5IG4A

Crystal structure of n. vectensis camkii-a hub
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
129
Chain Sequence
TAKVREQEIIRLTQKLITSITTGDYDTYSKLVDPHVTCFEPFSNGNLVEGLEFHKFYFDNTLSKVPINTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFHISGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Predicted protein
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Transferase
total genus 34
structure length 129
sequence length 131
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig4A00
1Q42A 2YFLB 4XB5A 1O7WB 5D81A 1ISKA 2GXFA 3MG3A 3K7CA 3EBYA 1JB5A 3JUQA 1OGZA 4STDA 7STDA 3K0ZA 5IENA 1CQSA 3DUKA 1E3RA 3T8UA 1OGXA 1GY7A 4PEJA 5KP4A 2RGQA 5CF2A 1TP6A 3D9RA 1Q40A 4XBYA 2HMNB 2W2CA 3MG1A 2GEYA 3EF8A 4WYKA 1JKGA 5IEOA 5EVHA 3NBRA 1ULIB 3ROBA 2F99A 3MSOA 3GZXB 4LEHA 1IDPA 1O7GB 2BNGA 4FCMA 1Q40B 3EN8A 3CU3A 1JB4A 1QMAA 2B1XB 2HMJB 4WYKB 3CNXA 1JKGB 3B4PA 1C7HA 3B8LA 1W6YA 5CF1A 1NDOB 5IG3A 3LYGA 1GS3A 3A76A 5IG0A 3RGAA 3FKAA 5DREA 3NUVA 2XR8B 3T8NA 3GWRA 1DMNA 5FW5A 4H3UA 3MG2A 3B7CA 3OWUA 1BUQA 4HM2B 3GZRA 1SJWA 2STDA 1AR0A 1OPYA 2XSOB 1U5OA 3FGYA 1EA2A 3F14A 3FF0A 3F8HA 5AEWB 4MJDA 3KSPA 4XBXA 4HVNA 3HZPA 4FCJA 3SOYA 2XSHB 5AI1A 5IEPA 4J8TA 4HKVB 4GB5A 3NV0A 4X2OA 3I0YA 3KZTA 1OHSA 2BMQB 2QIYA 3EHCA 4WP5A 2INXA 2GBWB 1W00A 2Z76A 3IPTA 4I4KA 5IERA 2A15A 3RGRA 1STDA 4HM6B 3OX9A 3G0KA 2CKFB 2F86B 1OHPA 4K1VA 5G2GA 3M8CA 3EX9A 3DM8A 4ORLA 1GY5A 3NV0B 3G16A 2BMOB 4R9LA 4K1UA 1ZX2A 4HM1B 5AEUB 3FH1A 3OV4A 1ZO2A 3JUPA 2HMMB 4XDVA 1GY6A 4HM0B 5D82A 3HX8A 5STDA 3GZBA 1O7NB 1GYBA 3E99A 4OVMA 3HK4A 5JPPA 3H3HA 2RFRA 1NWWA 3F7XA 5TGNA 4XBTA 1ULJB 2RCDA 4IIAA 5DRVA 3DXOA 4X2HA 4LMIA 3F40A 1WQLB 5CXOA 3JUOA 4R9KA 5CK6A 4N3VA 4WWUC 2UX0A 3S5CA 3NM2A 2HMOB 5IG4A 4HM8B 1OHOA 1W02A 4HM4B 4LGQA 5BVBA 4HZBB 2GBXB 3BB9A 1JN5A 4L7KA 3JUNA 1O7MB 5AIGA 1O7HB 4HM7B 3SEDA 4HM5B 2CHCA 1VZZA 2OWPA 3B4OA 3GRDA 4XM4A 3CNMA 1K41A 3F9SA 3EQQB 3VGNA 4L8PA 1OCVA 1UUWB 3JUMA 5D83A 3MHEA 4R1KA 5AIFA 1JN5B 5CLKA 2B24B 2JQ5A 2K54A 3BLZA 3EBTA 2YFJB 1Z1SA 3EC9A 8CHOA 5BXQA 4J9AA 5KP3A 3DMCA 4HZ9B 3FLJA 1S5AA 3F7SA 1JB2A 3LZAA 3FF2A 1UUVB 4RZMA 3KE7A 1OUNA 2GEXA 2I9WA 3UNLA 5AIHA 3MYTA 3OWSA 4OUQA 1NU3A 3FZWA 1OF5A 3STDA 2PZVA 1A2KA 2IMJA 2HMLB 5KP1A 3NXJA 5IG5A 2Z77A 4Q53A 1E3VA 3SOAA 3GZYB 2XRXB 3MKIA 1EG9B 3EN1B 5HGRA 1O7PB 3G8ZA 5AIIA 3ER7A 3NHXA 2Z7AA 4KVHA 3F8XA 3DZLA 3UJMA 3OXAA 2QGUA 4XDWA 1TUHA 1OF5B 4CDLA 5IF6A 3ECFA 4HJLB 3OWYA 3Q90A 3FSDA 1ASKA 2BMRB 3WMDA 6STDA 3EJVA 3CPOA 4L8OA 3KKGA 1HKXA 2F98A 3H51A 2HMKB 1W01A 2R4IA 4HM3B 2YFIB 4U13A 1DMMA 1OH0A 1DMQA 1E97A 5JPUA 3VSYA 1QJGA
chains in the Genus database with same CATH superfamily
3LOYA 2RNTA 1W6GA 1Q42A 2YFLB 1VQ63 4XB5A 1LOWA 1CH0A 1O7WB 1LVNA 2CG0A 4GL6A 5D81A 1IU7A 2GXFA 3ALAA 3OW22 1ISKA 4BIRA 1KC84 3MG3A 1TU5A 1BRGA 1GD4A 3K7CA 1B3SA 3LTDA 3D5IA 3AMOB 3EBYA 3LMLA 1RCLA 1JB5A 3JUQA 1OGZA 4STDA 1AV4A 2P0XA 7STDA 5M19A 3K0ZA 1UW1A 4IPBA 2QEX3 3KFQC 1F8NA 2IYJA 2IY2A 2E2TA 5EQLA 1VQP3 2XEPA 5IENA 3NQZA 1CQSA 1TRQA 7GSPA 3DUKA 3S27A 1E3RA 3X3XA 3T8UA 1N8QA 1FA3A 1OGXA 1GY7A 3WHOA 3BNEA 2RBIA 4PEJA 1GD3A 3JVCA 1BNSA 3U97A 4FMBA 5KP4A 1EQKA 1PYLA 2ML6A 2RGQA 1D6YA 1B2MA 1BIRA 2D1WA 4WHAA 4KFFA 5CF2A 4AKZA 3PYJA 1TP6A 1NO3A 3RNTA 1BNRA 2CFDA 3MPHA 3D9RA 3U1WA 3BNBA 1M904 1Q40A 1UDII 4MEIA 4XBYA 2CFGA 3CC43 3D5GA 2K0MA 1RJOA 1IVWA 2HMNB 2W2CA 3MG1A 1N8R4 1VQO3 2GEYA 3DGNA 1BNEA 4EXRA 1MOLA 3EF8A 1MWTA 3CCU3 1NNVA 4WYKA 2FGTA 2UUGC 1JKGA 5IEOA 1BANA 4KZ1A 5EVHA 3NBRA 5HOHA 1UGHI 1BAOA 2CIUA 1JZOA 1UI8A 1ULIB 3ROBA 2F99A 3MSOA 3PXMA 4N6LA 4KT3B 3GZXB 4K61A 4LEHA 3UL5A 1IDPA 1O7GB 3K5TA 3EE1A 3CCS3 1LNHA 2BNGA 2AAEA 1GSPA 4BU4A 1DVCA 1QVG2 1EUIC 4FCMA 2CC3A 3IJEB 5M1AA 1PU4A 2IUKA 1Q40B 4N6MA 1IVVA 2OTJ3 1SPUA 3V98A 2ZL8A 1BRNL 3EN8A 1UCLA 3NX0A 3CU3A 2OTL3 1A67A 1JB4A 3I553 1K8A4 3FG3A 3ZG0A 1QMAA 3DGMA 4JRFA 4BL3A 1BUJA 1X1UA 2B1XB 2HMJB 4WYKB 3CNXA 1JKGB 5M18A 8RNTA 3SLUA 3AGNA 1VQ53 5AYSC 3X3YA 3B4PA 3DH2A 1C7HA 3SX1A 3FG4A 1ZGXA 1BGSA 1RGHA 2W56A 3B8LA 1G0TA 4NHFA 1W6YA 1FGQA 1NDOB 5CF1A 6RNTA 2H0HA 5IG3A 1FUWA 2WOFA 1RKYA 1BRIA 1WMOA 3LYGA 1Q814 1BU4A 1LOYA 1GS3A 1EEJA 3A76A 3KCHA 5IG0A 3CC23 3RGAA 3WOEB 3FKAA 5DREA 1WTHA 1OACA 1IV7A 1IVXA 3AMOA 1BNFA 1SIIA 2XR8B 3NUVA 