF 2GJ6A 2VDRL 4ELMA 4JFED 4P99A 2I07B 4POZD 2XWTA 4U2ZA 4NHCH 3KPTA 1A0QL 5BZWB 1I8KB 5DD0H 5DT1L 5CUSL 5IM7B 3IS1X 5C0AD 1FE8L 2VZTA 1A6PA 4I4WA 4JDVA 5L9DL 3W0WA 1KGCD 4RWHA 2ZCKH 5FEBA 3BP5A 3U36A 4DN3L 5E5UB 2DOCA 1ZS8B 4IRSD 1X5FA 4KK8C 1Q38A 4OZHE 4XMKL 4ZOCA 3MRIB 4WUKH 4CU8A 2AK4A 3TZVD 3SCMB 2NY2D 1UB5B 3QDAA 3U4EA 5DEZA 2NXZB 2B1HH 3HC4H 4HJJH 2H3NA 1DJSA 4OIIH 2X1QA 3MA9L 2BOCB 2OJEA 2CMRL 4BZ2L 3WHE1 2EICA 3OBAA 4HLJA 2P7TA 4FQLH 1MFCL 3D9AH 4KJYB 5JLZA 2APWA 3DECA 1HNFA 3CLEH 1I7TB 4GFTB 3N1GC 4EJ1C 5A3IC 1YYLH 2I25N 1UT9A 5F6IB 2HJLA 2KL6A 5HHOE 4BSWB 5HYJE 4U1HA 4OIAA 4KKBC 2Y72A 2P8PA 4HKBA 4S1RH 2CUIA 1I1RA 5DFVD 1OLZA 3OG4B 3VXNA 3ROLB 3HPJA 3VH8A 2CDEA 5D2LB 1NC4A 3BKYH 3CDCA 2APFA 3V4UH 1ZA6B 5I18L 2F15A 4QRUB 1A3RH 1UACL 1ZEAL 5FUZL 4Y4KC 4YBQC 1G1CA 4QHNA 4ODWA 3LRSB 3X3GL 1IEHA 4Y1AB 1CU4L 1NCCL 4MJ2A 3V5DA 4Y5VB 4LOUC 2Q3AA 1VADA 4LCCB 4S1DC 4XT1C 4CMMA 1Z9MA 4XRCA 3W0WD 4MJIE 5HBBA 1OAQH 4XXDA 3VGHA 4ELKA 3IB4A 3DBXB 1J1PL 3REWB 2PW1B 4O5LL 2AK4D 4RISH 3I6LE 1N64H 4HUNB 4TVPD 1W8OA 2XZAH 4UTAH 2EH8H 1HZHH 2VXVH 1M7IA 4LSUL 1XGTA 1OARH 3MRQB 4YGAB 1FVCB 2VITB 4YHIA 4LLMA 1PAMA 5CBAB 4P46A 3TO2B 3CUPA 3B9EA 4XGZA 1BJ1J 1E4XH 2J2ZA 2NY5C 5C0RL 5BCAA 3C5ZB 3CCHB 1VFUA 5GGTH 4LQFH 3QNXB 4NQUA 1AIFA 5KVFH 4JREB 4YHNB 4XC1H 3DSFL 3GSNH 2HFGL 3BWAA 5JOPD 1A47A 1MJUL 1FLRL 1ZHLA 3KPRE 4DQOL 1CXKA 4ETYA 5IGXH 2ARJB 4OLUH 1FSKC 4PRAA 3SQBA 3QDGE 4L3CA 4PRPB 4Y4KA 5FO7B 5I74B 1BM3L 1KC5L 4HUKB 1XF5B 1ZA3A 2VXSH 4JN2A 2BHZA 4UV7H 3O11A 5IWLA 1NC4D 4YLQT 4G6AD 4PB0L 3ULUC 1ND0A 4PJEF 4UNTA 3ARGB 4HEME 4OLEA 4RCAA 4NO5B 1IC5H 1OT2A 4KRNA 4EUPA 5B21A 1NMCC 2OJZH 3OR7A 4N1CA 1A7PL 5D7JC 2Y6SD 3BUTA 1MAKA 1G7QA 2ZWLT 1FL3A 3LS4H 4DCQA 5GRZA 1MQKH 4LHUB 1EAPA 3L3JA 5A2IH 2A0LD 2VL5A 2EECA 2B4CL 1XF2B 2FGWH 3ARXA 4PRDA 1D5ZA 4XB8A 4ZO6A 4R0LA 3SDAD 5FCSH 2XNAB 3BH8A 1DQDH 1RZ8A 2EYTB 4R3SA 3UC0H 1KIQA 5KVDL 4E41B 2XQYG 1A02N 2R0ZL 1R5VA 3KPQB 3S34L 3X13B 4GS7C 4KQ4H 3K1DA 4GMSL 3QA3B 3B3IA 5C0CE 4P46D 3WD5H 4P9ML 3GJFK 3MUY1 4WWKB 4Z18A 4U1KB 4RAUB 3KJ6L 4P2OB 4D9QE 1MJJB 4KRPB 4B5EA 4GRWE 1IGYB 2FJGA 2YZ1A 3TPUA 2WSKA 1G7MA 3HG1B 4TUOA 4TUKH 1UM6H 3WIFB 4RFOH 