5IG4A

Crystal structure of n. vectensis camkii-a hub
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
129
Chain Sequence
TAKVREQEIIRLTQKLITSITTGDYDTYSKLVDPHVTCFEPFSNGNLVEGLEFHKFYFDNTLSKVPINTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFHISGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Transferase
molecule keywords Predicted protein
total genus 34
structure length 129
sequence length 131
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig4A00
3DXOA 4HM7B 1U5OA 3K7CA 3KE7A 3GRDA 3CU3A 4HM0B 4HM6B 5D82A 3LZAA 2HMJB 2HMKB 3OWUA 2B24B 4X2HA 4XM4A 3EF8A 1JKGA 1GY7A 1EG9B 1W6YA 4H3UA 2W2CA 3EN8A 3T8NA 3SOAA 2YFLB 3FZWA 3HX8A 3UJMA 4Q53A 3LYGA 3GZYB 2UX0A 3EQQB 4XDWA 3CNXA 1K41A 1W00A 1UUWB 3F8XA 4LEHA 3MG3A 5EVHA 3SEDA 1WQLB 2F86B 3SOYA 3S5CA 4XB5A 4GB5A 2GBWB 5D81A 1OGZA 1OF5A 3FKAA 3OV4A 5JPUA 3EBYA 3JUPA 5IG3A 5G2GA 4WP5A 3OXAA 3VGNA 4RZMA 5CF1A 3D9RA 2XRXB 2YFJB 1DMNA 2F98A 3BB9A 1W02A 2CHCA 1JN5B 3EC9A 3NV0B 4OVMA 2HMLB 1STDA 4K1VA 2B1XB 3HZPA 4HM3B 3STDA 3OWSA 1QMAA 1S5AA 2XSOB 3DZLA 3MKIA 4FCJA 1IDPA 4XBYA 5IEPA 1OPYA 1O7WB 1OHSA 3GWRA 1TP6A 1Z1SA 5DRVA 4XDVA 5FW5A 3VSYA 5CF2A 5IF6A 2BMRB 1A2KA 1ULJB 3FLJA 4HM1B 4HVNA 3NHXA 3F9SA 1GY5A 4WYKB 5STDA 7STDA 3MG1A 1AR0A 3NM2A 1O7GB 3FSDA 3G16A 3F7SA 3MG2A 1JB5A 5IERA 3JUMA 5AEWB 2CKFB 3NXJA 4HM4B 5IG5A 4XBTA 1TUHA 1W01A 3OX9A 3RGRA 1OHPA 3JUNA 1Q40B 1CQSA 1OF5B 2OWPA 1GYBA 1OGXA 3E99A 4HM2B 5IENA 3ECFA 3H51A 3B4OA 4HJLB 4HKVB 3NBRA 1QJGA 1JB2A 3MYTA 1VZZA 2GXFA 1ZO2A 3F8HA 5CLKA 4N3VA 5IG0A 1OH0A 4K1UA 3CPOA 4HZ9B 3MHEA 5AIHA 4WWUC 1Q40A 1O7NB 2R4IA 5IEOA 1EA2A 5CK6A 2PZVA 2XSHB 2A15A 3IPTA 3MSOA 3UNLA 3M8CA 1E3RA 1OUNA 3KSPA 1E3VA 3OWYA 2RGQA 3DMCA 2Z76A 4HZBB 1NDOB 2Z7AA 3F40A 4X2OA 3B4PA 5HGRA 3KZTA 4KVHA 1ZX2A 2GEXA 3Q90A 4WYKA 1ULIB 2HMOB 5DREA 1JKGB 4CDLA 5BVBA 4R9KA 1C7HA 1O7MB 1OHOA 3K0ZA 4R1KA 3GZBA 5KP1A 2INXA 4STDA 2IMJA 3G0KA 3KKGA 4U13A 2RCDA 3B7CA 3WMDA 6STDA 2I9WA 1OCVA 2F99A 3GZRA 3NUVA 4L7KA 5AEUB 3B8LA 3EHCA 3JUQA 1DMQA 2BNGA 4L8OA 4FCMA 3JUOA 2YFIB 2BMQB 1JB4A 1Q42A 4LMIA 4PEJA 2Z77A 5AI1A 4HM8B 5TGNA 3GZXB 5AIFA 2RFRA 4J9AA 3HK4A 1SJWA 4J8TA 3A76A 2JQ5A 3CNMA 1NWWA 3H3HA 1HKXA 1O7HB 3DM8A 3EN1B 4IIAA 1E97A 1JN5A 3NV0A 4L8PA 4LGQA 1UUVB 3DUKA 5KP3A 2XR8B 3EX9A 3FF2A 5AIIA 4OUQA 3EJVA 4XBXA 5AIGA 5BXQA 3FH1A 2BMOB 1ASKA 3ER7A 4I4KA 5D83A 2GBXB 2STDA 3FF0A 1GY6A 1NU3A 4R9LA 3ROBA 4ORLA 4HM5B 3FGYA 2QIYA 5IG4A 5CXOA 1ISKA 2HMNB 2QGUA 3G8ZA 3EBTA 8CHOA 3F14A 3F7XA 5KP4A 1BUQA 2HMMB 1DMMA 2K54A 1O7PB 4MJDA 3RGAA 3T8UA 3BLZA 5JPPA 1GS3A 3I0YA 2GEYA
chains in the Genus database with same CATH superfamily
1KD14 1RRLA 1LRAA 1AV4A 3OWUA 3J7Yd 4XM4A 1DVDA 2GU3A 5G1LA 1CEWI 2W2CA 3T8NA 1I8VA 1QALA 3LYGA 1YHQ3 1K28A 2GU1A 3FG1A 3F8XA 3MG3A 3SOYA 2F86B 4GB5A 2H0IA 3LTDA 4JRFA 1UGHI 2QEX3 3WA2X 2RBIA 3DH2A 4N6MA 5G2GA 4BTYA 1VQ83 4HOHA 3OXAA 4K61A 1NB5I 4RZMA 1BGSA 1JZDA 1GOUA 1LQMB 5CF1A 3BB9A 2CHCA 2CWVA 3ALAA 4OVMA 1VQ53 3DY5A 4K1VA 1GD4A 4HM3B 3OWSA 4HBRA 1PY3A 1YVBI 5M19A 1V57A 3D4AA 2OTJ3 3DZLA 1IDPA 1LNHA 2ZA4A 4HAAA 2CX1A 3PS8A 4OK0A 4XDVA 2W56B 1EKMA 5EEOA 3SYUA 1IV7A 1BRHA 2ML5A 2IUKA 1BSDA 3F9SA 5STDA 7STDA 1AR0A 3NM2A 3FSDA 4MMXB 1B21A 3MG2A 1RRHA 1TIJA 3NXJA 1SIIA 4HM4B 5IG5A 2KF5A 1TUHA 4MEIA 3RGRA 4EXRA 3G6E3 1Q40B 1I0XA 2OWPA 1IU7A 5IENA 1JV2B 4IT7A 3SX1A 4BL2A 3H51A 3ZG5A 1TTOA 5GSPA 1QJGA 3S5CA 5IG0A 5CLKA 2GXFA 1MWRA 3F8HA 3S67A 4N3VA 4K90B 4K1UA 1IQXA 1RDSA 2D1WA 3CPOA 3KIIA 1W6GA 3X3YA 5IEOA 4N6UA 1Q814 3CMA3 3S28A 3MPHA 1BVIA 2ZHXB 3MSOA 2KXGA 1BSBA 2KAAA 3M8CA 1YGEA 1E3RA 2KF6A 4EV2A 2Q07A 4MMYB 1VQO3 1E3VA 4HZBB 2RGQA 1YIT3 1CH0A 2W0QA 5BU4A 1ZX2A 2E2TA 3CXC2 1IYYA 3GZBA 3UB1A 3Q3FA 1BANA 2IMJA 3G0KA 4FMAA 1I0VA 2K3DA 3LTBA 1VQ43 2I9WA 3UL6A 5AEUB 4DKIA 1VQM3 4GHOA 5G1KA 2WOFA 2BMQB 3LXUX 1D6YA 2Z77A 4LYLB 5AIFA 1WMNA 2XEPA 1W7CA 3A76A 1W2B2 1VQP3 2O3OA 3BNBA 2IYJA 1HKXA 1O7HB 1RGLA 3EN1B 3GSPA 4N6LA 4O8SA 1YJ93 1S723 1UUVB 1WTHA 1NO3A 4O2HA 2YX9A 4OUQA 4EV5A 3N8BA 2CX0A 4I4KA 3PCSA 1MGRA 1GY6A 1NU3A 1B27A 3FF0A 2KF4A 3OW22 1ROVA 3CPW2 3EB8A 5IG4A 1RNBA 5CXOA 1W4NA 2QGUA 1RHLA 3HI7A 5BIRA 1JNQA 1SARA 1RGHA 5M1AA 1GSPA 1DMMA 3T8UA 2KRTA 4EYCA 2XGLA 6RNTA 1KC84 3AHWA 