4N6V0 1FW7A 1D6UA 3ZFZA 1DETA 1UCKA 1YGWA 3GWRA 2ZHXB 2OQEA 1DMNA 4N6UA 3RDEA 3L0RA 3SXXA 3X3ZA 3LTBA 5FW5A 4H3UA 6GSPA 3MG2A 4QWTA 1JV2B 3B7CA 3OWUA 2BIRA 2KF6A 2W6JH 3T8NA 4HM2B 2W9PA 3WA2X 1BUQA 1MGWA 1AQZA 3NQYA 3GZRA 3PCRA 3D79A 3NBJA 1QAKA 1W5ZA 1SJWA 2SARA 3KIIA 4KFDA 3DY5A 1B2UA 1BNIA 1RLSA 1BOXA 4I5QA 4AEQA 2GU1A 2STDA 1NB5I 1AR0A 1N9EA 2W04A 2P05A 4FMAA 1OPYA 3KN4A 2XSOB 1YJW3 1U5OA 3FGYA 1QVF2 1EA2A 3F14A 4HAAA 1VQ43 1BSAA 4G1MB 1KSIA 3FF0A 3V99A 1BRHA 3F8HA 4EV5A 3BU4A 1U8CB 5AEWB 4MJDA 2QA43 1RCKA 2F5MA 3KSPA 1FYSA 2WGOA 3UB1A 4FMDA 4XBXA 4HVNA 1IQYA 1STFI 2AADA 4HBRA 4OK0A 1T3BA 4EV2A 3HZPA 2HOHA 4FCJA 3SOYA 2GSPA 3GAXA 3G4S3 3CCM3 1TTOA 2XSHB 3NM7A 5AI1A 2L4VA 5IEPA 1KQS2 4J8TA 1W7CA 3HOHA 1QAFA 2CFLA 4HKVB 1CEWI 4GB5A 1BSEA 2W03A 3NV0A 4RBNA 4X2OA 3CCV3 3I0YA 3KZTA 1OHSA 2BU4A 4RNTA 2BMQB 2QIYA 2MF7A 3EHCA 4WP5A 2INXA 1BRJA 2GBWB 1W00A 2Z76A 1RSNA 3IPTA 2F56A 1YHQ3 1RN1A 1JRQA 3TDGA 2E2VA 4BL2A 3LT9A 1TFKA 4DKIA 4I4KA 3CCQ3 2P09A 5IERA 2A15A 3RGRA 2CX1A 4J5GA 2H0IA 1VQN3 1STDA 4HM6B 1IYYA 1RGKA 2ZA4A 1MNLA 3OX9A 3G0KA 3X40A 1FUTA 2CKFB 2F86B 3ZG5A 1OHPA 3GSPA 1YNVX 2K3DA 4K1VA 5G2GA 3N8BA 2OOVC 4R80A 3A5EA 3EX9A 3M8CA 1FGOA 1RDSA 1B21A 2XH9A 3DM8A 2IUJA 4ORLA 1R4YA 1GY5A 3NV0B 5EEOA 1B27A 1IVUA 2F4YA 2D42A 4O02B 3CME3 3G16A 2BMOB 2ML5A 4R9LA 1YVSA 1QALA 1NJI4 1LXEA 4N6TA 1J2BA 1PY3A 4K1UA 1CYVA 7RNTA 1ZX2A 4HM1B 2UGIA 5AEUB 3FH1A 3OV4A 3EB8A 1ZO2A 2H0GA 2LQVA 4N6OB 2GU3A 3JUPA 1BRSA 5GSPA 1M1XB 3URPA 4CJNA 2HMMB 4XDVA 2BT3A 1YVBI 1GY6A 1LRAA 1M9GA 3WODG 4HM0B 3LTCA 3O8YA 5D82A 1RHLA 3HX8A 5STDA 3GZBA 2XFTA 1R4CA 1VQQA 1O7NB 1JNQA 1RNBA 5IW9A 1GYBA 1VQL3 3E99A 4HOHA 4OVMA 2IA7A 4JF8A 3HK4A 1UI7A 5JPPA 2RSXA 2KF3A 4LYLB 1JBRA 1YIJ3 3H3HA 1T2HA 1RMSA 3PGBA 2C11A 2RFRA 1NWWA 2XFSA 3Q2PA 3KSED 3F7XA 4KFEA 4N6NB 4XBTA 1ULJB 5TGNA 3G713 2RCDA 1YI23 1MWSA 4IIAA 5DRVA 3DXOA 1B2SA 1VQK3 1LQMB 4X2HA 2CFKA 3X42A 2CWVA 1BRKA 4LMIA 1BNJA 3F40A 3MWZA 1WQLB 3UL6A 2Z6BA 1RGGA 2F5WA 1RGFA 4R4KA 1Q7HA 2E2UA 1WMPA 5CXOA 1A2PA 1B20A 2WOHA 3JUOA 1N5HA 3BNDA 2CWUA 1BVIA 4R9KA 1T5YA 4H61A 5CK6A 3K63A 1M1K4 3WDGB 1I3IA 4N3VA 5G1KA 3BIRA 3I563 2V1LA 2M7OA 2XF3A 4WWUC 2UX0A 3AHWA 3S5CA 3NM2A 4GSPA 4EYCA 3LH4A 2HMOB 4FCZA 5IG4A 1RNTA 1LOXA 3QRDA 4HM8B 3CMA3 1FGRA 4BTXA 1OHOA 1W02A 3X41A 3CXC2 3CPW2 4HM4B 4LGQA 5BVBA 4HZBB 1B2ZA 2GBXB 3CCE3 1I2FA 3BB9A 1D6ZA 1JN5A 4L7KA 1RRLA 4FR9A 1SIHA 1WMNA 2O9UX 1JBTA 1PFPA 4O3VA 1BNGA 2P0MA 3D3LA 1RGCA 3JUNA 1T2IA 1MWUA 3Q1CA 1O7MB 1UCJA 1O7HB 5AIGA 3T0UA 5RNTA 4HM7B 1RTUA 2OCTA 3SEDA 1GMRA 1SQWA 3DGYA 1V57A 4RNZA 1ZS7A 2CW9A 3LXUX 1BSDA 4HM5B 2CHCA 4HYZA 3CD63 1US1A 1VZZA 2OWPA 3B4OA 3GRDA 1N5PA 2P38A 4XM4A 3WA3A 1YJ93 1IQ8A 3FCSB 3CNMA 1K41A 3F9SA 3CCL3 1Q864 3EQQB 2W9QA 3VGNA 4L8PA 1LQGC 5A0OB 1OCVA 1UUWB 2CG1A 3JUMA 1FZUA 5D83A 5JBSA 3MHEA 4R1KA 1CYUA 5AIFA 1IK3A 1Y4KA 1JN5B 1AVLA 2O3OA 4WFOA 4EC6A 2R41A 2YX9A 5CLKA 2B24B 2JQ5A 5LC6A 2K54A 3BLZA 1W6CA 4BTYA 1B2XA 2KXGA 3K9MC 3EBTA 4MMXB 1FUSA 1Z1SA 2YFJB 3EC9A 1I0XA 8CHOA 1JBSA 5I97A 2Y73A 1N9JA 5BXQA 2KF5A 4J9AA 1VQM3 5KP3A 1YJN3 3DMCA 3CC73 1UCIA 1X1YA 1HYFA 2OQEC 4K90B 4HZ9B 3CCJ3 1GMPA 3FLJA 1S5AA 3F7SA 1UUGB 1RN4A 3S29A 1JZDA 1JB2A 1L5GB 3LZAA 3FF2A 2BO9B 1GOVA 1UUVB 1W4NA 1AVKA 2CH9A 2FXTA 3PS8A 4RZMA 9RNTA 3AHSA 1Q7Y4 3KE7A 2L1SA 3QK9A 1I2GA 4MMZB 1KWIA 1ROVA 2KCDA 1OUNA 4ZM8A 1BSCA 3S28A 2GEXA 1K734 2I9WA 3UNLA 1FGTA 1RGLA 5AIHA 1X1WA 3HI7A 3G6E3 1DE3A 3MYTA 3OWSA 1W2B2 1LOVA 2BHMA 2CFWA 4OUQA 4IT7A 2FNQA 1NU3A 3FZWA 3NBBA 1HZ1A 1I8VA 1OF5A 3STDA 2PZVA 1A2KA 2CX0A 2IMJA 1BSBA 2HMLB 3HIIA 3IMAB 3NXJA 2Z77A 1G96A 5IG5A 5KP1A 3SYUA 4Q53A 1TJDA 1E3VA 2XGLA 5FGOA 5ELJA 2Q07A 3SOAA 3GZYB 1W2ZA 2C4BA 1HU9A 2WO0A 2XRXB 1UGIA 1ROAA 2J8XB 4CPKA 2LYXA 2CWTA 1Q9EA 3CCR3 3MKIA 2MC8A 1EG9B 1I2EA 3EN1B 5HGRA 5BIRA 5BU4A 1K9M4 1O7PB 1DYUA 1IT8A 3G8ZA 1GOYA 2Y74A 2PNCA 4BTWA 5AIIA 3N9HA 3J7Yd 1V58A 3ER7A 1Q824 3NHXA 1TRPA 2XGNA 2Z7AA 4KVHA 1K28A 4NPBA 3F8XA 3DZLA 2KAAA 3LT8A 1GMQA 3UJMA 5LC7A 2ZDJA 3OXAA 2QGUA 3DGLA 4XDWA 1VQ73 2SBLA 1TUHA 1I70A 3LTAA 1OF5B 3PZWA 3FG1A 5AYRB 4CDLA 5IF6A 1IV9A 3ECFA 4TX4A 2KF4A 1IQXA 1GOUA 3VF1A 1IT7A 1RRHA 4HJLB 1DVDA 3OWYA 4EW5A 1RGEA 3Q90A 3V92A 1KD14 3FSDA 1EKMA 3HIGA 2WGQA 3PCSA 1NB3I 4FMCA 1ASKA 2BMRB 1AY7A 1JJ22 4AKYA 1LNIA 3N54B 5G1LA 1V74A 2W0QA 3AGOA 5ELUA 2OOVA 1A2VA 1G02A 4MMYB 2CK3H 1MWRA 1MGRA 1VQ83 3S67A 3WMDA 6STDA 4LSOA 4J5KA 3Q3FA 3DGOA 3EJVA 1VQ93 2KRTA 3CPOA 4RNYA 2C10A 1I0VA 4ILFA 4L8OA 1YGEA 3WR2A 1A90A 3KKGA 4GHOA 3BNCA 1SARA 4LZIA 1HKXA 1S723 4EBGA 1YIT3 4O2HA 2F98A 3H51A 2JDIH 1TIJA 3D4AA 3WOFB 4O8SA 1C54A 2HMKB 4CCVA 1TFOA 1W01A 2R4IA 4HM3B 2YFIB 4U13A 3SVAA 1DMMA 1RGAA 1WNHA 2W56B 4NREA 1OH0A 1DMQA 1E97A 5JPUA 1X1XA 1I3FA 3VSYA 1QJGA 1RN7A 1FGMA