5EWIH 3IF1B 1QBLH 4OKDA 4PJHB 4RIRB 3N0PB 1TJHH 1MEXL 4M6OL 3MJ9L 2P46B 4QXWA 4CN4A 5FFLA 4JR9H 5FHAL 5F7EH 4N9OB 4OV5B 4HAGA 1T04A 1A4JB 4K8RL 1FBIH 3CFKB 5IT2H 3GSRB 2JKXA 4OQTA 2DI7A 3VRJA 5KTEH 5GSVA 2A6JB 2E7CA 2MPAH 3QDJA 3U0WL 3EYVB 3VD7A 1GIGL 1RFDH 3QUKB 3ARED 1I8IA 3HNSH 3UTTE 4MNGA 2G5BA 1NBQA 5KSAD 3F5WB 3MLVL 2DQCL 1IZJA 2IFFL 3E6HA 4WU5B 3OHXB 1Q94A 5FHBH 2DKUA 3MOAH 1Z9LA 4N0UE 3DRQB 3MTRA 2P45B 3FQRB 3GMPA 3FFCB 3V4PH 3CU1A 2K3TA 3HE6A 5KAQG 3V52H 1NUFA 4J23A 1YPZE 3S37X 4NQDA 3VFRA 2AEQL 1I1AC 4LLDA 1JZ7A 4RBPH 1DQLL 1MFBL 2KZWA 3NAAH 1QFPA 4FXKA 3FB5B 3LKSA 4MAYA 5F7LB 4O51A 1XCQA 4P2QD 5GGSY 4KV5E 1EJ6A 4N1EA 3GNML 2CO6B 3S35H 2OTWB 3L7EA 1GHFH 4P23C 5SWZE 5FYLE 5EOCL 3VFTA 4V2CB 4U1LB 1LO3L 4GKNB 5KAQF 3HLAB 5EOTB 4PGJA 4MJ5A 1B2WH 3TWCH 3UTSD 2VIRA 4G42B 5KSBE 1CE1L 1XR9B 3QAZC 2CR6A 1LP9F 4LSTH 2VISB 5TQ2H 1MY5A 4ZFOA 1U8LA 1SEQL 4XH2B 3SKUD 4NPYB 5ABDE 5IB2B 3QBTB 3QDJD 3Q1SH 2EEAA 2OZ4H 2IGFH 5GS3A 4GKSA 2HJKB 3TBTA 4F33B 4U4BA 1E4KA 2PN5A 3QT2A 1U8JB 4KKLC 4KRMB 3TF7C 2IALA 4M6NH 1YNLL 2V17L 4DFHA 1EEYB 2W9EL 3HUJA 4C83B 5LWYL 4OCYH 1IQWL 4WV1A 1I1AA 2BY3A 4PJGF 1R5IB 1DBML 1C1EH 1ORSA 2AEIT 1FPTL 1WEJL 4EXPX 1F8TH 1U8PA 3PWLA 3HE6D 2H8PB 3LRHA 2EXYD 2EDYA 5HHPA 5JOEA 3MC0A 1KPVB 1O0VA 3MUGA 1DUZB 2YPKB 2NY1B 4YHZL 4Z95L 1G0XA 2NXYB 4LLWB 3H9SA 4J1UA 4HKXB 4MAYD 4MMXC 4S1QL 5E24E 4O4YH 2PTTA 2YC1A 3RL2B 3NCEB 1C08A 1M7DB 3G6JA 5A2LH 3AS3A 4YX2H 3MRBA 4U1MA 1CGYA 4Z76B 1U3YA 3PDDA 2EH7H 4OTXH 1QSED 4Z78B 1G9NL 1ADQL 4XP4H 5FM8A 1A1MA 2CIKA 2XY1A 3QRFM 1XF4A 5I30L 1MHCB 1ETZB 4I13B 1JF1A 3QEGL 4I2XE 1NMAH 4B7IA 3O45B 5H35A 4D0CA 4RZCA 4EBQL 2LE9A 2X9WA 4DKFH 4MLIA 4M1CD 5GJSH 3OKEB 3RDTC 4KQ3H 3TH3T 2Z8VC 5E2VH 3HI6L 4YHMH 1RVFH 5DD6B 1QNZH 5KBNC 5J6GA 4PJIE 4XP1H 1A9BB 3OL2A 3UTPE 5IIEB 2CR3A 4KTDL 1NQBA 2HAZA 4XB7A 4H8WH 3T0EB 5DQDH 3QULB 1S3KL 5T1DH 2GFBA 5TE6L 2A83A 6CGTA 1XT5A 3DVNB 4KK5D 4X7SL 1EGJA 1P6AB 4KKNA 4ZTPH 1JWMA 2FL5A 4OKVB 4P9HC 4UB0L 4WO4B 4YZFF 1GGBL 3RHWK 3VFGH 5I8EA 5KANG 3IDJA 2QR0A 3UEZA 4OZ4A 5INDB 2R0LH 1KPUA 4PS4H 3HFMH 4PJAE 5HPOA 2Z91A 2ZUXA 5GIRB 4GW1B 4IHOB 1T2JA 4PLJC 3ULVD 1S7WA 1UKSA 3OZ9H 3QP3A 5DZOA 4TNVK 