1U5OA 4KFFA 3KE7A 4AKYA 1B2UA 1K734 2HMKB 2Y73A 3V99A 5AYRB 1JKGA 1W6YA 1LOYA 4H3UA 4WHAA 1A2PA 3JVCA 3CCU3 3SOAA 1X1XA 1A2VA 2IA7A 2YFLB 2W6JH 3AMOA 3NM7A 4Q53A 1ZGXA 3D3LA 2UX0A 1FUSA 1W00A 1GOVA 1UUWB 3CNXA 3N9HA 2GBWB 5M18A 1OGZA 1OF5A 1RGAA 3OV4A 2E2VA 3EE1A 2O9UX 3DGLA 3CCR3 3EBYA 5IG3A 5EQLA 4WP5A 3CCJ3 3VGNA 2E2UA 3PZWA 1IVUA 3FG4A 1FGQA 2F98A 1HU9A 2P09A 4I5QA 3S27A 3CC23 1STDA 2B1XB 1YJN3 2C4BA 1T2HA 2XSOB 1W2ZA 3MKIA 4FCJA 3Q2PA 4XBYA 4AEQA 1PU4A 1PFPA 1K8A4 1OHSA 1RN4A 3AGNA 2Z6BA 1TP6A 5DRVA 5A0OB 1RGCA 3K5TA 2W04A 4RNYA 5IF6A 2BMRB 3I553 1A2KA 1BSCA 2LQVA 1GY5A 1RCLA 1RGGA 1O7GB 2CG1A 1IQYA 3CCM3 1YI23 2SARA 1UCLA 5IERA 2BT3A 2WGQA 3N54B 1N8R4 1W01A 3OX9A 3JUNA 1M904 1TRPA 1GYBA 2R41A 3E99A 1I3IA 4R4KA 1FGRA 1VZZA 1RNTA 1ZO2A 1V74A 2JDIH 3GAXA 3KCHA 3BU4A 4HZ9B 1C54A 3MHEA 4O02B 4WWUC 4BU4A 1O7NB 1DE3A 1HZ1A 5FGOA 1BNGA 2OQEA 4LSOA 1N5PA 2A15A 3IPTA 3UNLA 1NJI4 4N6V0 1RCKA 3DGOA 4JF8A 3DMCA 3KFQC 4R80A 3RDEA 3X40A 1VQK3 4BL3A 2OOVA 3HOHA 3KZTA 4KVHA 2GEXA 3Q90A 4KFEA 4WYKA 2PNCA 2HOHA 4R9KA 1C7HA 1M1XB 1AVLA 3K0ZA 1DETA 5ELUA 1VQN3 3NBBA 4EBGA 2W03A 2RCDA 1LOVA 3B7CA 3CCE3 3WMDA 1OCVA 1SQWA 4KT3B 4L8OA 2BNGA 4NHFA 3JUOA 1X1YA 2YFIB 9RNTA 1BNJA 3K9MC 5TGNA 3GZXB 1UW1A 4J9AA 1UI8A 4J8TA 1G96A 3PGBA 2Y74A 1BSAA 2F56A 1M1K4 1Q824 1Q9EA 1NWWA 1YGWA 5JBSA 3STDA 2BU4A 4IIAA 4LGQA 1N8QA 5KP3A 3CCQ3 4EC6A 3SXXA 2P0MA 1B2SA 1RTUA 1VQ93 2BMOB 4QWTA 5D83A 2STDA 3ROBA 4LZIA 1K9M4 1U8CB 4HM5B 4ORLA 1L5GB 1X1WA 3FGYA 1N9JA 4FCZA 3WOFB 3WHOA 3AMOB 3D5GA 2F5MA 3F14A 4MJDA 3NQZA 4KZ1A 3BLZA 1A90A 3I0YA 1BU4A 1B3SA 4HM7B 3K7CA 4HM0B 5D82A 1IT8A 1B2ZA 3BNEA 2W9QA 4X2HA 2B24B 3EF8A 3CCS3 3V92A 2F4YA 3EN8A 4H61A 2FNQA 1LQGC 3QK9A 1BUJA 3NQYA 1IK3A 4XDWA 4G1MB 2FGTA 5EVHA 4EW5A 1YVSA 1FW7A 2F5WA 1MWSA 3BNCA 1R4YA 5LC7A 3FKAA 2WGOA 3DGYA 1VQL3 3UL5A 1VQ63 2CFGA 4NPBA 2CWUA 3ZG0A 3CC73 5AYSC 2CH9A 1TJDA 3G4S3 1DMNA 3EC9A 3X42A 1OACA 1ROAA 2QA43 1BOXA 2J8XB 3QRDA 1WMPA 1QMAA 1EUIC 1S5AA 3AHSA 1FZUA 3X41A 3GWRA 1UCIA 5FW5A 2MC8A 1WMOA 3VSYA 3X3XA 1BRIA 1EEJA 1ULJB 3FLJA 4J5GA 4WYKB 1YIJ3 1W5ZA 3MG1A 1BRGA 1VQ73 2GSPA 2ZL8A 1IQ8A 1JZOA 1GD3A 5AEWB 1T3BA 4XBTA 2FXTA 2H0GA 3SEDA 1GOYA 1OHPA 4RNZA 4STDA 1GMPA 1OGXA 1D6ZA 1G0TA 6GSPA 3B4OA 4HJLB 3NBRA 4N6OB 1JB2A 3MYTA 5CF2A 1YJW3 2SBLA 3HIIA 1SIHA 3IJEB 7RNTA 5IW9A 4KFDA 2KF3A 1N5HA 3LTAA 5AIHA 1US1A 3V98A 1Q40A 1HYFA 3WA3A 1TFKA 2PZVA 2CWTA 2XSHB 2UUGC 1M9GA 1OUNA 3CC43 1X1UA 3DGNA 3K63A 2ZDJA 4RBNA 3OWYA 4BIRA 1JBTA 4IPBA 1NDOB 2Z7AA 1I2EA 2W56A 3PCRA 2CC3A 1D6UA 5ELJA 1IVVA 3B4PA 1RKYA 1JKGB 5BVBA 3ZFZA 1B2XA 3URPA 2AADA 1RGKA 5KP1A 2INXA 4U13A 3WODG 1FGMA 2CG0A 6STDA 1BIRA 1YNVX 1CYUA 2F99A 1RLSA 3JUQA 3KSED 2V1LA 1JB4A 1Q42A 4LMIA 1ZS7A 1V58A 1CYVA 5AI1A 4HM8B 1R4CA 2CW9A 4CPKA 1Q7HA 1UGIA 1SJWA 2P38A 1LXEA 3HK4A 3KN4A 3LOYA 3MWZA 4BTWA 3SVAA 1FGOA 2LYXA 4CJNA 3CNMA 4FMBA 2WOHA 4L8PA 1FGTA 1BRKA 3DUKA 2OOVC 3U1WA 5RNTA 2XR8B 1KSIA 1QAFA 3EX9A 3FF2A 5AIIA 1UI7A 4XBXA 1JRQA 3O8YA 5AIGA 1MWUA 3FH1A 3ER7A 1ASKA 3SLUA 2XFTA 5BXQA 2GBXB 1KWIA 4R9LA 3RNTA 2OQEC 4FMCA 2QIYA 1EQKA 1IT7A 1BSEA 2HMNB 8CHOA 2XGNA 2CIUA 5KP4A 1A67A 1BUQA 2K54A 3T0UA 3G713 1O7PB 1PYLA 5JPPA 4TX4A 1FUTA 3IMAB 5DREA 3DXOA 1FYSA 2L4VA 1UDII 3BIRA 2CFKA 1IVWA 2WO0A 3CU3A 3GRDA 1RSNA 2HMJB 3LZAA 4HM6B 1J2BA 2L1SA 1GY7A 1EG9B 2M7OA 4CCVA 1DVCA 3WR2A 3PXMA 3UJMA 3FZWA 3HX8A 1N9EA 3GZYB 3I563 3EQQB 1K41A 4LEHA 2XH9A 1LNIA 2CFLA 2P05A 1WQLB 4XB5A 4NREA 4HYZA 5D81A 1KQS2 1Y4KA 1I2GA 2OTL3 1MNLA 2AAEA 5JPUA 3BNDA 2XF3A 3JUPA 1BNSA 3LT8A 7GSPA 4GSPA 1IV9A 3D9RA 2XRXB 2YFJB 1JN5B 1W02A 3NV0B 1LVNA 1GMRA 2BO9B 2HMLB 1Q7Y4 1STFI 1BNEA 3HZPA 1RGFA 1RMSA 2RSXA 5LC6A 1QAKA 2CFWA 8RNTA 4MMZB 5IEPA 1BAOA 1BRJA 4BTXA 1OPYA 1DYUA 1BRSA 1O7WB 2KCDA 1IVXA 2MF7A 1Z1SA 3D5IA 3U97A 1RJOA 4HM1B 1MOLA 1I3FA 3FG3A 4HVNA 3NHXA 4N6TA 2CK3H 1BRNL 1ISKA 1G02A 4FMDA 5I97A 1RN7A 1QVG2 3VF1A 3G16A 3F7SA 1JB5A 3JUMA 2C11A 2CKFB 2OCTA 1Q864 3HIGA 3X3ZA 3CCV3 1JJ22 1CQSA 1MWTA 1SPUA 1OF5B 4HM2B 3A5EA 1UUGB 3ECFA 2BIRA 1AVKA 2RNTA 4HKVB 3S29A 2ML6A 3PYJA 3CD63 1OH0A 1FUWA 1LOWA 3TDGA 1GMQA 4AKZA 2R4IA 4N6NB 1EA2A 4WFOA 1VQQA 5CK6A 1LOXA 4J5KA 3WDGB 4ILFA 1NB3I 3KSPA 1QVF2 3CME3 1B20A 2Z76A 3F40A 4X2OA 3CCL3 5HGRA 2K0MA 1BNRA 2CFDA 1ULIB 2HMOB 3LH4A 4CDLA 1AY7A 1NNVA 3AGOA 3LT9A 1O7MB 1OHOA 1TFOA 1RGEA 1TRQA 2BHMA 4R1KA 3KKGA 1MGWA 1UCJA 1T5YA 3NX0A 3LMLA 1JBSA 3LTCA 3GZRA 3NUVA 4L7KA 3B8LA 3EHCA 1DMQA 3Q1CA 4FCMA 2D42A 3D79A 3FCSB 1BNFA 1RN1A 2XFSA 4PEJA 2RFRA 1BNIA 4FR9A 4GL6A 2JQ5A 2P0XA 2IUJA 3H3HA 3DM8A 1E97A 1JN5A 1I2FA 3NV0A 3DGMA 1WNHA 1T2IA 3EJVA 2C10A 1JBRA 1TU5A 1FA3A 1B2MA 1W6CA 1F8NA 1UCKA 4ZM8A 2H0HA 4RNTA 4O3VA 2IY2A 3G8ZA 5HOHA 3EBTA 3WOEB 3F7XA 1I70A 2W9PA 1AQZA 2HMMB 2UGIA 3NBJA 3RGAA 1GS3A 3L0RA 2GEYA