chains in the Genus database with same CATH topology
3LOYA 1W6GA 1Q42A 2YFLB 1VQ63 4XB5A 1O7WB 1LVNA 2CG0A 4GL6A 5D81A 1IU7A 2GXFA 3ALAA 3OW22 1ISKA 1KC84 3MG3A 1TU5A 1GD4A 3K7CA 3LTDA 3AMOB 3EBYA 3LMLA 1JB5A 3JUQA 1OGZA 4STDA 1AV4A 2P0XA 7STDA 3K0ZA 1UW1A 4IPBA 2QEX3 3KFQC 1F8NA 2E2TA 5EQLA 1VQP3 2XEPA 5IENA 3NQZA 1CQSA 3DUKA 3S27A 1E3RA 3X3XA 3T8UA 1N8QA 1FA3A 1OGXA 1GY7A 3BNEA 4PEJA 1GD3A 3JVCA 3U97A 4FMBA 5KP4A 1EQKA 2ML6A 2RGQA 1D6YA 2D1WA 4WHAA 4KFFA 5CF2A 4AKZA 3PYJA 1TP6A 1NO3A 2CFDA 3MPHA 3D9RA 3U1WA 3BNBA 1M904 1Q40A 4MEIA 4XBYA 2CFGA 3CC43 2K0MA 1RJOA 1IVWA 2HMNB 2W2CA 3MG1A 1N8R4 1VQO3 2GEYA 3DGNA 4EXRA 1MOLA 3EF8A 3CCU3 4WYKA 2FGTA 1JKGA 5IEOA 4KZ1A 5EVHA 3NBRA 2CIUA 1UI8A 1ULIB 3ROBA 2F99A 3MSOA 3PXMA 4N6LA 3GZXB 4K61A 4LEHA 3UL5A 1IDPA 1O7GB 3K5TA 3EE1A 3CCS3 1LNHA 2BNGA 1QVG2 1DVCA 4FCMA 2CC3A 3IJEB 1PU4A 2IUKA 1Q40B 4N6MA 1IVVA 2OTJ3 1SPUA 3V98A 2ZL8A 3EN8A 3NX0A 3CU3A 2OTL3 1A67A 1JB4A 3I553 1K8A4 3FG3A 1QMAA 3DGMA 4JRFA 2B1XB 2HMJB 4WYKB 3CNXA 1JKGB 3SLUA 1VQ53 5AYSC 3B4PA 1C7HA 3SX1A 3FG4A 3B8LA 2W56A 4NHFA 1W6YA 1FGQA 1NDOB 5CF1A 5IG3A 1FUWA 2WOFA 1RKYA 1WMOA 3LYGA 1Q814 1GS3A 3A76A 5IG0A 3CC23 3RGAA 3WOEB 3FKAA 5DREA 1WTHA 1OACA 1IV7A 1IVXA 3AMOA 2XR8B 1SIIA 3NUVA 4N6V0 1D6UA 3T8NA 3SXXA 3GWRA 2OQEA 3X3YA 1DMNA 4N6UA 3RDEA 3L0RA 3X3ZA 3LTBA 5FW5A 4H3UA 3MG2A 4QWTA 1JV2B 3B7CA 3OWUA 2W6JH 1BUQA 4HM2B 2W9PA 3WA2X 3NQYA 3GZRA 3PCRA 3NBJA 1QAKA 1W5ZA 1SJWA 3KIIA 4KFDA 3DY5A 4AEQA 2GU1A 2STDA 1NB5I 1AR0A 1N9EA 2W04A 2P05A 4FMAA 1OPYA 3KN4A 2XSOB 1YJW3 1U5OA 3FGYA 1EA2A 3F14A 1VQ43 4G1MB 1KSIA 3FF0A 3V99A 3F8HA 1QVF2 4EV5A 5AEWB 1U8CB 4MJDA 2QA43 3KSPA 2WGOA 3UB1A 4FMDA 4XBXA 4HVNA 1IQYA 1STFI 4HBRA 4OK0A 4EV2A 3HZPA 4FCJA 3SOYA 3GAXA 3G4S3 3CCM3 2XSHB 3NM7A 5AI1A 2L4VA 5IEPA 1KQS2 4J8TA 1W7CA 4HKVB 1QAFA 2CFLA 1CEWI 4GB5A 2W03A 3NV0A 4RBNA 4X2OA 3CCV3 3I0YA 3KZTA 1OHSA 2BMQB 2QIYA 2MF7A 3EHCA 4WP5A 2INXA 2GBWB 1W00A 2Z76A 3IPTA 1YHQ3 3TDGA 1JRQA 2E2VA 3LT9A 1TFKA 3CCQ3 4I4KA 2P09A 5IERA 2A15A 3RGRA 1VQN3 1STDA 4HM6B 1MNLA 3OX9A 3G0KA 3X40A 2CKFB 2F86B 1OHPA 4K1VA 5G2GA 3N8BA 2OOVC 4R80A 3M8CA 3EX9A 1FGOA 2XH9A 3DM8A 2IUJA 4ORLA 1GY5A 3NV0B 5EEOA 1IVUA 2D42A 4O02B 3CME3 3G16A 2BMOB 2ML5A 4R9LA 1QALA 1NJI4 1LXEA 4N6TA 1J2BA 4K1UA 1CYVA 1ZX2A 4HM1B 5AEUB 3FH1A 3OV4A 3EB8A 1ZO2A 2LQVA 4N6OB 2GU3A 3JUPA 1M1XB 2HMMB 4XDVA 2BT3A 1YVBI 1GY6A 3WODG 1M9GA 4HM0B 3LTCA 3O8YA 5D82A 3HX8A 5STDA 3GZBA 2XFTA 1R4CA 1O7NB 1JNQA 5IW9A 1GYBA 1VQL3 3E99A 4OVMA 2IA7A 4JF8A 3HK4A 1UI7A 5JPPA 2RSXA 1YIJ3 3H3HA 3PGBA 2C11A 2RFRA 1NWWA 2XFSA 3Q2PA 3KSED 3F7XA 4KFEA 4N6NB 4XBTA 1ULJB 5TGNA 3G713 2RCDA 1YI23 4IIAA 5DRVA 3DXOA 1VQK3 4X2HA 2CFKA 3X42A 2CWVA 4LMIA 3F40A 3MWZA 1WQLB 3UL6A 2Z6BA 4R4KA 2E2UA 1WMPA 5CXOA 2WOHA 3JUOA 1N5HA 3BNDA 2CWUA 4R9KA 5CK6A 1T5YA 4H61A 3K63A 1M1K4 3WDGB 4N3VA 3I563 2V1LA 2XF3A 2M7OA 4WWUC 2UX0A 3S5CA 3NM2A 4EYCA 3LH4A 2HMOB 4FCZA 5IG4A 1LOXA 3QRDA 4HM8B 3CMA3 1FGRA 4BTXA 1OHOA 1W02A 3X41A 3CXC2 3CPW2 4HM4B 4LGQA 5BVBA 4HZBB 2GBXB 3CCE3 3BB9A 1D6ZA 1JN5A 4L7KA 1RRLA 4FR9A 1SIHA 1WMNA 2O9UX 1PFPA 4O3VA 3D3LA 2P0MA 3JUNA 3Q1CA 1O7MB 5AIGA 1O7HB 3T0UA 4HM7B 2OCTA 3SEDA 1SQWA 4RNZA 2CW9A 3LXUX 4HM5B 2CHCA 4HYZA 3CD63 1US1A 1VZZA 2OWPA 3B4OA 3GRDA 1N5PA 2P38A 4XM4A 3WA3A 1YJ93 1IQ8A 3FCSB 3CNMA 1K41A 3F9SA 3CCL3 1Q864 3EQQB 2W9QA 3VGNA 4L8PA 5A0OB 1OCVA 1UUWB 2CG1A 3JUMA 5D83A 5JBSA 3MHEA 4R1KA 1CYUA 5AIFA 1IK3A 1Y4KA 1JN5B 1AVLA 2O3OA 4WFOA 4EC6A 2YX9A 5CLKA 2B24B 2JQ5A 5LC6A 2K54A 3BLZA 1W6CA 4BTYA 2KXGA 3K9MC 3EBTA 4MMXB 2YFJB 1Z1SA 3EC9A 8CHOA 5I97A 2Y73A 1N9JA 5BXQA 4J9AA 1VQM3 1YJN3 5KP3A 3DMCA 3CC73 2OQEC 4K90B 4HZ9B 3CCJ3 3FLJA 1S5AA 3F7SA 3S29A 1JB2A 1L5GB 3LZAA 3FF2A 2BO9B 1UUVB 2CH9A 1W4NA 1AVKA 3PS8A 2FXTA 