5IFHL

Crystal structure of the bcr fab fragment from subset #2 case p11475
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
211
structure length
211
Chain Sequence
YELTQPPSVSVAPGKTARITCAGNNIGSKSVHWYQQKPGQAPVLVIYYDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSGSDHPWVFGGGTKLTVLRQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heavy chain of the Fab fragment from BCR derived from the P1
publication title Distinct homotypic B-cell receptor interactions shape the outcome of chronic lymphocytic leukaemia.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 42
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2016-02-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifhL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ifhL01
3SE9H 4M8QB 3RTQD 2B1HH 3L3DB 3FMGH 2GTZA 4K9EH 2D03H 4EN3C 3H2WA 4NPYA 3O2DA 4HT1L 5GGVH 1BVKA 4YE4L 1I9IL 5DGQA 4AEHH 4PJEA 4RAUB 4DUWA 3LRSA 3NCJL 5C86A 4R26H 1INDL 4NBYB 1N0XH 1CTOA 1EO8L 1XCTB 4KK5D 4JPWL 4X7DC 5JPMB 2DQDH 4HBCL 3MO1B 4AZ8A 5K9OB 2J4WH 1JV5B 4ZNEE 4FFZH 1ZANL 3EYSH 3QA3A 3C2AL 1NMAL 3T2QA 2DQJL 4AH2A 2EXYC 5ID1A 3AREC 4X5XB 2VIRB 3MR9A 5ETUB 2NY6D 3BKJL 4X6DA 4PREB 1DVFB 4TSBL 1KENH 4OCSH 1KJ2B 3QQ9C 1IQWL 3UAJD 4HPOH 3DX9B 5H2BB 1NAMA 1FLTX 2R23B 3GMPB 5D1QD 1E0OB 1U0QA 3NABH 4ZFZA 4PV8A 5EWIL 1KN2L 3S36L 5DJ8B 4G43B 5DJ0A 4JDTH 1KTLA 4B50A 4WO4A 2FEEI 1ETZA 4F9LA 1DBJH 1K2DA 1CF8H 4PBWD 3PWVA 2J8OA 3DGCR 1FH5L 3SDXB 3OTTA 2EH7H 3GM0A 1CN4A 2DQGL 3RKDC 5C6WH 4BQ8A 3QUZB 4XMKL 3V5DB 5ICZA 1R3LB 3L5JA 1A3RH 1NCAH 5DVMA 4ELME 3O2VH 1P2CA 1CT8B 3EYOA 4PJCA 5B3JF 2IH1A 1YQVH 2CK0L 3D69A 3TYGH 1ADQH 2D3VA 1ZLWK 3T3ME 2ESVD 4JCMA 1YEJH 3TPUB 4I9WE 4LCIH 5SWZA 1UH2A 1S9KC 4NT6A 3SDCA 1EBPA 4RWHA 3Q5TA 3VU2A 6FABL 5D7LB 5H8DA 1FFOA 3PP4H 4G7VH 5EU4B 5MEOB 3IVKA 2L7UA 4M6ML 3C8KA 1A3LH 1FYHB 1EJOL 3GIVA 4UUJA 2JK5A 3VXPB 4WW2B 1UJ3A 2RQ8A 4QRQB 4WWKD 1TCRB 4MX7A 4C4KT 2DS4A 1J8KA 2FL5B 1J8HB 1LD9B 4O58L 5FM5M 1AQDA 2HJKA 4KRNA 1AP2A 4M00A 3QIBA 4RFNB 2VRAA 3GHEL 1KYOK 4UNVA 2R1WA 3JTTB 3LQAL 3X12B 4TSCH 2GY7B 1J9CT 4YGAB 1G7PB 1HOCA 2R56H 5DMGC 1LP9E 5B39G 5IWLC 2B8OT 4HKXA 2NXZD 1FZKA 1EV2E 8FABB 1HH6B 1EEYB 1KIQB 2IPKA 2V17L 1A7NH 1LO4L 3ULUC 4JFFD 4P48A 3VFRB 1XZ0B 1KB5L 4ODWA 5DQJA 4U1HB 5C09E 4MD5A 5BXFA 3HI5H 1HIML 4Y1AB 5IESH 5HHPA 4S0TD 3QRFM 3VFWA 5GISL 4LEXH 3RL2A 3NAAH 3QJHA 4JRXE 3D39A 2Z8RA 4RZCA 1NBZB 5A2LH 2AJSH 5E7FA 3IFNL 4JCLA 2EDTA 1RZKH 2EE9A 4MB5A 2PXYC 4HFWA 5C0GA 4APQC 3RZWA 1IE5A 4GRWE 1IGYB 4GRWH 3D0LB 3LCYA 4K3JH 1P4IL 4PJDA 4BFBD 3MBXL 1RJCA 5IGXL 5F9JA 4PJHB 3T3PF 3SKMA 1MCHA 1MRCL 1DUZB 3NIDF 4KRPD 1UWGH 1BWWA 1U8HA 2F9BT 5DLMH 5AG8A 1HHJB 1XH3B 1E4WH 2W0KA 5IR1B 4C4KO 1FZOB 3CFEB 4M93B 4BSJA 7FABL 2Q76A 1HZHL 2ZG3A 2FO1A 1REIA 4R2GC 5EOQL 3IDUA 3BH8B 4LCWD 4Q7DA 4I9WD 1Z9SA 3MZGB 4KWUA 3V6FA 3K2UL 5KVFL 3NIGE 4M5YH 2XTJE 3O6KL 2NPLX 4YHZL 1ZAGA 2FATL 3GMNA 1BF2A 3PGDA 1KB5B 4NQVB 5H37G 3ARPA 3NCFB 5KSBB 1I1YA 4XCEA 4ENEC 5GGTH 4JQIL 1CD1B 3VRJB 5EU5B 3WD5H 1Z5LB 3WHXA 1JZ4A 4QXUL 2DBJA 3K4AA 3DSFH 2YD3A 4IOFC 5HHVH 4O2EB 4OLXL 1X5HA 2OQJA 4OIIH 1DBKH 3VCLB 2OLDA 4WI6A 1S9VB 2B4CL 2YA2A 4X4MA 5CP7B 4MNGB 2BERA 4P3WA 4HIIB 3GSUB 4GRLD 1O0VA 3SCMB 3RVWD 4NKMA 1NLBL 2XZZA 3ARBB 4OUOA 3GJFK 4PGBB 4PIRF 1FGVL 3DIFA 3PHOA 1U92B 1WIPA 1FGNH 4LARH 4IRSA 1RPQA 4Z78A 3ZLQC 2UV3A 1A7OH 2FEDC 1U3HB 4HWZB 5TPWL 1EX0A 2ARJA 2PW2A 4KJQD 1DBMH 3SPVA 1T4KA 4J1UA 1GYAA 1TENA 2AK1L 3FO0H 5ADOL 5D7SH 4P23C 4F58L 5I15L 4E41D 1CDIA 2AK4E 4L3AA 5HVHB 1CD8A 2P44B 2JJSC 1NUGA 4FQQA 1AKJA 3HAEA 5I6XB 4JKLA 1S7WB 3W39A 4NN5C 3B6SA 3VWKB 1FZJB 5C0DB 3PP3H 4KDVA 4WHTB 3BPNC 4F7PA 2WMPA 2IF7A 3FFCA 4PUBH 1P7QD 2YXMA 1G9MC 2NY4C 5DR5H 1F2XK 4NQSA 2QADD 1P6FA 3DHMA 2DQEH 1G9NH 2Q86A 3S5LB 4F7TB 1WT5A 3DVNB 1BM3H 4L8DA 4L3ED 1XIWC 2HVJB 5DTFB 1FE8L 1YDPB 3IDJA 1R3IL 5TE4H 5F89B 2FJFA 2A83B 1MHPH 1BFOA 1TPXC 2DWEB 5HPOA 1QO3B 3ULVH 3ULVE 1I4FA 1SMAA 3MBED 4FMKA 5E8OB 1JPST 4XVTH 4UB0L 3KYOA 1FFRA 1HHHB 1PGRB 1UH3A 1BQHG 5EU3B 4UZGA 2AP2A 3E6FB 1LHZA 2B5IC 3C60C 4MB4A 2VDOH 1AXTL 3HC0A 3KYKH 2FDBP 3C5JB 5BCAA 2BNRE 2P48B 2ZCLL 5GGQH 3WLWC 4XVJH 4U6XB 2AJXL 3DRQA 4XXDB 1QBBA 3SBWA 4G5ZL 4CU8A 4R90H 2FWOA 1W2KT 1QSZA 3MZTA 1DQTA 1MPAL 3IDYC 1K5NA 3EOBB 5CAYB 4N8CL 5KW9H 2X7LA 1KCVL 5C7XH 3NCYS 1CXHA 2VZUA 4DVRL 3WFDL 3L7FA 1S7TB 1IEHA 3BKYL 2VWEC 3RFZC 2D9CA 3QXAB 1Q1JH 4XP6L 2VE6B 3S88H 3MLUL 2CIKA 2YPLB 4H8WC 4M5ZH 4UTAL 4Z7UB 1LWRA 1UH4A 1OTSC 3R8QA 5DD5H 5I1CL 3IJYA 3V6OE 1H8NA 4WO4C 5DEGA 4ZNEA 4NKDA 5KTEL 3S96A 3L6FA 1I75A 2R0ZL 3QNZB 3D3VE 3RWHB 1INQA 1ORSB 4O00A 4FQHB 4P9MH 1IMHC 3C6LD 4G8EB 4EDWH 1ZA6B 5IBTL 3UXFA 1FLRL 5C0FA 3T1FB 4Z7NF 3MLRH 4PJIB 2EC9T 1EVUA 3KR3L 3OBAA 3P11L 2DQIH 1I7UA 4KKAC 3FT2B 3KXFD 5DWUL 1JTTA 5EIQA 2FIRT 5E1HB 4U1SA 5D70L 2AQ2A 2NY1B 3SGKC 3UJTL 3SDCC 1K8IB 2CR6A 4Y4HB 2WQ8A 3LEXB 3LEVL 5JDSA 1JN6B 2ZOKB 1KJMA 4P3DB 4ONFL 5FGBA 1L0YA 2Z31B 3CAFA 2DQTH 1PVHA 1A6ZB 4GBXB 1HE7A 1TQBB 1YJDL 2NR6C 2XA8H 3I02A 3KPRB 5K93A 1IFHH 1J7VR 4ELMA 1YN6B 5AYUL 4WU5B 5L2KD 3V2AR 3QIBC 