chains in the Genus database with same CATH topology
1KD14 1RRLA 1AV4A 3OWUA 3J7Yd 4XM4A 1DVDA 2GU3A 1CEWI 2W2CA 3T8NA 1QALA 1YHQ3 3LYGA 1K28A 2GU1A 3FG1A 3F8XA 3MG3A 3SOYA 2F86B 4GB5A 3LTDA 4JRFA 2QEX3 3WA2X 4N6MA 5G2GA 4BTYA 1VQ83 3OXAA 4K61A 1NB5I 4RZMA 5CF1A 3BB9A 2CHCA 2CWVA 3ALAA 4OVMA 1VQ53 3DY5A 4K1VA 1GD4A 4HM3B 3OWSA 4HBRA 1YVBI 2OTJ3 3DZLA 1IDPA 1LNHA 3PS8A 4OK0A 4XDVA 2W56B 1EKMA 5EEOA 1IV7A 2ML5A 2IUKA 3F9SA 5STDA 7STDA 1AR0A 3NM2A 3FSDA 4MMXB 3MG2A 1RRHA 1TIJA 3NXJA 1SIIA 4HM4B 5IG5A 3G6E3 1TUHA 4MEIA 3RGRA 4EXRA 1Q40B 2OWPA 5IENA 1IU7A 1JV2B 4IT7A 3SX1A 3H51A 3S5CA 1QJGA 5IG0A 5CLKA 2GXFA 3S67A 3F8HA 4N3VA 4K90B 4K1UA 1IQXA 2D1WA 3CPOA 3KIIA 1W6GA 3X3YA 5IEOA 4N6UA 1Q814 3CMA3 3S28A 3MPHA 3MSOA 2KXGA 3M8CA 1YGEA 1E3RA 4EV2A 2Q07A 4MMYB 1E3VA 4HZBB 2RGQA 1YIT3 2W0QA 1ZX2A 2E2TA 3CXC2 3GZBA 3UB1A 2IMJA 3G0KA 4FMAA 3LTBA 1VQ43 2I9WA 3UL6A 5AEUB 1VQM3 2WOFA 2BMQB 3LXUX 1D6YA 2Z77A 5AIFA 1WMNA 2XEPA 1W7CA 3A76A 1W2B2 1VQP3 2O3OA 3BNBA 1HKXA 1O7HB 3EN1B 4O8SA 4N6LA 1YJ93 1S723 1UUVB 1WTHA 1NO3A 4O2HA 2YX9A 4OUQA 4EV5A 3N8BA 4I4KA 3PCSA 3FF0A 1GY6A 1NU3A 3OW22 1ROVA 3CPW2 3EB8A 5IG4A 5CXOA 1W4NA 2QGUA 3HI7A 1JNQA 3T8UA 1DMMA 4EYCA 2KRTA 2XGLA 1KC84 1U5OA 4KFFA 3KE7A 4AKYA 1K734 2HMKB 2Y73A 3V99A 5AYRB 1JKGA 1W6YA 4H3UA 4WHAA 3JVCA 3CCU3 3SOAA 1A2VA 2IA7A 2YFLB 2W6JH 3AMOA 3NM7A 4Q53A 3D3LA 2UX0A 3CNXA 1W00A 1UUWB 3N9HA 2GBWB 1OGZA 1OF5A 3OV4A 2E2VA 3EE1A 2O9UX 3DGLA 3CCR3 3EBYA 5IG3A 5EQLA 4WP5A 3CCJ3 3VGNA 2E2UA 3PZWA 1IVUA 3FG4A 1FGQA 2F98A 1HU9A 2P09A 3S27A 3CC23 1STDA 2B1XB 1YJN3 2XSOB 1W2ZA 3MKIA 4FCJA 3Q2PA 4XBYA 4AEQA 1PU4A 1PFPA 1K8A4 1OHSA 2Z6BA 1TP6A 5DRVA 5A0OB 4RNYA 3K5TA 2W04A 5IF6A 3I553 2BMRB 1A2KA 2LQVA 1GY5A 1O7GB 2CG1A 1IQYA 3CCM3 1YI23 5IERA 2BT3A 2WGQA 3N54B 1N8R4 1W01A 3OX9A 3JUNA 1M904 1GYBA 3E99A 4R4KA 1FGRA 1VZZA 1ZO2A 3GAXA 1V74A 2JDIH 4HZ9B 3MHEA 4O02B 4WWUC 1O7NB 5FGOA 2OQEA 4LSOA 1N5PA 2A15A 3IPTA 3UNLA 1NJI4 4N6V0 3DGOA 4JF8A 3DMCA 3KFQC 4R80A 3RDEA 3X40A 1VQK3 2OOVA 3KZTA 4KVHA 2GEXA 3Q90A 4KFEA 4WYKA 2PNCA 4R9KA 1C7HA 1M1XB 1AVLA 3K0ZA 1VQN3 5ELUA 3NBBA 4EBGA 2W03A 2RCDA 3B7CA 3CCE3 3WMDA 1OCVA 1SQWA 4L8OA 2BNGA 4NHFA 3JUOA 2YFIB 3K9MC 5TGNA 3GZXB 1UW1A 4J9AA 1UI8A 4J8TA 1G96A 3PGBA 2Y74A 1M1K4 1Q824 5JBSA 1NWWA 3STDA 4LGQA 4IIAA 1N8QA 5KP3A 3CCQ3 4EC6A 3SXXA 2P0MA 1VQ93 2BMOB 4QWTA 5D83A 2STDA 3ROBA 4LZIA 1K9M4 1U8CB 4HM5B 4ORLA 1L5GB 3FGYA 1N9JA 4FCZA 3WOFB 3AMOB 3F14A 4MJDA 3NQZA 4KZ1A 3BLZA 1A90A 3I0YA 4HM7B 3K7CA 4HM0B 5D82A 1IT8A 3BNEA 2W9QA 4X2HA 2B24B 3EF8A 3CCS3 3V92A 3EN8A 4H61A 2FNQA 3QK9A 3NQYA 1IK3A 4XDWA 4G1MB 2FGTA 5EVHA 3BNCA 5LC7A 3FKAA 2WGOA 1VQL3 3UL5A 1VQ63 2CFGA 2CWUA 3CC73 5AYSC 2CH9A 3G4S3 1DMNA 3EC9A 3X42A 1OACA 1ROAA 2QA43 3QRDA 1WMPA 1QMAA 1S5AA 3X41A 3GWRA 5FW5A 2MC8A 1WMOA 3VSYA 3X3XA 1ULJB 3FLJA 1YIJ3 4WYKB 1W5ZA 3MG1A 1VQ73 2ZL8A 1IQ8A 1GD3A 5AEWB 4XBTA 3SEDA 2FXTA 1OHPA 4RNZA 4STDA 1OGXA 1D6ZA 3B4OA 4HJLB 3NBRA 4N6OB 1JB2A 3MYTA 5CF2A 1YJW3 2SBLA 3HIIA 1SIHA 3IJEB 5IW9A 4KFDA 1N5HA 3LTAA 5AIHA 1US1A 3V98A 1Q40A 3WA3A 1TFKA 2PZVA 2CWTA 2XSHB 1M9GA 1OUNA 3CC43 3DGNA 3K63A 2ZDJA 4RBNA 3OWYA 4IPBA 1NDOB 2Z7AA 2W56A 3PCRA 2CC3A 1D6UA 5ELJA 1IVVA 3B4PA 1RKYA 1JKGB 5BVBA 5KP1A 2INXA 4U13A 3WODG 1FGMA 2CG0A 6STDA 1CYUA 2F99A 3JUQA 3KSED 2V1LA 1JB4A 1Q42A 4LMIA 5AI1A 1CYVA 4HM8B 1R4CA 2CW9A 1VQO3 2P38A 1SJWA 3HK4A 1LXEA 3KN4A 3LOYA 3MWZA 4BTWA 3SVAA 1FGOA 2LYXA 3CNMA 4FMBA 2WOHA 4L8PA 1FGTA 3U1WA 3DUKA 2OOVC 2XR8B 1KSIA 1QAFA 3EX9A 3FF2A 5AIIA 1UI7A 4XBXA 1JRQA 3O8YA 5AIGA 3SLUA 3FH1A 3ER7A 1ASKA 5BXQA 2XFTA 2GBXB 1KWIA 4R9LA 2OQEC 4FMCA 2QIYA 1EQKA 1IT7A 2HMNB 8CHOA 2XGNA 2CIUA 