4RZMA 1Q7Y4 3KE7A 3QK9A 4MMZB 1KWIA 1ROVA 2KCDA 1OUNA 4ZM8A 3S28A 1K734 2GEXA 2I9WA 3UNLA 1FGTA 5AIHA 3HI7A 3G6E3 3MYTA 3OWSA 1W2B2 2BHMA 2CFWA 4OUQA 4IT7A 2FNQA 1NU3A 3FZWA 3NBBA 1OF5A 3STDA 2PZVA 1A2KA 3HIIA 2IMJA 2HMLB 3IMAB 5KP1A 3NXJA 5IG5A 2Z77A 1G96A 4Q53A 1E3VA 2XGLA 5FGOA 5ELJA 2Q07A 3SOAA 3GZYB 1W2ZA 2WO0A 1HU9A 2XRXB 1ROAA 2LYXA 2CWTA 3CCR3 3MKIA 2MC8A 1EG9B 3EN1B 5HGRA 1K9M4 1O7PB 1DYUA 1IT8A 3G8ZA 2Y74A 2PNCA 4BTWA 5AIIA 3N9HA 3J7Yd 3ER7A 1Q824 3NHXA 2XGNA 2Z7AA 4KVHA 1K28A 3F8XA 3DZLA 3UJMA 3LT8A 5LC7A 2ZDJA 3OXAA 2QGUA 3DGLA 4XDWA 1VQ73 2SBLA 1TUHA 3LTAA 1OF5B 3PZWA 3FG1A 5AYRB 4CDLA 5IF6A 1IV9A 3ECFA 4TX4A 1IQXA 3VF1A 1IT7A 1RRHA 4HJLB 1DVDA 3OWYA 3Q90A 3V92A 1KD14 3FSDA 1EKMA 3HIGA 2WGQA 3PCSA 1NB3I 4FMCA 1ASKA 2BMRB 1JJ22 4AKYA 3N54B 1V74A 2W0QA 5ELUA 2OOVA 1A2VA 4MMYB 2CK3H 1VQ83 3S67A 3WMDA 6STDA 4LSOA 3DGOA 3EJVA 1VQ93 2KRTA 3CPOA 4RNYA 2C10A 4L8OA 1A90A 1YGEA 3KKGA 4LZIA 3BNCA 1S723 1HKXA 4EBGA 1YIT3 4O2HA 2F98A 3H51A 2JDIH 1TIJA 3WOFB 4O8SA 2HMKB 4CCVA 1TFOA 1W01A 2R4IA 4HM3B 2YFIB 4U13A 3SVAA 1DMMA 1WNHA 2W56B 4NREA 1OH0A 1DMQA 1E97A 5JPUA 3VSYA 1QJGA 1RN7A 1FGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q42 A;  2YFL B;  4XB5 A;  1O7W B;  5D81 A;  1ISK A;  2GXF A;  3MG3 A;  3K7C A;  3EBY A;  1JB5 A;  3JUQ A;  1OGZ A;  4STD A;  7STD A;  3K0Z A;  5IEN A;  1CQS A;  3DUK A;  1E3R A;  3T8U A;  1OGX A;  1GY7 A;  4PEJ A;  5KP4 A;  2RGQ A;  5CF2 A;  1TP6 A;  3D9R A;  1Q40 A;  4XBY A;  2HMN B;  2W2C A;  3MG1 A;  2GEY A;  3EF8 A;  4WYK A;  1JKG A;  5IEO A;  5EVH A;  3NBR A;  1ULI B;  3ROB A;  2F99 A;  3MSO A;  3GZX B;  4LEH A;  1IDP A;  1O7G B;  2BNG A;  4FCM A;  1Q40 B;  3EN8 A;  3CU3 A;  1JB4 A;  1QMA A;  2B1X B;  2HMJ B;  4WYK B;  3CNX A;  1JKG B;  3B4P A;  1C7H A;  3B8L A;  1W6Y A;  5CF1 A;  1NDO B;  5IG3 A;  3LYG A;  1GS3 A;  3A76 A;  5IG0 A;  3RGA A;  3FKA A;  5DRE A;  3NUV A;  2XR8 B;  3T8N A;  3GWR A;  1DMN A;  5FW5 A;  4H3U A;  3MG2 A;  3B7C A;  3OWU A;  1BUQ A;  4HM2 B;  3GZR A;  1SJW A;  2STD A;  1AR0 A;  1OPY A;  2XSO B;  1U5O A;  3FGY A;  1EA2 A;  3F14 A;  3FF0 A;  3F8H A;  5AEW B;  4MJD A;  3KSP A;  4XBX A;  4HVN A;  3HZP A;  4FCJ A;  3SOY A;  2XSH B;  5AI1 A;  5IEP A;  4J8T A;  4HKV B;  4GB5 A;  3NV0 A;  4X2O A;  3I0Y A;  3KZT A;  1OHS A;  2BMQ B;  2QIY A;  3EHC A;  4WP5 A;  2INX A;  2GBW B;  1W00 A;  2Z76 A;  3IPT A;  4I4K A;  5IER A;  2A15 A;  3RGR A;  1STD A;  4HM6 B;  3OX9 A;  3G0K A;  2CKF B;  2F86 B;  1OHP A;  4K1V A;  5G2G A;  3M8C A;  3EX9 A;  3DM8 A;  4ORL A;  1GY5 A;  3NV0 B;  3G16 A;  2BMO B;  4R9L A;  4K1U A;  1ZX2 A;  4HM1 B;  5AEU B;  3FH1 A;  3OV4 A;  1ZO2 A;  3JUP A;  2HMM B;  4XDV A;  1GY6 A;  4HM0 B;  5D82 A;  3HX8 A;  5STD A;  3GZB A;  1O7N B;  1GYB A;  3E99 A;  4OVM A;  3HK4 A;  5JPP A;  3H3H A;  2RFR A;  1NWW A;  3F7X A;  5TGN A;  4XBT A;  1ULJ B;  2RCD A;  4IIA A;  5DRV A;  3DXO A;  4X2H A;  4LMI A;  3F40 A;  1WQL B;  5CXO A;  3JUO A;  4R9K A;  5CK6 A;  4N3V A;  4WWU C;  2UX0 A;  3S5C A;  3NM2 A;  2HMO B;  5IG4 A;  4HM8 B;  1OHO A;  1W02 A;  4HM4 B;  4LGQ A;  5BVB A;  4HZB B;  2GBX B;  3BB9 A;  1JN5 A;  4L7K A;  3JUN A;  1O7M B;  5AIG A;  1O7H B;  4HM7 B;  3SED A;  4HM5 B;  2CHC A;  1VZZ A;  2OWP A;  3B4O A;  3GRD A;  4XM4 A;  3CNM A;  1K41 A;  3F9S A;  3EQQ B;  3VGN A;  4L8P A;  1OCV A;  1UUW B;  3JUM A;  5D83 A;  3MHE A;  4R1K A;  5AIF A;  1JN5 B;  5CLK A;  2B24 B;  2JQ5 A;  2K54 A;  3BLZ A;  3EBT A;  2YFJ B;  1Z1S A;  3EC9 A;  8CHO A;  5BXQ A;  4J9A A;  5KP3 A;  3DMC A;  4HZ9 B;  3FLJ A;  1S5A A;  3F7S A;  1JB2 A;  3LZA A;  3FF2 A;  1UUV B;  4RZM A;  3KE7 A;  1OUN A;  2GEX A;  2I9W A;  3UNL A;  5AIH A;  3MYT A;  3OWS A;  4OUQ A;  1NU3 A;  3FZW A;  1OF5 A;  3STD A;  2PZV A;  1A2K A;  2IMJ A;  2HML B;  5KP1 A;  3NXJ A;  5IG5 A;  2Z77 A;  4Q53 A;  1E3V A;  3SOA A;  3GZY B;  2XRX B;  3MKI A;  1EG9 B;  3EN1 B;  5HGR A;  1O7P B;  3G8Z A;  5AII A;  3ER7 A;  3NHX A;  2Z7A A;  4KVH A;  3F8X A;  3DZL A;  3UJM A;  3OXA A;  2QGU A;  4XDW A;  1TUH A;  1OF5 B;  4CDL A;  5IF6 A;  3ECF A;  4HJL B;  3OWY A;  3Q90 A;  3FSD A;  1ASK A;  2BMR B;  3WMD A;  6STD A;  3EJV A;  3CPO A;  4L8O A;  3KKG A;  1HKX A;  2F98 A;  3H51 A;  2HMK B;  1W01 A;  2R4I A;  4HM3 B;  2YFI B;  4U13 A;  1DMM A;  1OH0 A;  1DMQ A;  1E97 A;  5JPU A;  3VSY A;  1QJG A; 
