5IFHH

Crystal structure of the bcr fab fragment from subset #2 case p11475
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
217
structure length
178
Chain Sequence
b'VQLVESGGGLVKPGGSLRLSCAASGFTFRSYSMNWVRQAPGKGLEWVSSIISSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTALYYCARDQNAMDVWGQGTTVTVSSDSASAPTLFPLVSVGCLAQDFLPDSITFSWGFPSVLRGGKYAATSQVVCKVQHPNGNKEKNVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of the Fab fragment from BCR derived from the P1
publication title Distinct homotypic B-cell receptor interactions shape the outcome of chronic lymphocytic leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 30
structure length 178
sequence length 217
ec nomenclature
pdb deposition date 2016-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifhH02
4C59B 5I17A 2YRZA 2Y06L 3NCYS 1UYWH 2WQ8A 3D3VA 1YY9C 2X44D 4JO2L 3EZ8A 4L9LB 3O6LL 4HWZB 1BIIA 4K55A 5HYJB 5DD0H 5C70A 4NCC2 4D9LL 2D0FA 3ARFA 4ZTOH 1WAAF 2OXGA 4G42A 4HF5H 4HG4J 5EA0L 3UZVB 1SHMA 2AK4D 4RGOL 3KPRA 1KGCD 2AQ3A 1F02I 1D5BB 1ZT1A 2XN9A 1P7QA 3H3PL 3E6FA 4ZS6C 4PJGE 3DUUB 3W5NA 3BIBX 3VXUB 2F74B 1Q1JL 4H25A 4JVPA 4Z7OF 5EU4A 4X83A 2FR4B 3TBTB 4BQ6A 5JHDD 4LCUB 4ODTL 4IOSD 4ODSH 1ZS8A 4M6NL 3O8XB 1IGIL 3K2MC 4L3ED 4MAYB 1ZLSL 5CGMA 1UCBH 1NH6A 3ZHKA 3KXFB 3BDBA 2GIYA 3NTCL 3LKSB 2XRAL 1EFQA 4LLYA 1QQDB 4YPGA 4E41E 1YEDB 4JE4B 3N1GC 2E7LC 3X3GL 1NGYB 3SJVD 3MV8A 4DN3L 5IG7B 3RWEB 5CEZL 2X42A 4ZYKB 3QPQD 5ANME 1FN4A 4QEGA 2QQKH 2J8HA 2XG4A 4JZJC 1XH3A 4PRIE 3AS0A 3KPSB 5T1MA 3VFTB 4KK9C 1AP2B 1QSZA 4JFPB 1H8NA 4B53A 3UTQA 2A9MH 1F4WH 3HPLA 4R8WL 4R3SB 5E8EA 4TTDD 3RVWD 4Y2DB 4PJ8D 1OD7A 5BZDA 4A6YL 1V7NH 5FUOL 1P7KA 3K8MA 4FTVD 5BRZB 4X4XA 1I7UB 1JUFA 4XI5D 3VFWA 4RAUA 4CVXB 1NPUA 3B9DA 5GRWA 5D2LA 3IETA 3BDYH 3CX5K 5CILH 5I1DA 1I3RB 4YEEA 1IBGH 4RNRB 1RMFL 1S7TB 3GMQA 2KH2B 4EDWH 4HUKB 3MOBL 2XTJE 4MJIE 5IWLA 5SWQB 3BWAA 5EBMB 4HS6B 5IROC 2DIAA 5GS0H 2UWEF 1D9KD 2N1KA 1M1SA 5H37G 3TZVD 3H9SE 3BQUD 3VI3F 4NDMB 4OLZH 1BWWA 3I75B 2H32A 3PDOB 5D5MA 4OCXL 3LKPA 2HFEA 43CAB 5I8CA 3RBGA 2XPGB 3I02B 2EC9U 3SDAD 1J9CT 4XBGB 5HGHA 2QSTA 1JZ3A 3WIHL 4LARH 5I1JH 2D9QB 5KBNC 3MA9L 2P7TB 3IJHB 2F53A 3MLYL 3TA3B 4P4KD 4PGEB 3O11A 3S8WA 4Y5YC 2ESVE 4ONHB 1MIEH 3K1KC 5D4QA 5EBLB 3C8KB 4KZEL 2MMXA 4NZTL 8FABA 1JI1A 4DFHA 5DT1H 3GBMH 2F54A 4JGMA 3ULUH 4YAQB 3CDGB 2OTWB 1YNKL 3GHBL 2ZNWA 4MX7A 1YY8A 5MEOA 5IR1A 5C0DB 1AO7B 5BVJA 1U36A 3MV11 4K07A 1GYAA 2FECL 4PJFF 3QHTC 1ZHBB 4MMZC 3MRNB 2XKSA 5E94B 4U4BA 2I9LA 4M8VA 2DBLH 4GLRI 1T1XA 1WLHA 3BXNA 1MHEB 2EEBA 3JSSA 4IRJA 3S35X 5AAWA 5J06A 1YN7B 2HFTA 1UWEH 1QLEH 4N9GA 1BWMA 3QG6B 3MUZ1 2EKSA 5FA3B 1HINH 5ITFB 3ET9F 2V2XB 3VGHA 2CDEA 3PGCB 1FJ1B 1NFDA 4M6OL 4N1EA 2R2HA 3IB4A 1RHHA 2JB5L 5C0AD 3UTSD 4AG4L 1F8TH 1MCOH 4TTGA 3FQRA 5E6IB 4TNVF 3FB7B 4M61A 4M7JH 5LJYH 5DD1L 5IMMA 4KKLD 1A8JH 2ZKHL 3IYLW 2XWBB 1I7ZA 3MRMA 1DUYB 3OKNA 1R5IB 5DFWH 2RFXA 5HHMB 2JCCA 5HYSB 4K8RL 4X99B 2YD2A 1FGVL 5B39A 3L3HB 4O4YH 3LMJH 5E9DA 1Z2KA 2LE9A 4NRYB 3BO8B 3BSZH 3GSXB 3F7VA 2HKFL 4MAUL 5HHOA 2PTTB 1PYWB 3DV6B 1XR8B 4H1LB 4OFPA 5IHBA 1N64H 4N8VG 3MV7B 2ICEB 3HUJA 3U9PH 1MI5D 4FQ2L 4JFEE 1EPFA 4YO0B 5HVWA 4NC1E 1K9TA 1HXYA 1QHOA 1HZHL 1IC5L 4FZ8H 4WW2C 1NBYA 1IM9A 4NHUA 5C07D 4I0PD 5DJ6A 3VRJB 3KYMB 4EIGB 3V8CA 3GO1L 1ZLWK 2X1PA 5EO9B 2XZQL 2A74B 4XMLH 2BOBA 2O5YL 5L0QC 3MBED 4LLQB 3QWOB 4ZPTB 1DQDH 4BM7A 4KMTL 4Y5VB 1MCEA 5I8EA 1MFBH 3OKDB 1G84A 2E7LA 3LRSB 4NM8L 3ZKXB 4C56B 4XP6H 1A47A 5IM7A 4Q9RL 2XZCL 4O51A 2EH8H 4M43L 4I18B 1QOKA 1NGPL 1CTNA 5IIEB 3DX7B 4JZJA 4XNXL 5HI3D 1UEYA 2AJUH 4HFWB 5I76B 3CZFA 3C8HA 5C0EA 2DQFB 4P59H 5SV3A 5ADOL 1HHJB 5INDA 2I60L 4OUOA 4NKOA 4D9QD 5SX4I 4JN1L 2IANB 1J1OH 2Q8AH 3PGDB 5EZOL 5JDSB 4KVCH 3IGAB 3KJ6H 2W9LA 1IC4H 3TWCH 3W11D 1DN0A 1Z9SA 4WFGD 2Y6SC 1UZ8A 3EJZC 5JXEC 3T2NH 4LPYA 3VWKB 2BSTA 4OFYD 1DN2A 4XPGH 1CL7H 1DVFD 4GKNB 5HI5D 4OCWL 3MXVH 3S4SG 2J8UA 5HYJE 1ZMYA 1G9NC 5HVHC 5DMYA 4QNPE 4ZAKC 1SYVA 4NKMB 1J8HD 4EUPH 5IROA 3RDTD 4GQ9L 5LVEA 5FYJU 1VADA 5KVDL 2R2EB 4HT1H 4CAGA 2M1KA 4H88H 1PAMA 3MRPA 3VXUE 1CE1L 3QUKB 1U8KB 3TO4D 3CFKA 3GMNB 1YEGH 1A14L 2IQ9L 3RWDB 1A2YB 3V0WL 4FABH 1BP3B 1I9JL 1WT5C 3KYNA 2PN5A 4WI7A 4KKAD 5L2JA 4KK5D 3ZE1F 5HDLA 1EA9C 1XMWA 1RIVH 5GGSY 5TDPA 4OD3L 4JDZA 2JB6B 4HPYL 5CJOH 1LK3H 1TZIB 2H1PL 5INCB 2WUBH 3OKKA 3OKMB 4MA1C 2PR4L 2VLKE 3FO1A 3MREB 2Y4SA 4HHAA 5KSAD 2LAAA 3VFMB 3R06A 2Z92A 4M93B 4TQEH 32C2B 1KTLB 4D0CB 3B5TA 3KPSE 4NWUL 1JFQH 4Z7WF 4E41D 3OV6A 4ZSOB 3EYUH 3MJ7B 5IK3A 1AGDB 4BFIB 1WCBA 4ONOA 3HI5H 4G9FA 4N1HB 4R9HA 3Q6GH 4LNVA 3QAZC 4PJXE 1KN2H 2QR0A 3O2DL 4QTHB 2N4IA 3SE3C 3MRGA 1KB9K 4PRID 1BVKB 1AKJB 3PHSA 5BRZE 1A7QL 1X44A 3IKCA 4UQ3A 4JCLA 4UUJA 2O61A 3UTTB 1PG7H 5F7LB 1UKQA 4KRLB 4MB3A 3HTLX 5K9OA 3QCTL 1I8IB 5SWZB 3T08A 1WC7B 4C83B 2DQTL 1KXTB 2XXCB 4CU6A 2CR3A 3GRWH 1QHPA 5F1OB 4GKZB 3IDNA 2B1AL 4JY5H 4P2OD 2AV1A 3IFNH 1GXEA 2AABL 4HKZB 1LE9A 2XTJD 4MJID 5L9DH 2EYSA 1QKZL 3QJFA 3P73A 4KI5F 2A1WL 5AYUL 4KTDH 3MV9B 3H9SD 3AS3A 4O58L 1OP3K 2Q7YB 2BSRA 3QUYB 2C3XA 4QNPF 5D71L 2DYPA 