5KP4A 1A67A 1BUQA 2K54A 3T0UA 3G713 1O7PB 5JPPA 4TX4A 3IMAB 5DREA 3DXOA 2L4VA 3CU3A 3GRDA 2CFKA 1IVWA 2WO0A 3LZAA 4HM6B 2HMJB 1J2BA 1GY7A 1EG9B 2M7OA 4CCVA 1DVCA 3PXMA 3UJMA 3FZWA 3HX8A 1N9EA 3GZYB 3I563 3EQQB 1K41A 4LEHA 2XH9A 2CFLA 2P05A 1WQLB 4XB5A 4NREA 4HYZA 5D81A 1KQS2 1Y4KA 2OTL3 1MNLA 5JPUA 3BNDA 2XF3A 3JUPA 3LT8A 1IV9A 3D9RA 2XRXB 2YFJB 1JN5B 1W02A 3NV0B 1LVNA 2BO9B 1Q7Y4 2HMLB 1STFI 3HZPA 2RSXA 5LC6A 1QAKA 2CFWA 5IEPA 4MMZB 4BTXA 1OPYA 1DYUA 2KCDA 1O7WB 2MF7A 1IVXA 3U97A 1Z1SA 1RJOA 4HM1B 1MOLA 3FG3A 4HVNA 1ISKA 3NHXA 4N6TA 2CK3H 4FMDA 5I97A 1QVG2 1RN7A 3VF1A 3G16A 3F7SA 1JB5A 3JUMA 2C11A 2CKFB 2OCTA 1Q864 3HIGA 3X3ZA 3CCV3 1JJ22 1CQSA 1OF5B 1SPUA 4HM2B 3ECFA 1AVKA 4HKVB 3S29A 2ML6A 3PYJA 3CD63 1OH0A 1FUWA 3TDGA 4AKZA 2R4IA 4N6NB 1EA2A 4WFOA 5CK6A 1LOXA 3WDGB 1NB3I 3KSPA 1QVF2 3CME3 2Z76A 3F40A 4X2OA 3CCL3 5HGRA 2K0MA 2CFDA 1ULIB 2HMOB 3LH4A 4CDLA 3LT9A 1O7MB 1OHOA 1TFOA 2BHMA 4R1KA 3KKGA 1T5YA 3NX0A 3LMLA 3LTCA 3GZRA 3NUVA 4L7KA 3B8LA 3EHCA 1DMQA 3Q1CA 4FCMA 2D42A 3FCSB 2XFSA 4PEJA 2RFRA 4FR9A 4GL6A 2JQ5A 2P0XA 2IUJA 3H3HA 3DM8A 1E97A 1JN5A 3NV0A 3DGMA 1WNHA 3EJVA 2C10A 1TU5A 1FA3A 1W6CA 1F8NA 4ZM8A 4O3VA 3G8ZA 3EBTA 3WOEB 3F7XA 2W9PA 2HMMB 3NBJA 3RGAA 1GS3A 3L0RA 2GEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXO A;  4HM7 B;  1U5O A;  3K7C A;  3KE7 A;  3GRD A;  3CU3 A;  4HM0 B;  4HM6 B;  5D82 A;  3LZA A;  2HMJ B;  2HMK B;  3OWU A;  2B24 B;  4X2H A;  4XM4 A;  3EF8 A;  1JKG A;  1GY7 A;  1EG9 B;  1W6Y A;  4H3U A;  2W2C A;  3EN8 A;  3T8N A;  3SOA A;  2YFL B;  3FZW A;  3HX8 A;  3UJM A;  4Q53 A;  3LYG A;  3GZY B;  2UX0 A;  3EQQ B;  4XDW A;  3CNX A;  1K41 A;  1W00 A;  1UUW B;  3F8X A;  4LEH A;  3MG3 A;  5EVH A;  3SED A;  1WQL B;  2F86 B;  3SOY A;  3S5C A;  4XB5 A;  4GB5 A;  2GBW B;  5D81 A;  1OGZ A;  1OF5 A;  3FKA A;  3OV4 A;  5JPU A;  3EBY A;  3JUP A;  5IG3 A;  5G2G A;  4WP5 A;  3OXA A;  3VGN A;  4RZM A;  5CF1 A;  3D9R A;  2XRX B;  2YFJ B;  1DMN A;  2F98 A;  3BB9 A;  1W02 A;  2CHC A;  1JN5 B;  3EC9 A;  3NV0 B;  4OVM A;  2HML B;  1STD A;  4K1V A;  2B1X B;  3HZP A;  4HM3 B;  3STD A;  3OWS A;  1QMA A;  1S5A A;  2XSO B;  3DZL A;  3MKI A;  4FCJ A;  1IDP A;  4XBY A;  5IEP A;  1OPY A;  1O7W B;  1OHS A;  3GWR A;  1TP6 A;  1Z1S A;  5DRV A;  4XDV A;  5FW5 A;  3VSY A;  5CF2 A;  5IF6 A;  2BMR B;  1A2K A;  1ULJ B;  3FLJ A;  4HM1 B;  4HVN A;  3NHX A;  3F9S A;  1GY5 A;  4WYK B;  5STD A;  7STD A;  3MG1 A;  1AR0 A;  3NM2 A;  1O7G B;  3FSD A;  3G16 A;  3F7S A;  3MG2 A;  1JB5 A;  5IER A;  3JUM A;  5AEW B;  2CKF B;  3NXJ A;  4HM4 B;  5IG5 A;  4XBT A;  1TUH A;  1W01 A;  3OX9 A;  3RGR A;  1OHP A;  3JUN A;  1Q40 B;  1CQS A;  1OF5 B;  2OWP A;  1GYB A;  1OGX A;  3E99 A;  4HM2 B;  5IEN A;  3ECF A;  3H51 A;  3B4O A;  4HJL B;  4HKV B;  3NBR A;  1QJG A;  1JB2 A;  3MYT A;  1VZZ A;  2GXF A;  1ZO2 A;  3F8H A;  5CLK A;  4N3V A;  5IG0 A;  1OH0 A;  4K1U A;  3CPO A;  4HZ9 B;  3MHE A;  5AIH A;  4WWU C;  1Q40 A;  1O7N B;  2R4I A;  5IEO A;  1EA2 A;  5CK6 A;  2PZV A;  2XSH B;  2A15 A;  3IPT A;  3MSO A;  3UNL A;  3M8C A;  1E3R A;  1OUN A;  3KSP A;  1E3V A;  3OWY A;  2RGQ A;  3DMC A;  2Z76 A;  4HZB B;  1NDO B;  2Z7A A;  3F40 A;  4X2O A;  3B4P A;  5HGR A;  3KZT A;  4KVH A;  1ZX2 A;  2GEX A;  3Q90 A;  4WYK A;  1ULI B;  2HMO B;  5DRE A;  1JKG B;  4CDL A;  5BVB A;  4R9K A;  1C7H A;  1O7M B;  1OHO A;  3K0Z A;  4R1K A;  3GZB A;  5KP1 A;  2INX A;  4STD A;  2IMJ A;  3G0K A;  3KKG A;  4U13 A;  2RCD A;  3B7C A;  3WMD A;  6STD A;  2I9W A;  1OCV A;  2F99 A;  3GZR A;  3NUV A;  4L7K A;  5AEU B;  3B8L A;  3EHC A;  3JUQ A;  1DMQ A;  2BNG A;  4L8O A;  4FCM A;  3JUO A;  2YFI B;  2BMQ B;  1JB4 A;  1Q42 A;  4LMI A;  4PEJ A;  2Z77 A;  5AI1 A;  4HM8 B;  5TGN A;  3GZX B;  5AIF A;  2RFR A;  4J9A A;  3HK4 A;  1SJW A;  4J8T A;  3A76 A;  2JQ5 A;  3CNM A;  1NWW A;  3H3H A;  1HKX A;  1O7H B;  3DM8 A;  3EN1 B;  4IIA A;  1E97 A;  1JN5 A;  3NV0 A;  4L8P A;  4LGQ A;  1UUV B;  3DUK A;  5KP3 A;  2XR8 B;  3EX9 A;  3FF2 A;  5AII A;  4OUQ A;  3EJV A;  4XBX A;  5AIG A;  5BXQ A;  3FH1 A;  2BMO B;  1ASK A;  3ER7 A;  4I4K A;  5D83 A;  2GBX B;  2STD A;  3FF0 A;  1GY6 A;  1NU3 A;  4R9L A;  3ROB A;  4ORL A;  4HM5 B;  3FGY A;  2QIY A;  5IG4 A;  5CXO A;  1ISK A;  2HMN B;  2QGU A;  3G8Z A;  3EBT A;  8CHO A;  3F14 A;  3F7X A;  5KP4 A;  1BUQ A;  2HMM B;  1DMM A;  2K54 A;  1O7P B;  4MJD A;  3RGA A;  3T8U A;  3BLZ A;  5JPP A;  1GS3 A;  3I0Y A;  2GEY A; 