#chains in the Genus database with same CATH topology
 3LOY A;  2RNT A;  1W6G A;  1Q42 A;  2YFL B;  1VQ6 3;  4XB5 A;  1LOW A;  1CH0 A;  1O7W B;  1LVN A;  2CG0 A;  4GL6 A;  5D81 A;  1IU7 A;  2GXF A;  3ALA A;  3OW2 2;  1ISK A;  4BIR A;  1KC8 4;  3MG3 A;  1TU5 A;  1BRG A;  1GD4 A;  3K7C A;  1B3S A;  3LTD A;  3D5I A;  3AMO B;  3EBY A;  3LML A;  1RCL A;  1JB5 A;  3JUQ A;  1OGZ A;  4STD A;  1AV4 A;  2P0X A;  7STD A;  5M19 A;  3K0Z A;  1UW1 A;  4IPB A;  2QEX 3;  3KFQ C;  1F8N A;  2IYJ A;  2IY2 A;  2E2T A;  5EQL A;  1VQP 3;  2XEP A;  5IEN A;  3NQZ A;  1CQS A;  1TRQ A;  7GSP A;  3DUK A;  3S27 A;  1E3R A;  3X3X A;  3T8U A;  1N8Q A;  1FA3 A;  1OGX A;  1GY7 A;  3WHO A;  3BNE A;  2RBI A;  4PEJ A;  1GD3 A;  3JVC A;  1BNS A;  3U97 A;  4FMB A;  5KP4 A;  1EQK A;  1PYL A;  2ML6 A;  2RGQ A;  1D6Y A;  1B2M A;  1BIR A;  2D1W A;  4WHA A;  4KFF A;  5CF2 A;  4AKZ A;  3PYJ A;  1TP6 A;  1NO3 A;  3RNT A;  1BNR A;  2CFD A;  3MPH A;  3D9R A;  3U1W A;  3BNB A;  1M90 4;  1Q40 A;  1UDI I;  4MEI A;  4XBY A;  2CFG A;  3CC4 3;  3D5G A;  2K0M A;  1RJO A;  1IVW A;  2HMN B;  2W2C A;  3MG1 A;  1N8R 4;  1VQO 3;  2GEY A;  3DGN A;  1BNE A;  4EXR A;  1MOL A;  3EF8 A;  1MWT A;  3CCU 3;  1NNV A;  4WYK A;  2FGT A;  2UUG C;  1JKG A;  5IEO A;  1BAN A;  4KZ1 A;  5EVH A;  3NBR A;  5HOH A;  1UGH I;  1BAO A;  2CIU A;  1JZO A;  1UI8 A;  1ULI B;  3ROB A;  2F99 A;  3MSO A;  3PXM A;  4N6L A;  4KT3 B;  3GZX B;  4K61 A;  4LEH A;  3UL5 A;  1IDP A;  1O7G B;  3K5T A;  3EE1 A;  3CCS 3;  1LNH A;  2BNG A;  2AAE A;  1GSP A;  4BU4 A;  1DVC A;  1QVG 2;  1EUI C;  4FCM A;  2CC3 A;  3IJE B;  5M1A A;  1PU4 A;  2IUK A;  1Q40 B;  4N6M A;  1IVV A;  2OTJ 3;  1SPU A;  3V98 A;  2ZL8 A;  1BRN L;  3EN8 A;  1UCL A;  3NX0 A;  3CU3 A;  2OTL 3;  1A67 A;  1JB4 A;  3I55 3;  1K8A 4;  3FG3 A;  3ZG0 A;  1QMA A;  3DGM A;  4JRF A;  4BL3 A;  1BUJ A;  1X1U A;  2B1X B;  2HMJ B;  4WYK B;  3CNX A;  1JKG B;  5M18 A;  8RNT A;  3SLU A;  3AGN A;  1VQ5 3;  5AYS C;  3X3Y A;  3B4P A;  3DH2 A;  1C7H A;  3SX1 A;  3FG4 A;  1ZGX A;  1BGS A;  1RGH A;  2W56 A;  3B8L A;  1G0T A;  4NHF A;  1W6Y A;  1FGQ A;  1NDO B;  5CF1 A;  6RNT A;  2H0H A;  5IG3 A;  1FUW A;  2WOF A;  1RKY A;  1BRI A;  1WMO A;  3LYG A;  1Q81 4;  1BU4 A;  1LOY A;  1GS3 A;  1EEJ A;  3A76 A;  3KCH A;  5IG0 A;  3CC2 3;  3RGA A;  3WOE B;  3FKA A;  5DRE A;  1WTH A;  1OAC A;  1IV7 A;  1IVX A;  3AMO A;  1BNF A;  1SII A;  2XR8 B;  3NUV A;  4N6V 0;  1FW7 A;  1D6U A;  3ZFZ A;  1DET A;  1UCK A;  1YGW A;  3GWR A;  2ZHX B;  2OQE A;  1DMN A;  4N6U A;  3RDE A;  3L0R A;  3SXX A;  3X3Z A;  3LTB A;  5FW5 A;  4H3U A;  6GSP A;  3MG2 A;  4QWT A;  1JV2 B;  3B7C A;  3OWU A;  2BIR A;  2KF6 A;  2W6J H;  3T8N A;  4HM2 B;  2W9P A;  3WA2 X;  1BUQ A;  1MGW A;  1AQZ A;  3NQY A;  3GZR A;  3PCR A;  3D79 A;  3NBJ A;  1QAK A;  1W5Z A;  1SJW A;  2SAR A;  3KII A;  4KFD A;  3DY5 A;  1B2U A;  1BNI A;  1RLS A;  1BOX A;  4I5Q A;  4AEQ A;  2GU1 A;  2STD A;  1NB5 I;  1AR0 A;  1N9E A;  2W04 A;  2P05 A;  4FMA A;  1OPY A;  3KN4 A;  2XSO B;  1YJW 3;  1U5O A;  3FGY A;  1QVF 2;  1EA2 A;  3F14 A;  4HAA A;  1VQ4 3;  1BSA A;  4G1M B;  1KSI A;  3FF0 A;  3V99 A;  1BRH A;  3F8H A;  4EV5 A;  3BU4 A;  1U8C B;  5AEW B;  4MJD A;  2QA4 3;  1RCK A;  2F5M A;  3KSP A;  1FYS A;  2WGO A;  3UB1 A;  4FMD A;  4XBX A;  4HVN A;  1IQY A;  1STF I;  2AAD A;  4HBR A;  4OK0 A;  1T3B A;  4EV2 A;  3HZP A;  2HOH A;  4FCJ A;  3SOY A;  2GSP A;  3GAX A;  3G4S 3;  3CCM 3;  1TTO A;  2XSH B;  3NM7 A;  5AI1 A;  2L4V A;  5IEP A;  1KQS 2;  4J8T A;  1W7C A;  3HOH A;  1QAF A;  2CFL A;  4HKV B;  1CEW I;  4GB5 A;  1BSE A;  2W03 A;  3NV0 A;  4RBN A;  4X2O A;  3CCV 3;  3I0Y A;  3KZT A;  1OHS A;  2BU4 A;  4RNT A;  2BMQ B;  2QIY A;  2MF7 A;  3EHC A;  4WP5 A;  2INX A;  1BRJ A;  2GBW B;  1W00 A;  2Z76 A;  1RSN A;  3IPT A;  2F56 A;  1YHQ 3;  1RN1 A;  1JRQ A;  3TDG A;  2E2V A;  4BL2 A;  3LT9 A;  1TFK A;  4DKI A;  4I4K A;  3CCQ 3;  2P09 A;  5IER A;  2A15 A;  3RGR A;  2CX1 A;  4J5G A;  2H0I A;  1VQN 3;  1STD A;  4HM6 B;  1IYY A;  1RGK A;  2ZA4 A;  1MNL A;  3OX9 A;  3G0K A;  3X40 A;  1FUT A;  2CKF B;  2F86 B;  3ZG5 A;  1OHP A;  3GSP A;  1YNV X;  2K3D A;  4K1V A;  5G2G A;  