1KEGL 5L2KE 1QOKA 5DHYA 3H9SD 4TVSa 4U1SA 4G8FA 2VB5A 3VXSB 4B0MM 2W59A 5I76B 1OB1B 5ILTH 5DQ9B 4JFDA 4PGBB 3I9GL 3VI3F 2DI8A 3KYMB 1FNAA 12E8L 3QIBB 4H20H 3L3DA 3RDTA 1BIHA 5D93B 1EA9C 3KPNB 4NN5B 2V7NA 4FTVE 1X5HA 2BNRA 3VG0L 1IM3B 1J7VR 4AMKL 4LIQL 4C4KT 2EDWA 3MRPB 4JFPB 2EDDA 4MS8D 3HE7C 3QUXD 4HBCL 1UEMA 3H42L 4UQ2B 1G6RA 4GRLB 1IGIH 4P4KD 4QRRE 1JI2A 1WAAA 3MLZH 4U1JB 5JW5A 1CLZL 2R2HA 1U2CA 4UBDC 3T04D 2ADGA 1EBAA 2V9TA 4G8GE 3RX7A 4QLRA 1IEBA 1HDMA 3QYCA 1DQTA 1BBJA 4WTZG 1WBYB 1B0RA 4FXGA 4JFEB 3ARBD 4OCSH 2XA8L 4MCYB 4X4MA 2PCPA 3BRDA 1J8HA 5L8LB 1CVRA 3DYOA 3MJ8A 1T2XA 4F7EB 3DX9A 1KXTB 3PGFL 4WW2B 5KSVA 3GBMH 2Z35B 4L1DA 5CGMA 3QCTH 4D9RE 4HGMA 4N0YL 2VDQH 4XNXL 1WUNT 2YUXA 3C09C 4LF3B 4IRSB 5IVZA 5CIPB 2NTFA 1JGEB 3B83A 4PJ7F 3MLRL 5D2NA 5EH1A 1P53A 2NY2B 2UY6A 5T3XL 4E5XA 2HT2C 2H9GA 3BXNA 3EDEA 2FX9H 1YY9D 4QOKE 1RK0A 3MNZB 1L7IH 1H3GA 4EI6B 3WUWB 5I16A 1YEGH 1RZJC 4NQCB 1VDGA 2VWEC 3SHSA 3U9UA 3VCLA 3LQZB 3WN5A 4HUXA 4JFDD 5FOJA 5HI5C 5DO2D 5AWNH 4DVBA 4U05A 4NZTH 2IPTH 2ZCLH 4ODSL 2JF1A 2VABA 3EYOA 3RVWC 2HLFD 3ARDC 4JHWH 1CGTA 4P3DB 3EOTL 4GUPA 1IQDA 3C8KA 3RVTD 2JLLA 4JFFB 5DSCA 2CRMA 1XIWA 2PW2A 4YDJA 1EHXA 4FG6C 5I1EH 4ALAH 2W0FB 1EHLH 1M6OA 2DQUL 1WIOA 3B6SA 2CLRA 1OLLA 5EU4A 2D31A 4JLRA 3LN9A 1F2XK 3RGVC 5LG1A 3PNWB 2EDRA 4PJBA 1NCDL 1BFTA 2GJ6B 4ELMB 1NUDA 3GB7A 1XGRA 2XWTB 2ATPA 1J8HD 4XWOD 4XNUH 3UJTH 4YPJA 4UOW1 4XCFL 4I4WB 1X5LA 1GC1H 2HWZH 1M71A 2H1PL 2J6EA 3BP5B 3U36B 3GO1H 3O8XB 1BIIA 3RWGA 3L9RA 3IFLL 1T0NA 1G7JA 1QHPA 3WEXB 1NAML 1U6AL 2WK2A 1MIMH 3HN3A 1GL4B 2AK4B 1UA6H 5DC4B 1MH5A 5TE7H 4R4BA 2WLYA 3VXMA 3HNVL 2DMCA 4W4OA 4GW4A 2C3XA 3HNTH 4MLSA 1YMMA 1JGLH 1J88A 2WBJC 2P7TB 4OQ1A 3WE6A 2I5YH 2WIIB 4FQ2L 2AK1L 4DGYL 4DOHE 5JLZB 2X09A 1TQCB 1K3ZA 3U4AA 3LPGA 5DYOA 1UYWH 4N0CD 2YPVL 3P9WB 2HJLB 3DYMA 2FO4A 4U1HB 4FRWA 2PNDA 4N8PA 1XIWD 2P8PB 2JK5A 3S3JA 1YA5A 4MXQD 2NY4C 2VZOA 3CFJA 3VXNB 4GSDL 4J12A 3HPJB 3VH8B 2CDEB 1KN4L 1GGIL 1MI5D 1NC4B 4YHPA 4ZPTA 1F4YH 2IMMA 1PG7L 4KVCL 3HHRB 3PWJA 4FQ1H 5TDOA 2WQRA 1IGMH 5T5FL 2OL3A 3O81A 4HH8A 2V2TB 2VNCA 4QHNB 1G9ML 1EDQA 5J89A 1AY1L 4ODWB 1B4JL 1CR9H 1D5MA 4GRWF 2DN7A 1J0ZA 3M07A 4N8VB 