#chains in the Genus database with same CATH topology
 1KD1 4;  1RRL A;  1LRA A;  1AV4 A;  3OWU A;  3J7Y d;  4XM4 A;  1DVD A;  2GU3 A;  5G1L A;  1CEW I;  2W2C A;  3T8N A;  1I8V A;  1QAL A;  3LYG A;  1YHQ 3;  1K28 A;  2GU1 A;  3FG1 A;  3F8X A;  3MG3 A;  3SOY A;  2F86 B;  4GB5 A;  2H0I A;  3LTD A;  4JRF A;  1UGH I;  2QEX 3;  3WA2 X;  2RBI A;  3DH2 A;  4N6M A;  5G2G A;  4BTY A;  1VQ8 3;  4HOH A;  3OXA A;  4K61 A;  1NB5 I;  4RZM A;  1BGS A;  1JZD A;  1GOU A;  1LQM B;  5CF1 A;  3BB9 A;  2CHC A;  2CWV A;  3ALA A;  4OVM A;  1VQ5 3;  3DY5 A;  4K1V A;  1GD4 A;  4HM3 B;  3OWS A;  4HBR A;  1PY3 A;  1YVB I;  5M19 A;  1V57 A;  3D4A A;  2OTJ 3;  3DZL A;  1IDP A;  1LNH A;  2ZA4 A;  4HAA A;  2CX1 A;  3PS8 A;  4OK0 A;  4XDV A;  2W56 B;  1EKM A;  5EEO A;  3SYU A;  1IV7 A;  1BRH A;  2ML5 A;  2IUK A;  1BSD A;  3F9S A;  5STD A;  7STD A;  1AR0 A;  3NM2 A;  3FSD A;  4MMX B;  1B21 A;  3MG2 A;  1RRH A;  1TIJ A;  3NXJ A;  1SII A;  4HM4 B;  5IG5 A;  2KF5 A;  1TUH A;  4MEI A;  3RGR A;  4EXR A;  3G6E 3;  1Q40 B;  1I0X A;  2OWP A;  1IU7 A;  5IEN A;  1JV2 B;  4IT7 A;  3SX1 A;  4BL2 A;  3H51 A;  3ZG5 A;  1TTO A;  5GSP A;  1QJG A;  3S5C A;  5IG0 A;  5CLK A;  2GXF A;  1MWR A;  3F8H A;  3S67 A;  4N3V A;  4K90 B;  4K1U A;  1IQX A;  1RDS A;  2D1W A;  3CPO A;  3KII A;  1W6G A;  3X3Y A;  5IEO A;  4N6U A;  1Q81 4;  3CMA 3;  3S28 A;  3MPH A;  1BVI A;  2ZHX B;  3MSO A;  2KXG A;  1BSB A;  2KAA A;  3M8C A;  1YGE A;  1E3R A;  2KF6 A;  4EV2 A;  2Q07 A;  4MMY B;  1VQO 3;  1E3V A;  4HZB B;  2RGQ A;  1YIT 3;  1CH0 A;  2W0Q A;  5BU4 A;  1ZX2 A;  2E2T A;  3CXC 2;  1IYY A;  3GZB A;  3UB1 A;  3Q3F A;  1BAN A;  2IMJ A;  3G0K A;  4FMA A;  1I0V A;  2K3D A;  3LTB A;  1VQ4 3;  2I9W A;  3UL6 A;  5AEU B;  4DKI A;  1VQM 3;  4GHO A;  5G1K A;  2WOF A;  2BMQ B;  3LXU X;  1D6Y A;  2Z77 A;  4LYL B;  5AIF A;  1WMN A;  2XEP A;  1W7C A;  3A76 A;  1W2B 2;  1VQP 3;  2O3O A;  3BNB A;  2IYJ A;  1HKX A;  1O7H B;  1RGL A;  3EN1 B;  3GSP A;  4N6L A;  4O8S A;  1YJ9 3;  1S72 3;  1UUV B;  1WTH A;  1NO3 A;  4O2H A;  2YX9 A;  4OUQ A;  4EV5 A;  3N8B A;  2CX0 A;  4I4K A;  3PCS A;  1MGR A;  1GY6 A;  1NU3 A;  1B27 A;  3FF0 A;  2KF4 A;  3OW2 2;  1ROV A;  3CPW 2;  3EB8 A;  5IG4 A;  1RNB A;  5CXO A;  1W4N A;  2QGU A;  1RHL A;  3HI7 A;  5BIR A;  1JNQ A;  1SAR A;  1RGH A;  5M1A A;  1GSP A;  1DMM A;  3T8U A;  2KRT A;  4EYC A;  2XGL A;  6RNT A;  1KC8 4;  3AHW A;  1U5O A;  4KFF A;  3KE7 A;  4AKY A;  1B2U A;  1K73 4;  2HMK B;  2Y73 A;  3V99 A;  5AYR B;  1JKG A;  1W6Y A;  1LOY A;  4H3U A;  4WHA A;  1A2P A;  3JVC A;  3CCU 3;  3SOA A;  1X1X A;  1A2V A;  2IA7 A;  2YFL B;  2W6J H;  3AMO A;  3NM7 A;  4Q53 A;  1ZGX A;  3D3L A;  2UX0 A;  1FUS A;  1W00 A;  1GOV A;  1UUW B;  3CNX A;  3N9H A;  2GBW B;  5M18 A;  1OGZ A;  1OF5 A;  1RGA A;  3OV4 A;  2E2V A;  3EE1 A;  2O9U X;  3DGL A;  3CCR 3;  3EBY A;  5IG3 A;  5EQL A;  4WP5 A;  3CCJ 3;  3VGN A;  2E2U A;  3PZW A;  1IVU A;  3FG4 A;  1FGQ A;  2F98 A;  1HU9 A;  2P09 A;  4I5Q A;  3S27 A;  3CC2 3;  1STD A;  2B1X B;  1YJN 3;  2C4B A;  1T2H A;  2XSO B;  1W2Z A;  3MKI A;  4FCJ A;  3Q2P A;  4XBY A;  4AEQ A;  1PU4 A;  1PFP A;  1K8A 4;  1OHS A;  1RN4 A;  3AGN A;  2Z6B A;  1TP6 A;  5DRV A;  5A0O B;  1RGC A;  3K5T A;  2W04 A;  4RNY A;  5IF6 A;  2BMR B;  3I55 3;  1A2K A;  1BSC A;  2LQV A;  1GY5 A;  1RCL A;  1RGG A;  1O7G B;  2CG1 A;  1IQY A;  3CCM 3;  1YI2 3;  2SAR A;  1UCL A;  5IER A;  2BT3 A;  2WGQ A;  3N54 B;  1N8R 4;  1W01 A;  3OX9 A;  3JUN A;  1M90 4;  1TRP A;  1GYB A;  2R41 A;  3E99 A;  1I3I A;  4R4K A;  1FGR A;  1VZZ A;  1RNT A;  1ZO2 A;  1V74 A;  2JDI H;  3GAX A;  3KCH A;  3BU4 A;  4HZ9 B;  1C54 A;  3MHE A;  4O02 B;  4WWU C;  4BU4 A;  1O7N B;  1DE3 A;  1HZ1 A;  5FGO A;  1BNG A;  2OQE A;  4LSO A;  1N5P A;  2A15 A;  3IPT A;  3UNL A;  1NJI 4;  4N6V 0;  1RCK A;  3DGO A;  4JF8 A;  3DMC A;  3KFQ C;  4R80 A;  3RDE A;  3X40 A;  1VQK 3;  4BL3 A;  2OOV A;  3HOH A;  3KZT A;  4KVH A;  2GEX A;  3Q90 A;  4KFE A;  4WYK A;  2PNC