3QBTB 4WW2A 5L6YL 4I1NB 1KCSL 2ICWA 5E1HB 1ZWIB 3EO0B 4Y8DC 4K23L 5CIPB 3QEGH 4RMVA 1TPXB 1KPVA 2R2BB 3BKMH 3DWTA 3FTGA 2ESVD 5C9KA 5I30L 1AO7E 4OTXH 4R4BA 1I9RL 2ZUVA 3CH1A 1D5ZB 3I9GH 3BYTA 3HC3L 3W9DB 4DGYH 3Q0HA 1K4DB 2YBRA 4F80A 3IS1X 3ARSA 1JPST 2YD6A 1KYOK 1CDCA 4IMLB 2ZOKA 1J0JA 3JWOH 1A5FH 5I17B 3TBSA 3NPSB 1K3IA 2XFXA 4LSPH 2A6DA 3D3VB 3MNVA 3T0BA 3L7EA 2FDBP 1BIIB 1H5BC 4MCZA 4UAOC 1FAIL 2YWYA 3P40A 3ARFB 3V8OA 1Q0YL 4OCRL 4G42B 5D1QD 5I75C 3KPRB 3CFBA 3X3FL 1ZT1B 1H3PL 2XN9B 1P7QB 3E6FB 4MQSB 2DI8A 1PKQA 2DBJA 4H25B 2NY5H 4ZPVB 5EU4B 1WEJL 1FFPA 4QHNA 5KVEL 3I85A 4HCRA 3QP3A 5JXEA 1A7OH 2BHYA 1ZS8B 1MCLA 3KHQA 4L5FL 2W9EH 4ZDHA 3SCMD 3I3EA 2NMSA 1XF1A 1BJ1H 4E0RA 1C5DA 1G9EA 4ZAKA 2X4RA 4HWBL 5GS2D 2EYTB 2PYEA 4D94A 5F88A 2V17H 5J4MA 4LLYB 1V7ML 3MV7E 4YPGB 4PY8I 4W70A 4BKLA 2BZDA 4I3SH 3MV8B 1JE6A 1HYRC 3NGBB 5T5NG 2ZUQC 1I7RA 1FN4B 3CDCA 4KUZH 1WT5A 1XH3B 5EULV 5T1MB 4BH7A 4FFWD 4HIEB 4KV5F 4ODUB 4R7DA 1KCVH 2IAMA 4DKEH 4RMRA 3UTQB 4JFED 5I71C 2M8XA 5E8EB 4HEPG 1RZ7L 3OGOE 5GIRA 4UOJA 5FOJA 4LAJH 1LVEA 1S8DA 5BZDB 2YXMA 3FB5A 1CFSA 5EC1A 1P7KB 2VNCA 3D9AH 4X4XB 4XX1G 1SVCP 4IHOA 1JUFB 2QADB 4RAUB 2HWZL 4UT9L 2M2DA 2VWEE 5D2LB 1KCUL 4G43A 2EIDA 5I1DB 2OJZL 1S7RA 3GMQB 5D6CA 2H41A 1F13A 3CFCL 2XG5A 4YHZL 1YECL 4TSCL 3BWAB 2WBJD 4F57H 4RWYL 4EJ1C 4F8TA 3RPIA 1U91A 3T77A 3DECA 3BMWA 5DUMH 3L7FA 5FCUH 1KPRA 2H32B 2ZPKH 4CVZA 1U2CA 3LKPB 2HFEB 5I8CB 2FRGP 5HGHB 4TULL 4WU5A 2MCPL 2CPCA 1DBJL 1DBAL 2FHFA 2F53B 1D6EA 2G5RA 3OBAA 1CXKA 3O11B 4NT6A 4J3WA 3QUXB 3BGFB 2VQUA 5JOPE 2HFGH 2FIRT 8FABB 5E08L 5HDQL 4LRIC 2NY4C 2F54B 5T3ZE 4P9MH 3VXTA 4MX7B 3S3JA 5IGXH 4MA3A 3WDIA 4M7ZB 4H8WC 4CRPA 1YY8B 2Z4QA 5MEOB 1OARL 5IR1B 3QYCA 4L4TE 5HYJD 3VG9C 4PJBA 2EO1A 4MCYA 1WSST 1RVFL 2ARWA 4PJEA 1QNZH 3G9VA 5BVJB 1MAMH 3FQTA 2IPUK 3IRPX 3PHOA 4KJPD 4D8PA 2I9LB 3AMKA 1T1XB 3VXUD 3BXNB 1WGOA 4LHJB 4IRJB 3U6RA 3GB7A 1Z9OA 2OR7A 4LP4A 3JBG7 4N9GB 2FBOJ 2EKSB 4RX4D 1XF5A 3EAKA 1U9KA 2BMKA 4LHQB 5D70L 3LIZL 3RY6C 2CDEB 2MTPA 4UINH 4MAYD 2R2HB 4LIQH 1RHHB 2DM3A 1AGFA 2Z8RA 3FQRB 5IFHL 4M61B 5IMMB 4PRPE 3P0YH 4WWKA 5E1AA 2KDGA 4H1LH 3WFBH 2K3TA 1I7ZB 3OKNB 2I5YH 5TQ2H 4ZSOE 2HVKA 2RFXB 2VLKD 1GGBL 1FLRL 1VFUA 2JCCB 3RY5A 1XGRA 4I77H 5GSVA 5B39B 2LAGB 1LO4H 1LO2H 5E9DB 4NC2B 5DDHA 3F7VB 3HPJA 1H5BA 3RNKA 3KPSD 5HHOB 5DRXA 4EQ2A 1OPGH 4NZDA 1L0XA 4F7CA 1MELA 1NKRA 4WO4C 4OZFG 5SWSA 5D96C 4G6MH 1GHFH 2GJJA 2XWTA 5IB1A 2R4RH 1OAQH 4JPKL 4Y2DD 4JR9H 5EU6E 1HXYB 4XC1H 1NBYB 2NY0C 3MNZA 1IM9B 4NHUB 5BRZD 4KHXH 5DJ6B 4L1HA 2YOCA 4LU5L 4GJTB 1IQDA 4M7LH 4RDQF 5C8JA 2E9BA 3JWNC 2BOBB 1QBMH 4FQXA 3LHPH 3HHRB 3MLWL 3RWJA 5B3NA 2BY1A 2QTEA 1ZANL 4K94H 1VPOH 2YD9A 2BNUA 3C60D 3DETD 4JFXA 5I8EB 3MV9E 1QFWI 4ZO9A 5HVGB 2C9AA 4PJAE 1N7ML 1W8OA 1MRCH 1T3FA 1KJ3H 5IM7B 4PLJC 3HG1A 1OP9A 2CO7B 5JMRA 4JZJB 3WL9B 3BGMA 3HAEH 1FZJA 3WFDH 4CN1A 4JFDA 4XBEL 3CZFB 5I1GH 5C0EB 5FGRA 3PP4L 3TA3D 1BAFH 1OTUD 5FUCC 1NANH 1HH9A 1F4XL 4KRPC 2RCSH 5INDB 4NKOB 5B38A 1ZTXH 3DROA 1WWWX 3NA9H 4U1MA 1JRHI 3FO0H 1FORH 3MRKA 2W9DL 4MA7H 4J4PC 2IGFL 2NW2A 1DN0B 3NFNA 4BQBA 3WCYA 1UZ8B 1DQML 2BSTB 1NLDL 4JDVB 5E7FA 3BE1H 1AO7D 4N9OB 4YZFE 4YXKL 4OIAA 2J8UB 1PY9A 1MCFA 3BGAA 4PB0H 3EZJB 1PBYA 3IFLL 4Z8FH 1T1WA 5GHWH 1CQKA 5DD5L 5DLMH 1VADB 2QV2A 3HS0A 4JFOA 5L2KA 4OZGE 2VO5A 1VESA 4QRSA 1BQUA 1AXSA 3MRPB 4LAQH 4XVUC 4KQ4L 1CLYL 3CFKB 4O2EA 3RGVD 3VRIA 3DX8A 2YPLA 4LLMA 3DHMA 2Y07L 2GITA 1MFEL 1F2QA 2YA0A 3KYNB 4AEIH 1WZMA 3CLEH 2HG5A 3C09C 3TT1H 5L2JB 5E6ID 3T8XA 3QNXA 1A6VH 4ZFOA 4G80B 5TDPB 4P46D 4JDZB 1I3VA 3L3IA 3KLDA 1A4JA 1CF8L 1AHWA 3KS0H 2W0FA 3OKKB 4KVNH 4OM1L 4HHAB 3D5OF 4QRQA 3R06B 1X5HA 2Z92B 3DI3B 3CDFA 4OCLC 1IAIL 1AI1H 1EHXA 5FKAA 1QSVA 4L3CA 2MOVA 5DMGD 2ZNXA 2KQNA 4X4YA 4ODHL 1B2WL 5FYLH 3LOWA 35C8H 3MV7D 4PP1C 5ESQB 4M4PA 5IK3B 1G9MC 1WCBB 4G9FB 1PLGH 1T0MA 2AEPL 1WBZA 1K6QH 4FQ1H 2QR0B 4R90L 4J8RA 3IDIA 2GTWA 3MRGB 3SDXA 4DGVH 4CU7A 5JOFA 2Y5TA 4XCCH 1RIUL 3RY6A 3IKCB 4UQ3B 4UUJB 4F7TA 2YSSA 2O61B 3KYOA 5TE6L 5DJAA 5K9OB 3V5KB 1QO3A 3QUMH 2VRAA 2R0LH 2UY7A 3OWEA 2AK1H 4DW2L 2EXYC 1KIPA 1OAXH 1QBLH 4S0SD 3IDNB 2ADFL 4QOKA 1MVUA 1A6UH 1QZ1A 2AV1B 2DDQH 4UB0L 2Z8WC 3BPOB 4N90E 1LE9B 3FAXA 3MACH 1T83C 5F7KC 43C9A 2EYSB 4KROC 2E8ZA 3QJFB 3P73B 5F96H 3R8QA 5I16A 4WO4A 4GXUM 2ZUYA 2B8OT 1GGYA 4KK8C 2J2ZA 4F7MA 3G5YA 1P4LA 2XNAA 1T1ZA 1JGUH 2DYPB 3WD5L 5J1AA 1DUZB 5E2VL 1JGDA 1NKOA 4WW2B 2ICWB 2F54E 1TQCC 3QIWC 2PW2A 1WZLA 2HJKA 3K74B 4P57A 4Z6AT 1FZMA 5HJ3A 1KPVB 1E4WL 5L0QB 1OVZA 5A2IH 4TVPE 1OW0C 3FTGB 5JXAH 1MCPL 1UQSA 2OSLA 2UVFA 1JZ2A 5ALBH 4BUHA 4R4BB 2LVCA 5JOPD 5KSBA 3C5JA 3TJHD 3CH1B 1SJVA 4JG0H 2MCG1 4PJIA 4ZTPH 5T3ZD 2YBRB 3NIDF 5ILTL 1V05A 1VSCA 4NCC1 4EN3C 1F6FB 2ZOKB 3TBSB 1RK0A 2XFXB 3WSQH 2A6DB 1Z9MA 4L4TD 4U6YA 4JHBA 4HUUA 3MNVB 3INUH 4Z77A 3B8SA 3L7EB 5EN2B 4MCZB 1UZ6E 1Y18A 1KBGH 4XCFL 4NN5C 1SVZA 1R0AH 2GTZA 1A7NL 4OD1H 4XTRD 4YE4L 5CP3A 2CKBA 3VDCA 4J4PA 4OGYL 5DJCA 1GGIH 5E8PA 1QYGL 1FFPB 4QHNB 1WQVT 4TNVK 5JW4R 3OAUH 4FFZL 4QRPA 4LCIH 4GRWE 3WFCH 3MFGB 2Y5EA 5JUEH 3QCVH 1KB5L 3K3QA 