3V5DB 2QADB 2HKHH 1VADB 1WZMA 4D2NA 4CMMB 3MROA 1FGNH 4KROC 3D69A 4XRCB 1AE6L 1K4CA 1KF9B 3LKRA 3N06B 3BX7C 5FKAA 5IROC 4XXDB 3F7RA 1A1OA 4ELKB 4JY6B 3MACH 1I3VA 2R0WL 3SJVA 4K94L 5E9DE 1U91A 2IJ0C 5AD0A 3GIZH 3TJEH 4WHTA 2AJXH 3REVA 2FEDC 2APVA 4EVNB 4ZAKA 4XTRC 5GRJH 3VXMD 1RJLA 4CVZA 4U7KA 2ADIA 4LRNH 1XGTB 3JV4A 3RZCC 1ZTXL 4NQED 4LP5A 4LLMB 2UZIL 1YMMD 4YHIB 5C7XH 4PJFA 1OD9A 5HYJA 5SX4I 3CUPB 3QH3A 5C9JA 3TJHD 4H0HB 3BGMA 2DQGL 3GSXA 1AIFB 2VLME 4KU1A 1FZJA 2KQNA 2O5YH 3T0BA 2CUMA 1JPSL 5C0ND 3BWAB 1ZHLB 4HK3J 2YS4A 2ICWJ 4PRAB 5BVJA 4Y4KB 1NPUA 4KUCD 2V5TA 5TF1L 1ZA3B 4JN2B 1UVQA 3O11B 4BQ9A 2YWYA 5E08H 1OTUD 3FO0H 3CFCL 1ND0B 4RGNC 2E6QA 4MJIA 5EU7C 5JHLH 1UJTA 4P59H 5IROA 4FFYH 4EUPB 2JE8A 4OLZH 4JM2C 3QIUD 3OR7B 4JPIB 4Q0XH 5I1HH 4O58L 1OGAE 5I15H 1G7QB 2BNQA 4FHBD 1FL3B 4DCQB 3U0TA 4P2RA 4KZDL 1EAPB 1OWRM 1JV5B 1S7XA 5DUBB 3EDFA 2VL5B 5ID0A 4PRDB 1DSFL 3CXDH 1D5ZB 2ZOKA 3GSWA 4R0LB 3SJVD 1WCBA 3X11B 3BH8B 4YBHA 1RZ8B 1KNOA 5C0GB 3PABA 4R3SB 4GKZB 2DQFB 5GS0L 1I8LC 3ES6A 5E00A 4ZAKD 1JYXA 3VD9A 4S1SH 3ARZA 1DE4A 4N68A 3PL6D 1R5VB 5MEOA 2R29L 3B3IB 4EXKA 4IM8A 5A2FA 3NVQA 1FSKB 5HHOD 5HYJD 3PP3K 3KPRA 2ICWA 2KPNA 1BLNA 4V1DE 3QDGA 1H3WM 1QFWI 2EO1A 5I71C 3QO0A 2ADFH 1XGYL 4JZJA 4RFEA 4TSCL 3IU3A 5DXWA 1OP9A 1AKJA 1JZ5A 3TPUB 5GGVL 4YDLC 5FO8A 1PKOA 3MV9E 4TUOB 3VXPA 1MRCH 3WBDA 4KJWC 3S96A 3JUYA 1MREH 5KSUA 1J12A 3WIHH 3BIKB 2EDBA 1UXSA 3B9AA 4MJID 1MIEH 2JTDA 5DFTA 1T04B 5HTSA 1CGUA 4E42A 3SDXF 3C5JB 5GSVB 3QDJB 1X5JA 2DICA 3K8LA 3I6LD 4GAJL 2WWMD 4MYWB 3UDWC 1FQ9C 4ISVA 3V6FA 4BZYA 5KJRH 5DWUL 4X9FA 3SDCD 4U1NB 3V79C 1I8IB 3TT3L 4MNGB 3H9ZA 4GS7B 1Q9KA 2FJFB 4P57A 3RA7H 3RPIA 3BAEL 4PGDA 4DKAA 1Q94B 4LRIA 4OD3H 2AERT 5C0CA 5F9DC 3QG7H 2QQNH 5A2JH 3GMPB 5CSBA 3EJJX 3EJYC 3HE6B 4NQDB 2P8LA 1JZ6A 3KPRD 3OGOE 3VFRB 3BP6A 4LLDB 3KR3H 3QDGD 4Y0GA 4RX4A 4AT6B 3T77B 4FXKB 3OMZA 3LKSB 4O51B 4IRZH 1CL7L 3DURB 2P44B 2WW8A 3L7EB 4K9EH 4OCWH 3DX8A 1J1OL 2AJYL 3VFTB 4WRLA 1JPGA 5CP3H 5IQ9A 4OI7A 1TZGL 5I1JH 4MJ5B 1JNLH 3RTQA 1VFBA 5DDHA 2VIRB 3RVXD 4MX7B 1L0XA 2K7QA 4W4NA 5DK2B 3TCLB 4HC1L 3UTTA 1S78D 1KCSL 4ZFOB 4WI6A 1N5AA 1U8LB 1NGQH 2DQEL 4G9DA 4LHJB 2HH0H 4M8QA 4NKMB 1T03H 1SY6L 4C4KO 1LO0H 4G5ZL 4WCYL 4M7ZB 4N0UA 4GKSB 3GMOA 1XGPA 4ODUA 4LP4A 2I9TA 3KLAA 2DDQH 2LVEA 4ONOA 4JPWH 4HPOL 2IALB 2IQ9H 3HUJB 3P4OB 1NGZA 2DLIA 1WJ3A 5HYSA 1YPZA 3KS0H 3X12A 1I1AB 4TUJA 3MZTA 5HDBE 2B4CC 5C0CD 2FB4L 3CLFL 1ORSB 2YN5A 4D9QD 1U8PB 2FX8H 3PWLB 4DK3A 4I77H 4LDEB 5ELIA 5HHPB 5JQ6L 1LO5A 4P23B 5SWZA 4RX4D 1DL7L 2VN4A 5C0EA 2E9JA 1P6FA 3QIWC 3QG6A 4HXBL 3H9SB 4J1UB 2YC1B 1C08B 3G6JB 4M7LT 3MRBB 4U1MB 3KDMA 3P4MA 3I85A 1NDMA 1WICA 2OK0L 3QAZB 4JFOA 5KSBA 1OQOA 2CIKB 5DVNA 1XF4B 4PB9L 43C9A 2VAJA 5KS9E 4GMTL 4PJXA 4GH7B 5JHDE 5GRVK 5H35B 3RTQD 1TIUA 4RZCB 3HRPA 1KB9K 2AGJH 3UJIL 1LK2A 3S4SB 5DJ0A 5EZLA 1OAYH 4ODBD 4XX1E 3VD5A 3UTTD 1QR1A 4WTXA 5DD1L 2ZUQB 1FO0A 5J11C 2E8YA 1D5BB 5DRWA 4OLWH 1V5JA 2F19L 4MA7H 5J6GB 5DR5L 1U3JA 3JTSA 5KVEH 1CWVA 4K8RC 3KPSE 4KJQD 3FB8A 3UZQA 1CDBA 4JPVH 1AGCA 2F58L 1JYWA 1AP2A 2RAMA 4AG4H 1BEYL 1ZANH 3CVIL 2A83B 3VA2C 3ALWA 3HKFA 1JWMB 2FL5B 4XCCH 5D1ZC 1RIHL 4TTDC 4HWEH 4ZO7A 5I8EB 1RSFA 3MZGB 2QR0B 1EX0A 3IDJB 4OZ4B 2HJFA 1KPUB 2F5BH 3HI5H 2Z91B 5EIVA 4DGIL 4YXKL 1V7NH 1P7QA 4KKCD 4KY1L 4F80A 4N8CH 3T3ME 5SWZD 4HD9A 5FYLD 4TQEL 5KVGL 1U8IA 4G6JH 4Y4HA 1J8KA 5DHYB 3TP4A 4U1SB 1T5XB 4G8FB 3FN0L 2K7PA 2BK8A 2X4UA 4I2XA 4JFDB 4I0PA 2Y5EA 2XKNA 3ARYA 4MVBC 5JNYA 4TOYH 3HAEH 4X8JA 3RDTB 4D9LH 5IKCA 5C07E 2V7NB 2BNRB 4Y2DA 4HX1A 1CFQB 3BD3A 3O2WL 4Z7UE 3WXVH 1E6OH 2J7LA 4NNYA 5CIPH 4DTGH 1IAKA 5LVEA 1TPXC 1X5KA 3QEUA 3WSQH 5CEZH 5K9KA 2A73B 1F4WL 3QEHA 3VGDA 1GAFL 4M1DL 2BY0A 1LWRA 5L7XL 4Y19B 1FDLH 3BKCH 5JW5B 1Z5LA 2ADGB 1BQHA 3D18B 4DGVH 1X5GA 1QFHA 1IEBB 1HDMB 1TCRA 3H9YA 3BEWA 3RKDD 5GRUL 1BBJB 1B0RB 1MFEH 3ZDYF 2D4DA 3L5WA 3NZ8A 5F1SA 4NBYB 3BE1L 4NKIH 1BFVL 1NSNL 1CE6A 1JRHL 4CDHA 2PCPB 4I3SL 4BQBA 1J8HB 5L0QC 2I26N 3QUYA 1YECL 3MJ8B 1Q8MA 4JM4H 2F54E 3ZKMC 3K81A 2Y06H 2FNBA 4U6VH 1UB6A 3K4DA 2ICES 1UCTA 1A3LL 5C71A 5IVZB 3OV6A 3ZSTA 2NTFB 4WEBH 4FS0A 3V6OE 2JCCF 5SX4H 5DHVA 3UBXG 4E5XB 2H9GB 3BXNB 3EO1A 1EFXD 2Q76A 4OFDA 1UM5H 1HILA 2JB6A 4FTVA 4Y4HD 5I16B 2FH6A 3U9UB 1JHTA 5HVGB 3C08L 4K3DH 4I0KA 5CZXC 1F58H 3K3QA 4I0PD 1GGYA 1YEFL 4DVBB 5AAMA 2AV1B 4HJ0D 4Z8FL 3C9NA 2KUTA 1SBSH 4Y2DD 1NCTA 2VABB 1DLFH 5CHNA 