A;  2HOH A;  4R9K A;  1C7H A;  1M1X B;  1AVL A;  3K0Z A;  1DET A;  5ELU A;  1VQN 3;  3NBB A;  4EBG A;  2W03 A;  2RCD A;  1LOV A;  3B7C A;  3CCE 3;  3WMD A;  1OCV A;  1SQW A;  4KT3 B;  4L8O A;  2BNG A;  4NHF A;  3JUO A;  1X1Y A;  2YFI B;  9RNT A;  1BNJ A;  3K9M C;  5TGN A;  3GZX B;  1UW1 A;  4J9A A;  1UI8 A;  4J8T A;  1G96 A;  3PGB A;  2Y74 A;  1BSA A;  2F56 A;  1M1K 4;  1Q82 4;  1Q9E A;  1NWW A;  1YGW A;  5JBS A;  3STD A;  2BU4 A;  4IIA A;  4LGQ A;  1N8Q A;  5KP3 A;  3CCQ 3;  4EC6 A;  3SXX A;  2P0M A;  1B2S A;  1RTU A;  1VQ9 3;  2BMO B;  4QWT A;  5D83 A;  2STD A;  3ROB A;  4LZI A;  1K9M 4;  1U8C B;  4HM5 B;  4ORL A;  1L5G B;  1X1W A;  3FGY A;  1N9J A;  4FCZ A;  3WOF B;  3WHO A;  3AMO B;  3D5G A;  2F5M A;  3F14 A;  4MJD A;  3NQZ A;  4KZ1 A;  3BLZ A;  1A90 A;  3I0Y A;  1BU4 A;  1B3S A;  4HM7 B;  3K7C A;  4HM0 B;  5D82 A;  1IT8 A;  1B2Z A;  3BNE A;  2W9Q A;  4X2H A;  2B24 B;  3EF8 A;  3CCS 3;  3V92 A;  2F4Y A;  3EN8 A;  4H61 A;  2FNQ A;  1LQG C;  3QK9 A;  1BUJ A;  3NQY A;  1IK3 A;  4XDW A;  4G1M B;  2FGT A;  5EVH A;  4EW5 A;  1YVS A;  1FW7 A;  2F5W A;  1MWS A;  3BNC A;  1R4Y A;  5LC7 A;  3FKA A;  2WGO A;  3DGY A;  1VQL 3;  3UL5 A;  1VQ6 3;  2CFG A;  4NPB A;  2CWU A;  3ZG0 A;  3CC7 3;  5AYS C;  2CH9 A;  1TJD A;  3G4S 3;  1DMN A;  3EC9 A;  3X42 A;  1OAC A;  1ROA A;  2QA4 3;  1BOX A;  2J8X B;  3QRD A;  1WMP A;  1QMA A;  1EUI C;  1S5A A;  3AHS A;  1FZU A;  3X41 A;  3GWR A;  1UCI A;  5FW5 A;  2MC8 A;  1WMO A;  3VSY A;  3X3X A;  1BRI A;  1EEJ A;  1ULJ B;  3FLJ A;  4J5G A;  4WYK B;  1YIJ 3;  1W5Z A;  3MG1 A;  1BRG A;  1VQ7 3;  2GSP A;  2ZL8 A;  1IQ8 A;  1JZO A;  1GD3 A;  5AEW B;  1T3B A;  4XBT A;  2FXT A;  2H0G A;  3SED A;  1GOY A;  1OHP A;  4RNZ A;  4STD A;  1GMP A;  1OGX A;  1D6Z A;  1G0T A;  6GSP A;  3B4O A;  4HJL B;  3NBR A;  4N6O B;  1JB2 A;  3MYT A;  5CF2 A;  1YJW 3;  2SBL A;  3HII A;  1SIH A;  3IJE B;  7RNT A;  5IW9 A;  4KFD A;  2KF3 A;  1N5H A;  3LTA A;  5AIH A;  1US1 A;  3V98 A;  1Q40 A;  1HYF A;  3WA3 A;  1TFK A;  2PZV A;  2CWT A;  2XSH B;  2UUG C;  1M9G A;  1OUN A;  3CC4 3;  1X1U A;  3DGN A;  3K63 A;  2ZDJ A;  4RBN A;  3OWY A;  4BIR A;  1JBT A;  4IPB A;  1NDO B;  2Z7A A;  1I2E A;  2W56 A;  3PCR A;  2CC3 A;  1D6U A;  5ELJ A;  1IVV A;  3B4P A;  1RKY A;  1JKG B;  5BVB A;  3ZFZ A;  1B2X A;  3URP A;  2AAD A;  1RGK A;  5KP1 A;  2INX A;  4U13 A;  3WOD G;  1FGM A;  2CG0 A;  6STD A;  1BIR A;  1YNV X;  1CYU A;  2F99 A;  1RLS A;  3JUQ A;  3KSE D;  2V1L A;  1JB4 A;  1Q42 A;  4LMI A;  1ZS7 A;  1V58 A;  1CYV A;  5AI1 A;  4HM8 B;  1R4C A;  2CW9 A;  4CPK A;  1Q7H A;  1UGI A;  1SJW A;  2P38 A;  1LXE A;  3HK4 A;  3KN4 A;  3LOY A;  3MWZ A;  4BTW A;  3SVA A;  1FGO A;  2LYX A;  4CJN A;  3CNM A;  4FMB A;  2WOH A;  4L8P A;  1FGT A;  1BRK A;  3DUK A;  2OOV C;  3U1W A;  5RNT A;  2XR8 B;  1KSI A;  1QAF A;  3EX9 A;  3FF2 A;  5AII A;  1UI7 A;  4XBX A;  1JRQ A;  3O8Y A;  5AIG A;  1MWU A;  3FH1 A;  3ER7 A;  1ASK A;  3SLU A;  2XFT A;  5BXQ A;  2GBX B;  1KWI A;  4R9L A;  3RNT A;  2OQE C;  4FMC A;  2QIY A;  1EQK A;  1IT7 A;  1BSE A;  2HMN B;  8CHO A;  2XGN A;  2CIU A;  5KP4 A;  1A67 A;  1BUQ A;  2K54 A;  3T0U A;  3G71 3;  1O7P B;  1PYL A;  5JPP A;  4TX4 A;  1FUT A;  3IMA B;  5DRE A;  3DXO A;  1FYS A;  2L4V A;  1UDI I;  3BIR A;  2CFK A;  1IVW A;  2WO0 A;  3CU3 A;  3GRD A;  1RSN A;  2HMJ B;  3LZA A;  4HM6 B;  1J2B A;  2L1S A;  1GY7 A;  1EG9 B;  2M7O A;  4CCV A;  1DVC A;  3WR2 A;  3PXM A;  3UJM A;  3FZW A;  3HX8 A;  1N9E A;  3GZY B;  3I56 3;  3EQQ B;  1K41 A;  4LEH A;  2XH9 A;  1LNI A;  2CFL A;  2P05 A;  1WQL B;  4XB5 A;  4NRE A;  4HYZ A;  5D81 A;  1KQS 2;  1Y4K A;  1I2G A;  2OTL 3;  1MNL A;  2AAE A;  5JPU A;  3BND A;  2XF3 A;  3JUP A;  1BNS A;  3LT8 A;  7GSP A;  4GSP A;  1IV9 A;  3D9R A;  2XRX B;  2YFJ B;  1JN5 B;  1W02 A;  3NV0 B;  1LVN A;  1GMR A;  2BO9 B;  2HML B;  1Q7Y 4;  1STF I;  1BNE A;  3HZP A;  1RGF A;  1RMS A;  2RSX A;  5LC6 A;  1QAK A;  2CFW A;  8RNT A;  4MMZ B;  5IEP A;  1BAO A;  1BRJ A;  4BTX A;  1OPY A;  1DYU A;  1BRS A;  1O7W B;  2KCD A;  1IVX A;  2MF7 A;  1Z1S A;  3D5I A;  3U97 A;  1RJO A;  4HM1 B;  1MOL A;  1I3F A;  3FG3 A;  4HVN A;  3NHX A;  4N6T A;  2CK3 H;  1BRN L;  1ISK A;  