4JFZH 4ZDHB 2VDPL 1GGUA 1SY6A 4JDTH 5KS9E 4XWOC 4ZXBD 4PRPD 4E0RB 2F5BL 5HVHB 1C5DB 4ZAKB 2FHBA 1MWAL 2PYEB 2AV7A 1F3RB 2MNUA 3RVUC 5F88B 4LASL 1U92A 5D2LF 1A02N 4BKLB 4D0BA 3H6JA 3JV5A 2IG2L 2ORBH 3KNBA 4J6RL 4NKIH 3QI9C 4FQJH 3AC0A 3VJ6A 1L4IA 4N5EC 1KXVC 1I7RB 1CD0A 2HTLC 1UWGL 3W0WA 3VFOA 5CEXA 5F9AC 3ARVA 3Q3GA 5D5MF 4BH7B 5A2KH 5DQDL 4R7DB 3F62A 2IAMB 3EDJA 2DQUH 2F8VA 4B5EA 4F58H 3KS0J 3R1GL 2H2PC 2X4OA 2IH1A 5EU6D 4HAFA 5GIRB 1BOYA 3KGRA 4N8VA 4MA1B 1S8DB 3FB5B 1CFSB 5EC1B 3ARDD 1KOAA 3TH4T 4KMLB 5BOZG 4D3CL 5HHXL 4IHOB 1A0QH 1Q8MA 1UA6H 3CFDB 4G43B 4ENED 3VRLE 4P49A 5KW9H 1S7RB 5D6CB 3UBXA 1B4JL 3MV9D 1CK0H 5DURD 5IKCA 5FB8A 2VSDA 1MCWW 3LRGA 2CD0A 1QFUL 4K9EH 3RPIB 2CLVA 4L8SA 2XZZA 4HH8A 1MPAH 1U91B 3T77B 3QAZB 4HDIA 3L7FB 1KPRB 5E8DH 1OTTD 3GMMB 4CVZB 2CMRL 4LQ1A 1CFNA 4HGWA 1OAZH 3UEZA 1U6AL 3DYMA 1IZKA 2MPAH 3DRQA 1BEYL 4XPHL 4XGZA 4WU5B 2CLZA 3ARTA 5C6TL 2VDOH 4WFHE 2VXVL 4JRYE 3RZCA 2ITCB 1Y0LA 4BZ1H 4NT6B 5JTWA 3EOTH 2OXHA 2J8UE 3CGTA 4WUUA 3K4AA 1IZJA 1HYSD 5F7HA 1NFDF 2CRMA 3WKML 1S7WA 3S88H 5D2NC 3FMGL 4IOFC 4P9HL 3RKPA 5I15L 1GIGH 1LO0L 4Z7VE 3V4UH 5IW1B 4RMSA 1I85A 3VXTB 1AXTH 2A0LD 5E2UH 1UXWA 3Q6FA 2L7JA 4MA3B 1MAKA 4TRPH 2Z4QB 4JO4H 1R3IH 2AJYL 5J3HD 3KAAA 4UI2A 2HT2D 4YQXH 2JCCF 4K8RC 1JWMA 1T83A 4MCYB 3CC5A 4PJBB 2R1YA 3VWJD 4PJEB 1ITBB 1FG9C 3QDJA 2VLJE 3FQTB 5EUKA 4NBZB 3V6ZA 5D7SL 4M1DH 1HH6A 3PHOB 4KKCC 5CINL 2V2TA 4D8PB 4RGMB 3F7YA 4KAQL 5E03A 3S4SA 1QR1A 1EEUA 1T2XA 3I84A 5EZLA 3O4OC 3S97C 3OAZH 3F6IA 4WVRA 2DOCA 1WBYA 3BZ4A 3U6RB 3GB7B 3QIWA 3HUJF 1CDYA 2FH8A 1CLOH 2VDKL 1XF5B 2BMKB 1C5CH 4AMKH 3SY0A 2B1HL 1OW0A 4H20H 1AGFB 4NQUA 2WP3T 4MA8H 4ZOCA 2YUXA 4G6KH 4WWKB 5E1AB 3VD7A 1H15A 1X5GA 1EGJH 5LXGH 1HIML 3WV0A 3QO1A 2HVKB 3LPWA 3W5MA 2QSCH 1XGRB 4C54A 2D7TL 4EN3A 5GSVB 5GGQH 4YHMH 4OF8A 3NBNA 5DDHB 2VISA 2YUVA 5ACZA 5FF6A 3HPJB 3L5HA 1H5BB 1QRKA 4UAOB 5GJTH 5A3ID 3RNKB 25C8H 2VXUH 5KVGH 3I50H 2VXTH 3EOAA 5DRXB 2DICA 5TPWL 4F7CB 2C4FU 5I75B 5JNYA 5SWSB 1KF9B 5IBTL 1D6VL 3TGXA 3OKLA 5DO2D 3RA7H 2XWTB 5IB1B 2VH5H 5CUSH 3WN5A 2NY2C 1MQ8A 3MNZB 1NGQL 15C8H 3LD8C 4M7LT 2VDQH 5C8JB 4NFBA 1WFUA 1R3HA 3QPXL 4FQXB 1RURH 4A6YA 3RWJB 4HIHA 1JBJA 2EDEA 4J2XA 3ZE0F 3QDGE 2F58L 4IMKC 1JVKA 2BNUB 4JFXB 1PW3A 1CD9B 1CD1A 1T3FB 2ADGA 1I1FA 2J8UF 1UEMA 3QI9A 5J6GA 4QXUH 3HG1B 4I2XA 4UV4L 1KJ2B 4N90D 4YX2H 2VN4A 3MRFA 3IJYA 4KK6D 3BGMB 2FATL 1FZJB 3TN0D 4JFDB 1DQTA 1SJEA 3CLFL 5CJ8A 2PXYA 4LPCA 5C0BA 1TITA 3WIHA 1HH9B 1IGTA 3QUXD 1JHLH 5JW3L 5B38B 3DROB 4U1MB 1OSPH 5I71B 3EJJX 3MRKB 4F15B 2F54D 4XBPA 3U4AA 2PNDA 4KI1A 2NW2B 1CZ8H 2XY1A 1FFOA 3AM8C 3NFNB 4G5ZH 1PFCA 1NMBH 4ZFGH 4TVPD 5EUOE 4F7PA 1NBZA 2P46B 5C7XL 1PD6A 1EEYB 4JGUA 4HK3J 2DD8H 3C2AL 2C3GA 5CSZA 1T1WB 3G9AB 2E27L 4BJLA 3AREC 3M17A 3O45A 2BSSA 1QG3A 5FK9A 5C09B 3ZKQD 3HS0B 2C4FT 4XP5H 4JFOB 5L2KB 1URLA 3EYFA 4QRSB 2Q3ZA 3VDAA 1AXSB 3DMMA 1CWVA 4OF3A 3BHBA 4J3OC 4O2EB 3VRIB 5BXFA 3DX8B 3EOBA 2YPLB 4LLMB 2GITB 1K85A 5EU5A 3QRGH 4OD2A 2B20A 2HG5B 4XXCC 3DLQR 3IDXL 1KTRL 3T3ME 3J8F7 3QNXB 1EERB 4ZFOB 2OJEB 4EOWH 3DVNA 4XAWL 1MIMH 1TJIH 4L8CA 1RZJL 2PYEE 3PGFH 1PY4A 3L3IB 3O2WL 4ZO8A 1A4JB 5D2NA 2NY4B 1AHWB 1G0XA 4Y4FD 2CXKA 2W0FB 2QHRL 4EI6A 1UM5L 3C6SA 5EOCH 3KG5A 4KGLA 5AYQA 4QRQB 1U41A 3E8UL 1XF3A 5FKAB 4L3CB 2EYRA 4PJCA 4PLOB 5KG9A 1JF5A 1FHGA 4LLAA 4U1GC 4X4YB 2X09A 3PHQA 2VZTA 3STZA 1WIOA 2DQIL 5IW3A 1NCCH 4GLRH 3TYGH 1JGLH 4LSVH 1K8DA 1T0MB 5BMFH 1HEZA 1WBZB 3W82A 4RFOL 1BQSA 5F7EH 4NNYA 4CMHB 2NX5A 4J8RB 5K59E 3BPCA 3IDIB 2GTWB 3LKNA 2WZPD 4QY8A 3SDXB 1FL5A 3U0PA 5JOFB 4M1GH 3UJIH 1Z0MA 3S36H 5IJKC 1ACYH 4F7TB 5KAQG 2YSSB 3O9WA 4WW2F 1MCIA 3KYOB 5DJAB 5EOTB 3L3JA 3WUWG 3LB6D 4XCEA 1QO3B 3RVVD 4KXZI 1YQVH 1Y6NR 3D1MC 1KIPB 3MC0A 4IRSB 7FABL 1XIWD 3T1FA 2VUOA 1BLNA 3SOBL 2FYYA 1FPTH 5CJBA 4QOKB 1BQHG 1MVUB 3WHE1 1L7IH 5T5FL 5F1IA 3GEWB 5I16B 1CBVH 4WO4B 3T09A 2D4FA 5DJXA 5D96B 2P49B 5IOPA 2W1NA 1Q9LA 4G8GA 1ROWA 4F7MB 3CFJA 1LO3L 3G5YB 1P4LB 2XNAB 4I0KA 4NSKA 1T1ZB 2B0SH 5DZNA 4LDOB 5IQ7L 4MD0A 2AJXL 3TFKD 5J1AB 1KEMH 1I8MA 5F1KC 1JGDB 1FVCA 2SEBB 4X4MA 3QDMA 3QPQC 1TQBC 2PW2B 4OGZA 1V5JA 3CVIH 4WFHD 2HJKB 2VLRA 4JRYD 4YHOH 4P57B 1FZMB 1VCAA 5HJ3B 1MEXL 2B7DT 4K2UL 1KIUA 1TJHL 4ZUWB 1A22B 1UQSB 1W0YT 2OSLB 3A67H 4PRBB 3RU8H 4PJBE 2XXMB 4IMKA 5KSBB 3C5JB 4PJEE 3RQ3A 1OAKL 1BQLH 5C0IA 5EWIL 5DR5L 5B22A 1XZ0A 4PJIB 4BK5A 2HH0L 4TTDC 1M7DA 4N8CL 1PDKA 3RVWC 3T3MF 1JIBA 4PJ8C 3BVNA 3VXQA 2UZIH 4Y2OA 5TF1H 1RK0B 3LRHA 4XI5C 4U6YB 4DGIL 2E7MA 5CZVH 5E5UB 4Z77B 4ZUTA 4L4JA 2HYMA 4YBQD 1ZEAH 1FNSH 1Y18B 4HCRH 3UMTA 1CR9H 2VLJD 3CVHL 4KRMB 2NW3A 1TJGH 3EFDH 2OK0L 2GTZB 2VQ1A 4NUJA 4X6DA 4TPRL 1D9KC 1G9NH 3U36A 3TZVC 2ATKA 2CKBB 4AEEA 3LS5L 3BQUC 2ZWLT 5IESL 2VERN 5DJCB 1AGEA 5E8PB 1Q9OA 4W6YB 4XC3H 4CMMA 1FBIL 3SDAC 2WP3O 4QRPB 3MLXL 4UILL 4PBXA 5ADPL 2DJ4A 4Q58C 3VD9A 1LDPL 3C9NA 4P4KC 2EDNA 1CS6A 1INDL 4WTXA 1U8LA 4OGXL 1Q38A 2AV7B 4NRZA 1M05A 1U92B 4ZS7L 5ESVA 2OMNA 1RZFL 5F97E 3QEHA 3LS4L 4RCAA 1RV6X 3KNBB 3VJ6B 3NCMA 4JO3H 4PS4H 3N50A 1FH5H 3NH7H 3W0WB 2E7BA 3VFOB 5CEXB 3CD4A 4HBCL 