1Z0MA 3UBXG 4KTDH 5IVOA 4NFBA 1BD2E 5EH1A 1AGCA 5HVGB 1ADQA 5J0BA 5DJ6B 1MRDH 5GRJH 1T03H 3RVUD 4JFEE 4DCQB 3F7QA 2HG5B 5TE6L 3B83A 3TESA 4R3SA 2QQLL 3EFFB 5L9DH 3QFJD 1H3PL 2V7NA 1RZ8A 2LABA 2Z92A 3LSOA 4HZLB 1RZJL 5GRWA 4ZTOL 2JB6B 2XT1B 4JFPB 2N56A 4HPYH 2D0GA 3H9SE 3QWRA 4PRHE 5INDA 3DUSA 2VL5A 1YEDB 2Z8WC 5EZOL 2EECA 1NPUA 3H7BA 1H15A 2BRQA 1TETH 1NGYA 4LBEA 4WFEE 4ZUTB 4MA7H 5GRYA 5C08B 3RPIA 2Y6SD 2RCSL 4QRRB 1LP9A 5F71A 4HBQA 3D3VD 2XFXB 3A6OA 1KBGL 2FX9L 2VC2H 3QI9C 1KIRA 5IMOB 4V1DE 3F8UB 1HK6A 3QJFA 1RJYA 5SX5K 3D85D 4TNVF 3MJ6A 2ZUWA 1QA9A 5ID0A 5C09A 5ICYB 1MEXL 5H35B 3T0EE 4P0DA 1LEGB 2BSTA 4J3OC 3LZFH 5HHNB 4JRXA 3ZDXE 5I9QC 4RDQF 1T0NB 3RDTC 5DRNA 1K8DB 4WFFE 3SE8H 2GCYB 2V2TA 5CLWA 2VUYA 2XN9B 4CGTA 1LDSA 3UTZB 5E00A 2ERJC 5KSAA 2NZIA 5J56B 2BSRB 3J8F7 3MPCA 1JHTA 2AXGB 1AGFA 2CQVA 4Y19E 3VFTA 3N1MC 3BE1H 4Z6AT 1DLHB 3BKMH 4GG6E 3HG1A 4HKJA 3P9MB 4YBLC 4HIEB 5I73B 2YPKB 3KPSB 4DK3A 3CK0H 1KJ3H 4XHJC 5IROC 1F42A 2AEPL 3BO8B 4ODSL 3KWWA 4ONHA 2FJHA 2BOBA 3CZJA 4H88L 4G8IB 4HWUA 2NTFA 2W0FB 4CVUA 5K59F 3I6KB 3JWDH 1QEWA 3G6JF 4GW1B 1A7RL 4JM2B 1EGJL 2BOCB 5LGKA 4WHCA 1FFPB 1H8OA 4MQ7B 4POUB 2H32H 4R6UA 2EKJA 2OTWA 5DRWB 3EFDL 4PV9B 4BELD 3ELAT 4IRSC 1KTKE 3DX7A 1CIDA 5D9SB 4WIQA 2XQYG 5I16A 2UWEB 5GS0H 1JCKA 1E6JH 2IJ0C 2E9JA 4IOIB 5HDBF 2ATKB 2P46B 5I74B 3B9KC 5JQ6L 5LQBL 3GMQA 5E1AB 4N9OB 4LLMB 3RY5A 3GHBH 3I9GH 1FIGL 2X42A 1UB5A 3QRGH 5BRZB 4L9DA 1EXUA 4XCFL 2RHEA 4O2CA 1X4ZA 5FKPA 5T3ZH 5I1EH 3WN5B 2O5ZH 2A6IB 3U83A 1QR4A 2YA1A 4PJFE 2QJDA 4RMTA 3SDAD 1MCPH 1QSFD 3T0ED 1K3ZA 3U7WL 1KELH 1Q38A 2E7MA 2EDXA 3LKRB 3PNWA 1A64A 3CFBA 5C0ND 2AJZB 5FO8B 1HSAB 3VRIB 4P4KD 2VN7A 5J3HD 2O5YL 3KYMB 3C5ZB 3AB0C 3OKEB 1SM3H 4LSDA 5IEKB 2ITCA 4O51B 4PG9A 2GSIA 4WEUD 3ROLB 5FK9A 1CXFA 3DV6A 2AK4A 3O3UN 4Y4KD 4EBQH 1MCWW 3TO2B 4ZDHA 1QBAA 3TVMD 3TBVB 2F5BL 2IADA 2XWJA 5CJ5A 1XGYL 4MLIA 43CAB 2DKSA 2UUDH 2IGFH 2YPVH 4G9FD 4QRUA 2IG2L 5DUBB 3M17B 4NWUL 1IGFL 3NPSC 1TFHA 4NNPH 4XGZB 1P4LA 1CICA 5FA4A 5IK3A 1IGTA 1A6WH 4TNWK 3GSNA 1GAFH 1R3JB 1IGCL 1NKOA 4QXGH 4IRJB 4ZXBD 2IAND 4X7EC 1QZ1A 1RURL 4FQJL 2G75B 2NY5C 3ZTNL 1FFNB 3WLBA 3SBWC 2WINA 4POYA 2KH2B 4HXBH 5LG1A 1NMBL 3E8UL 3VRLF 4S10A 4RMSA 5FUOL 1F3DJ 2E7CA 3UPRB 3N06B 2ZNWA 4K94H 3I2CL 3OG6B 3QNYA 5E24E 4LSPH 1IEBB 3GO1L 3WXWH 3H9HB 1T22B 2EYTA 5GRUL 2CSPA 3OXSB 3K7UA 4HS8L 4KGJA 3RHWF 1A9BA 4W6XB 1KPUB 2QHRH 1M7DB 5K9KA 2P7TB 2DLTA 4PRNB 5KS9A 4MZ3A 2BNRA 1AI1H 4QRPE 4FQIL 1BOYA 4BK5A 3MUHL 1V7NL 3ARFB 3BWUC 3QCVH 3PWPB 2HWZL 3PJSB 5T3ZD 3LOWA 5EOTA 4Q97A 3P4OB 2A9NH 1G6RB 4R4BB 2E8ZA 2H1PL 2VLME 4G7YH 1B0GA 2YWZA 3DVGA 4WEBH 3UTTE 4CVXB 2J5LB 3U9PL 3P4MB 1Q94B 5BVJA 4X6FB 4L4VB 3VFGH 1AO7D 4HMDA 1OAZH 2QSVA 3V0VA 1A5FL 2M8XA 3NCEB 3KPMB 1NFIA 3OF6A 4QHLB 3RNQA 4F7MB 3V6OA 1WZ1L 1EAPB 3MJ7A 1GGBH 5ISZB 2FX8H 3RBSA 3LMJH 1AR1C 1J11A 3ZL4H 3ZKNC 4K7FA 1ONQB 1CDJA 3TWCL 4B7IA 4Y4FD 3RY6C 2N1KA 2AJUH 4Y88A 3IKCA 4YAQA 2NY3B 1UXWA 1TCMA 1WBZA 3OAZH 2VMFA 2DDQL 4L8SA 5I17B 3TNMA 3WYRA 3NGBB 5L7XH 1JTOA 3ES6A 4PP2B 3P30L 4XMPL 3C6SB 3QDMD 4KJWD 1WK0A 4GOSA 4AT6B 4GW4A 5JLZB 1KC5H 1DBBL 1MHHA 4DW2H 4ZD3H 2OTUA 4OZIE 4HCRL 4D9LL 5B8CB 3OB0K 4YXHH 1AJ7L 2KQNA 4ELKA 4GRMB 4DOHB 4X7CC 5F1KC 1T7VA 3VXNA 1QSED 3G04A 1XCQA 1OY3B 12E8L 2JCCB 1DBAL 3HMXL 3D5OF 4GKNB 5IKCB 2WSKA 1CDUA 3ARDD 1BD2A 4K7PY 4M48H 3RRQA 2BVUA 3MRNA 3EOTH 4RX4D 4JFEA 3MCKB 1JNNH 5AD0A 4LLVB 4MD0B 2IAMB 2R0LH 5C9JA 2CH8A 3PGFL 5MEND 1DLFL 1Y0LB 3ZYIA 4NQCD 5I1DA 4IIQA 3VFSB 1NFDF 3UTTD 1GPOH 1BQLL 3DUUA 4OFYA 3H9SA 4PRHA 5CD5C 5E8PB 3MXVH 4JLRB 2HAZA 3U1SL 2V9TA 4OLZH 1H0DA 5HD8C 5EIIA 3GM8A 3EOAA 4L4TE 3TBTA 2MCG1 4H20H 1IT9L 1HILA 4Y5VA 3FQXA 3GSRA 2A0LD 4YHOH 1BJMA 4YHNB 4JFZH 4PY7B 4S1QL 3WIFA 4V1DA 4BSVA 1D9KA 1UM5H 2YD7A 5C0AB 1J0HA 4AK1A 4JY5L 5I1HL 2X5PA 4XC3L 3O9WB 1JNLH 2CUMA 3AVEA 1G6VK 1KCLA 5DSCB 5K9JH 1YY9D 4ZTPL 5GZOD 3T0EA 3BHBA 4MXQD 2GT9B 2K3TA 3TN0D 3QIUB 1R3KB 3OPZH 1OAKH 1VEOA 4H5SA 4D9QE 1FO0L 4KV5E 3HS0A 3M8OH 4WFHE 1PX3A 4I0PC 4XXCA 2HLAA 2A6DB 1EIBA 1YY8A 4FFYL 4UTBL 4P3CL 4Y19A 2D2OA 1OPGH 1KCSH 4OTXL 3NA9H 3O4LB 3VFUB 4OQTL 4GAJH 3IFLH 4OT1L 4P5KA 4Z7VE 4GG6A 5IG7A 1VCAA 1QLRA 1T5WB 1JGLH 4MQXD 3WFCL 3PDDA 1CXKA 3GKWH 2EO1A 3G6JB 5J1AA 4NQDE 5J11C 2PTTA 3C5SB 4YXLH 3FQUB 2X05A 4AENA 4F57L 4OI7A 3UDWA 4PB9L 3AUVA 3G5YB 1ZA3B 1RK1A 3Q2CA 3O4OC 3QUMB 3HNVL 1Q0YH 2HTKD 2WBJB 3OQ3B 3MGTA 1NL0L 5D6DC 3QNXA 4BSWB 5FECA 1UEYA 1FCCA 5F1NB 1SJEB 1A0QL 4Q2ZA 5FYJL 1F11B 1HI6B 3VFMA 1FL6B 5LGJA 2YZ8A 4H26A 4WHDA 1C5BL 4EN3B 1SQ2N 1HXYA 5KVGH 3KYNA 1MCFA 5E6IA 3CSGA 1EH9A 1INEH 3K1KC 1XF3B 5FUZL 5EC2B 4XWOD 4LHUB 5GXBB 5EO0B 3DRTA 5DD3L 1N4XH 5ADPH 1NGQH 2DICA 2E7LC 3MROB 1FNSH 5FEBA 3KDMA 5ANMB 3VA2C 3N1GC 3CUPB 5GJTL 4DGYL 3KLHC 3EYUH 3CIQA 3T8XA 1EMTH 1ROWA 5BS0E 5CS7A 4YPJA 1IAIM 3AREB 3KPLB 1IM9A 2VAAA 4FZ8L 4PJFA 1A4JA 1EZVY 2NQCA 4B41A 3SKJL 3QH3B 1MJJB 3VD4A 1QR1A 4LLDB 4NHUB 1RVFL 3RAJH 1RIVH 1JMXA 3BIKA 4HFUH 2OYPA 4G42A 3RWIB 2PUQT 4J8RA 1PZ5B 2F54B 3ORJA 4QO1A 1CI5A 5BZDA 2QQKL 1BAFL 5D7IE 5MEPB 3TCLA 4JKMA 3VE0A 