3N8B A;  2OOV C;  4R80 A;  3A5E A;  3EX9 A;  3M8C A;  1FGO A;  1RDS A;  1B21 A;  2XH9 A;  3DM8 A;  2IUJ A;  4ORL A;  1R4Y A;  1GY5 A;  3NV0 B;  5EEO A;  1B27 A;  1IVU A;  2F4Y A;  2D42 A;  4O02 B;  3CME 3;  3G16 A;  2BMO B;  2ML5 A;  4R9L A;  1YVS A;  1QAL A;  1NJI 4;  1LXE A;  4N6T A;  1J2B A;  1PY3 A;  4K1U A;  1CYV A;  7RNT A;  1ZX2 A;  4HM1 B;  2UGI A;  5AEU B;  3FH1 A;  3OV4 A;  3EB8 A;  1ZO2 A;  2H0G A;  2LQV A;  4N6O B;  2GU3 A;  3JUP A;  1BRS A;  5GSP A;  1M1X B;  3URP A;  4CJN A;  2HMM B;  4XDV A;  2BT3 A;  1YVB I;  1GY6 A;  1LRA A;  1M9G A;  3WOD G;  4HM0 B;  3LTC A;  3O8Y A;  5D82 A;  1RHL A;  3HX8 A;  5STD A;  3GZB A;  2XFT A;  1R4C A;  1VQQ A;  1O7N B;  1JNQ A;  1RNB A;  5IW9 A;  1GYB A;  1VQL 3;  3E99 A;  4HOH A;  4OVM A;  2IA7 A;  4JF8 A;  3HK4 A;  1UI7 A;  5JPP A;  2RSX A;  2KF3 A;  4LYL B;  1JBR A;  1YIJ 3;  3H3H A;  1T2H A;  1RMS A;  3PGB A;  2C11 A;  2RFR A;  1NWW A;  2XFS A;  3Q2P A;  3KSE D;  3F7X A;  4KFE A;  4N6N B;  4XBT A;  1ULJ B;  5TGN A;  3G71 3;  2RCD A;  1YI2 3;  1MWS A;  4IIA A;  5DRV A;  3DXO A;  1B2S A;  1VQK 3;  1LQM B;  4X2H A;  2CFK A;  3X42 A;  2CWV A;  1BRK A;  4LMI A;  1BNJ A;  3F40 A;  3MWZ A;  1WQL B;  3UL6 A;  2Z6B A;  1RGG A;  2F5W A;  1RGF A;  4R4K A;  1Q7H A;  2E2U A;  1WMP A;  5CXO A;  1A2P A;  1B20 A;  2WOH A;  3JUO A;  1N5H A;  3BND A;  2CWU A;  1BVI A;  4R9K A;  1T5Y A;  4H61 A;  5CK6 A;  3K63 A;  1M1K 4;  3WDG B;  1I3I A;  4N3V A;  5G1K A;  3BIR A;  3I56 3;  2V1L A;  2M7O A;  2XF3 A;  4WWU C;  2UX0 A;  3AHW A;  3S5C A;  3NM2 A;  4GSP A;  4EYC A;  3LH4 A;  2HMO B;  4FCZ A;  5IG4 A;  1RNT A;  1LOX A;  3QRD A;  4HM8 B;  3CMA 3;  1FGR A;  4BTX A;  1OHO A;  1W02 A;  3X41 A;  3CXC 2;  3CPW 2;  4HM4 B;  4LGQ A;  5BVB A;  4HZB B;  1B2Z A;  2GBX B;  3CCE 3;  1I2F A;  3BB9 A;  1D6Z A;  1JN5 A;  4L7K A;  1RRL A;  4FR9 A;  1SIH A;  1WMN A;  2O9U X;  1JBT A;  1PFP A;  4O3V A;  1BNG A;  2P0M A;  3D3L A;  1RGC A;  3JUN A;  1T2I A;  1MWU A;  3Q1C A;  1O7M B;  1UCJ A;  1O7H B;  5AIG A;  3T0U A;  5RNT A;  4HM7 B;  1RTU A;  2OCT A;  3SED A;  1GMR A;  1SQW A;  3DGY A;  1V57 A;  4RNZ A;  1ZS7 A;  2CW9 A;  3LXU X;  1BSD A;  4HM5 B;  2CHC A;  4HYZ A;  3CD6 3;  1US1 A;  1VZZ A;  2OWP A;  3B4O A;  3GRD A;  1N5P A;  2P38 A;  4XM4 A;  3WA3 A;  1YJ9 3;  1IQ8 A;  3FCS B;  3CNM A;  1K41 A;  3F9S A;  3CCL 3;  1Q86 4;  3EQQ B;  2W9Q A;  3VGN A;  4L8P A;  1LQG C;  5A0O B;  1OCV A;  1UUW B;  2CG1 A;  3JUM A;  1FZU A;  5D83 A;  5JBS A;  3MHE A;  4R1K A;  1CYU A;  5AIF A;  1IK3 A;  1Y4K A;  1JN5 B;  1AVL A;  2O3O A;  4WFO A;  4EC6 A;  2R41 A;  2YX9 A;  5CLK A;  2B24 B;  2JQ5 A;  5LC6 A;  2K54 A;  3BLZ A;  1W6C A;  4BTY A;  1B2X A;  2KXG A;  3K9M C;  3EBT A;  4MMX B;  1FUS A;  1Z1S A;  2YFJ B;  3EC9 A;  1I0X A;  8CHO A;  1JBS A;  5I97 A;  2Y73 A;  1N9J A;  5BXQ A;  2KF5 A;  4J9A A;  1VQM 3;  5KP3 A;  1YJN 3;  3DMC A;  3CC7 3;  1UCI A;  1X1Y A;  1HYF A;  2OQE C;  4K90 B;  4HZ9 B;  3CCJ 3;  1GMP A;  3FLJ A;  1S5A A;  3F7S A;  1UUG B;  1RN4 A;  3S29 A;  1JZD A;  1JB2 A;  1L5G B;  3LZA A;  3FF2 A;  2BO9 B;  1GOV A;  1UUV B;  1W4N A;  1AVK A;  2CH9 A;  2FXT A;  3PS8 A;  4RZM A;  9RNT A;  3AHS A;  1Q7Y 4;  3KE7 A;  2L1S A;  3QK9 A;  1I2G A;  4MMZ B;  1KWI A;  1ROV A;  2KCD A;  1OUN A;  4ZM8 A;  1BSC A;  3S28 A;  2GEX A;  1K73 4;  2I9W A;  3UNL A;  1FGT A;  1RGL A;  5AIH A;  1X1W A;  3HI7 A;  3G6E 3;  1DE3 A;  3MYT A;  3OWS A;  1W2B 2;  1LOV A;  2BHM A;  2CFW A;  4OUQ A;  4IT7 A;  2FNQ A;  1NU3 A;  3FZW A;  3NBB A;  1HZ1 A;  1I8V A;  1OF5 A;  3STD A;  2PZV A;  1A2K A;  2CX0 A;  2IMJ A;  1BSB A;  2HML B;  3HII A;  3IMA B;  3NXJ A;  2Z77 A;  1G96 A;  5IG5 A;  5KP1 A;  3SYU A;  4Q53 A;  1TJD A;  1E3V A;  2XGL A;  5FGO A;  5ELJ A;  2Q07 A;  3SOA A;  3GZY B;  1W2Z A;  2C4B A;  1HU9 A;  2WO0 A;  2XRX B;  1UGI A;  1ROA A;  2J8X B;  4CPK A;  2LYX A;  2CWT A;  1Q9E A;  3CCR 3;  3MKI A;  2MC8 A;  1EG9 B;  1I2E A;  3EN1 B;  5HGR A;  5BIR A;  5BU4 A;  1K9M 4;  1O7P B;  1DYU A;  1IT8 A;  3G8Z A;  1GOY A;  2Y74 A;  2PNC A;  4BTW A;  5AII A;  3N9H A;  3J7Y d;  1V58 A;  3ER7 A;  1Q82 4;  3NHX A;  1TRP A;  2XGN A;  2Z7A A;  4KVH A;  1K28 A;  4NPB A;  3F8X A;  3DZL A;  2KAA A;  3LT8 A;  1GMQ A;  3UJM A;  5LC7 A;  2ZDJ A;  3OXA A;  2QGU A;  3DGL A;  4XDW A;  1VQ7 3;  2SBL A;  1TUH A;  1I70 A;  3LTA A;  1OF5 B;  3PZW A;  3FG1 A;  5AYR B;  4CDL A;  5IF6 A;  1IV9 A;  3ECF A;  4TX4 A;  2KF4 A;  1IQX A;  1GOU A;  3VF1 A;  1IT7 A;  1RRH A;  4HJL B;  1DVD A;  3OWY A;  4EW5 A;  1RGE A;  3Q90 A;  3V92 A;  1KD1 4;  3FSD A;  1EKM A;  3HIG A;  2WGQ A;  3PCS A;  1NB3 I;  4FMC A;  1ASK A;  2BMR B;  1AY7 A;  1JJ2 2;  4AKY A;  1LNI A;  3N54 B;  5G1L A;  1V74 A;  2W0Q A;  3AGO A;  5ELU A;  2OOV A;  1A2V A;  1G02 A;  4MMY B;  2CK3 H;  1MWR A;  1MGR A;  1VQ8 3;  3S67 A;  3WMD A;  6STD A;  4LSO A;  4J5K A;  3Q3F A;  3DGO A;  3EJV A;  1VQ9 3;  2KRT A;  3CPO A;  4RNY A;  2C10 A;  1I0V A;  4ILF A;  4L8O A;  1YGE A;  3WR2 A;  1A90 A;  3KKG A;  4GHO A;  3BNC A;  1SAR A;  4LZI A;  1HKX A;  1S72 3;  4EBG A;  1YIT 3;  4O2H A;  2F98 A;  3H51 A;  2JDI H;  1TIJ A;  3D4A A;  3WOF B;  4O8S A;  1C54 A;  2HMK B;  4CCV A;  1TFO A;  1W01 A;  2R4I A;  4HM3 B;  2YFI B;  4U13 A;  3SVA A;  1DMM A;  1RGA A;  1WNH A;  2W56 B;  4NRE A;  1OH0 A;  1DMQ A;  1E97 A;  5JPU A;  1X1X A;  1I3F A;  3VSY A;  1QJG A;  1RN7 A;  1FGM A; 
#chains in the Genus database with same CATH homology
 3LOY A;  1W6G A;  1Q42 A;  2YFL B;  1VQ6 3;  4XB5 A;  1O7W B;  1LVN A;  2CG0 A;  4GL6 A;  5D81 A;  1IU7 A;  2GXF A;  3ALA A;  3OW2 2;  1ISK A;  1KC8 4;  3MG3 A;  1TU5 A;  1GD4 A;  3K7C A;  3LTD A;  3AMO B;  3EBY A;  3LML A;  1JB5 A;  3JUQ A;  1OGZ A;  4STD A;  1AV4 A;  2P0X A;  7STD A;  3K0Z A;  1UW1 A;  4IPB A;  2QEX 3;  3KFQ C;  1F8N A;  2E2T A;  5EQL A;  1VQP 3;  2XEP A;  5IEN A;  3NQZ A;  1CQS A;  3DUK A;  3S27 A;  1E3R A;  3X3X A;  3T8U A;  1N8Q A;  1FA3 A;  1OGX A;  1GY7 A;  3BNE A;  4PEJ A;  1GD3 A;  3JVC A;  3U97 A;  4FMB A;  5KP4 A;  1EQK A;  2ML6 A;  2RGQ A;  1D6Y A;  2D1W A;  4WHA A;  4KFF A;  5CF2 A;  4AKZ A;  3PYJ A;  1TP6 A;  1NO3 A;  2CFD A;  3MPH A;  3D9R A;  3U1W A;  3BNB A;  1M90 4;  1Q40 A;  4MEI A;  4XBY A;  2CFG A;  3CC4 3;  2K0M A;  1RJO A;  1IVW A;  2HMN B;  2W2C A;  3MG1 A;  1N8R 4;  1VQO 3;  2GEY A;  3DGN A;  4EXR A;  1MOL A;  3EF8 A;  3CCU 3;  4WYK A;  2FGT A;  1JKG A;  5IEO A;  4KZ1 A;  5EVH A;  3NBR A;  2CIU A;  1UI8 A;  1ULI B;  3ROB A;  2F99 A;  3MSO A;  3PXM A;  4N6L A;  3GZX B;  4K61 A;  4LEH A;  3UL5 A;  1IDP A;  1O7G B;  3K5T A;  3EE1 A;  3CCS 3;  1LNH A;  2BNG A;  1QVG 2;  1DVC A;  4FCM A;  2CC3 A;  3IJE B;  1PU4 A;  2IUK A;  1Q40 B;  4N6M A;  1IVV A;  2OTJ 3;  1SPU A;  3V98 A;  2ZL8 A;  3EN8 A;  3NX0 A;  3CU3 A;  2OTL 3;  1A67 A;  1JB4 A;  3I55 3;  1K8A 4;  3FG3 A;  1QMA A;  3DGM A;  4JRF A;  2B1X B;  2HMJ B;  4WYK B;  3CNX A;  1JKG B;  3SLU A;  1VQ5 3;  5AYS C;  3B4P A;  1C7H A;  3SX1 A;  3FG4 A;  3B8L A;  2W56 A;  4NHF A;  1W6Y A;  1FGQ A;  1NDO B;  5CF1 A;  5IG3 A;  1FUW A;  2WOF A;  1RKY A;  1WMO A;  3LYG A;  1Q81 4;  1GS3 A;  3A76 A;  5IG0 A;  3CC2 3;  3RGA A;  3WOE B;  3FKA A;  5DRE A;  1WTH A;  1OAC A;  1IV7 A;  1IVX A;  3AMO A;  2XR8 B;  1SII A;  3NUV A;  4N6V 0;  1D6U A;  3T8N A;  3SXX A;  3GWR A;  2OQE A;  3X3Y A;  1DMN A;  4N6U A;  3RDE A;  3L0R A;  3X3Z A;  3LTB A;  5FW5 A;  4H3U A;  3MG2 A;  4QWT A;  1JV2 B;  3B7C A;  3OWU A;  2W6J H;  1BUQ A;  4HM2 B;  2W9P A;  3WA2 X;  3NQY A;  3GZR A;  3PCR A;  3NBJ A;  1QAK A;  1W5Z A;  1SJW A;  3KII A;  4KFD A;  3DY5 A;  4AEQ A;  2GU1 A;  2STD A;  1NB5 I;  1AR0 A;  1N9E A;  2W04 A;  2P05 A;  4FMA A;  1OPY A;  3KN4 A;  2XSO B;  1YJW 3;  1U5O A;  3FGY A;  1EA2 A;  3F14 A;  1VQ4 3;  4G1M B;  1KSI A;  3FF0 A;  3V99 A;  3F8H A;  1QVF 2;  4EV5 A;  5AEW B;  1U8C B;  4MJD A;  2QA4 3;  3KSP A;  2WGO A;  3UB1 A;  4FMD A;  4XBX A;  4HVN A;  1IQY A;  1STF I;  4HBR A;  4OK0 A;  4EV2 A;  3HZP A;  4FCJ A;  3SOY A;  3GAX A;  3G4S 3;  3CCM 3;  2XSH B;  3NM7 A;  5AI1 A;  2L4V A;  5IEP A;  1KQS 2;  4J8T A;  1W7C A;  4HKV B;  1QAF A;  2CFL A;  1CEW I;  4GB5 A;  2W03 A;  3NV0 A;  4RBN A;  4X2O A;  3CCV 3;  3I0Y A;  3KZT A;  1OHS A;  2BMQ B;  2QIY A;  2MF7 A;  3EHC A;  4WP5 A;  2INX A;  2GBW B;  1W00 A;  2Z76 A;  3IPT A;  1YHQ 3;  3TDG A;  1JRQ A;  2E2V A;  3LT9 A;  1TFK A;  3CCQ 3;  4I4K A;  2P09 A;  5IER A;  2A15 A;  3RGR A;  1VQN 3;  1STD A;  4HM6 B;  1MNL A;  3OX9 A;  3G0K A;  3X40 A;  2CKF B;  2F86 B;  1OHP A;  4K1V A;  