3Q3GB 3C09B 3FRPG 4XXCA 1GZPA 3LEVH 3O2DA 4LCWE 1YYLH 2X4OB 1RJZA 2IH1B 4NJ9L 3WHXA 1I3UA 5EOCJ 4N8VB 3P11L 2NYYD 4X8JA 4ESKA 1BMGA 2ERJC 3HG1E 3N1PC 4OZHA 3VCLB 4LPXA 2VLME 3QDGD 3RPKA 5EORH 2A6JA 2FX7H 3BIKA 4ALAL 2VDLL 1NLBH 1NUGA 2YHGA 3HCVB 3UBXB 5KJRL 4KKLC 1MREL 2ZUXA 6FABH 5FB8B 1AE6L 3VXPB 12E8H 2AEIT 4WTZA 5J11C 3WDHA 3OX8A 3KLHD 2CLVB 4L8SB 4U1IA 4PJBF 1G1CA 1KXQE 4HDIB 4PJEF 3SO3C 1CVSC 1CFNB 4HGWB 2VR5A 5JHLL 1DLHA 1IL1A 1L6ZA 1W0VA 3DRQB 4HZAA 4ZNEE 3DURA 2CLZB 1P5VA 2R4SH 3IDJA 2RQ8A 3QJHA 3RZCB 1Y0LB 3MLVH 3O6ML 3A6BH 2AK4A 5FOBA 3HZMA 3NIFE 1FYHB 4E9LA 3L5XL 4WUUB 1AQDA 1A7BA 1N0LA 4R26H 3RL1A 5I8OH 4UT6H 1H3XA 1CYGA 1S7WB 4OLVL 5C09E 3MLTA 5KANG 5JHDA 1X5YA 1UXWB 5F3BA 3Q6FB 4I0PC 4L8DA 1FIGL 4ZOBA 2ADIA 4BZ2H 5FUZL 3S34H 1JWMB 2YPLE 3CC5B 3FN9A 4KROB 1Z9LA 3B2UD 3QDJB 3MBEC 1KENL 3KR3H 4R4ND 3V6ZB 5EUKB 2DM4A 1ZXQA 1HH6B 4CADA 3P4OA 3FQNA 2V2TB 3F7YB 5JW4Q 3S4SB 1Q72L 1QR1B 5EZLB 2VDMH 3LZFH 3SJVA 1F00I 4OLWL 2VJXA 1WBYB 3BZ4B 3MZGB 3RFZC 3ORJA 4LLWA 1TQCB 3P4NA 3QIWB 1EO7A 1MCHA 1PSKL 3SKMA 1NGXA 3P3YA 5HI3C 1W0WA 1NUNB 4RSVA 3NZHL 3SY0B 3GBLA 4OLUH 3OB0H 3N0PB 3J7HA 3PWUA 4PB9H 3WFEH 5FCSH 2PYED 3QFJE 4S1RH 4UDUA 1H15B 4LSTL 4POZD 1E4XL 1JPTH 2DWEA 4Z78A 3M45A 3QO1B 4OLYH 4ZG1A 4PJ8A 4HH9A 1X5XA 4X7SH 1G7LA 4EN3B 2YD1A 4HWBA 4ZO6A 1U8PA 5DUPH 4PD4J 3W11C 4FTVA 1F4YH 3KLSA 3W2DL 1JF6A 1CLZL 1JP5A 4RFNB 5AZEL 2X4NA 1P6FA 2VISB 5FM4A 3RHWF 5I6XB 1INEL 5LBSL 5FF6B 5ACZB 1JPSL 4NZRH 3SDXE 1XFPA 2X7LA 1DVFC 3EOAB 1JI2A 5HI5C 1FC1A 4U1KA 1EXUA 4NN5B 4OM0H 2IAMD 1BPVA 5JNYB 2Z91A 4GFTB 2ZG2A 3OKLB 1BF2A 3RDTC 1D9KA 3TPKA 4I3RL 1T4KA 1U3YA 4PGCA 4PGBB 3RKDD 3BQUA 1ZA3A 3S96A 4ZTOL 4JJ5A 4HF5L 1EHLH 3WN5B 2EDKA 3TO4C 1IKFH 2C5DC 1WK0A 4PG9A 2GCYB 4L1DA 4X7CC 1R3HB 5BS0E 2FEEI 1EBAA 2P47B 2HN7A 4YHKH 4KKAC 4A6YB 4KK5C 4P4KA 4HIHB 1JPFA 1BGXH 1BM3H 3WBDA 4BK4A 3ARPA 4UV7H 2YA1A 4MXVE 3DX9A 1PZ5A 4HFUH 3VXOA 1CD1B 3KPQA 1UCBL 2ADGB 1HKLL 1I1FB 3QI9B 5DJDA 2GAZB 3MXWH 3ECBA 4WRLA 5F9OH 5J6GB 1QACA 2HLFD 3S37H 4I2XB 1DZBA 5KSAC 2XZAL 2FD6H 3IJYB 3MRFB 4JRXA 4QF1B 3SBWC 1SJEB 2PXYB 5ISZE 5C9JA 3VGDA 1V8HA 5C0BB 1XT5A 1IGTB 4G6JH 3VH8G 2C7UA 4MXQD 1ES0A 2DQHH 3BDXA 4XB8A 3U7WL 4FZEL 3BRFA 5F70A 2DRUA 2R0KH 3ELAT 3TESA 4XBPB 1CXLA 1EO5A 3H2WA 1EHNA 2PO6B 5F7NC 4PJDE 3Q1SH 4FXKA 1FFOB 4OFVA 3P9MA 4XP4H 1N4XH 4XAKE 4F7PB 1NBZB 3SE9H 3UTSA 3HMWH 5ENWA 4YHLL 2EDBA 2ZP0T 3ULVE 2D2OA 3HI6L 5CSZB 3L5WA 3O45B 3BDYL 2DM7A 2BSSB 2DMBA 3M17B 4N1CA 1MJ7H 5FK9B 5F9DC 1VEPA 4EDWL 3T04D 3EYFB 3T3PE 2AKRA 4M8QB 2RB8A 1FNLA 3DMMB 2A9NL 3BHBB 1BZ9A 1SEQL 4P2OC 5GS0L 4UTBL 3HKFA 5AWNH 1W72H 5BXFB 4HC1L 3FN0L 5DZOA 3VA6A 1JTPA 2ZG3A 5FV1L 2FGWH 5EU5B 1I1RA 1UG9A 5DHYA 1HQRA 4H8WH 4OD2B 2XTJC 5JW5A 4KPHH 3ARUA 1MFNA 5HI4D 1N6UA 4WWKD 3DVNB 3SDXF 1GGTA 5I1JL 2FH6A 1JJUA 1UH2A 4UIMA 2ZCKH 1HE7A 1U8OB 1JTTA 5D2NB 1FNFA 2JJWA 4RISH 1UACL 1IMHC 2L4OA 3WS6C 1E4KC 4EI6B 2NTFA 4GW5A 1MIEL 3WXVL 1S7VB 2ENYA 2VLLA 4I0PA 2JELL 5D72H 4H26A 4WU7A 1HXMA 2DQJH 1XF3B 1BBJA 4JQVC 4NFDA 2EYRB 4PJCB 5KG9B 4KHTL 3ULUL 3BPNC 3MCG1 1CL7I 3MBEA 3PHQB 1WZ1H 4QYOA 3STZB 4KU1A 2CKNA 2AEQH 5BVPH 4GAYA 1A6PA 4M00A 3QIUA 3UYPA 5JQ6H 1K8DB 1HEZB 1HNGA 3O4OB 2MWCA 3MOAL 4NNYB 3CSGA 2NX5B 3BPCB 3LKNB 3WNNA 4QY8B 1DBBH 1FL5B 2QHLA 3U0PB 2JJSC 2FCBA 2WWMD 1YNLH 4U31A 1KCKA 2IPUG 4FQXD 4XHQA 2APWA 2EDXA 3FQUA 4LCWD 4XP9L 3OKEA 5ACMA 3I6GA 3O9WB 4WJ5A 5D1QC 2JJTC 1QLEL 3NABH 5F7YC 3L3JB 1X3DA 4YHIB 1HINL 1NBVH 4OKDA 3T1FB 1MCOL 1WWCA 1BLNB 3H8NA 5GRVL 2FYYB 2HA1A 2J6EH 5KSBF 3HG1D 3QA3A 5D1XA 1EEZA 3NZ8A 1QTYT 2VLMD 4YFLF 4PJIF 4OFYA 1BECA 5F1IB 3SCMC 4MDJA 5IVZA 2IF7A 5F7DA 3CPLA 3GK8H 2VXQH 5C0GA 3LMJL 5DJXB 4S1SL 1J8HA 4HKXB 5ID1A 5IOPB 3RDTA 3LH2H 1Q9LB 3BSZL 4ETYA 1MRDH 4J23A 3ZE2F 3CFJB 4HXAH 4NSKB 2LU3A 4DQOH 4NO2A 4MD0B 4Z0BH 4WUUE 2NY2B 3EJYD 1HSBB 4DKFH 1I8MB 1FVCB 4OSUH 3KYKH 3TO4A 5IT2H 1JZ4A 3BZDA 4F7EA 1X5ZA 3QDMB 4HS8H 3AUVA 3LD8B 4KDTC 3FFDA 5IB2A 1FRGL 5L88H 3ZYIA 3UJTL 3LN5A 4FQQA 4PY8J 4C58B 1HQ4A 4PJGA 5C0IB 1DL7H 4NC1C 1XZ0B 4M03A 4RWHA 5JR1H 3OAZK 1A1NA 1M7DB 1S5HA 5C09D 3BVNB 3VXQB 4LPVA 2IPTH 3O0RL 5CP3H 3DO7A 1JMZA 1DR9A 2BFVH 5CEYA 3UZEA 5KSAA 1U8NA 5GRZA 2WLZA 2YPLD 3RUGE 4ZUTB 5HHPA 4LK4A 3QZWG 5A2FA 3MLZH 1EEQA 4ELMA 1SY6H 2VQ1B 4NUJB 4X6DB 4E41A 4Q6YA 2WBJC 1JRHH 4LSQH 3U36B 5GISH 3LKRA 2ATKB 2AJUL 1S7XA 1KN4H 4RA0C 2LVEA 4LVHC 4ZQKA 1AGEB 5I1LA 5LWYH 5ANMA 4CMMB 1MFAH 3ZTJG 4X5LA 4KTEH 4DK3A 5KTEL 1J1OL 5I9QC 4AEHL 1J18A 3RP1A 4KVCL 3KJ6L 3NIGE 1A7RL 3FAWA 1IC4L 1RFDL 3QFJD 1PQZA 3C9NB 2IMMA 1U8LB 1YYMH 3TVMD 2OP4H 4NRZB 3T2NL 4PIRF 2DQEH 1VB9A 2NZ9D 4JKPH 4Z5RA 3QEHB 3BD3A 3MXVL 3ZDXE 2EDOA 3BEVA 1EHAA 1OWWA 3RIAF 5I73C 1BVLA 4NM4H 4P2OA 4MVBD 3H7BA 4JANA 1H3VA 4F33A 4KQ3H 2APFA 4M48H 4F9LA 4MJIA 5DMIH 1FQ9C 1GZPB 1QFOA 2JTDA 3CU1A 4YXHH 4S1QH 5IB4B 4P4RA 2GQHA 4DVRL 5ICYA 4JGJA 3UPRA 3H9SA 3IVKA 2WLYA 1PG7X 2X4TA 4KJPC 1MF2H 3P4MA 2DB8A 1RJZB 1KJVA 4FXLA 1N3NA 4HAGA 4U0QB 4IRSD 5EG6C 3WHXB 1G9MH 5MP6H 3WS6A 1E4KA 4YDVA 4X8JB 3N9GL 1RIVL 1FL6A 2PCPB 5BS0D 1LK3L 4OZHB 3LCYA 3V4PL 