5IMLB 5MEQB 2ZSVB 3LKPA 4I5BA 2HH0H 1KGCE 1HWGB 4LAJH 5GRXG 4PP1D 2LE9A 3NFPB 4Q9BA 5J6GA 4JEGB 1MWAA 1I7ZA 4LU5L 4N90E 4NM4L 3QDGD 3Q1SH 4G6MH 5JHDB 1MQKH 4LP4A 4XP1H 4XWGH 2R2BA 4H0HB 5E5UB 1BBJA 3C9NA 4AIXA 4DK6A 3ULUL 4QTHB 1U8LA 1XGRA 1E4XL 4NRYA 5EPMB 1IC5H 1OW0C 4RIRA 4XPGL 3D2UB 1FV1A 3MODL 2NXYB 4D0CB 3REWB 3JSSA 5EC1B 1GIGH 4EUPB 3T4YA 5JW4R 2VERN 2MCPL 4XPAL 4OGYL 2W9DH 5I30L 1YMHA 1CGSL 4LIQL 2BDNH 3MYJB 2DLFL 2A2QT 4OAWA 2J6EH 4TTDC 5F1IA 3UZVB 2JELL 2DLGA 5B4MC 3OZ9H 1QRNE 1RFDL 3OAYK 1S9YB 5DJCB 4TUKH 2OBGA 1JWMB 4ONOA 2PTVA 4GUPB 5DUPH 2ZCHH 2XG5A 4LK4A 3GMMB 1MJ7H 4YHML 1UCBH 3B2VH 4YUEL 5EA0H 1OWWA 3K2MC 5BO1L 4JR9H 4GSDL 1B0RA 1QPXA 3TJHD 4PRAA 1CG9A 1OSPH 4LRIA 3QXUA 2W38A 3Q5OA 1I7TA 2PETA 1LK3L 4JQVC 4QRPA 1BX2B 5CEXB 5FM4A 1ZVSA 3CH1B 1J1XL 1ZEAL 3FQTB 4P2OD 1NDMB 3Q5YA 3HLAB 2VISA 4HJJH 3WE6A 3IU4L 3TA3B 5C6PB 3TBYA 3ARXA 4HX1B 5DJAB 3K8MA 2IBZX 3UZQA 1MRFH 4NSKB 1YEFL 5TJWK 4I8DA 3UTSE 2CLVA 5I1IH 1AHWA 1TTGA 4L8SC 3BZ4B 4LOUD 4PJ8D 4OZHE 1Q9OA 2FO4B 3NH7L 5ESQB 3ILPA 1MCIA 4P2QB 4X6EB 4EI5C 4WI8A 2I9TA 3ZE1E 4MHHG 4PJ5B 5EN2A 3O41B 1IEAB 3CDFA 4R7DB 5CD3A 3OGOE 2BHUA 3PL6A 5FYLD 4LGPB 5EUKA 2CKBH 4N5EC 3BSZL 5I66A 1NUNB 3O6FA 3ARUA 2IPUG 1B2WH 4N90D 4PBXA 4UNUA 5DMYA 4M1GH 4BZ1H 4YWGH 4WTXA 1U91A 5C70A 3QULB 5DUML 5EU7E 1N5YL 1Z3GH 4MJIE 3GMLB 1CLYH 1BP3B 3GJEA 2XACC 3G6AA 4FFVD 3S37H 3S4SA 1A14H 1CLOH 1Q0XH 3QHFH 3TO4A 3FO9A 3VH8G 3SDDA 3HMWH 1VFBA 2JB5H 4MLSA 5E9DD 5F8QC 3WEXA 5L2JB 4QHKI 4CDGC 1HEZB 4NCDA 2CD0A 4YBQC 1MCKA 4OZIA 4BQBA 2VXSH 2AABH 5IB2B 3LEYH 5JXED 3BZFB 3HE6B 1BBDH 5JW4Q 1JF1A 2MWCA 3D1MC 4AG4L 4D8PB 4LVOC 3X13B 2R1XB 1ZHBA 3IDGA 1SJHA 1NDGB 1BFVH 1MF2H 3QUXA 1G9ML 5T1MB 5DJYB 3UTPD 4ODUA 4AEEA 4Y5VC 3MJ9L 1DQMH 4LSUH 4HGKC 2M26A 4KJYB 2JIXB 4MXVE 1DQJA 2X4PB 1B4JL 4YFDB 2I07B 3FRUA 1QKZL 2Y5TB 4LDLB 4JPKH 1U8PB 4LLUB 3V4VH 4Y8AA 5GJSL 2EDWA 1KJ2H 3DURB 5BJTA 1WICA 3OB8A 4MSWB 5TDPB 3MREB 3P4NA 2EO9A 3ARGC 4M62H 3RBGA 1HCFX 3VI3E 1C5DB 5HHXL 2XZQH 1JFQH 4P23B 4L4TA 4XXCC 1I1AD 3G5ZA 3QFDB 3BN9C 3F6IA 5C0CD 2BY3A 3CC5A 1FRGL 2QSQA 2DJ4A 1X44A 1ODAA 5HHMD 4OKVB 1KXVC 1ERNA 4NN5B 1SBBA 4MDIB 4Y5YA 2APVA 4HT1H 4Z9KB 3SDXE 4YE4H 5C8JA 1I9IH 5GIRA 5TF1L 5L6YL 1MFNA 3BPNB 2BK8A 3NCJH 3QQNA 4Y2DA 1QFWL 1INDH 1EO8H 2NY4B 3MRJB 4JPWH 2HTLD 1U95A 5DMKB 1GC1C 4HBCH 5CJ8A 3BQUB 1WF5A 1LO3H 2ADFH 1W0WA 1ZANH 3NACL 4XC1L 5JOPD 1VKXB 3C2AH 1FNFA 1NMAH 1XIWB 4NO3A 2DQJH 5KZCB 5IMMA 5GGSB 3HNTH 3B2UD 4NNYA 4C54A 3WFBH 4H8WL 2ZCKL 3BKJH 3OR7B 1J05B 1LK2A 3S4SG 4HUWB 3DETC 2MKLC 4TSBH 1TPXB 4M43L 5D7LE 1DR9A 2F53D 5IW1A 1OTUC 5C07D 4Z7VA 5I8OL 4U1NB 1O7SA 4QRSA 1X6LA 2AXFB 4HV8B 1YPZF 1IRAY 2B5IB 2ICWB 1J8HE 2EIZA 3C60B 5EWIH 1KN2H 2F74B 1E4XI 2VR4A 3S36H 4NQDA 3HRZA 2H26A 1HXMB 2LVEA 3QIWD 4U6YA 5GSVA 3TV3L 5ESVA 5I8CA 2C1PA 5TF0A 4Z7OE 4GXUM 2JJVA 4NQEB 4CW1B 1S5HB 5SX4I 1FH5H 4UU9A 1IZKA 2GAZB 4LF3A 4MAYA 2DQGH 3BUTA 3MLVL 1X4YA 3GB7A 4XMKH 3ZTJH 4OV6F 4HWBL 5IBUG 4Y1AE 3QEQB 3TT1L 2PTUA 5KAQG 2EE6A 4NN7C 2CK0H 4YDLC 1L0QA 5L0QB 4JVWA 1RIHL 1S8DA 1G7LA 4QYOB 5D7JB 3FQNB 5E70A 5E2UL 1NC2D 3FN3A 1AFVL 6FABH 1DEDA 3U0WL 4JGUA 2Q3AA 4WUUB 5MP6L 4M6MH 3HN3A 1EJOH 4PJHE 5HYIA 3P73A 2C26A 1ACYL 1I3RA 5DHYB 3BP5B 5BS0A 4NGHL 4ZYKA 3O8XA 5JIIA 3LDBC 4TRPL 3RVVC 5F3BB 1AE6H 1T21A 1Q72L 2P45B 5K33A 2ZZUT 4WU7B 3IF1B 4O58H 1CXLA 1AD9A 1NBYB 3TJEL 3U0TB 3GHEH 5CBEB 5KSVB 3PWNA 4OI9A 1CGYA 3LQAH 2X4TB 3MNZA 1AR2A 3S3JA 2BRRL 3OKOA 4PJGF 4OD3L 2XKUA 1FPTL 1JUFB 1UWXH 4XCNA 5DF0A 4OZFH 4CUCA 2IPTL 5D7IA 5FM5O 2V17H 3CFKB 3EAKA 3VI4F 1LO4H 4PRBA 4AEIL 4S1SL 2GJ6D 4OF0A 4YEFA 2ICES 2APXA 1CFTA 4YGVB 4KKNA 5KSBE 4FABL 3KPQB 1JRHL 4JQXA 2J2ZA 5GISH 1DE4A 3QXDA 5GQBA 4MJ6B 1J10A 1T66C 4Z7WE 1U6AL 3IFNH 4K3GA 4WGWB 3VGFA 1NAKL 3QEUB 2J8UF 5SWSD 3I85A 4OZGF 1HKLL 3F5WA 3EO0B 3MRMA 1OGAB 1I1RA 2RAMA 1P4IH 3MBXH 3JTSA 4RWYL 5IGXH 3AM8A 2R2HA 3T4AB 1YC7A 1MRCH 1T5XA 1T0PB 1K4CB 4HIHB 3PV6A 4N0UB 3SDYL 2C7UB 1VGEL 1OF2A 4P46D 4XH2A 4KROD 3GJFB 4MVBC 1IC1A 2J6EA 4U3CA 2N4IA 4A6YA 1QRNA 2ICEB 1QBLL 1F4YL 2XV6B 1XGUA 3FONA 3BP6B 5FUCC 3RIAF 5KZCD 1HZHH 4I3SL 4M4PA 5GZNC 4P5MB 5EOQH 1D5ZA 4HJGB 3K2UH 4HDIA 5KVFH 4LAQL 1FZMB 3MFFA 3I6GA 3MJGX 3O6KH 4YHZH 3BRDA 2FATH 3PL6C 5EO1A 3ECBB 3FFDA 4PRPB 4U2ZA 2WV3A 3QI9B 4JQIH 3T0VA 4TSAL 1UC6A 5T1KA 1Z2KA 1KACB 4PGCA 2DM7A 5M7QA 4QXUH 4E0RB 2XWBA 3MJ8A 4GKSB 2PF6A 3UTSA 2X4UB 4OLXH 3VDCA 1BZ9A 3DYOA 5E5MB 4I4WA 4OZHA 3VWJA 4XBGB 1M71B 3JV4A 3SDDC 3IXTB 3RDTB 4DN3H 4KGLA 2P5WD 3VMOA 3ZT5A 4TVPL 4OKDA 1NLBH 2ERJB 3P2TA 5IQ9B 1FGVH 3GBNL 2YWYA 3QEQD 5D1XA 1L6XA 1D6VH 3K3QA 2AJVL 5DD1L 5ITFB 3ZE0F 3TIEB 4G8FA 4J3WA 2Q8BL 5ACZA 1V8HA 4N1CA 4W6WB 4ZAKB 2DJUA 5TGBA 3RL1A 3QZWB 1Y6MR 4DTGL 2D31A 4MJIA 1VEPA 4NRZA 3X3GH 1FVEB 1R6VA 2QKIA 2AK1H 2VO5A 5DI8B 5ADOH 3QUXC 3NZ8B 2HT4D 4F58H 5I15H 1A6TA 3WL9A 1VADB 3PXJA 4N0FB 4UILL 3VMNA 2CIIA 4F37F 3T09A 2OL3B 4JKKA 1ZLSL 5LWYL 4FQXA 4XTRC 4F2MA 4KI5F 1Y18B 3IU3B 4X8JB 5KVEL 2YRLA 5KANG 3MMEB 4FMFA 4S1DC 5IHLB 4M8QA 5J4MA 2VZTA 7CGTA 2P49B 4F8QA 3QPQD 3F7RA 3L3DA 2E3VA 3QISA 