4KDTC 3CVHL 1G9NC 1F3RB 1YNKH 3Q5OA 4G8GA 4O00A 1CTOA 5D5ME 3UTPD 1IQDB 1AJ7H 3C8KB 4K23L 4YHOL 1XIWB 4XP5L 3T2OA 3UP1A 1Z0MA 4YDJB 4ZD3L 3EHBC 1X6NA 32C2A 3VGFA 1T66C 4OUUA 1M6OB 3B6SB 2MKLC 2CLRB 3DGGA 3G5VA 5E4IA 4JLRB 5ITFA 2IPUG 4M1GH 4GQ9L 3R1GL 3F7VA 2Q20A 2B5IC 3HB3C 4OGXL 4OZGF 4R9HA 5ESAB 5TPWH 4C56A 4PJBB 4FQHA 4X6DE 3T0XA 3RBSA 1DDHA 3LD8C 1B6UA 1U8KA 1XGRB 3C09B 1WTGT 1HQ4B 2ATPB 5DRNB 4JKKA 3NGBC 3QXVA 4X7CC 1XZ0B 2DTML 3VWJD 5C6PB 1AFVL 2VLKE 2W65A 2BDNH 2OP4L 1M71B 2APTA 5DJ2A 1CCZA 1BIIB 3RWGB 3L9RB 3SDDA 5CEXA 1T0NB 1GGCH 2X7LB 1G7JB 5L6YH 3KLDA 4KHXH 2QQLH 1N6QH 3OKNA 4MDJA 3P9MA 1OHQA 5DRZA 1QFWH 1MH5B 2ERJC 5IMOA 1AR2A 4TRPL 4R4BB 4MB3A 4FTVD 3VXMB 1UKQA 1X3DA 4FQCL 2NQCA 1ADQA 5F7DA 3WNLA 1CXEA 1XCTA 1YMMB 4KZEH 1AR1C 4LPXA 3WE6B 5KN5B 1LNUA 3BMVA 1QSFA 1NEUA 1NGWA 4UQ3B 5F97E 1Z0NA 2C1PA 1QD0A 2DAVA 5DYOB 4R2GC 3RGVB 2GKIA 4G8GD 1VACA 2PR4L 4HFWA 4LBEA 2FD6L 3VGAC 5AUMA 3HI1A 2JK5B 1KLGB 4LDLB 4HS3B 2ZKHL 3CFJB 5DS8A 5MENE 3T3PE 1JPTL 1ACZA 4YHPB 3VFUA 3P30L 4NJAH 4PJDA 4ZPTB 4EQ3A 1DFBH 3PWJB 4XBEH 5TDOB 3WJLC 5IESH 2OL3B 5GZND 3OB0H 1U8HA 1CFVL 3DTXA 4D9RD 4HIEA 2R8SH 3D85B 4RMSA 1D5MB 1KCUH 1NEZG 3SE8L 2R9HD 4Y5YA 1F6AA 3S7GA 1V8HA 2HMID 4QRPE 1R0AL 3D69B 4APQA 3SDYL 4OCRH 1WIUA 4U6XA 1NJ9A 1PW3A 4QOKD 3GIVA 3LKRB 5FKAB 4HWBL 3SDDD 1A1OB 3WNMA 1F02I 3SJVB 3PDOB 1U91B 5AD0B 3WXWL 3AU1B 4WHTB 1K8DA 3REVB 3UYRL 1WFTA 2J8UB 3AS2A 5TH2A 4YXLL 1I3RA 4Y16A 1RJLB 4WI2A 4CVZB 2LU3A 4R4ND 3JV4B 1P1ZA 5FKPA 4EUPH 2IMNA 2Z31C 4MQTB 4PJFB 1FVDB 5K9JL 5HYJB 3ZKNC 3G5ZA 2IANE 2P1YA 2NY4B 3NA4A 1KN2H 5MEPB 5C9JB 2ZUUA 3JUZA 4XHJC 3GSXB 4LVEA 1VB9A 3K4ZA 2BXZA 2OS7A 3FQUA 4IIQC 3Q5YA 4LSVH 5ALBL 1OSPH 5FYKL 1TQBC 5GGRA 5BVJB 1YEKL 4JRYE 2NY5H 1BJ1H 1NMBH 1UVQB 3QPXH 1KEMH 1WISA 3HZYA 5GZOD 4MQ7A 5IUSA 1R3LB 1T20A 4MJIB 2AEWA 5FA4A 2CKNA 1WZKA 3LB6C 3QWRD 1V3MA 3ARRA 5ICXA 5T3ZH 5FDWA 2PYEA 3A67L 3ILQD 5MP6L 2GEEA 4KHTH 5HGGS 1CFSA 5IHUL 3BMWA 3RAJL 2YD7A 3AVEA 2BNQB 3ULUH 1U8OB 2JELL 3U0TB 4P2RB 2CDFB 3PXHA 5DQJA 4L9LC 1S7XB 4JDZA 1IGJB 5ID0B 3RZCB 5EB9A 4BZ1H 1FH5L 2ZOKB 3BD5A 3GSWB 1WCBB 3KJ4C 5I75C 2Z31A 4FABH 1MCOH 1KNOB 2CRZA 3PABB 3SQOL 3J7HA 4ZNEE 