1IGYB 1KLUA 2WUBL 5EU3A 4JQVA 4O2CA 3REWA 5ERWA 3CUPA 4MAYC 2A6JB 2ESVA 4XMKH 3BIKB 1VFOA 1UFUA 4LKXB 4TQEL 3MO1A 5BO1L 1QA9A 3OX8B 2BNRE 4U1IB 1A7PH 2FJFB 1JFQL 1S7QA 3MRLA 3TIDB 3EYUL 1MH5A 1IL1B 1W0VB 3CXDH 4GRLA 3HI5L 3DURB 5C0RL 3FT3A 2JJSA 2RJMA 5ISZD 1B0WA 2FB4L 3IDJB 3QJHB 2E6PA 1KN2L 1EAPA 2DLGA 3RVTD 3VE0A 5D1QA 3EOYG 2AK4B 4KKBD 1RJCA 3BESR 4GAJL 1OCWH 4ODBD 3RL1B 3E6HA 2YA2A 3OKYA 3K8LA 4Y2DC 4MHHI 1PG7L 4JREC 3MLTB 4J1UA 5JHDB 1G7QA 5HPOA 5F3BB 4L8DB 4YDKL 4XAKD 5A43C 4RGOH 5TE4H 1T7XA 1EV2E 3GRWL 1RZGA 3H3PH 3SCMA 3Q5TA 3VFGL 5IHUL 3ULVD 1FNHA 4R4FH 1Q1JH 3O81A 4LDEB 1FVEA 4JPWL 3IFNL 3JWDL 2R8SL 4CADB 3P4OB 3FQNB 3C60C 3DETC 2MSPA 4P2RA 1N5YL 4M6NH 3GHEH 4JPVL 1IGIH 3SJVB 1HI6A 1TZHA 1C8PA 3WIIL 1CFBA 5AEAA 3SQOL 5FYKE 1P53A 4B41A 4LLWB 1TQBB 2WUCL 3P4NB 3NTCH 2YS4A 4XT1C 5DC9B 3UDWC 1OF2A 3BISA 4ISVA 3SKMB 1NGXB 1U8MA 2B4CL 5ID0A 4JCMA 4U1JA 3TA3C 3AAZA 1CICB 1OTUC 3X3GH 3PWUB 4DN3H 3D87B 3T0DA 4UDUB 5CEZH 3TCXA 1X4XA 4JFEA 4GMSH 1AD0A 1KB5A 2DWEB 4Z78B 3NVQA 2W92A 3EO1A 3SGDH 4PJ8B 4HH9B 1G7LB 1NAML 4OTXL 4Y1AA 1U8PB 2X1WL 4FTVB 3ARGB 2X4NB 3E2HC 3ARWA 1MSPA 2NX5E 3BOVA 3BKJH 4R8WH 2X7LB 1FDLH 1DSFH 1ZLWH 5IBUG 1A5FL 4U1KB 1EXUB 2IBGA 2Z91B 4LSPL 4A6YH 2WBJA 1SQ2N 5J0BA 1T4KB 3ILPA 4OBSA 1S9WA 1NDMA 3BQUB 5EOQH 1ZA3B 3S96B 4JJ5B 1G6RA 4X7DC 3KPMA 5HY9A 3GI9L 1RMFH 2J12B 3MOBH 4PG9B 1FIEA 1J10A 4GAGH 5EO1A 3RGVC 2MHAA 5DD3H 4NJAL 3JZ7A 3DX6B 4XPFH 2HN7B 1QRNE 2E9JA 5D7IE 4P4KB 3SKJH 3OHXA 5EIQA 4UBDD 1JPFB 5E6IC 1A7OL 2HJLA 4P46C 2W9EL 3WIHH 5C86A 3DX9B 1PZ5B 4QHKI 5F7FA 3VXOB 3KPQB 4M7KH 5IF0A 4Q9CA 4LBEA 5DJDB 3WUWA 4Q7DA 3ECBB 3MA9H 3T0XA 5MERA 1PG7W 2EDQA 1AD9A 2V17L 2R0ZL 4Y5XA 4JRXB 4X4ME 3IXAA 3ZYOA 4GG8A 3B9KD 5HBBA 2UZYB 4I3SL 3NCFB 1KCLA 1FGNL 4NQDA 4NZTH 5DMGC 3SKOA 3ZT7A 3RZCD 5C9JB 3FT4A 3K4DA 3WE6A 3RJDA 1IT9L 2C7UB 2V5SA 1ES0B 3JVGC 4WUUD 3BZFA 2EO9A 3GI8L 2GJ6E 5DA0B 1X9QA 4WY7H 4KJQD 1CU4L 1MJ8L 1KCVL 5GXBB 2FR4A 3D6GA 3WNPA 4DKEL 4U0RB 3GIZL 3WKNA 4LCUA 2VKWA 4AYFA 1TTFA 4FXKB 1G1YA 4LSRH 2ERJB 3ALWA 1BZ7B 3P9MB 1MCJA 4HV8A 1SM3L 1LP9E 5HSFA 2QL1A 2V5MA 1T21B 2QQNL 3UTSB 2P8LA 3NCJL 2AW2A 3D9AL 5ENWB 5D93C 1HHIB 1EH9A 5GRXG 4RGNE 4WDIA 4Y5VC 5J11B 3HNTL 3L5WB 5ITBH 1HSAA 2ZG1A 4PJCF 2VLKA 4HGKC 1JN6A 3SO3B 4KRNA 2JB5H 1BZ9B 4AG4H 2VB5A 2VWEC 2WIIA 1I8LA 1RIHH 5DUML 5FCUL 5DHYB 2QSVA 1HQRB 3LQAL 4BUGA 3DARA 4EVNA 3TPUA 2Q8BH 5JW5B 4K8RH 1FGVH 1TTGA 4Q2ZA 1NANI 1RUKH 5K93A 1ZT4A 4XNUL 2X1XR 4UIMB 3EFFA 4PJXA 2FSEA 1OP5H 5T1DH 2HKFH 4CN4A 3GMPA 4M6AA 5LGJA 4MAUH 2NTFB 4GW5B 4WHYH 3PABA 5FA4A 2NY1D 2VLLB 2HFGL 4H26B 4WU7B 3D25A 1HXMB 3QQ9D 1AY1L 1BBJB 1JZ8A 2XA8L 3GKZA 4FQ2H 3A6CH 2IBBA 3MBEB 1ND0A 1KV3A 4QYOB 5IGXL 4Z7QF 1HZHH 1IC5H 3TJHC 4CVUA 3C60A 3HC4H 4QHMA 4GAYB 2HT3D 4XHJD 3QIUB 3GO1H 1K8IA 2XZQH 2O5YH 4XH2A 2EDHA 2XPGA 2ZUSA 2G5BA 4NHCH 3RL2A 4YDLC 3BP6A 1U93A 2AXGA 3S7GA 3UDWA 2PTVA 3CSBA 4Y89A 4KMTH 4IBLT 1T7WA 4HIXL 3FQUB 3OKEB 1KSRA 3I6GB 3TA3A 4WJ5B 3C87A 1EJOL 4R0LB 3O6KL 4Q9RH 5FAAA 2XZCH 4XTRC 4M43H 3FRPA 4PBWD 1WISA 1NGPH 2MQ0A 4LCYA 4XXDA 4UINL 4I48A 4XNXH 3CJJA 4EQ3A 4JAMA 1GGCH 3QA3B 3I3DA 5ADOH 5D1XB 1K2DA 1EEZB 2BOCA 4M93C 5TQ2L 5CGTA 3GJFA 5DFTA 2PXYD 4KJWD 2W0PA 4MDJB 5IVZB 5MENE 2YKLH 3CPLB 5F7DB 4ZXBC 2AJ3B 5C0GB 5EZOH 1J8HB 5ID1B 4UZGA 4I4WA 1NL0H 2BNRD 3MYJA 3RDTB 4XNYH 1T03H 4NO2B 1OPGL 4FQLL 3T0AA 2PO6D 1QLRA 3IT8D 4LCCA 4OCWH 3TO4B 4X6DF 1LO5A 4F7EB 1GHFL 3RGVA 4LPUA 1OAQL 3FFDB 5IB2B 2VC2H 4OJFL 4GQ9H 4XC1L 3OPZH 2P5WE 4UIKL 3DI2B 3LN5B 5KVDH 3HNVH 4FQQB 4KHXL 1HQ4B 4M7LL 4PJGB 4P46A 3QH3A 2XWJA 1QBML 1A14H 2IQ9H 1S5HB 1WIUA 3V0WH 2VDRH 5DXWA 1I9JH 3DO7B 1AH1A 4N0UA 3DMMD 3ARDC 5CEYB 1IEBA 3W81A 5KSAB 5HYEA 1U8NB 1S3KH 2F19H 3OB0K 5HHPB 3HE7D 4OD3H 3K1DA 4ENEC 4HPYH 5FFLA 3VU2A 3RTQA 4HWEL 4ELMB 3MV7A 3NCYP 2PR4H 3VGEA 4E41B 2G9HA 5IMOA 3LKRB 1CGSL 1S7XB 4F37F 4ZQKB 1BAFL 5FYKD 4MZ2A 1OTTC 5GGRA 3UYOD 5ANMB 4P0DA 3F7QA 4YXLH 3G6AA 2RCSL 3VRJA 1ZTXL 3C2SA 3FFCE 4NWUH 1S9KC 1ERNA 2V5RA 1FORL 3AY4C 4MA7L 3LPGA 5EB9A 1PQZB 1CDHA 4MNQE 1KT2A 3O2DH 4OZHF 4QTIL 3RHWK 1HYSC 4Z5RB 1CGXA 2UVEA 3BEVB 2AVGA 4TUOA 4N0RA 1BVLB 2A0LC 4P2OB 4Z8FL 1WTGT 2NX5D 2R2CA 4H0IA 3H7BB 5I1CL 4JANB 2AI0L 3QCTH 4HWNA 1ADQL 5J3HC 5IFJA 4F33B 3FO2A 2HT2C 5F21B 1N5AA 4D0DB 2XTJB 4MJIB 2WAHA 1J1PH 2NXYD 3VWJC 1Q0XL 3O9WD 4P4RB 4S2SA 5ICYB 3UPRB 3H9SB 3TBWA 3IVKB 1PKOA 2B1AH 2DLEA 2X4TB 2XQYK 3P4MB 2ZCLL 4AEIL 5DVMA 1KJVB 4OKVA 1N3NB 3H3BC 1CN4A 4YDVB 1A6VL 5JW4N 1VGEH 4Z9KB 1FL6B 3IU4L 2XQBL 2A1WH 5AYUH 1KB9J 4AIOA 2B39A 1QRND 4XRCA 1KLUB 4O58H 5EU3B 3F5WB 3LKQA 4JRXE 4O2CB 3REWB 1XGYL 3BPNB 5ERWB 3CUPB 2ESVB 4M3JA 2BVQA 2CDGA 4MMXC 1WTLA 1EUUA 4K23H 3MO1B 1QA9B 2CQVA 5ICXA 2COQA 2X41A 1AQKL 4PR5A 5C0FA 2XTLA 1S7QB 3ULVL 5CGYD 3SQBA 5CZXD 1MH5B 5I30H 1MFCH 4GRLB 4L4TA 4MD4A 1I9RH 2YD7A 1PLGL 3FT3B 4QRRB 1CDBA 5I2IA 5A3IC 1ZK9A 4FQ1L 3DBXA 3U0TA 1L7TH 5HHVH 3VE0B 5D1QB 4QXGL 5F3HB 4OCNC 1YEKL 5DO2C 4XCCL 2GJ6D 5IJVB 5F71A 4DZ8A 3E6HB 2EDRA 3G6DL 1A6ZA 1YMMA 4J1UB 1ONQA 1G7QB 1Q0YH 1S9VA 3QUML 2R0LL 1TTUA 2AK1L 4Z18A 1OAXL 1RULL 