1G02 A;  4FMD A;  5I97 A;  1RN7 A;  1QVG 2;  3VF1 A;  3G16 A;  3F7S A;  1JB5 A;  3JUM A;  2C11 A;  2CKF B;  2OCT A;  1Q86 4;  3HIG A;  3X3Z A;  3CCV 3;  1JJ2 2;  1CQS A;  1MWT A;  1SPU A;  1OF5 B;  4HM2 B;  3A5E A;  1UUG B;  3ECF A;  2BIR A;  1AVK A;  2RNT A;  4HKV B;  3S29 A;  2ML6 A;  3PYJ A;  3CD6 3;  1OH0 A;  1FUW A;  1LOW A;  3TDG A;  1GMQ A;  4AKZ A;  2R4I A;  4N6N B;  1EA2 A;  4WFO A;  1VQQ A;  5CK6 A;  1LOX A;  4J5K A;  3WDG B;  4ILF A;  1NB3 I;  3KSP A;  1QVF 2;  3CME 3;  1B20 A;  2Z76 A;  3F40 A;  4X2O A;  3CCL 3;  5HGR A;  2K0M A;  1BNR A;  2CFD A;  1ULI B;  2HMO B;  3LH4 A;  4CDL A;  1AY7 A;  1NNV A;  3AGO A;  3LT9 A;  1O7M B;  1OHO A;  1TFO A;  1RGE A;  1TRQ A;  2BHM A;  4R1K A;  3KKG A;  1MGW A;  1UCJ A;  1T5Y A;  3NX0 A;  3LML A;  1JBS A;  3LTC A;  3GZR A;  3NUV A;  4L7K A;  3B8L A;  3EHC A;  1DMQ A;  3Q1C A;  4FCM A;  2D42 A;  3D79 A;  3FCS B;  1BNF A;  1RN1 A;  2XFS A;  4PEJ A;  2RFR A;  1BNI A;  4FR9 A;  4GL6 A;  2JQ5 A;  2P0X A;  2IUJ A;  3H3H A;  3DM8 A;  1E97 A;  1JN5 A;  1I2F A;  3NV0 A;  3DGM A;  1WNH A;  1T2I A;  3EJV A;  2C10 A;  1JBR A;  1TU5 A;  1FA3 A;  1B2M A;  1W6C A;  1F8N A;  1UCK A;  4ZM8 A;  2H0H A;  4RNT A;  4O3V A;  2IY2 A;  3G8Z A;  5HOH A;  3EBT A;  3WOE B;  3F7X A;  1I70 A;  2W9P A;  1AQZ A;  2HMM B;  2UGI A;  3NBJ A;  3RGA A;  1GS3 A;  3L0R A;  2GEY A; 
#chains in the Genus database with same CATH homology
 1KD1 4;  1RRL A;  1AV4 A;  3OWU A;  3J7Y d;  4XM4 A;  1DVD A;  2GU3 A;  1CEW I;  2W2C A;  3T8N A;  1QAL A;  1YHQ 3;  3LYG A;  1K28 A;  2GU1 A;  3FG1 A;  3F8X A;  3MG3 A;  3SOY A;  2F86 B;  4GB5 A;  3LTD A;  4JRF A;  2QEX 3;  3WA2 X;  4N6M A;  5G2G A;  4BTY A;  1VQ8 3;  3OXA A;  4K61 A;  1NB5 I;  4RZM A;  5CF1 A;  3BB9 A;  2CHC A;  2CWV A;  3ALA A;  4OVM A;  1VQ5 3;  3DY5 A;  4K1V A;  1GD4 A;  4HM3 B;  3OWS A;  4HBR A;  1YVB I;  2OTJ 3;  3DZL A;  1IDP A;  1LNH A;  3PS8 A;  4OK0 A;  4XDV A;  2W56 B;  1EKM A;  5EEO A;  1IV7 A;  2ML5 A;  2IUK A;  3F9S A;  5STD A;  7STD A;  1AR0 A;  3NM2 A;  3FSD A;  4MMX B;  3MG2 A;  1RRH A;  1TIJ A;  3NXJ A;  1SII A;  4HM4 B;  5IG5 A;  3G6E 3;  1TUH A;  4MEI A;  3RGR A;  4EXR A;  1Q40 B;  2OWP A;  5IEN A;  1IU7 A;  1JV2 B;  4IT7 A;  3SX1 A;  3H51 A;  3S5C A;  1QJG A;  5IG0 A;  5CLK A;  2GXF A;  3S67 A;  3F8H A;  4N3V A;  4K90 B;  4K1U A;  1IQX A;  2D1W A;  3CPO A;  3KII A;  1W6G A;  3X3Y A;  5IEO A;  4N6U A;  1Q81 4;  3CMA 3;  3S28 A;  3MPH A;  3MSO A;  2KXG A;  3M8C A;  1YGE A;  1E3R A;  4EV2 A;  2Q07 A;  4MMY B;  1E3V A;  4HZB B;  2RGQ A;  1YIT 3;  2W0Q A;  1ZX2 A;  2E2T A;  3CXC 2;  3GZB A;  3UB1 A;  2IMJ A;  3G0K A;  4FMA A;  3LTB A;  1VQ4 3;  2I9W A;  3UL6 A;  5AEU B;  1VQM 3;  2WOF A;  2BMQ B;  3LXU X;  1D6Y A;  2Z77 A;  5AIF A;  1WMN A;  2XEP A;  1W7C A;  3A76 A;  1W2B 2;  1VQP 3;  2O3O A;  3BNB A;  1HKX A;  1O7H B;  3EN1 B;  4O8S A;  4N6L A;  1YJ9 3;  1S72 3;  1UUV B;  1WTH A;  1NO3 A;  4O2H A;  2YX9 A;  4OUQ A;  4EV5 A;  3N8B A;  4I4K A;  3PCS A;  3FF0 A;  1GY6 A;  1NU3 A;  3OW2 2;  1ROV A;  3CPW 2;  3EB8 A;  5IG4 A;  5CXO A;  1W4N A;  2QGU A;  3HI7 A;  1JNQ A;  3T8U A;  1DMM A;  4EYC A;  2KRT A;  2XGL A;  1KC8 4;  1U5O A;  4KFF A;  3KE7 A;  4AKY A;  1K73 4;  2HMK B;  2Y73 A;  3V99 A;  5AYR B;  1JKG A;  1W6Y A;  4H3U A;  4WHA A;  3JVC A;  3CCU 3;  3SOA A;  1A2V A;  2IA7 A;  2YFL B;  2W6J H;  3AMO A;  3NM7 A;  4Q53 A;  3D3L A;  2UX0 A;  3CNX A;  1W00 A;  1UUW B;  3N9H A;  2GBW B;  1OGZ A;  1OF5 A;  3OV4 A;  2E2V A;  3EE1 A;  2O9U X;  3DGL A;  3CCR 3;  3EBY A;  5IG3 A;  5EQL A;  4WP5 A;  3CCJ 3;  3VGN A;  2E2U A;  3PZW A;  1IVU A;  3FG4 A;  1FGQ A;  2F98 A;  1HU9 A;  2P09 A;  3S27 A;  3CC2 3;  1STD A;  2B1X B;  1YJN 3;  2XSO B;  1W2Z A;  3MKI A;  4FCJ A;  3Q2P A;  4XBY A;  4AEQ A;  1PU4 A;  1PFP A;  1K8A 4;  1OHS A;  2Z6B A;  1TP6 A;  5DRV A;  5A0O B;  4RNY A;  3K5T A;  2W04 A;  5IF6 A;  3I55 3;  2BMR B;  1A2K A;  2LQV A;  1GY5 A;  1O7G B;  2CG1 A;  1IQY A;  3CCM 3;  1YI2 3;  5IER A;  2BT3 A;  2WGQ A;  3N54 B;  1N8R 4;  1W01 A;  3OX9 A;  3JUN A;  1M90 4;  1GYB A;  3E99 A;  4R4K A;  1FGR A;  1VZZ A;  1ZO2 A;  3GAX A;  1V74 A;  2JDI H;  4HZ9 B;  3MHE A;  4O02 B;  4WWU C;  1O7N B;  5FGO