2YC1B 2VQTA 5JNYB 3LN4B 3OAUL 2G60L 1ZSDB 1F3RB 4RAUA 5GGRA 3PHSA 3B9KB 3D48R 4DGVL 1XCTA 3WXVL 1FE8H 1R3IH 1IAMA 2H6PB 2YPLE 1LMKA 2EH8L 5JPMA 1T1XB 4Z7UE 3MO1A 4RGND 5K9OA 1JV5A 5EIVA 3V7AG 1FNAA 2ID5A 4PYGA 3FB7B 3M07A 4UB0H 4I18A 3L5XL 2X40A 2NY5L 4PJ9D 4QTIL 4Y5YC 4C59B 4X5XA 4YR6B 1HHGB 2GUOB 2VDQL 2VIRA 5ETUA 4PREA 1DVFA 4P57B 1KJ2A 1AXTH 1MLCB 4PJIE 3B5GA 3DX9A 3O3DB 3CNKA 4PGZA 5H2BA 2ZCLH 2AXJA 3AB0B 5E8DH 3GMPA 3ARVA 2AJXH 1PJ9A 3DMMC 4GXVL 3MA9L 4G43A 4G5ZH 5E56A 5J89A 1JBJA 4D2NA 1MPAH 4P2RB 1I9EA 4N8CH 5CINL 1KCVH 5JO5B 4YC2C 3SDXA 4LEOB 2PO6D 4X7SL 4U0RC 3WFDH 3G9AB 1U3YA 1T3FB 1ZHNB 4JJ5B 3BKYH 3DARA 5B3JE 4XP6H 3QUZA 3V5DA 3VJ6B 3KPRE 3NPSB 1R3LA 1QVOB 3MLUH 4D3CL 4WJ5B 4UTAH 1B6UA 3VFOB 1CT8A 4JG0L 1U8IB 5I1CH 1CE1L 2A9ML 5D7KE 5KTEH 3PE9A 2R0ZH 1AD0B 5SV4A 3TPUA 5IFHL 4OCWH 3IGAB 4OFPA 4PJBF 3RGVD 5D7LA 5EU4A 5MEOA 3BMVA 4NC2B 4OCYL 4KXZH 1AXSB 4DFIA 3KR3H 3VXPA 4WW2A 3QWOB 3P11H 3VW3L 1KEML 4QRQA 2R69L 1TCRA 4HK0B 3MLXL 5DWUH 3W0WD 2FL5A 1J8HA 1LD9A 2ED7A 2LAGB 4LPWA 3FQRB 5D70H 4PGEB 3UJTH 3VFPB 3IS1X 5J9PB 3ZE2E 4NP4L 3O3AB 3LEVH 3JTTA 2X9YA 5C08E 4P59L 3X12A 4ONFH 4XHQA 5HI3C 1G7PA 3EYQC 1EDQA 4QRRE 2Q7NA 2Z9TA 3QWQB 1ZOXA 2RFXB 3BUYB 4PB0L 8FABA 1YJDH 1JZ3A 1KCKA 1HH6A 1EEYA 1JPGA 2RB8A 1KIQA 1S78D 2PYED 3VFRA 1YYML 1XZ0A 1EBAA 3RWGB 3U4BH 4LLYB 4U1HA 5AYUH 4Y1AA 4F7EB 3LKSB 4WI7A 5HJ3B 2DF3A 3ZDZE 1MQ8A 5EZLB 3RTQC 5HGAB 3MLZL 1NBZA 5E4IA 3MV8B 2XN9E 4BFIB 3OKMB 3EBAA 3T3PE 1T2JA 2VLJD 4I0CC 5TE6H 3B8YA 2QQLH 1T83C 1IGYA 2DTSA 3D0LA 1H3PH 5CEZD 4D9RE 4ZTOH 1RZJH 4KK5C 4PJHA 3EDEA 1DUZA 1FL3B 4ODHL 4WUKH 1HHJA 1XH3A 3EJYD 3QPXH 1RMFL 5IR1A 4K2UL 4KHTL 2FX7L 1FZOA 2A1WL 3BEVB 1E6OH 3KPSE 3CFEA 4JM4L 4NQUA 1UKTA 3BEWB 4PLNC 2G5BB 4FQ1L 3WO4B 5AZEL 2VQUA 3CXHJ 5D7KD 2WUBL 2RCSH 5D6CB 1X5IA 3BH8A 2X89A 1KBGH 2FX9H 2OP4L 3UAJC 2NX5B 3RWDB 3RI5F 3V5HB 5BVPL 4ACPA 1BVLB 5C0BD 1WFUA 3ABZA 1B9ZA 3FL7A 1KB5A 1JF5A 4NQVA 4OFIA 5D1QC 5DC9B 2WLYA 4JFQB 2Q20A 1F13A 3SGDI 1A3QA 1MEXH 2BVEA 5KSBA 3REVB 5CGYD 2H45A 4ZS6D 3HHRB 4QHKJ 3WJLA 1CD1A 3VRJA 1F02I 3PWUB 3R1GH 1IAKB 1Z5LA 2UWEE 1QFUH 4EQ2A 4H1LB 4M7ZB 5D1ZB 4O2EA 1FQ9C 5MHSE 4LVHC 4L8CB 3VCLA 1CYGA 1HNGA 4TYUA 4UI2A 4TUOB 1S9VA 5MI0C 1NC4B 4J2XA 2VITB 3GSQB 3OXRB 3MV01 4GQPH 4MNGA 5CP7A 5BRZE 4G8GB 4HIIA 3STLB 2XZCL 3SCMA 3OX8B 3RGHA 1UYWL 3MLSL 3VFVB 4PRIB 1JPFB 3MOBH 4MNQD 4PGBA 1UZ8B 3ZMRA 3OKKB 3OR6B 1U92A 3K8KA 1CXEA 2H2SD 2AEPH 4FZEL 4ODSH 1YZZA 5LAXB 1F4WL 4AMKL 1U3HA 3MFGB 3MRIB 4HWZA 4TN9A 5D2NE 4H88H 3LKOB 1XR8B 1A7RH 1DN0B 4ONGL 3O3BB 3UYRL 5F1SA 3D25B 2PKDA 2R39A 4D0DB 1WBYA 4J7RA 2KKQA 4C58B 5CBAA 1T2XA 3R0NA 2X10A 3EFDH 2X09A 3LB6D 1NSNL 1S7WA 3VWKA 4WRLA 1FZJA 5C0DA 4WHTA 3IJHB 3LKQB 2NNAB 1TJIL 5LQBH 1UT9A 2ED9A 2NXZC 3R0MA 3L5WB 3QO1B 1FIGH 4NZDA 1OP5K 3S5LA 3C08L 4F7TA 4QF1B 1SVZA 3DVNA 4CKVX 1S7XB 4XCFH 4BM7A 4M3JA 5EBMB 3VXMB 2VXVL 2HVJA 5DTFA 3UZEA 3L3OB 3ULUF 1P9MA 1YDPA 4BKLB 4I0PB 5F89A 2APTA 3DX6B 4AYFA 2QTEA 2Z0BA 4RMWA 2A83A 3OSKA 2DWEA 1QO3A 3U7WH 5E8OA 1KN4L 5ALCL 1L4IA 1A1NB 4L4JA 2ADJB 1HHHA 5EU3A 4ZUWB 4OZFG 2CDGB 1CD9B 2BVQB 2FGZA 2O5YH 4JB9H 4PJ7B 3E6FA 3L3JB 3SO3C 5SV3A 1NCNA 4CNIB 1T1ZB 1IKFL 4KRPC 5HVWA 5J11B 3K4DA 3C5JA 1MCBA 4CRPA 4LSRL 1XGYH 3GSNL 3O4OB 4O9HL 2HVKB 4KK6D 3RIFK 1H3GA 3PWPE 1JHKL 4XXDA 1MCSA 2GHWB 4NWUH 1IGFH 5EUOF 3EOBA 4RBPK 2CK2A 2C4FU 3NCMA 1IGCH 2W0LA 1S7TA 3VDAA 1RURH 4FQJH 3QXAA 3ZTNH 2VE6A 2YPLA 5FYKE 4NC1C 4Z7UA 1NMBH 1SBSL 4F15C 3E8UH 5FUOH 1YECL 4RNRB 3QNZA 3I2CH 3B3IB 3GO1H 3RWHA 4BA8A 1FC2D 1ORSA 5F7KC 3TZVD 5EZIH 4FQHA 4O02L 1VA9A 5GRUH 4HS8H 1SMOA 4ZPVB 4G8EA 1TDQA 1ZA6A 4ZOEA 4YEEA 5D2LB 2EIBA 3QUZC 4FTVD 1PD6A 3T1FA 4N9GB 2WWKO 4PJIA 2FH6A 2VQ1B 2EC8A 1MUJB 5B3NA 5I18H 1SYVB 2Q3ZA 4UIKL 4FQIH 1MAKA 5BZWB 1V7NH 3FT2A 2V5TA 1MCRA 1TZIB 2HWZH 3N50A 1T1YB 1CD0A 4IDJH 4LRNL 3PF2A 3X11B 3RZCD 4X7TB 3LPGA 1DUYB 4LQFL 4KJQC 1K8IA 4Y4HA 3UYPA 5IM7A 3LEXA 5T3XD 1JN6A 2ZOKA 4P3DA 5E94B 1MCDA 4ZUUB 2Z31A 1OQXA 1A6ZA 4GBXA 3IETB 3O3EB 1T0MB 4WW2C 4DOHE 1EFXB 2YUZA 4IDLA 5KBNC 3KPRA 1H3WM 4XCYB 2JJTA 1A5FH 2V7HB 3SGJA 3T65B 2JCCE 1YN6A 4F7CB 1JZ6A 5IJVB 5HYJB 4RFNC 1WZ1H 4BQ9A 5GS1C 4PJBB 1X5JA 2W9EL 4XZUB 5DJ6A 3RNKB 3TWCH 2B1AL 4DCQA 1N3NB 4Y8DC 4LMQI 4Z5RA 2HG5A 5DHVH 5F70A 4LSTL 5I8EB 2XI9A 3EFFA 4HZLA 1KTDB 2OJEB 2JB6A 4JFPA 4QRTB 2DDQH 1CGVA 2Y5EA 5E2WH 3HNSL 4M3KB 2ZSWB 4GW5B 2OCFD 1KLUB 2XY2A 3NMEA 3P30H 4XMPH 1YEDA 2AV7B 3MBEC 5DA4A 15C8L 1QFHA 4JFHD 2EYSA 4JN2B 3F7YB 3U6RB 5I76B 1DBBH 1UCTA 1H5BA 4ZUTA 5CJXA 5C08A 2VZVA 4M03A 4D9LH 4QRRA 4BH8B 5D5MB 2XFXA 4TPRL 1AJ7H 1MHEB 5IMOA 4QXTB 4PJEF 2VXQL 5C0AE 3U82B 3BFOA 4KI5D 3AAZB 4ERSH 5ICYA 1DBAH 5H35A 3HMXH 1D5MA 1LEGA 5KOVC 5DFTA 5CSZB 4JO2L 3CFIC 5HHNA 1AC6A 2X4NB 4QNPF 4OD2B 5F88B 2SEBB 5ACMA 2OMBA 1T0NA 1VERA 3BGAA 1K8DA 3VXSB 4EI5B 2GCYA 1X5AA 2H2PD 2XN9A 2GIYA 1BOGB 4X6DF 3UTZA 3CDYA 1DLFH 2Q7YB 4M7LL 2XKNB 2BSRA 3DSNA 1QRKA 3CFCH 3HI6L 2AXGA 1S5IH 1RULH 5KSUB 2D9QB 1XF4B 4RRPG 2WWMC 4C56B 1BQLH 3O4LE 1DLHA 2R4RL 2MKWA 5EU6B 1GZQB 2EE3A 1T04B 2UVEA 3P9MA 3U1SH 4HIEA 