3B5TA 3ARUA 3ES6B 1L6ZA 5E00B 4AEHH 5LGJB 2GK0A 1INQA 1S7SB 1IL1B 4OB5H 5C08E 4Y16D 4EOWH 1FV1A 5FUOL 5MEOB 2NW2A 2AJSL 4LLQA 5HSFA 3BDYH 1XAUA 1L0QA 4KDVA 4XNZC 5C0FA 2ICWB 1BLNB 4OQTH 4JPKL 4RA0C 5F71A 4Y2OA 3RIFF 3WYRA 4X80H 1II4E 4RFEB 4I1NB 4JZJB 3IU3B 4NGHH 3X14A 2YN3A 4GG6B 1T2QL 1VGEH 1OAUL 1AKJB 2MSPA 3QEQE 1QFWM 2C1OA 4LLYA 1NFDF 5ID1A 1HINH 2FDBP 4XPHH 5FO8B 4WHYG 4JKWA 2JJUA 3VXPB 5BV7L 1S7QA 1ZLSH 2JJTC 3MNWA 1TJIH 4QGYA 3BUYA 4LASL 4Y7MA 2E7MA 5F89A 1A7QH 4OM1H 4Z7QF 3S96B 4JHAH 1L4IA 2VDMH 4L1HA 1OGAA 3TN0C 2D03L 4PGCA 4ZMAT 2VLLA 5EO0A 2Z93B 1UXSB 4L9LA 3RWIA 1FNEA 3GHEH 1JZ8A 5DUPH 2NYYD 3P11L 3HZVA 3ZTJG 5DJZB 2YD8A 3S8WA 5E9DD 4DVRL 1G9MC 4NFBA 4Z7VB 4ISVB 3V6FB 6FABH 3LEVH 1RY7B 4H0IA 5F7FA 3LEXA 3O6LH 3NA9H 3HCVA 3WCYA 3PE9A 4P57B 2K9UA 5C8JA 2JJSA 3VXQA 2VE6B 3NACL 3MOQA 2HFEA 4NWUL 3D6GA 5E6ZA 5C1MB 3L6FA 3DROA 5I1DA 2NY6C 4O9HL 3G6DL 1F13A 4V1DA 1WZ1L 5I71B 4K94C 3SBWC 5CJOH 3MXVL 3TYFB 5CFHA 4YDLB 4NQXA 4Y89A 4BJLA 2IPKA 1FL6A 5E1AA 3MV9A 1EHAA 1SYVB 2H45A 3BP6B 2V7HA 1EFQA 1DEDA 4O02L 3DVGA 2AABH 4QXUH 4P0DA 1OSZA 4HUVA 4G7VH 3WLWC 3SKJL 3RWCA 3ZE2E 1KENL 3RFZC 4AYFA 4L5FL 1S7VA 3DX8B 1JPGB 4X7DC 3MLPA 1YEIH 1D9KD 5EZOL 5IQ9B 3HMWH 5T1KB 1JNNH 4PLNC 35C8H 5LCVH 4JG1L 5EU6A 3RTQB 1OGAD 5DDHB 4L4JA 2D0GA 4IEFB 4NQVA 1MFDH 4HH9A 5D2LE 3RVUD 1A6AB 1A64A 1EMTH 4S2SB 4OSUH 1N5AB 3OAUL 5D71H 4G9DB 1TVHB 4M8QB 1QLRA 2QHLA 1B0GA 4LHQB 1N26A 1H3XA 3GMOB 1XGPB 4MCZA 4Y1AE 3SBWA 5D72L 2I9TB 3KLAB 4CU7A 4HWZA 3GK8H 2ZJSL 5AZEH 2VH5H 2AKRA 1IC4L 1W72L 2VDNL 1YPZB 5HHVL 5EBLB 3C6SA 5HHXL 3X12B 4TUJB 5F8RC 4NQTA 4Z0BL 2UUDK 4R4FL 2O5ZL 2O5XL 4V1DD 1Z3GH 4LPCA 1VENA 4LKCA 1W8NA 3N85L 5GS0C 4G7YH 1DZBA 3I75A 1LO5B 3MV9D 3QUZC 4LPYA 2X9YA 5JXAL 1JNHA 4ZTOL 3DV4A 1Q9OA 1E27A 3TVMC 2AJVL 2X89A 5IVOA 1JGUH 4P49A 3P4MB 1NDMB 5IB3A 4UT6H 3VFVA 4JFOB 4XPAH 3BZDA 2Q6WA 1EGJH 3M8OL 2BVPA 4M6ML 5DMIH 4PJXB 3QQNA 4XPBH 1MWAL 3ZSSA 5LXGL 2EDQA 1LP9A 3ROOB 3ARWA 1LK2B 2AEPH 2XY2A 5DJ0B 5EZLB 5ESVB 2HT4D 1QR1B 3BZEA 3JV6A 3IVKA 2X4RA 1FO0B 1RUKH 5J13C 5DRWB 4X6CF 1YC7A 1A7NL 3JTSB 1KJ2L 5I0DA 5T1MA 2MQ0A 5E56A 1ACYH 4ZS6C 5L88L 3TO4D 2MOVA 5JZ7D 2DMBA 2H32A 3LEYH 1AGCB 5JA8B 