1H3PH 1RZGB 3SCMB 3VFSA 4ZXBA 4PRPA 1DEDA 3H7LA 4M4RA 2BVUA 4POUB 4RGND 1FVEB 1NCBL 5IWLC 2DDQL 4DAGL 4ZSOA 3MJ7A 3GNML 4HMEA 1UB6A 2NY7H 4P2RB 3ZT6A 5IVXE 3VI4E 5F96L 3K2UL 1FE8H 3CVHA 3GSVA 1KYOJ 1HI6B 1PEWA 1TZHB 3MJ8A 4KY1L 1G7HA 2OX5A 3VA2C 4HWBH 3H42H 4KK6C 1JGUL 1OF2B 4V1DE 4ISVB 3TN0C 3QQ3A 1U8MB 4R2GD 5CD5D 5AAMA 3AAZB 4MXWH 1ED3A 1PJ9A 1F6AA 3QUXC 4IRZL 4JFEB 4DKDC 1D5XA 1AD0B 1KB5B 3Q2CA 5EU6A 1M71A 1T04A 2CXGA 2YPVL 3EO1B 5JXAL 3H9ZA 4KMQA 4Y1AB 5GGUA 1MWAB 3ARDA 4O00A 1BVZA 2DI7A 4ZTPL 1L0QA 3M1BA 1DANT 4QRTA 3RX5A 3T1WA 2HRLA 4GG6A 3HB3D 1T5XA 1HDMA 1LHZA 3ETBF 1RZ7H 4D9RE 4KWUA 2AQ1A 5B21A 3WSQL 4QHUA 2P45B 4PJAA 2VZSA 3INUL 2D7OA 3F58L 1Y6KR 4N0FA 4X5XA 4WI6A 4M02A 3ILPB 1S9WB 1NDMB 3JV6B 1HHKA 4HEME 4UT9H 4X6EB 1KBGL 3QIBA 4NOBA 3HE6D 1R0AL 2OJZH 1LQSR 4OD1L 4K71B 1VHPA 3CFCH 4YHZH 5EO1B 2MHAB 1YEFL 4H1LG 5E8NB 3AY4A 2JJUA 4OZIE 4PLNC 4LVNB 4OQ1A 3OHXB 3CK0H 4HUVA 4LCIL 5GRJH 2HJLB 3IXTA 4JFZL 4QHLA 5FV2A 2OYPA 2MCPH 2AXFB 5IF0B 4Y4FC 4LBEB 3WUWB 4AIZA 2Q87A 5MERB 1DBJH 3ARYA 5CJ5A 4M5YL 1AD9B 4S10A 3ZKMD 4G7YH 4Y5XB 2NNAA 3IXAB 4FNLH 4IDJL 3WNLA 4EBQL 3HFML 4GG8B 5MEND 2P42B 4QWWD 1T89A 2BP3A 4TYUA 1F5WA 4NQDB 3SKOB 5HDQH 1BQHB 3NN8A 3QHFL 3FT4B 3VWJA 5LAXB 2Y9RT 3DPBA 3WE6B 1B4RA 2HAZA 2VN7A 1H3UA 4OZGA 3ALXA 2FX8L 5T1LB 1IEAA 3BZFB 4G8EA 3V7AG 4ODVL 3BRGC 4Q74A 4ZPVA 2JIXD 2DQUL 1AJ7H 4WI5A 1HKFA 2A6KA 4OF7A 1MJUL 4F58L 3HC0A 2P5WD 4HV8B 5JPNA 4MYWB 4NO3A 2JE8A 1AGBA 4RDQG 2P8LB 5H2BA 5DVKA 2EYTA 2F9BT 3LB6C 2PW1A 4WDIB 1RUQL 4Y16B 3RVVC 4CBPA 4ELME 5JPMA 1HSAB 3HAEG 2VZVA 2FBJL 1GOGA 2VLKB 5KW9L 2HLAA 1JN6B 1XIWC 4WI8A 1KPUA 5JIIA 5D70H 2VL4A 3LIZH 4JQIL 2O5ZH 3WHE0 3TP4A 4WI9A 1CDIA 1CK0L 1Z3GH 4MGXA 5DTFA 5IFHH 2WIIB 2A83A 4YUEH 4K9EL 1T0NA 5DHVA 4ZOAA 4EVNB 3TPUB 3B4NA 2W91A 4HIEA 4ODUA 1CICD 4GUPB 2MPAL 5KVMC 4Q2ZB 2VDOL 1UB5A 3VGAC 1ZT4B 5E6ZA 3EFFB 4PJXB 1G0DA 2FSEB 1F3DJ 4JREB 3GM8A 3GMPB 3TFKC 5LGJB 3FFCD 3QXVA 3EOTL 3PABB 4G9DB 5FA4B 3ARGD 4Z7NE 5T3XE 1FG2A 1NCAL 1KTKE 3D25B 1RZKL 5E24E 3TM6A 1WIPA 3TV3H 4MNQD 4JPKH 1AXTL 1BFVL 5E2UL 1ND0B 1T20A 3RIAK 2X4UA 1ZVYA 4XP1L 4O02L 1L9NA 4JO4L 3C60B 1G6VK 4QHMB 3EYOA 2VOTA 4YQXL 3LPFA 4LU5H 5BJTA 1MCDA 1K8IB 4K3JH 4BQCA 3PV7A 2ZUWA 5K9QG 3DRTA 4XH2B 3X14A 2G5BB 4M1DL 3RL2B 3MLWH 1XR9A 1I9IL 3BP6B 3BX7C 1U93B 2FIKA 2AXGB 4YC2C 2IALA 3TN0A 4YBQC 1E6JH 2NR6D 3EYQD 1N7MH 3R4DA 3VGBA 1J0YA 1MNUH 3NFSL 3QUXA 1YN6A 2PF6A 1R24A 1O0VA 3HLAA 4LCYB 4XXDB 1C5CL 1HWHB 1V3MA 2E7HA 3UAJD 2J3SA 5CLTA 3VFUB 2P8MB 1BBDL 4I48B 3EYSL 4G6KL 2GKIA 4LKCA 3MCLL 1LILA 4JAMB 2GEEA 4YIQA 3PP4H 4PJGF 1EGJL 5LXGL 1K2DB 3E2HB 4JRXD 2BOCB 1F4XH 3STBA 2QSCL 3GJFB 4YHML 4QRRE 3U1SH 4U1LA 4I5BA 4HUWA 5MI0C 2VITA 4I4WB 3MYJB 2W38A 2IWGA 3CSYA 1LGVA 2VXTL 3WFZA 3O2VH 1DQMH 1NLDH 1AR2A 2GUOB 5J56B 4ODWA 2YRLA 4PJ5E 3KVQA 3BN3B 1FFQA 4NIKB 1QLRB 4LCCB 4ELMF 3V5HA 1LO5B 1BD2E 1MQKL 3RGVB 3DGGA 1B90A 2VH5L 3IFLH 3HZVA 5CUSL 5DJ0A 3MRCA 5DD5H 2PUQT 4YJZL 4JM4H 3WLBA 1S9YA 4M3KB 5FYKL 2DQCH 1NFIA 3BH9A 1JL8A 5CFHA 4PRDA 4ORGA 4P46B 5DQJA 3ZZ1A 3QH3B 4KQ4H 2XWJB 1CLYH 4PJHE 1WBXA 2Y07H 5EC2A 4Y4FA 1MFEH 2NYYC 4P2RE 4N0UB 4NYLB 3OZ9H 1D5MA 5L8KB 4XVTL 1IEBB 1N59A 2NXZD 4KZDL 4X6BA 1TXKA 3FQWB 5KS9A 3BPOC 2OBGA 2ICWI 3W9EA 4FG6D 4GAFB 4QXUL 1CF8H 3RTQB 1RUPL 1KFAL 4YX2L 4HC1A 2EE2A 4OM1H 1W8NA 2G9HB 3MTRA 5IMOB 3KLHC 4LHUD 4Z95L 4EXKA 2CUHA 3WJJC 3DHJA 5GGRB 4HX1B 3G6AB 1JHLL 3BPLB 4V1DD 4Y1AE 4ODHH 4HIIA 4EIZC 3S35L 4PTTA 4MB5A 1CZ8L 2AEPH 5D93B 4G5ZL 1H0DA 1NMBL 4Z7UE 4ZFGL 4R90H 1KT2B 2WWKT 2J5LB 1CGYA 1PZUB 3QIUD 4YDJA 1XIWA 4OGAD 1RIUH 3IRZA 3K4ZA 1WFTA 4TUOB 5F93C 2DD8L 4ZUSB 2FJHA 1DCLA 4TVSa 5LCVL 3FHQA 5TE6H 1H8SA 1D5IH 3WL9A 4J3XA 5IFJB 4D9RD 2A38A 3FO2B 1N5AB 3S36X 1INQA 3B2UC 4RQQA 2ZJSL 4S2SB 4R4NC 2W65A 5EU7E 3TBWB 1UCTA 1B6UA 3UZQA 4EEEA 4FFVD 4OKVB 5D6DC 3QRGL 1KLGA 4UB0H 4HIJA 9CGTA 2BVTA 4LEXL 1HNFA 3CU7A 4EOWL 3TNNB 1M7IA 3ALPA 2FO1A 5D1XD 4JRYA 4XRCB 4HXBH 4JDVA 3LKQB 1TVHA 3HI1A 1KELL 5EOCL 2BVQB 2CDGB 4NQDE 5E5RB 4K7PH 3SE8L 5E2VH 4OCYH 1GZQA 2DWDA 4POZC 5JW4M 5JA8B 4Z7VA 5ICXB 4NN6B 4PR5B 5C0FB 1E4WH 1JZ6A 1CDGA 2N7BA 3VFVA 1B6DA 3JWDC 5L7XL 4YDLB 4L4TB 4MD4B 2Y36L 3AS2A 3D85A 3PV6A 1R5VA 5I2IB 2K1MA 2DJSA 5F7EL 3DBXB 2VLJA 3U0TB 4JY6B 2IAMC 3GMOA 4HUMB 2AERT 4G80A 3N1MC 4L8BA 4M1GL 3UJIL 4YBHA 3S36L 2D0HA 5GS2H 4DZ8B 4FQCH 2B4CC 3RAJL 3RKDC 3QWQB 1LNUB 4E5XA 5I74B 5I1EH 1A6ZB 3PQYA 1YMMB 1ONQB 4XCFH 1S9VB 2Q1EA 4M62L 3BKYL 1WFOA 1A7NH 1I4FA 3RJQB 3F8UB 4FQHA 1G7PB 4YE4H 3VFSB 3SN6N 4ZXBB 1FPTL 1DBKL 4PRPB 4ZD3H 4U3CA 1L7IL 4Q9QH 5ESQA 1OP5K 4FFZH 1UB6B 2J88H 2P8PB 3SE4C 1VA9A 5C71A 3RNQA 3CVHB 1C08A 3GSVB 5EDXA 1WCQA 3MJ8B 2HLFC 2A2QT 1SJHA 1G7HB 2F5BH 3RIFF 3BW9A 4FHBD 5FM5M 1OGAA 2DF3A 3QQ3B 1KEML 3L3OA 2HP4A 2C4XA 2IG2H 4IDLA 1BIHA 3CSPA 4J6RH 2OZ4L 1ED3B 5IVNA 3V5KA 1F6AB 3CVIL 3CFIC 1D5XB 4MXQC 5EU6B 1M71B 2HT4D 1T04B 3A67L 4GXUN 3F65A 3QHZH 5T3XD 1YDPA 1FVDA 3ZHLA 5GGUB 2P4AB 3ARDB 2ZZUT 3F6LA 1BQLL 5DQDH 1G6RH 5KAQF 5F44A 3M1BB 4QRTB 5ETUA 1NC4A 4GG6B 1NUDA 2UZIL 1T5XB 3QDGA 1CGTA 1HDMB 3NACH 