4M61A 4NO5A 2NY7L 2YPKA 3CJJA 3KPSA 3MRLB 5DVNA 1N8ZB 3G6JE 1IT9H 3C6LC 3F7VB 3AGVA 3BO8A 1OT2A 1NANI 3HTLX 4GMTH 4G8IA 1BWMA 2A38A 2W0FA 5CJOL 4PR5B 3I6KA 5ALBL 4JM2A 4S1QH 2BY0A 3GDBA 1J87A 5ACLA 4JY5H 3L3IB 3ARBC 4MQSB 4XC3H 1FFPA 4MQ7A 1NGPH 4ZTPH 3CDCA 5DRWA 4PJCF 4PV9A 5CHNB 4JPVL 1CGXA 2O61B 2MMXA 5D9SA 4LVOB 3BD5A 1AXIB 3V8CA 2UWEA 4Z0BL 5H94B 2AJYL 3MV9B 3HC3L 5IVXF 2GJZB 3CLEL 5C0IB 1FO0H 3ZHLA 4IOIA 2ATKA 2P4AB 5E1AA 4LLMA 2AW2A 4EQ3A 4FFYH 1GC1L 1OAUL 4UTBH 1UZ6E 5BRZA 3KJ6L 4OTXH 1NCWL 4OQTH 4OT1H 4UOW1 2EIDA 2J88L 3WFCH 3V52L 3WN5A 2A6IA 2YSSB 1RUPL 5F7EL 2DIJA 2FYYB 1GH7A 1B4RA 3LKRA 1J0YA 1S3KL 1CS6A 4PLOB 5HDQL 5FO8A 1HSAA 3VRIA 4F57H 3ARGB 4PB9H 5JMOC 3KYMA 3C5ZA 4LFHG 1FYTB 4WCYL 3OKEA 2OXGA 4LP5A 1EGJA 5IEKA 4O51A 4V2BA 5GS3A 3IDIA 1NL0H 1A0QH 4JDZB 3TO2A 4DKDC 2I60L 3TBVA 5FYJE 5FYJH 4KRMB 2DI7A 1NGZB 5A43C 3PG2A 2ZP0T 2JF1A 2HMIC 5I0ZA 43CAA 5JHDE 4WV1C 4P5TB 2CJUL 2X1OA 5DUBA 3QXTA 2EDBA 3ME0A 4U6TA 5FUZH 3M17A 4OIBA 2VNCA 4KMQA 5DD3H 4JFDE 5KOMC 2V9RA 1IGML 5DJXB 1GHFL 4PJDF 1R3JA 2H8PB 4IRJA 4WENB 1I8KB 5GJTH 3B4NA 4DGYH 3M45A 2FJGB 2G75A 2ZG2A 4N0YL 1FFNA 5D8JL 4FZ8H 3BN3B 1ZHLB 3SKJH 1O7VA 3MACL 2VLKD 2BVTA 3UPRA 4EI6B 5JHLH 1RVFH 3QEHB 3VXUB 4HHAA 1MWAL 1IEBA 2GYSA 1UA6L 5LGHL 3H9HA 4NWTL 2GK0B 3OXSA 5T1DL 1YNLL 1WFNA 3GBML 1RAMA 1KPUA 1P4BL 1BAFH 4QEGA 1M7DA 1WUNT 2P7TA 4PRNA 4OLVL 4HLZH 4JAMB 1CGUA 2RBLA 4QT5B 3ARFA 1PLGH 3PWPA 2DD8L 4NM4H 3PJSA 1OHQA 2EXYD 3P4OA 4ZUSB 3QG7L 2P8PA 1G6RA 4G9DB 4XP4L 4R4BA 2LV4A 3DXAB 3ULUH 4OLUL 1CFQA 1V05A 1J18A 3H8NA 2GKIA 3T0AA 5HYQB 3QQ9D 1U8QB 1UM6H 5JA8B 4XPGH 4CVXA 3MODH 3P4MA 1Q94A 3PWLB 5F7DB 4JKWA 4X6FA 2Y9RT 4L4VA 3GEWB 4XPTL 2H41A 1PSKL 5B22A 3FB6B 4P2QE 4GMSL 4JRYB 1HQRB 2MCPH 4XPAH 3KPMA 4FG6D 4OGYH 4PJ5E 4LIQE 1CGSH 4LIQH 5I30H 1F5WA 4IS6B 4F7MA 4KHXL 5FYJD 4Y4HC 1EAPA 5TE7L 4HKZB 1NFKA 5GGSY 5ISZA 4J6RL 4R0LC 2JELH 2R2EB 3JV5A 1ONQA 4XB8A 2BSSB 4GBXC 4YFEA 4WTZG 3RKDD 1AH1A 1TQBC 1MREL 2HRPL 4YUEH 4JFDD 3T1WA 3W81A 3QUYB 4FFWD 5BO1H 4GSDH 5C2BL 3SGJC 5I17A 3SDAC 4HZAA 2XZAL 5GRVK 1LK3H 1NH6A 4WGVB 4PP2A 1KPVB 1T80A 3C6SA 5D72L 1G9EA 2XQBL 4AT6A 4U2YA 1ZEAH 5C0NC 1RZFL 4P4KC 5JLZA 3SJVB 3IAPA 3IU4H 2VDPL 3WIHL 5B8CA 3DBXB 4Y4KC 1UVQB 5E8EB 3HE7D 4G3YL 3KVQA 3HFML 1HINL 4GRMA 3NH7H 2BY1A 6CGTA 1CR9L 2VDRL 4K8RD 2JCCA 4UT9L 3SE3C 3BISA 3MSPA 3PQYB 1ZE3C 4GKNA 5IKCA 4LPYA 4XAKD 3LV3B 2X1PA 3BSZH 5CJXC 1CWVA 3LIZL 5DMGD 2DJSA 1PG7L 3GMOB 3MCKA 1GSMA 4MD0A 2IAMA 4ZXBC 3S8WA 3EHBD 5DUMH 1Y0LA 3FOLB 2HKFL 3ULUD 4EZMA 1NCUA 4U4BA 1S7QB 4AEFA 2EDYA 1RUKL 2DKMA 5E8PA 3P77A 1PX4A 4JLRA 1YEKL 1MOEA 3BPCB 3I6LD 1JIBA 4NO0B 1G7MB 4J4PA 2DWDB 3MRBA 3V4UL 5B39B 1BVKB 2PXYD 4APQD 2K7QA 5F9WC 4NUGL 1WCQA 5HYSG 3VXUD 4HCRA 2AEQL 4WI2A 4YHNA 1VB9A 1V3LA 1C8PA 4PY7A 4AG4H 3HCVB 5C0AA 1UENA 2RGSA 3B9EA 1OARL 3G5VB 5CIPB 1UB6B 3O9WA 3QA3B 4U7KA 5DSCA 3TGXA 5I73C 3SKNB 3HMXA 1G9MH 2L4OA 1QD0A 2UZIL 3J7HA 4RFEB 1MFDL 2GT9A 4F3FB 3QIUA 1R3KA 4NM8L 4R2GD 1FG9C 1RI8A 1A6VH 1OAQL 4Q6IC 2P8LB 1B4JH 1ZLWH 2AEWA 1L6ZA 2P5EB 1Z9OA 3A0OA 2A6DA 4XPBL 3V6ZB 3HUJB 5GJSH 1WEJL 1T7YA 3O4LA 4EXPX 4P4RB 3VFUA 1FL5B 1T5WA 1WFTA 3GUTB 1F6FB 3MGOB 2CO7B 4JRWA 1ZV5A 3EDKA 4IOFD 4JZOB 5HHXH 5E03A 1QHPA 3WSQL 1JGVL 3G6JA 4Y4FC 3QDJD 4PRDB 3C5SA 4NQXB 3AXLB 5HHOB 1F8TL 3FQUA 5CUSL 2F8VA 2Y36H 3G5YA 1ZA3A 4BZ2L 3QUMA 4NQEE 3NOIA 1FORL 2WBJA 3FAXA 2IH1B 3CX5J 2VSDA 2AQ3A 3WN5C 5TF1H 4BSWA 5L6YH 5F1NA 4OLWL 4KJWC 1SJEA 1YMMD 1QFWH 4ELMF 4DKFL 5IVXB 1F11A 1HI6A 4KAQL 3O2WL 2OMNA 2LQRA 5J12C 1FL6A 4OLEA 2N7BA 1HKFA 2FEDD 4EN3A 3T3MF 3RX8A 3NACH 1QLFB 1XF2B 2APFA 4XC1H 1MJUL 1XF3A 2VWEE 5EC2A 4LHUA 4NZUL 5EO0A 1DL7L 4H8WH 2ZCKH 2DYPB 3H42L 1BQSA 4HQQH 2BSED 3MROA 5ANMA 4M43H 4TNVK 4GG8B 4Z8FL 4WUUE 2ZJSL 4AL8L 3CUPA 4PLKD 2P8MB 4OQTA 1CDCA 3DV4A 3ARDC 1IGIL 3AREA 3KPLA 2EZ0C 3T0WA 5KJRL 4OB5H 3THML 2R0KL 3QH3A 1MJJA 3P4LA 1AGEB 2WAHA 4I77L 4LLDA 5BMFH 2VLRE 1LVEA 3MV7D 4MXWL 3L1OL 1LP9F 5FYKU 3RWIA 2IFGA 1PZ5A 2F54A 3DMMB 5CP3H 5T1LD 1HHIA 2FSEA 3D9AL 3TPKA 5MEPA 1SJVA 5IMLA 2P43B 4K7PL 4ZOBA 5MEQA 2ZSVA 1MY5A 3C09B 4KUCF 4M6OL 4R4ND 4HWBH 3NFPA 2HKHL 2NY0B 4HIJB 5EORL 2B2XL 3TT1H 4YC2B 5JHDA 2J12B 4HSQA 1RIHH 2CRYA 5AAWA 2X4RB 1IAIH 4LASL 4QTHA 4JFDA 5E2UH 4GRWF 5EPMA 1AFVH 3D2UA 3EW3B 1OD7A 3U0WH 1OGAE 3SE4A 4D0CA 5MP6H 2CDEB 3REWA 5K9QG 5EC1A 4EUPA 3GMRB 4XPHL 4MXQC 1ACYH 4Y16B 3EYVB 4KPHL 3CXHK 4NGHH 3TN0C 3E0GA 3QCUL 3N1PC 2Q1EA 4N0UE 4U1GC 2Q6WA 1BQHB 4TRPH 2YA0A 4UDTB 1Q72H 3MYJA 3ULSB 3GJFH 3CU7A 4GO6B 1ES0B 2OX5A 5AEAA 3GMNB 1H3UA 3PGDB 1S9YA 5DJCA 3BYYA 3KLDA 3A6CL 5JOFB 1JWMA 2BRRH 4WWID 1GCFA 4GUPA 4OD3H 1FPTH 3NIFE 3NIGF 5EOCH 1VDGA 3GMMA 2IPTH 4UV4L 5BW7C 4MQXC 5FDWA 1GGCL 1MCNA 3KPNB 5ELIA 1OP3K 1MIEL 4BH7A 4WO4D 4AEIH 3VXRB 1GOGA 1BX2A 2FEEL 4KKBC 5CEXA 3FAWA 4JANB 4PRPE 5DFWH 4FABH 1JRHH 3CH1A 2CLZB 3FQTA 1NDMA 2BZDA 1JPTL 3HLAA 3VXOA 3TA3A 2M2DA 4YLQT 1U6AH 4HX1A 5DJAA 2HTKC 1NAKH 2NY3C 4A2LA 1HKLH 2BNQE 4JFYB 3BZ4A 4X6CF 3F12B 4KKAD 2FO4A 3WS3B 3RTQB 4RWYH 5E8NB 5ESQA 3GSOB 3HZVB 4N1HB 4P2QA 4X6EA 1RD6A 2Q8AL 