4HLZH 1AP2B 1CFTA 4MD0A 4JO4L 1BGXH 3MRDA 5IVNA 1CGSL 3I84A 5FB8A 1JHLH 1J18A 3FB7A 3BVNA 1JVKA 2BC4A 1MFAH 3QIWB 3QXUA 5CS7A 2VN7A 4YWGL 2BZDA 4ZFGL 2MFNA 4PV8A 3HC3H 4Y4FD 4OD1L 1C5CH 5C9KA 3MXWL 1P7QB 1XMWA 4S10A 2XPGA 3TPKA 4LSQH 3D2UD 3GKZA 3U7WL 4Y4HB 1MPAL 1LO2H 5KS9A 2X4UB 1KLFA 4I2XB 4I0PB 4MAUH 4BK4A 3IFNL 2XKNB 3MV01 5F9OL 5HGDB 2F5AL 5JNYB 4X8JB 1MCWW 5IKCB 4D3CH 1GPOH 1YC8A 1WT5C 5J11B 5DK3A 3WO4B 5D7LE 4ZXBA 3HG1E 3MV8A 1SMAA 4HX1B 4RAVB 2WUBL 2CD0A 3QPQD 3T08A 3SPVA 5SX5K 1D5IH 1EPFA 1A14L 3AMKA 3BIBX 4HUWA 1PYWA 4NNYB 4NQSA 1JWSA 1IAKB 3BO8B 4XP9H 4JCMA 1RK1A 3QEUB 4KJPD 4I5BA 3RI5K 3KPSA 3MBXH 3DX6A 4PJHE 5IVXF 3DETC 3JBG7 1TNMA 1CBVL 1Z5LB 5L8KB 1RMFL 5D7SH 2D0FA 1BQHB 2Y36H 3P4LA 4XHQA 5GGTA 4HKZA 1TCRB 3BEWB 3MFFA 3O0RH 3GSNA 3NZ8B 1YQVH 1IM9B 1CE6B 2X41A 5T1LA 4OZIF 2KH2B 5H8DA 3QUYB 3O3UN 1P7HL 4TNWK 3LZFL 1RIVL 1UB6B 4NP4L 4AM0A 2VZ3A 3OAYH 2H2SD 2PXYD 2FECL 3HS0B 2EKJA 3Q3GA 4OT1L 3EO0A 5DHVB 1T1YA 3FFCE 1AD9A 4Q58C 3QFJA 1UJ3A 2F8VA 4N0FB 2Q76B 3CSPA 4ONGL 3I6KA 5C07A 3TFKC 2JB6B 1HILB 4FTVB 4QXGL 4XWGH 4ZUUB 4UT9H 1DBAH 2DLFL 5FUCC 4FZ8L 4Z7UA 5JHDD 4HGWA 4NWTH 3B9KA 2FX7H 3OJVC 4NZUH 3V0AC 1M7XA 5C6WH 3IAQA 1FIEA 4LU5H 1QPPA 3C9NB 3RVVD 3RZWA 4HG4J 3MGOB 4ZXBD 2J6EH 3OPZL 5CHNB 3CK0L 5F88A 1N0XH 1RZJH 3C8HA 3DI2B 3BSZL 1INDL 1PEZA 3HR6A 1QFUL 5F3HA 5F7HA 4JQVC 2MQCA 3KPSD 2GITA 4HK0A 5D7IE 3PHQA 2B1AH 3EYSL 1FFNB 3ARSA 32C2B 4OUUB 5L0QB 1KJ3H 5IW6A 4CADA 1MQ8A 4G80B 4JFZL 5ITFB 3F7VB 2DLTA 5GSRA 1HN1A 5FCUL 4C56B 4CUCA 2F54A 3NIFF 4FQHB 4KXZI 5KG9A 1AD0A 4LEXH 1U8KB 3OKMA 2F8XC 1J1XH 2UYLA 5T1LD 2EDOA 1HXMA 2W65B 5EZIH 1QSZA 5GS1C 4NHCL 3T1WA 3DWTA 3H3PL 5DJ2B 2RCSL 1B4RA 1R3KA 4YE4L 5F7KC 3PWPA 1F3JA 4OI8A 3S36L 4WTZA 3WIIH 3BYYA 1G7HA 2F74A 3OKNB 2YK1H 4ERSL 4MDJB 3P9MB 4PJCF 4YFDB 5DRZB 5D1QC 4NRZA 5C07D 5IMOB 5F7UA 2OL3H 3MLYL 1A6WL 3IYLW 5F7DB 4GBXA 2B1HL 1XCTB 1T89C 4GT7A 4HJJL 3BN9C 3B9KD 5D5MA 4OIIL 4ESKA 1D6VL 3MBEC 1LNUB 4W70A 4LARH 1QSFB 4PY7A 1NGWB 3NPZB 2C1PB 3F7QA 3OX8A 1Q0YH 1ZVSB 4UTBH 4EZMA 5IBUG 3TT1L 1Y0LA 4F58L 5JOFB 3MRJB 3V4VL 1KXQE 3CLEL 4DW2H 4HFWB 2P5EA 4LBEB 1IFHH 3LD8B 4X6DA 4Q9BA 1T1WA 4CN1A 4F9LA 5JIPA 3PQYB