5TF1L 1GOHA 4QHUB 4PJAB 5DURB 3PE9A 4ERSH 1DTUA 5CZVL 3LY6A 4N0FB 4RGMC 4X5XB 1FNSL 4HCRL 3JXAA 3P0VH 1HHKB 5FHAH 1ZLUH 3WJJA 3QIBB 1HHGA 4J3UA 1TJGL 1DUZA 3EFDL 3QXUA 3I2CH 1P69B 2EDLA 4NNPH 1MCCA 2VZ1A 5AZ2H 3D39B 1JNLH 1UKTA 4XC3L 3RWHA 2CMRH 4HUVB 5HI4C 2N7AA 4WWKC 1GC1L 3IXTB 3QXWA 1U6AH 4WHCA 4QHLB 1BEYH 4RRPA 4I13B 3VD4A 2DQDL 2J1KA 5C6TH 1MCSA 4AIZB 4JJHA 4HLZH 4K3EL 3DV4A 4EXPX 2BX5A 1QLFA 5EUOA 4GRLD 2NNAB 4UNVA 2VDNL 4QRRD 3QB7C 5EN2A 4B0MM 2A73A 3GUTA 1QBBA 3NN8B 3VWJB 4CDGC 3WKMH 4G8FA 3FMGH 4N8PA 5I15H 3WS3A 1LO0H 1FH5L 1Q9WA 3PP3H 2E6JA 4OZGB 3VGFA 3MMEA 5D6DA 3SDDD 4KC3B 1IEAB 3LQAC 4G8EB 4PJ5D 1MCNA 3LEVL 2AJYH 5D1ZA 2QKIA 2DL9A 5TE7H 2EE6A 1BD2D 3UTPE 1Z0NA 2A6KB 5ESAB 1RUMH 2GW5A 3HC0B 4N0UE 4YEFA 4I9WE 5D7SH 4PJXF 4ACPA 5JPNB 4Y7MA 2WWMC 1NMAH 2DI9A 4KAQH 2VXSH 4NO3B 4FQXC 3TO2A 1AGBB 4PG2A 4QXTA 5H2BB 1AR1D 4A2MA 4LOUD 1QUNA 1CXEA 5TFSH 2IH3A 4U2ZA 1U58A 5GZOD 2PW1B 2FHCA 5JPMB 4Z76A 4RA3A 4P2RD 4XNMA 5EORL 5GSRB 2VDKH 2HLAB 1KPUB 2ARJB 3OR7B 1A6AA 2OR9H 1NLBL 4UT7L 3U46A 1GJIA 3L3KA 4BZYA 2X40A 2BHZA 6FABL 2DJUA 5DTFB 5B8CB 4YBLC 2A83B 3AB0C 1T0NB 4NUGL 5DHVB 5K9JL 3CFEA 4F37K 2D7TH 1T2JA 4F2MA 2W0KA 1JK8A 2GJZB 5IEKA 1IFHH 1UB5B 3AROA 2X4SA 1ZT7A 3QG7H 4HPOH 3ILQD 3T4AA 4F15C 3EJYC 4Y1AD 3SKUD 1FG2B 2H6PA 5TDNB 1I9EA 2ILLA 5I8OL 1CDUA 2CO6B 4UT6L 5IV2A 1D6VH 3ISWA 3CFDA 2WWKO 1VFBB 3QEQE 1NAMA 5DSCA 2WIMA 1T20B 2X4UB 4BZ2L 4U33A 4TSBL 2YN5A 2Z31A 3EYOB 3RWFA 3ULSA 5IBLD 5M94B 5BJTB 2NY6B 3SE4A 2V7NA 1UM6L 3GMMA 3QPXH 3DRTB 3SHSA 1U8QA 3PG2A 3X14B 1P5UA 1E0OB 2X9XA 3ESUF 3FONA 1YEEH 1HHHA 2X2YA 3RX7A 1XR9B 3BI9X 2F58H 2FIKB 2CRYA 2IALB 3TN0B 5CLWA 3MR9A 2VDML 3LZFL 1YJDL 2QQLL 2ITCA 1EFXD 2OS7A 5KSUA 1AXIB 3GJFH 1FZOA 1YN6B 4ZODA 2HFFB 5E7BA 3VD5A 4UV4H 1R24B 3HLAB 3MLRL 1FFRA 3UTZA 3T0EE 4OLUL 1YEHL 2FATH 3OL2A 1AHWC 3VFPA 4PB9L 3CLFH 4KJYA 4LKCB 3WFEL 5IW1A 2X4QA 4YIQB 1CXHA 1P9MC 1JPTL 3MLSL 1RUAH 3S37X 3GKWL 5JW3H 1NJ9A 3P4LA 3WXWL 5IB5A 2DIJA 4NQDD 3IAPA 4U1SA 4U1LB 4I5BB 3DIFA 1J5OH 4HUWB 2VITB 4LGRB 3TVMC 3SDCD 3VW3H 3QUZD 4NO0D 3CSYB 3TEUA 4KUCF 5T1LD 2NZ9C 4N0CD 2E5EA 4ODWB 4OM0L 5KOMC 2I26N 5C7XH 2HTKD 3V5HB 4CMHC 3GMLA 4MVBC 1AIFA 1YMME 5K33A 3DGGB 2IADA 3HZYA 3C2AH 3HZVB 4U1NA 2E27H 5DJ0B 3MRCB 3WLBB 1S9YB 1NFIB 3BH9B 3NA4A 4PRDB 2OM5A 4ORGB 5DQJB 2FX9L 4Y16D 4YHKL 1DLFH 4IRSC 1WBXB 5EC2B 4Y4FB 3O3UN 2X1OA 1BGXL 4GRWB 4PRAA 1D5MB 1BM3L 3IDXH 4NQXA 1N59B 3C5SA 2R56H 3L1OH 4RBPH 2BERA 4HFUL 4X6BB 5KS9B 1RAMA 1ZOXA 3PJSA 3W9EB 4R97C 3DYPA 3MXWL 3O2WH 3HZKA 4G6FB 2QHRH 3EIFA 2FD6L 2H3NA 1UM5H 5F7UA 1NEZG 2FLBT 2CDFA 1F58H 4YFEA 3E8UH 2BY3A 4JN2A 3LN4A 3FZUD 4YFLI 5GGTL 4HIIB 3IFPA 2CRIA 4PTTB 1BJ1J 2R0KL 4LCWA 1N0XL 3U83A 2EEAA 4OFIA 4KTYA 1CDJA 4GG6E 3RVTC 1B0RA 3B6SA 2EEDA 4RFOH 4KKBC 1H0DB 2J4WH 5T33L 3UROR 3OR6A 5DRWB 4LMQE 3CMOL 1N4XL 4J3TA 1OGTB 4YDJB 3SE9L 4CJ0A 1XIWB 3P2TA 3MPCA 3K7UA 4XVSL 4F8QA 3MJ9A 4QT5A 2ITDA 2FJHB 3ZDYE 1KJ2A 3F7RA 2OL3L 2O93L 4GMTL 3G08A 1MJ7L 2KUTA 2E9IA 2QLVB 1CCZA 3D39E 7FABH 1INQB 4RQQB 3ULVC 2KZWA 3BUTA 1FL3A 3SOBH 5AWNL 1W72L 2W65B 2BRRH 2X89A 1OTSD 2VR4A 1KUMA 3VGAB 5IBUB 1MCBA 1KLGB 4KPHL 4DUVA 4HIJB 3UPCA 4ZNEA 3O41A 5T3ZH 5KOVC 3FJTA 4EI5A 1JF1A 1R5WA 1M7IB 2RAMA 4QRUA 4L4VE 1LEGA 4YHYC 4JRYB 4OF0A 4JM2A 5B3JE 1X6LA 1V3KA 1LO3H 1TVHB 3HI1B 4FXGA 2CIIA 4P23D 1EEYA 2V5TA 1QSFB 4UTAL 4P3CH 3MYZA 2DQJL 1GZQB 2DWDB 4MB4A 4YHPA 2E3VA 2BJMH 2V9TA 3S5LG 2KZ1B 5TQ0H 5C09A 4Z7VB 5J7CC 5I0ZA 1MEXH 2Y72A 4JHAL 1WZ1L 1TJHH 4JG1L 3VFVB 2BY0A 1GPOH 1LK2A 3PWVA 4OCSL 1BHGA 4YC2B 4DUXA 1OAKH 3D85B 3PV6B 3SDYH 1R5VB 3Q5YA 1CGVA 2ZCHH 5DR5H 5EO0A 2VLJB 4N8CH 3VXSA 3O6FA 3S3SA 2Q7NA 3GMOB 1DBBL 2OJEA 4L8BB 2MKLC 3V4VH 1X4ZA 3BIAX 4DGIH 3UBXI 3MCKA 4E5XB 2GSGA 3UTPD 5D7JA 1MFDL 3PQYB 5FYJE 3L3DA 4I9WD 1P9MA 2ZUUA 4LVOB 3CVHH 3UTOA 4EDXA 1UVQA 1I4FB 2XIDA 4FQHB 4KUCD 1HN1A 3LS5H 5CMAA 3QFJA 2J6EL 2ED8A 5IESH 3RTQD 4O5LH 5T3XL 4UBDC 5MI0B 3TVMA 1FBIH 4OBRA 4GG6F 4L8SC 3MLXH 4UILH 5L8LB 2PKDA 3RNQB 5ADPH 1C08B 5HDBE 4PJAF 3VXME 1LDPH 1SJHB 3HAEA 1MRDL 1NCNA 1INDH 3BW9B 4HXAL 1OGAB 4OGXH 4TSAL 4DQOL 3B9KC 4ZS7H 1RZFH 4NQCE 3L3OB 3RZCC 1T5WA 3LS4H 3KYKL 4WCYL 2B2XL 2VAAA 4HS8L 4QHKJ 4APQA 5EOTA 5GQBA 1NSNL 1ZE3C 1WV7T 2O26U 3QULA 5L88L 4IRSA 3N85L 1SJXA 2RR3A 4KJQC 2CGRH 2NY3B 2F8XC 3NOIA 1YDPB 1FVDB 1TCMA 1N6QL 1I85C 1QFWL 4WUKL 4NOFA 3E0GA 2GK2A 5BS0A 3QEQD 3ARBA 2X10A 5ETUB 2X1QA 1NC4B 5ALCL 5CIPH 2IPTL 3QDGB 4ONGL 4K7PY 2BFVL 4H0GA 3TBVA 3UPAA 3ZL4H 1IAIM 3DTXA 1MHPH 2LABA 2E8YA 5C0AE 3MOQA 1ADQA 1LD9A 4YZFF 1HWGB 5SX5H 3MLZL 4QO1A 2HRPL 3BWUC 3SGJA 1HHGB 1QR4A 4P5TD 3E3QE 4NPYA 2WV3A 1IAOA 1SY6L 2SEBA 1TDQA 1JRHL 2VDLH 1K3ZA 3V52L 4OZGF 2EDYA 1WAAE 4MJ5B 1C5BH 1J86A 5ISZA 5KJRH 5DRNA 1MREH 4ZUWA 5JORA 4WHTA 4XCYA 1I1AA 1A9BA 1MFAL 4GBXA 4KGJA 4PRBA 4YHNA 3RWHB 2DTSA 4KTEL 2OCFD 3T0ED 4FS0A 5JHLH 4XWGL 4PJDA 2BCKA 3SGDI 2R39A 1NDGA 1YYML 1RQ5A 2OP4L 5B4MD 1CFVH 2NY1C 3DV4B 3QXAA 4PUBH 4RFNC 1QLFB 5EUOB 5I6XC 4FP8L 3QQ9C 4DZBA 2ZSVA 2HKHH 3L5XH 4HW6A 2A73B 3GUTB 5D7LE 4K3DL 4M6MH 3PUCA 4G8FB 4LHUG 4NM4L 4PGDA 