4PJ5A 3GSWB 5SWZD 3O41A 3SDYH 1VGEH 1C1EL 1IEAA 3SDCD 4R7DA 1TLKA 4DVBB 3CVIL 1KB9J 5B8CC 3CCHB 1QBLH 1F4YH 3S7GA 4HS3B 4I3SH 2XXCB 2NR6D 5JDJA 4XX1E 4J12A 1SY6A 3GMLA 4L5FL 4GAFB 4YIQB 3QIBD 2NY6B 2WLZA 2E8YA 2G2RB 4KY1L 5LJYH 2YD4A 4LSSL 1NKRA 5L2JA 5GGVL 3HA0A 1RSFA 2IAMC 2LU3A 4HIXL 5D1QB 3RHWK 5IB2A 2D7QA 3BZFA 3HE6A 3ZHDA 5AWNL 3W5NA 4NCC1 1BFOB 4D8PA 5J7CC 1H9VA 3X13A 4IOSD 2R1XA 4FFZL 3UBXB 1NDGA 5IBLD 3D39D 4JO3H 4U49A 4TVPE 4TVPH 1CLZL 1KPRB 1RIUL 3D18A 4LVHB 3PDGA 3ULVF 3MRKB 2ILLA 5T1MA 2VDML 1TZGL 2HJFB 5DJYA 3GBNH 3P9LB 4DKEL 4KZDL 1S7VB 4ETYA 5DD1H 3P0VL 2Q8BH 1MAML 1PAMA 4HPOL 4KJYA 2JIXA 1TJGL 2X4PA 4S0SD 1RZGB 2I07A 4DTGH 1DP0A 2Y5TA 4FHBD 3T0DA 1ZLVK 5IB4B 1U8PA 2ESVB 4LLUA 1QYGL 1P1ZB 4HLZG 3DURA 4UILH 4KTEL 4MSWA 5TDPA 4KU1A 3W2DL 3MREA 4RQQB 1DBJL 2J8HA 3W5MA 2FR4B 1WC7A 3QIUC 4YO0B 1CF8L 5LWYH 1V5JA 2NY2D 1C5DA 4ZQKB 2EH7L 4P23A 4UQ3B 4WWKB 4MD4B 3QFDA 4NIKB 5CMAB 2GQHA 1A3RL 1F4AA 4GJTB 4OF3A 4X6BB 3U4EB 3TJHC 4OKVA 3N85H 4MDIA 4NN6B 3FHQA 4X80L 5J8OA 1JP5A 4AY0A 1KSRA 3OAUH 2G60H 3L6FB 3M1BB 4LKXB 1DDHB 1INQB 4LCIL 4P2OC 3WXVH 2NXZB 4KK8D 2EDLA 3MRJA 2EH8H 5DMKA 5J1TC 1ZVYA 1QP1A 3BQUA 2VAJA 4JFFB 1Q9KB 3MJ9A 4LVNC 5C0FB 1HHKB 2BJML 3MRDB 1WSST 5FYJU 1XIWA 3L5XH 2NY5H 2WBJC 5GGSA 4QTIH 4QY8B 2ZWLT 2VDQH 3ZKXB 4TOYL 1E27B 3OR7A 1J05A 4NFCA 4HF5L 4HUWA 3TIDB 2G9HA 4JHAL 4ZS7L 3UC0L 4HW6A 3T2NL 3V0AC 1N2RB 3QYCA 4IRSD 1BF8A 1HSBB 4U1NA 4UINL 2E27L 5IFJB 5IOPB 2AXFA 4HV8A 3NCYP 4AIOA 4RISL 4GKZB 4YQXL 3SO3B 2ICWA 2W92A 5IV2B 3RPKA 3C60A 3MRRB 4GXVH 2F74A 4KRPB 3MA9H 1YEIL 3HR6A 1T89A 1HXMA 3TT3L 2DOCA 2XYCA 3HI5L 3T0XA 4NQEA 4CW1A 1AKJD 3BJ91 1S5HA 4X7SH 1J12A 2GAZA 2BXYA 1CCZA 4Z95L 2C5DC 4LCWB 4KKLC 3MNVB 1RZKL 3K4ZA 5SX5H 3FFCD 4D3CH 1E4JA 5CILH 4R3SB 4MNHB 4JG0H 1AIFB 1CE1H 2A9MH 1T7ZA 3S98A 5DZOA 3D0VB 1JTPA 3WNMA 1QNZL 4U1IB 5IFHH 2MQ3A 5JTWA 3MV8E 4QYOA 3FQNA 4UBDD 5D7JA 5DLML 4JVPA 1E4WL 1LNUB 4JG1L 4NDMB 4EDXB 4F15B 3HR5B 2FHFA 4WUUA 4AIZB 1D6EB 3D6GA 3U9UB 4OCYH 5F7WC 5DHYA 1WBXB 3VW3H 4EJ1C 5F72S 1KEMH 2R69H 1L9MA 5F3BA 4GRLB 1MIML 4HEME 4WU7A 3IF1A 2Q87A 3VG9B 4PJAB 1NBYA 3U0TA 2VLRA 5CBEA 5KSVA 1B3JA 1ZT1B 4NP4H 5T5NF 2Z91B 2X4TA 4P59H 2NXYC 3SE4C 3UBXI 1IM3B 5CP3A 1JUFA 2EKSB 2NX5E 4PB0H 5DVOA 3SGKA 4M7JL 2KUTA 3CFKA 5HTSA 4HWBA 1YYMH 3HI1B 2K7PA 4YHIB 1QHOA 4I3GA 4OIIL 2VJXA 5BV7H 1ND0B 3ZDXF 1L9NA 1ZGLB 4YGVA 3RWJA 4E41B 2EYRB 2IBZY 3KPQA 1WWBX 2VTFA 43C9B 4R97B 2VKXA 4MJ6A 3JWOC 4CN4A 3VFTB 2X70B 5HI5D 3MLZH 4H1LH 4QHMB 3MUJA 1OD9A 3QEUA 3EO0A 2C9AA 1OGAA 5GS1B 4GG6F 1P7QB 4L9LC 2AERT 3B43A 2QADB 2HTLC 3RY4A 4G8GE 3V7MA 2DTML 4ODBD 4P49A 1YYLH 1Q9WB 1K4CA 4HIHA 4HS6B 4ODHH 4P9HC 5IT2L 4N0UA 4PRIE 3O6LL 1DBML 3TA3C 1RMFH 3GJFA 1JGDB 4K2UH 4L3EB 4QKXB 4Q9QL 4KHTH 2A1WH 3DO3A 4OM0L 5D7SL 3WDHA 3U46B 4JM4H 3B2UC 3EO1B 1LEKB 2ICEA 4FQ1H 3BP6A 2OR7A 2WUBH 3TFKD 4P5MA 3MBEB 1R5IB 2OP4H 4HJGA 2GI7A 5BVPH 1FZMA 5MERB 4PUBL 3ECBA 1ZT7B 4ZMAT 1I85C 2OZ4L 4PRPA 4DZBB 25C8L 3QI9A 1K6QL 5CCKL 4U31A 1JYXA 1UB5B 2P1YA 3QQ4B 3O6ML 3HG1E 4X6CB 1PZUB 1GJIA 1BZQK 5CWSB 3MRCB 4GKSA 2X4UA 1RJZB 3CMOL 2BVOB 2BNQA 3GGWB 1MFBL 5E5MA 3MRHB 5C6TL 1N5AB 4XBGA 1M71A 1UXSB 3IXTA 3V8OA 3PNWB 3RDTA 1LDPH 4GLRH 4IHOB 2XZCH 4PJFF 1LO0L 5FGCB 3BH9B 2I9LB 1UYWH 3FB8B 3MLSH 3VXME 4NJ9H 1WZKA 4MMXC 3HB3C 2JJWA 5IQ9A 1BJ1J 4MWFB 4YDIL 4B53A 4RGMC 2GSIB 1DEEA 2NW3B 2VDOL 5ITFA 2WIMA 4S11A 3RU8L 2MQCA 3TIEA 3HE6C 4FZEH 4LLAA 4ZAKA 3QWRD 3VMPA 4AMKH 2IADB 1X9QA 3QZWA 3MLWL 1I8IA 4PJ7E 1FVEA 3DI3B 4ONGH 3AS3A 5DI8A 3NZ8A 3UYRH 5IROA 2V5SA 4EEEA 1VADA 4N0FA 3C6LB 3JV0A 4TVSa 5IB5B 3GI8L 4NCC2 2ATPA 2A74A 5LVEA 2OL3A 5IK3B 1AY1L 2CXGA 1JI1A 1JWSB 1NSNH 5C7XL 1Y18A 4OCMC 5DRZB 3IU3A 4X8JA 1C5CL 1R5VB 2OK0H 3KXFB 4LVEA 1TJIH 2R29L 5C09D 2VUOA 4M5ZL 4KUCD 4LCCC 5JNYA 2R15A 4WNQB 3C08H 4JRXD 3LN4A 1NANH 4P2YA 1I8LC 1A6UH 1ZSDA 2VXTL 3ISWA 3B9KA 2VXVH 4LPUA 4IJ3C 3VG0L 2H6PA 1HYRC 2AJ3B 3A6BH 4CVZB 1W8OA 5KSAD 2DIBA 1T1XA 1G0DA 3S37X 5ALCH 5K9KB 5L2KB 3FB7A 4DQOL 4G6FD 2WP3T 2DB8A 3HG1D 4MDJB 3WBDA 4YR6A 1HHGA 2GUOA 4ZFFB 1PBYA 4MAUL 3BP7B 5ICXB 5TH2B 3ZYJA 4P57A 1A6AB 1A6PA 1IKFH 4HGWA 5D2LE 5IVZB 3CSPA 1PYWB 4AQ1B 1CL7H 4ZUVB 1MLCA 4P46C 4YDKH 4KROC 2C3WA 1CBVL 3O3DA 3QFJB 4JVUA 3BQUC 4LSRH 3DVGB 3GSNH 4O9HH 1YUHB 2VDNH 1JHKH 4UT6L 2YXFA 2XTJD 1VHPA 3MRPA 1PFCA 1OGTB 3IYLW 2I5YL 4YHLL 3VA6A 4P2RA 4OBSA 4WFGE 1KFAL 1CU4L 1W0YT 3IS0X 4OFVA 5CJQL 3OB0H 5JO5A 4EIGB 4RFOL 3IT8D 4RMVA 4WV1B 1T3FA 2X1WL 4BQCA 5F7LB 1ZHNA 3D3VB 3EKCA 1VFMA 4JJ5A 3VGBA 1T03L 3Q6GL 3VJ6A 1CTNA 1XR9B 1QVOA 4LPCA 1CQKA 4WJ5A 5C0RL 2VXUL 1CK0H 3BRFA 1T89C 1ED3B 2HJLB 3D85B 3VFOA 1ZLUK 1U8IA 4G6KL 1PY9A 1SBSH 5M94B 5KS9E 2W60B 1YECH 2E6JA 2YMXL 2XXMB 2ZKHL 1AD0A 4Z76B 2DL2A 3SO5A 1CFNB 1D7FA 3IGAA 2EDQA 4O02H 5F7YC 2WP3O 3ALWA 1S9WB 1Z9MA 3UP1A 1PQZB 1AXSA 1U93B 5E99L 2OTUB 3JUYA 3QWOA 2EDJA 3K74B 3V4PL 4RMRA 5F9OL 4HK0A 1TZHB 5L0QC 5A2FA 4ELKB 3FQRA 1UKQA 1J5OH 4PGEA 5D7JC 4OZIF 3OKDB 3VFPA 4LQFH 2AK4D 2XY1A 5J9PA 3O3AA 2NZ9D 3O11B 1DQQB 2HT4C 5D5ME 4YNYB 2RFXA 3BUYA 4GQ9L 3NVQA 5EO9B 4IM8A 