5G2G A;  3N8B A;  2OOV C;  4R80 A;  3M8C A;  3EX9 A;  1FGO A;  2XH9 A;  3DM8 A;  2IUJ A;  4ORL A;  1GY5 A;  3NV0 B;  5EEO A;  1IVU A;  2D42 A;  4O02 B;  3CME 3;  3G16 A;  2BMO B;  2ML5 A;  4R9L A;  1QAL A;  1NJI 4;  1LXE A;  4N6T A;  1J2B A;  4K1U A;  1CYV A;  1ZX2 A;  4HM1 B;  5AEU B;  3FH1 A;  3OV4 A;  3EB8 A;  1ZO2 A;  2LQV A;  4N6O B;  2GU3 A;  3JUP A;  1M1X B;  2HMM B;  4XDV A;  2BT3 A;  1YVB I;  1GY6 A;  3WOD G;  1M9G A;  4HM0 B;  3LTC A;  3O8Y A;  5D82 A;  3HX8 A;  5STD A;  3GZB A;  2XFT A;  1R4C A;  1O7N B;  1JNQ A;  5IW9 A;  1GYB A;  1VQL 3;  3E99 A;  4OVM A;  2IA7 A;  4JF8 A;  3HK4 A;  1UI7 A;  5JPP A;  2RSX A;  1YIJ 3;  3H3H A;  3PGB A;  2C11 A;  2RFR A;  1NWW A;  2XFS A;  3Q2P A;  3KSE D;  3F7X A;  4KFE A;  4N6N B;  4XBT A;  1ULJ B;  5TGN A;  3G71 3;  2RCD A;  1YI2 3;  4IIA A;  5DRV A;  3DXO A;  1VQK 3;  4X2H A;  2CFK A;  3X42 A;  2CWV A;  4LMI A;  3F40 A;  3MWZ A;  1WQL B;  3UL6 A;  2Z6B A;  4R4K A;  2E2U A;  1WMP A;  5CXO A;  2WOH A;  3JUO A;  1N5H A;  3BND A;  2CWU A;  4R9K A;  5CK6 A;  1T5Y A;  4H61 A;  3K63 A;  1M1K 4;  3WDG B;  4N3V A;  3I56 3;  2V1L A;  2XF3 A;  2M7O A;  4WWU C;  2UX0 A;  3S5C A;  3NM2 A;  4EYC A;  3LH4 A;  2HMO B;  4FCZ A;  5IG4 A;  1LOX A;  3QRD A;  4HM8 B;  3CMA 3;  1FGR A;  4BTX A;  1OHO A;  1W02 A;  3X41 A;  3CXC 2;  3CPW 2;  4HM4 B;  4LGQ A;  5BVB A;  4HZB B;  2GBX B;  3CCE 3;  3BB9 A;  1D6Z A;  1JN5 A;  4L7K A;  1RRL A;  4FR9 A;  1SIH A;  1WMN A;  2O9U X;  1PFP A;  4O3V A;  3D3L A;  2P0M A;  3JUN A;  3Q1C A;  1O7M B;  5AIG A;  1O7H B;  3T0U A;  4HM7 B;  2OCT A;  3SED A;  1SQW A;  4RNZ A;  2CW9 A;  3LXU X;  4HM5 B;  2CHC A;  4HYZ A;  3CD6 3;  1US1 A;  1VZZ A;  2OWP A;  3B4O A;  3GRD A;  1N5P A;  2P38 A;  4XM4 A;  3WA3 A;  1YJ9 3;  1IQ8 A;  3FCS B;  3CNM A;  1K41 A;  3F9S A;  3CCL 3;  1Q86 4;  3EQQ B;  2W9Q A;  3VGN A;  4L8P A;  5A0O B;  1OCV A;  1UUW B;  2CG1 A;  3JUM A;  5D83 A;  5JBS A;  3MHE A;  4R1K A;  1CYU A;  5AIF A;  1IK3 A;  1Y4K A;  1JN5 B;  1AVL A;  2O3O A;  4WFO A;  4EC6 A;  2YX9 A;  5CLK A;  2B24 B;  2JQ5 A;  5LC6 A;  2K54 A;  3BLZ A;  1W6C A;  4BTY A;  2KXG A;  3K9M C;  3EBT A;  4MMX B;  2YFJ B;  1Z1S A;  3EC9 A;  8CHO A;  5I97 A;  2Y73 A;  1N9J A;  5BXQ A;  4J9A A;  1VQM 3;  1YJN 3;  5KP3 A;  3DMC A;  3CC7 3;  2OQE C;  4K90 B;  4HZ9 B;  3CCJ 3;  3FLJ A;  1S5A A;  3F7S A;  3S29 A;  1JB2 A;  1L5G B;  3LZA A;  3FF2 A;  2BO9 B;  1UUV B;  2CH9 A;  1W4N A;  1AVK A;  3PS8 A;  2FXT A;  4RZM A;  1Q7Y 4;  3KE7 A;  3QK9 A;  4MMZ B;  1KWI A;  1ROV A;  2KCD A;  1OUN A;  4ZM8 A;  3S28 A;  1K73 4;  2GEX A;  2I9W A;  3UNL A;  1FGT A;  5AIH A;  3HI7 A;  3G6E 3;  3MYT A;  3OWS A;  1W2B 2;  2BHM A;  2CFW A;  4OUQ A;  4IT7 A;  2FNQ A;  1NU3 A;  3FZW A;  3NBB A;  1OF5 A;  3STD A;  2PZV A;  1A2K A;  3HII A;  2IMJ A;  2HML B;  3IMA B;  5KP1 A;  3NXJ A;  5IG5 A;  2Z77 A;  1G96 A;  4Q53 A;  1E3V A;  2XGL A;  5FGO A;  5ELJ A;  2Q07 A;  3SOA A;  3GZY B;  1W2Z A;  2WO0 A;  1HU9 A;  2XRX B;  1ROA A;  2LYX A;  2CWT A;  3CCR 3;  3MKI A;  2MC8 A;  1EG9 B;  3EN1 B;  5HGR A;  1K9M 4;  1O7P B;  1DYU A;  1IT8 A;  3G8Z A;  2Y74 A;  2PNC A;  4BTW A;  5AII A;  3N9H A;  3J7Y d;  3ER7 A;  1Q82 4;  3NHX A;  2XGN A;  2Z7A A;  4KVH A;  1K28 A;  3F8X A;  3DZL A;  3UJM A;  3LT8 A;  5LC7 A;  2ZDJ A;  3OXA A;  2QGU A;  3DGL A;  4XDW A;  1VQ7 3;  2SBL A;  1TUH A;  3LTA A;  1OF5 B;  3PZW A;  3FG1 A;  5AYR B;  4CDL A;  5IF6 A;  1IV9 A;  3ECF A;  4TX4 A;  1IQX A;  3VF1 A;  1IT7 A;  1RRH A;  4HJL B;  1DVD A;  3OWY A;  3Q90 A;  3V92 A;  1KD1 4;  3FSD A;  1EKM A;  3HIG A;  2WGQ A;  3PCS A;  1NB3 I;  4FMC A;  1ASK A;  2BMR B;  1JJ2 2;  4AKY A;  3N54 B;  1V74 A;  2W0Q A;  5ELU A;  2OOV A;  1A2V A;  4MMY B;  2CK3 H;  1VQ8 3;  3S67 A;  3WMD A;  6STD A;  4LSO A;  3DGO A;  3EJV A;  1VQ9 3;  2KRT A;  3CPO A;  4RNY A;  2C10 A;  4L8O A;  1A90 A;  1YGE A;  3KKG A;  4LZI A;  3BNC A;  1S72 3;  1HKX A;  4EBG A;  1YIT 3;  4O2H A;  2F98 A;  3H51 A;  2JDI H;  1TIJ A;  3WOF B;  4O8S A;  2HMK B;  4CCV A;  1TFO A;  1W01 A;  2R4I A;  4HM3 B;  2YFI B;  4U13 A;  3SVA A;  1DMM A;  1WNH A;  2W56 B;  4NRE A;  1OH0 A;  1DMQ A;  1E97 A;  5JPU A;  3VSY A;  1QJG A;  1RN7 A;  1FGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...