4AL8L 3WS3B 5MEPA 1Q9WB 4Y4HB 3THML 4PRHE 3MRDA 4KQ3L 4LNRA 3MMEB 5ICZA 2HT3C 1II4E 4XHJC 5D1ZB 2QKIB 3MLUH 4S1QL 3MA7A 4FQIH 3D18A 1T7ZA 3WN5C 5F6HI 1YMMD 5FKPB 1MF2L 4TUKL 5HDBF 5A1AA 3TO2B 3P9LA 2R29H 2XQYG 1R3KA 1BZQK 1Q72H 3HA0A 4QXTB 3QR2A 5E99H 5HGAA 5DHVH 3QUMA 4OLWH 3UJJH 2R9HD 2IH3B 4CNIB 1U58B 1RZKC 4MJ2A 5IW6A 4Z76B 2CJUH 3MUJA 1DEEA 1GOFA 4P5MA 4XNMB 1IKNA 1PSKH 4XMKL 3NPZB 3U46B 1MCWM 1A6AB 1IGFH 2P5EB 3BT2H 4JFYA 3DJ9A 3L3KB 4X6CA 3UC0L 2XKNA 5E00B 2BHUA 1A7PL 2C3VA 4LSTH 1E4XH 2PXYC 4KJWC 2UWEE 3CFEB 4OQTL 2VZUA 4F2MB 3VI3E 1JK8B 3CXDL 3MRRA 2BVPA 1KEGL 5IEKB 3W2DH 2X4SB 3CNKA 5AZEH 1ZT7B 5HPMA 5J1TC 1INEH 5LBSH 3T4AB 2Q6WA 3ULUE 5EZIL 1WJ3A 2JF1A 2PO6C 3G5VA 3GFUA 1HK6A 3ZLQC 3OSKA 3QEUB 2H32H 2H6PB 1OCWL 4GOSA 4PV9A 3VCLA 5IV2B 2FECI 2F5AL 1A9EA 4I3RH 1NAMB 1TZGH 5DSCB 1REIA 5F72S 3MRJB 1BX2A 5E56A 3FO9B 3HCVA 1NC2A 2IBZY 4CGTA 1F3JA 5TE4L 3IJSA 3QXDB 2Z31B 3RWFB 3ULSB 3VXPA 5C0JA 2XY2A 1EDQA 4FFYH 2V7NB 1IGCL 3QIBD 3F7PC 4R4FL 1U8QB 1MLBA 5K9KA 3DMMC 3OGCB 3NCCB 4Y19E 3FONB 1HHHB 4LF3A 1MCQA 3GDBA 1A6WH 1WVZA 2O5XL 3B9KA 3D39D 3GHEL 3HE7C 3MR9B 5HDOA 4JFFE 4PJFE 5FDYA 4TVPH 5KSUB 3FKUS 5M95B 1HKLH 1FZOB 1QSFE 1UZ6F 4Q0XL 1KULA 4OLXH 3UTZB 2XZAH 2GY7B 5C2BH 2NLJA 3VFPB 2W60A 4RAVA 3X11A 4KJYB 4NN7C 4L4VD 3W39A 4DN4L 2X4QB 4Y4KD 4GMSL 3TJEL 4MDIA 3ZSSA 4NP4L 4JRWA 5DFVD 1K5NA 5IMLA 1NJ9B 2YN3A 4A2LA 4URTB 5IB5B 5CWSA 4U1SB 1UM4L 3V6OE 3U7WH 4GRWF 1A64A 4FZEH 4GH7B 4OZ4A 3DIFB 1WUNT 1IC7H 3OF6D 3PL6A 1A21A 3BKJL 4PJ9A 5KS9F 3GJEA 1FDLL 1DSFL 2IFFH 3HR6A 3G6JA 3MBXH 3B83A 3B5HA 3GMLB 3RUGA 4HJJH 3PQYE 1XGTA 1AIFB 3FN3A 4YHLH 3BEWB 4JHWH 1IQWL 2IADB 3HZYB 4GRWH 3V0AC 5EOQL 3BAEL 3HI6H 4U1NB 4JY4A 4LPWA 2NXYC 1OLLA 1XGPA 5CD3A 3O9WC 1U42A 4ZFFA 2EXWD 2DKMA 2Z9TA 1NGZA 4AENA 4GAGL 2A9NH 1I3GH 4WEMB 3N06B 4U1HA 1SEQH 1P84J 5DD3L 4UTBH 4XPFL 4HC1H 4LLDA 2OQJA 3FN0H 2AXHA 2BRQA 5FYJD 3SKJL 1SBSL 3B9EA 4PRAB 3CMGA 4NQXB 3C5SB 4MS8D 1U3HA 2CLRA 4MJ4A 5C0ND 3ULUF 4WEUD 3DSFL 1SMAA 4M7KL 3PJSB 3U2SB 1OGAE 4NBYB 3HZKB 2AEWA 1EO8L 5EIIA 1UACH 5GZND 2H3NB 3VGGA 1A3LL 3RIFK 3WXVH 3VRLF 4LPTA 2JELH 4WW1A 3DVGA 4PGBA 2CDFB 1YC8A 4JN2B 3O3AA 4OT1H 3LN4B 3VXMD 1J87A 4KHTH 1EZVY 5CGYC 1P6AB 5CZXC 1A4KA 4N0YH 2GCYA 3IFPB 4NQCD 4WY7L 5GS3A 4LCWB 3NMEA 1B0RB 1UJ3C 2G60L 2YMXH 3B6SB 4LSRL 2FWOA 1OAUL 3MOAH 3OR6B 5T1KD 1ZLUK 3U7YH 1LWRA 2NY6D 4HGMA 3GGWA 2GAZA 1JV5A 4XP9H 4QT5B 5I19L 1E6OL 2ITDB 3BYYA 3C6LA 3NAAH 5LKNA 1QD0A 4WHDA 2Z35A 4YBLB 5ITBL 3AB0B 3G08B 4QF1A 4OB5L 3P30L 4Z7VF 3Q48A 2YPKA 3LN9A 5HYFA 1QPPA 4HLJA 4RGNC 1FL3B 1KCRL 5F9JA 5LG1A 2APTA 5IFAH 2BNRA 5F8QC 4O9HH 1RIHL 2FEDD 4LGPB 4G7VH 2Q8BL 1O7SA 4WTWA 4BH8A 1OL0A 3K81A 4NGHL 2PO6A 3O41B 1P4BL 1O5DT 4P2YA 1JF1B 4EI5B 1R5WB 1RUKL 4J12A 1NAKH 4QRUB 1LEGB 4S1SH 5E2TL 4PTUA 3ZE1E 1FCGA 3A6OA 4JM2B 5T1DL 4R2GC 4U3XA 5CD5C 4FXGB 2CIIB 2EC9T 2ZOLA 3PP3K 3VMOA 5F9WB 1EGJA 1RJLA 1KJMA 1VENA 2BVEA 4TOYL 4CVWA 2AP2A 4S1DD 4U6TA 4DOHE 1T1YA 2DLFL 4YHPB 4J3VA 4P99A 4YGAB 3A6CL 5KZCB 5FGSA 3L6FB 1FRGH 4M8QA 5GGRY 5LQBL 3UJTH 2GK0A 4LP5A 1BFSA 3HC4L 3LV3A 1LK2B 3PWVB 3RWCA 5D7LD 1CGUA 1ETZA 3HE7A 3UBXG 1CFTA 4Z7WE 3HB3C 4M1CD 5EO0B 1JNHA 2UUDH 3VXSB 1MHHA 4NHCL 3O6FB 2JJVA 4PRHD 3O0RH 1KIQA 3GSNL 1OAYL 3BKCL 4HQQH 1Q9KA 2DQGH 2ADJB 2Y7QA 1U8OA 3MCKB 1D3CA 2GSGB 4G6AD 5D7JB 2AQ2A 3HE6C 3IDGA 5C08A 3L3DB 1S7VA 3STLA 2P5EE 4OIIH 4EDXB 1UVQB 4YDIL 4GQPH 4NWTL 2R1WA 5CBAA 1X5LA 3DXAA 4HBQA 5CMAB 3QFJB 4U6VL 1GGCL 4G6FD 5GS0D 3AU1A 1EIBA 2EH7H 3TVMB 1RI8A 1C1EH 2D03L 1A3RL 5KTEH 4PRNA 2PYFA 2YKLL 4AEHH 4Q9BA 1A7RH 1LEKA 1RFDH 5BQ7B 3BD4A 1NL0L 2CK2A 3HAEB 3ZKMC 1JGVL 1ZV5A 2PETA 4XNYL 1T03L 2P24A 3CXHK 4KI5E 1FFNA 3FB6A 4XPBH 4QWWC 1OOAA 3PIQA 3GBNH 1QEWB 1T5WB 3U30C 1DQLL 4C4KT 3ZTNH 5BV7L 2VAAB 4APQB 2V9RA 4YHIA 1YC7A 1SYSA 2VC2L 3WYRA 2QJDA 3VXRA 2GT9A 3QULB 3ULUD 3OPZL 5I18H 1EMTL 1OT1A 3HNVL 4QXWA 4J7RA 4L3AA 1E28A 1GC1C 3RRQA 4DVRH 1TNNA 5BS0B 3QWRA 3ARBB 4OFKA 4JO1H 2XOTA 1QRNA 3GM0A 2CIKA 1F90L 5D7IA 2VDRL 3GJFK 1D7FA 4R97B 5F1NA 2VIRA 3RI5F 1VERA 4LL9A 4YNYA 3TBVB 2DTML 4M5ZL 4FMKA 5DEFA 1S3KL 3DTXB 4Y5YA 4HKXA 5EUOF 3N9GH 2D7NA 2F19L 1LD9B 3RX8A 3KXFE 1FO0L 2OLDA 2H26A 5BOPA 1KC5H 3V4PH 4Y19D 1QFHA 1HSBA 4NPYB 5HGBB 2DKUA 1IAOB 4ELKA 2BXZA 1XCQA 4JFFD 4X80L 5MEQA 3OKOA 5ISZB 5DRNB 1J88A 4F3FA 5BO1H 5C6WH 5JORB 2WM0A 4WHTB 4XCYB 1I1AB 2CK0H 4YXLL 1A9BB 4GBXB 1QSFD 3M8OL 1CICC 1UJ3A 4YHNB 5E2WH 3PDGA 1EUTA 4NQEA 2GJ6A 4MSWA 1GAFL 1YEJH 4NQVA 1J05A 3C08L 2B5IC 3C5ZD 5HD8D 5C0RH 2WANA 1MLCA 4PJDB 4PLKD 2BCKB 2FB4H 2P43B 1NDGB 2YWZA 4BFEA 5E8OA 4OV5B 3ARGC 1FYTA 3KWWA 1QBAA 3QXAB 1LP9A 4HD9A 3OXRA 2MQCA 1HILA 3D85D 4IS6A 2ZSVB 4DZBB 4AZ8A 4GAJH 1TCRA 4BSVA 3UYRL 1N26A 1DBMH 4PGDB 1UKSA 1A3QA 2VZOA 1XGQA 5MEPB 2BNQA 3UXFA 3MRDB 4RIRA 3EYVA 4LNRB 4YDKH 5ICZB 1M7XA 4HS3A 1J1PL 3MA7B 1DJSA 3D18B 3PQYD 4RBPK 3VFGH 2BDNL 5IHUH 3HMXL 4YHYB 4KV5E 1I1CA 1U8IA 5CBEA 4JPWH 3JWDH 2R8SH 3D2UD 4XVJH 3P9LB 2NR6C 1R3KB 3EYQC 1N5YH 5K59F 3OJDA 1VGEL 3WEXB 5HGAB 4JPVH 4UNUA 4DTGL 3QUMB 5CCKH 3VFNB 3HNSH 3WIIH 2RIKA 3SQOH 2L0DA 2W59A