4YK4B 5FF6B 3E1F1 4IMKC 1TNNA 3RWGA 3TNNB 2X44D 3IDMA 4LLYA 3K8LA 1TJHL 4LPVA 3DPBA 1CICD 4F7EA 3LKSA 5HJ3A 5DDHB 5KAQF 2W65B 4X7FC 2HT2C 1BGXL 3HAEG 5EZLA 2W9EH 3PDOB 3QPQC 4L8BB 5HGAA 3H9SB 2KZWA 3RUGF 2EDOA 3CGTA 3VXSE 3MV8A 1KNOB 1V3KA 4BFIA 3OKMA 2E6QA 5C71A 4LSTH 1D5IL 2X4SB 1U41A 3N1FC 3ULVD 3P9WB 3AU1B 3S36X 4R0LB 1R24B 5DK3A 1S7UB 4C56E 2IBBA 3HNSH 3MA7B 3DROB 4TULL 1U8KB 1NCCL 3LS4L 1FL3A 5EU6E 5E95B 3RY6A 4RGNC 5A2JH 3OJDB 4OGAD 15C8H 2F5AL 1JYVA 1MY7A 3NFNB 5J1SC 3BEVA 4PJ9C 1JHLL 1A4KB 2DL9A 3Q48A 3SDAB 2G5BA 3U7YH 2BNRD 1QSFB 4MJ5B 3T0EB 1RJLB 5D6CA 4W6YB 4DKAA 3BHBB 4XMLL 1G0XA 1F45A 4TPRH 2NX5A 3RWDA 4UNTA 5L8LB 4P4KB 3S3PA 3V5HA 2VXQH 1BVLA 2V6HA 1E6JL 4H5SB 4UMGA 5FOJA 1NJ9B 1TVDA 5FCUH 4JFQA 2F19L 1EJ6A 5T33L 4TTDD 4N8PA 4Y4KB 3REVA 3SN6N 4JO2H 3PWUA 1X6NA 2OSLB 3TVMB 3F65A 4LL9A 2V5YA 1IAKA 3BGMB 4KV5F 2AV1A 3ZHKA 1XGTB 4H1LA 5JIHA 3MV9E 3UTQB 4W4NA 5D1ZA 5FV2A 2CKNA 3OF6D 4G9FB 3AS2A 3ZKMD 4K07A 4M7LH 2EEDA 4TUOA 3HI6H 3LAFA 3KS0J 1NC4A 2VITA 3GSQA 3OXRA 3P3YA 4Z7VF 5EBLB 2WK2A 1J0KA 2GFBB 4G8GA 2L0DA 2R4RH 3OX8A 3O45B 3VFVA 4PRIA 5FDYA 2X9XA 1JPFA 1JNHB 4M8VA 4ZXBB 1UZ8A 3OKKA 2IANB 5AG9A 1SM3L 3OR6A 2Z93B 2NY7H 1NLDL 3CX5K 2DLHA 2H32B 3FOMB 5FIEA 2D0FA 3RGVC 4XBEL 1JZ7A 5LAXA 4PD4J 3MRIA 3LKOA 1XR8A 5CJOH 4HUUB 4JZJC 5ALBH 1FYTE 1DN0A 2V2WB 3O3BA 1U58B 3L7EB 2DQCH 4HWNA 3D25A 5F9WB 2EXWD 4D0DA 1L7IL 1UQSB 4GAYB 4JHWL 2HT3C 2DAVA 3U2SB 1KF9B 5A1AA 4JPVH 1W0VB 3KPPB 1G84A 1A6WL 2CDFB 5ENWB 1GAFL 4X4YB 4ZAKC 5ITBL 2CLRA 4Z0BH 2AJYH 3HC3H 3MOAL 3IRPX 3CLEH 3IJHA 3LKQA 5I71C 2NNAA 2COQA 4PJFB 4KK9D 3L5WA 1LE5B 1S78C 3AY4C 4JZNB 3QO1A 1GC1H 1OAUH 1BD2D 4CJ0A 3KJ6H 4QF1A 4XNYL 1QR1B 4HKBB 1NCWH 4I0KA 4X99B 1S7XA 4RAVB 4LSPL 4JFED 4Q6IB 5EBMA 3VXMA 2VH5H 4OF8A 2J88H 3L3OA 3V52H 3WXWL 4HC1L 5F44A 2GITB 4BKLA 4I0PA 3DX6A 3UO1L 1AO7B 3PGCB 2MQ0A 1RUPH 2QHRL 5F7EH 3TC9A 3V5KB 3ARTA 5HDOA 2E9BA 1YC8A 1S3KH 1A1NA 3H9SD 4OFYD 4PRHD 5HDQH 2ADJA 4JKPL 4ZUWA 2CDGA 5DQ9A 2BVQA 3OAYH 3VH8B 5D7IF 4PJ7A 1MSPA 4WCYH 3L3JA 3L5IA 2XTLA 4CNIA 1IL1B 1T1ZA 2JLLA 2D7TL 2P24A 4Y4FB 1JPSL 1L7TL 4WFED 3HC4L 3EJYC 2I60H 5E08H 4JO4L 4ZFOB 5DJDB 5GRVL 2HVKA 1JGUL 2WBKA 4V1DD 1D9KD 5D6DA 2CJUH 3QDMB 3RIAK 5E7BA 2Y23A 3QBTB 1J86A 3DXAE 5FA3B 1CXIA 4HJ0D 5J12B 1KCUL 5DURD 1GHFH 4RGOL 4ZO8A 2XKSA 5JW4M 1SEQL 1J1OL 1I7RB 4WFFD 3WUZA 4ZS6C 3X14B 4CMMB 1GOHA 3W11C 4JRYE 1XGPB 4IRZL 1N7ML 1QSEB 2FLBT 3BN9D 2E7LA 4QHNB 4XP9L 3GI9L 4IMLB 1VEMA 2A6KB 3MACH 4RNRA 1GRWA 4Y19D 1U8OB 2DRUA 4ORGB 3RWFB 1MWAH 1Q9LA 5L7XL 3B3IA 3ARDB 1UA6H 5LGHH 4NWTH 3LHPL 3BIAX 5T1DH 1YNLH 4ZPVA 3GBMH 5D2LA 1G6RL 4N9GA 4ODVL 1BLNB 5MENB 1MH5B 4H25B 2VQ1A 2AQ1A 1MUJA 5KVDL 4NQCB 1SYVA 5IHZB 3UTTB 5BZWA 1XGQB 4NYLB 4IEFB 3UJJL 1TZIA 2DD8H 1FIEA 2Z35B 1T1YA 1LO5B 4BYHA 3SJVE 3X11A 4X7TA 3QG7H 1DUYA 5FYKL 3DETD 4XP4H 4OLUH 5E94A 4OZHF 1EVTC 4J3XA 1OTUD 3L3KB 2R4SL 4DZ8B 4ZUUA 4FQCL 5DEZA 3O3EA 4M48L 1KG0B 5GS0D 1T0MA 5I66B 2RR3A 3ZE1F 3WFEH 1KB9K 5E6ID 4XPTH 3DGGB 4F37K 1PSKH 3LB6C 2MOVA 4XCYA 4GMSH 1FG2B 2V7HA 3T65A 5AYQA 4F7CA 1KLFA 1OW0A 4OFDA 3PQYE 4PGDB 5HYJA 5IJVA 4KHXH 3WS6A 3CU1A 4MA3B 4PJBA 5TE7H 4J6RH 4XZUA 2F15A 4V2CB 5E2TL 3FT3B 3ROOB 3RNKA 1N3NA 3TH3T 5IQ7L 3TN0B 5HGDB 1IM9D 4U1GB 1MREH 5I8EA 4K3EL 2HRPH 1CZ8H 1IILE 3T77B 1KTDA 2OJEA 1XAUA 5C2BH 4H20L 1A7PL 2QQNL 2XZAH 1WWWX 5ERWB 4OZIB 4HMEA 2ZSWA 4GW5A 5FUCE 1IC7L 3BDXA 3RX5A 2AV7A 5D72H 5I1AB 2XQBH 4J3VA 3ZDYE 1RZFH 4GKOA 4JN2A 3F7YA 3U6RA 2VDPH 4U1KB 4MHHI 1JNLL 4OJFH 5JR1H 4JQVA 2ADGB 3ARWA 3WIHH 5HYFA 4U1MB 4BH8A 5D5MA 1RV6X 1WTLA 1MHEA 4G3YH 3V0WL 4QXTA 5IBUB 3HFMH 1HINH 3QSKB 1RK0B 3CLFL 5C2UB 4G80A 4KK6C 1CR9H 3RVTD 2VDRH 5CIPH 3AAZA 1NBQA 4UT9H 3RUGB 5CSZA 4ISVB 5ESAB 1NBVL 1V7ML 2X4NA 3WO4C 3MXWL 3LIZH 2B20A 2SEBA 4OD2A 4XNUL 5F88A 1PG7H 4KUZL 4D0BB 3NTCL 3VXSA 4KJPD 4EI5A 3L9RB 1BOGA 4CL7A 3VD5A 1QQDB 3GKWL 2P5EE 1F6LL 5TDOB 2Q7YA 1NCTA 1UG9A 2XKNA 4Y5XC 2HKFH 5KSUA 1Q8MA 1XF4A 3HUJE 2HYMA 5E5RB 4C56A 1RUKH 4Z77B 4UIMB 2HFEB 5EU6A 1YEKH 3VI3F 1GZQA 2OJZH 5B38B 1T66D 1T04A 3GZKA 1TVBB 4QOKE 4OF5A 1DQDL 3MRLA 2PYFB 4M7ZC 2QL1A 4MA8H 5D1ZC 3V4UH 3TZVC 1N8ZA 4X9GA 2FECI 3I50L 5DFVD 5HHOE 3F7VA 3WCYA 2AEQH 4QRPD 2R0WH 3SDXF 2VZSA 5LBSL 1ORQB 4PR5A 2CMRL 1S7RB 1FDLL 1OARH 4HUVB 4OLYL 1HWHB 1OLLA 3OG4B 2VLMD 5AZ2L 3CSYB 3IDXH 3RZCC 1N4XL 2UZIH 5CHNA 3MLYL 1FVDB 2O61A 2PW1B 2YK1L 3U48A 2IH3B 4NM8H 5H94A 3MV9A 4PBVC 2GJZA 4Z7VB 1OAQH 5CLTA 5C0IA 2LFGA 3QDGB 5HI4C 3FO1B 4AM0B 5F3HB 3N1QC 5TQ2H 1U2CA 2P42B 4XPBH 3PL6D 4RMUA 3CZFB 1WAAE 3HZYA 4NQDB 4WW2F 1WEJH 1BEYL 1ZWIB 3O6FD 4WI4A 2HA1A 1IC4L 4HFUL 3QUML 3CFJB 2C1PB 1YN7B 4X5LA 5C0JB 1IQDB 2YSSA 2LAAA 3F58H 3WSQH 4DWHA 1JGVH 1CGTA 3UMTA 3TO4D 4Z7OF 3FRPA 2DBLL 1F8TH 5CUSH 5FYLL 3SDDD 3ARGA 4I1NB 1FYTA 1MCOL 2C4FT 3LPFA 1FORH 1D5XB 1FN4B 1QFWM 2WM0A 4OLWH 1KJVB 4QLRA 4JDZA 3EO9L 4G6JL 4DKFH 3KLAB 3KNBB 3O2WH 4KAQH 1NGZA 5A40E 2H3NB 1M7IA 1JJUA 1F4HA 3HKFA 4P5TA 3UPAA 5CEYB 3WUWB 1MJUH 1YNTB 4PYHA 1KULA 3QUXD 4P2OB 4NZUH 1DL7H 4HWEL 5DJXA 3RI5K 1C16B 3H42H 3RJDA 1BPVA 4PJHF 4LVNB 5HDLA 4Z8FH 2H8PA 2ZJSH 1I8KA 2FJGA 5C1MB 4PJ8B 1IGIH 3F62A 4YHYB 3MCG1 4DAGL 3THMH 1ZHLA 1EEZB 2H2PC 1RHFA 2R0KH 1HCVA 4I77H 4EI6A 3R4DA 1OSPL 3QEHA 4RSVA 4MXWH 3L1OH 3SGEH 1ZS8B 3BX7C 4M1CD 2GK0A 5C3LD 4CADB 3D9AH 4Z7QE 2ENYA 4K7PH 3S35H 1BREA 3ILQD 4L4TD 4OM1H 5CSGA 3S9DB 2FD6L 5KSBF 4M6OH 1WIUA 4KZEL 1H3VA 5GGVY 1SJXA 3VXRE 2HKHH 4QT5A 1WWAX 5I1LB 5EORH 2B2XH 4Z7WF 1B0WA 5DS8B 3X3FH 4ZUSA 2DQUH 5E9DB 4G9DA 3DXAA 4Y2DD 4LASH 3HZMB 5HYQA 3KHQA 1U8QA 5T5FL 4FXKB 5T5NG 3PWLA 4MCYB 5F7DA 5BQ7B 3JWOL 4D9QD 4NJAL 1WJ3A 4KH2A 3FB6A 2XRAL 4KPHH 4NZRH 4JRYA 4OIAA 4WFHD 1MI5E 1HQRA 3QCUH 4IS6A 4B0MM 5DD6A 4HKZA 1Q0XL 5F97E 4X9BA 2R2EA 4I2XB 1AGBB 3QUKB 3A6CH 1K9TA 2BSSA 4NKIL 4P9HL 1MFEL 2A6JB 3VGHA 4MS8D 4UV4H 2ZOLB 1GGCH 3QUYA 1EK3A 1VENA 4NQDD 2KDGA 5DK2B 1MIEH 4YDJB 4PGJA 3WS6C 2MJWA 2DM4A 1KPVA 1BBDL 1IKNC 2PR4L 4K71B 2YS4A 5DMJB 3LKNB 3SJVA 4MAYD 3KGRA 3DTXB 2QR0B 5KN5B 1E28B 3O81A 3SY0B 3DBXA 1UVQA 4U05A 5E8EA 1I1AB 2CKBB 4A6YH 5I19L 5C0CB 5E6YA 4GS7C 4N0CD 1AGDB 1EHNA 3EJJX 5HHMB 4MA1C 1F3DH 2Q8AH 1SY6L 3BESR 1C1EH 3PQYA 3OGCB 2R9HC 4XVUD 3LV3A 2VR9A 5C3TA 3LQZB 4WY7L 4HUNB 1X7QB 4L9LB 3CVIH 3JVGA 3GMOA 5JIPA 4OCXL 3GSXB 1LGVA 3R06B 5BS0D 2CIIB 3CFDB 1I1FB 2HN7B 3O8XD 4M62L 2MHAB 2IALB 4F2MB 3FOLA 4L5FH 1RHHB 3CMGA 2ESVE 3IAQA 3G08B 1JFQL 1S7QA 4LLWB 1RUAL 3HPLB 4FP8L 2I25N 3HZKB 4KY1H 4OQ1A 3QO0B 1F3JB 3BPCA 4QCIB 1U8MB 2F53B 4N8VB 2C4XA 5C07B 4LSSH 4NO0A 2W1NA 1G7MA 1MI5D 2DWDA 4NRXB 5F7NC 4BZYA 5B39A 1IJ9A 4PTTB 2X4OB 1KGCD 5GGRB 1UM4L 2O5XL 4HIXH 3WIHA 3MX0A 5AWNH 3QIWB 3MRGB 3JUZA 1QUNA 4NC0B 1LO3L 2ADFL 3HCVA 1JWUB 4UT7L 2UZYB 5JUEL 1NUDA 4WDIB 2Y07H 3I75B 3G5VA 5CIPA 4FN0A 5BOPA 1UB6A 4I18B 1CLZH 1RIUH 4Z7UF 5I8KL 3SKNA 3HNTL 3L3HB 1DQLL 1ULVA 3WFBL 2VDMH 1TZGH 4RFEA 4PS4H 1X5XA 4DKEH 4KZDH 4F3FA 3WJJA 4JFFE 4N5UA 4EIZC 1FNEB 3P0VH 3H9ZA 4E5XB 1MAMH 3FCTA 1TJGH 2DIAA 2P8LA 2P5EA 2ADIB 3JZ7A 1BFTA 4RGMB 1QYGH 4PJIF 5KANI 3V6ZA 3HUJA 4FG6C 4HG4K 1NC2B 1QRND 4P4RA 4KTEH 1FL5A 3W2DH 4U7MA 3GRWL 3GUTA 3MGOA 2JE8A 4QOKA 2BVYA 4JZOA 4EVNB 4GXUN 4LDEB 3ALXA 5JPNB 4PRDA 1YQ2A 3EOYG 4NQXA 3AXLA 5HHOA 4NHCH 1QPPA 2AVGA 4FFWC 4X9FA 5L8KB 2Z4QB 4R96B 3DX8B 4MB3A 1NFDB 5T1KD 4X80H 1AQKL 2F58L 2ZUSA 4LCWE 1CFSB 4U1LB 3UTSD 4U3HA 5IVXA 1OAYL 4LCCB 3U30B 3ET9F 4ESKA 3VWJD 1R0AL 2BJMH 2GJ6B 1UGNA 2ZPKL 4DUXA 1A7BA 2LTQC 2AS5M 1QLFA 1XF2A 4W68A 3HE7C 4IJ3B 3DO7B 2XNAB 4TOYH 4NC1E 1AE6L 2DYPA 4HF5H 4JHAH 1XMWA 5D1XD 1WAAA 4ZS7H 4GG8A 4K8RC 5SWSB 3UC0H 3H0TB 3T2NH 1G1YA 1U8NB 2P8MA 3EJZC 4UINH 1A9EB 5DVLA 2E27H 2WBWB 5FB8B 1XF5B 4ODTL 5DO2D 2DN7A 4RISH 4P5TC 3CPLB 4YQXH 3WKNA 4MJID 2YD1A 3ZE2F 3C8HA 4OSUL 2ZG1A 1YEIH 1AGEA 3BD3A 1JPGB 4P46B 3TT3H 3H7LA 4HH9B 3EHBC 4KROB 4PJAE 4LHQB 4F33B 3JV6B 1E4KA 1XEDA 3DMMA 4FQXD 2DI8A 5L88L 5C0EB 4ZPTB 2CUIA 2YHGA 4Z95H 3ZDZF 2VLLB 5EG6C 3BGFB 4HIJA 3WDJA 4E41E 1IQWH 2NLJB 4W4OA 2ZUUA 3ZSTA 3JBG7 1R3HB 1QNZH 2X4RA 1P5VA 1DANT 3MLPA 3SKUD 2Z8SA 4JG1H 4OCRL 2ICCA 3RWCB 2XA3A 2HFFB 4MJ2A 2CDEA 3GMRA 1WTGT 4Y16A 3EYVA 3WMSA 4KI1A 2P47B 1BQHA 4OZFB 1DN2A 1F58L 2P5WB 4UDTA 3ULSA 1MIMH 1DVFD 4L3EE 5IW6B 1ES0A 2ENSA 3OKNB 5DMIL 1IAOB 5AUMA 1EEUA 3FN0L 5JOFA 4JM2F 3UTOA 2B0SL 4O5LL 2IBGA 5EFIB 3DVIA 2VABB 4Z7WB 4M7JH 4PLJD 3KPNA 4UAOB 1FNLA 2NW2B 3VXRA 2HFGL 4JANA 4NKOB 5A16B 5A3IC 3DLQR 2UWEF 4PY8I 2CLZA 4QHUB 1QBML 4FNLL 4OZ4B 3UJIL 5DYOB 4DN3L 4X6CE 4XNQB 5FXCH 3MCLL 3QUZD 2BVPB 1I9RL 1MHCB 3MUZ1 3QUYC 1I3VA 4JFYA 5DEFB 1D6VL 1URLA 4F9PA 3F12A 3WS3A 3RTQA 5E8NA 5J13B 1OP5H 3GSOA 2C3VB 3HZVA 3MUY1 2DTMH 4CJ1A 1LEIB 1UEMA 1Z0NA 4U6HB 1MI5A 4L29B 5FGCE 5IT2H 3GSWA 4PD4K 3O6LH 4YPGB 4UV7L 4JREC 3X3GL 1T83A 4ETQB 3VD3A 4Q9QH 2C3HA 5D7LD 1KEGL 2YBRB 4OM0H 1KB5H 4DVBA 3CCHA 4ODXB 1WBYB 1HIMH 3W9EB 2QSTA 1ZT4B 5EZJB 5CBAB 4RGNB 4HS3A 3K80A 4NO2B 3AROA 3QQ3A 4PLKC 1NMCB 1A7QL 1J8HD 4PJ9B 4YIQA 1D5BB 4YHKL 5E2JA 5GSRB 3FTGB 2YKLL 3U36B 2G2RA 2VOTA 2UZXB 3QDAA 1CIUA 3F6LA 2OZ4H 3FZUC 2DM2A 1GGTA 4MNGE 25C8H 3JVGC 1K6QH 2YN5A 5CCKH 1FSKB 2YUXA 3O6MH 4DN4L 5D1QA 3KXFE 1CDYA 2MPAL 3CMOH 4DUVA 2W91A 1MFBH 5C6TH 4Y1AD 5DD0L 4RBPH 7FABH 4R4NC 4KDWA 4OGZA 3UBXA 3MQIA 1FC1A 1LO0H 2X4QB 1KPRA 4YZFE 4LNRB 4XCCL 2PO6B 3MRKA 3SQOL 1VFUA 2HJFA 3P9LA 4YDIH 1S7VA 3ZYOA 3RU8H 4K3HA 1JGEA 3EGSA 2J7LA 2KBGA 3BZDA 2IFFL 2OL3L 5L2KE 5IHUL 5DJZB 1KT2B 1RZGA 3MLWH 5E8DL 3Q3GB 2FNBA 5IB4A 2NYYC 2ESVA 1P1ZA 5EBWB 1A02N 3MLTB 4PJXF 4E9LA 4WW1B 3RGVB 2W9LA 3WIIL 4EKXA 3GI8H 2B4CH 3QFJE 4RMQA 4RQQA 5CEZL 2FR4A 3WJJC 4YO0A 1AY1H 2EDHA 4JZJB 3TBWB 1N6VA 2X89D 4JPIB 1WGOA 4X0KB 2DM3A 4ZQKA 4NZTL 4UQ3A 4WWKA 3WNPA 1C5CH 2YUVA 4XAWL 4MD4A 3W0WB 2R29H 5CMAA 2WWMD 3FHAA 4X6BA 3NBNA 3U4EA 1YNKL 2GW5A 4F9LC 2FZ3B 5TPWH 2VXTH 3DNKA 4LSVL 2FB4L 3M1BA 4LKXA 3OV6A 5I71B 2UYLB 1DDHA 4OCWL 5D96B 3VG0H 2HLFC 2AKRB 1MNUL 3AS0A 2PYEB 4JFFA 4BQ6A 1Q9KA 8CGTA 3GFUA 1HHKA 3MRDA 3MC0A 5JW3L 3SCMD 1N59B 4DQOH 3BKCL 1PG7W 3ARBD 4QY8A 1E27A 3TIDA 4MAUH 5DJ2B 2VLJB 2YD5A 1N2RA 1DJSA 4XBPB 1HSBA 5IM7B 1CBVH 5IB1B 5IFJA 5J6HB 5IOPA 3LY6A 1U3HD 3IAGC 4GKZA 5IV2A 5HGGS 3DOSA 2PCPB 5DT1L 4UT6H 3MRRA 4ORZC