A;  2OQE A;  4LSO A;  1N5P A;  2A15 A;  3IPT A;  3UNL A;  1NJI 4;  4N6V 0;  3DGO A;  4JF8 A;  3DMC A;  3KFQ C;  4R80 A;  3RDE A;  3X40 A;  1VQK 3;  2OOV A;  3KZT A;  4KVH A;  2GEX A;  3Q90 A;  4KFE A;  4WYK A;  2PNC A;  4R9K A;  1C7H A;  1M1X B;  1AVL A;  3K0Z A;  1VQN 3;  5ELU A;  3NBB A;  4EBG A;  2W03 A;  2RCD A;  3B7C A;  3CCE 3;  3WMD A;  1OCV A;  1SQW A;  4L8O A;  2BNG A;  4NHF A;  3JUO A;  2YFI B;  3K9M C;  5TGN A;  3GZX B;  1UW1 A;  4J9A A;  1UI8 A;  4J8T A;  1G96 A;  3PGB A;  2Y74 A;  1M1K 4;  1Q82 4;  5JBS A;  1NWW A;  3STD A;  4LGQ A;  4IIA A;  1N8Q A;  5KP3 A;  3CCQ 3;  4EC6 A;  3SXX A;  2P0M A;  1VQ9 3;  2BMO B;  4QWT A;  5D83 A;  2STD A;  3ROB A;  4LZI A;  1K9M 4;  1U8C B;  4HM5 B;  4ORL A;  1L5G B;  3FGY A;  1N9J A;  4FCZ A;  3WOF B;  3AMO B;  3F14 A;  4MJD A;  3NQZ A;  4KZ1 A;  3BLZ A;  1A90 A;  3I0Y A;  4HM7 B;  3K7C A;  4HM0 B;  5D82 A;  1IT8 A;  3BNE A;  2W9Q A;  4X2H A;  2B24 B;  3EF8 A;  3CCS 3;  3V92 A;  3EN8 A;  4H61 A;  2FNQ A;  3QK9 A;  3NQY A;  1IK3 A;  4XDW A;  4G1M B;  2FGT A;  5EVH A;  3BNC A;  5LC7 A;  3FKA A;  2WGO A;  1VQL 3;  3UL5 A;  1VQ6 3;  2CFG A;  2CWU A;  3CC7 3;  5AYS C;  2CH9 A;  3G4S 3;  1DMN A;  3EC9 A;  3X42 A;  1OAC A;  1ROA A;  2QA4 3;  3QRD A;  1WMP A;  1QMA A;  1S5A A;  3X41 A;  3GWR A;  5FW5 A;  2MC8 A;  1WMO A;  3VSY A;  3X3X A;  1ULJ B;  3FLJ A;  1YIJ 3;  4WYK B;  1W5Z A;  3MG1 A;  1VQ7 3;  2ZL8 A;  1IQ8 A;  1GD3 A;  5AEW B;  4XBT A;  3SED A;  2FXT A;  1OHP A;  4RNZ A;  4STD A;  1OGX A;  1D6Z A;  3B4O A;  4HJL B;  3NBR A;  4N6O B;  1JB2 A;  3MYT A;  5CF2 A;  1YJW 3;  2SBL A;  3HII A;  1SIH A;  3IJE B;  5IW9 A;  4KFD A;  1N5H A;  3LTA A;  5AIH A;  1US1 A;  3V98 A;  1Q40 A;  3WA3 A;  1TFK A;  2PZV A;  2CWT A;  2XSH B;  1M9G A;  1OUN A;  3CC4 3;  3DGN A;  3K63 A;  2ZDJ A;  4RBN A;  3OWY A;  4IPB A;  1NDO B;  2Z7A A;  2W56 A;  3PCR A;  2CC3 A;  1D6U A;  5ELJ A;  1IVV A;  3B4P A;  1RKY A;  1JKG B;  5BVB A;  5KP1 A;  2INX A;  4U13 A;  3WOD G;  1FGM A;  2CG0 A;  6STD A;  1CYU A;  2F99 A;  3JUQ A;  3KSE D;  2V1L A;  1JB4 A;  1Q42 A;  4LMI A;  5AI1 A;  1CYV A;  4HM8 B;  1R4C A;  2CW9 A;  1VQO 3;  2P38 A;  1SJW A;  3HK4 A;  1LXE A;  3KN4 A;  3LOY A;  3MWZ A;  4BTW A;  3SVA A;  1FGO A;  2LYX A;  3CNM A;  4FMB A;  2WOH A;  4L8P A;  1FGT A;  3U1W A;  3DUK A;  2OOV C;  2XR8 B;  1KSI A;  1QAF A;  3EX9 A;  3FF2 A;  5AII A;  1UI7 A;  4XBX A;  1JRQ A;  3O8Y A;  5AIG A;  3SLU A;  3FH1 A;  3ER7 A;  1ASK A;  5BXQ A;  2XFT A;  2GBX B;  1KWI A;  4R9L A;  2OQE C;  4FMC A;  2QIY A;  1EQK A;  1IT7 A;  2HMN B;  8CHO A;  2XGN A;  2CIU A;  5KP4 A;  1A67 A;  1BUQ A;  2K54 A;  3T0U A;  3G71 3;  1O7P B;  5JPP A;  4TX4 A;  3IMA B;  5DRE A;  3DXO A;  2L4V A;  3CU3 A;  3GRD A;  2CFK A;  1IVW A;  2WO0 A;  3LZA A;  4HM6 B;  2HMJ B;  1J2B A;  1GY7 A;  1EG9 B;  2M7O A;  4CCV A;  1DVC A;  3PXM A;  3UJM A;  3FZW A;  3HX8 A;  1N9E A;  3GZY B;  3I56 3;  3EQQ B;  1K41 A;  4LEH A;  2XH9 A;  2CFL A;  2P05 A;  1WQL B;  4XB5 A;  4NRE A;  4HYZ A;  5D81 A;  1KQS 2;  1Y4K A;  2OTL 3;  1MNL A;  5JPU A;  3BND A;  2XF3 A;  3JUP A;  3LT8 A;  1IV9 A;  3D9R A;  2XRX B;  2YFJ B;  1JN5 B;  1W02 A;  3NV0 B;  1LVN A;  2BO9 B;  1Q7Y 4;  2HML B;  1STF I;  3HZP A;  2RSX A;  5LC6 A;  1QAK A;  2CFW A;  5IEP A;  4MMZ B;  4BTX A;  1OPY A;  1DYU A;  2KCD A;  1O7W B;  2MF7 A;  1IVX A;  3U97 A;  1Z1S A;  1RJO A;  4HM1 B;  1MOL A;  3FG3 A;  4HVN A;  1ISK A;  3NHX A;  4N6T A;  2CK3 H;  4FMD A;  5I97 A;  1QVG 2;  1RN7 A;  3VF1 A;  3G16 A;  3F7S A;  1JB5 A;  3JUM A;  2C11 A;  2CKF B;  2OCT A;  1Q86 4;  3HIG A;  3X3Z A;  3CCV 3;  1JJ2 2;  1CQS A;  1OF5 B;  1SPU A;  4HM2 B;  3ECF A;  1AVK A;  4HKV B;  3S29 A;  2ML6 A;  3PYJ A;  3CD6 3;  1OH0 A;  1FUW A;  3TDG A;  4AKZ A;  2R4I A;  4N6N B;  1EA2 A;  4WFO A;  5CK6 A;  1LOX A;  3WDG B;  1NB3 I;  3KSP A;  1QVF 2;  3CME 3;  2Z76 A;  3F40 A;  4X2O A;  3CCL 3;  5HGR A;  2K0M A;  2CFD A;  1ULI B;  2HMO B;  3LH4 A;  4CDL A;  3LT9 A;  1O7M B;  1OHO A;  1TFO A;  2BHM A;  4R1K A;  3KKG A;  1T5Y A;  3NX0 A;  3LML A;  3LTC A;  3GZR A;  3NUV A;  4L7K A;  3B8L A;  3EHC A;  1DMQ A;  3Q1C A;  4FCM A;  2D42 A;  3FCS B;  2XFS A;  4PEJ A;  2RFR A;  4FR9 A;  4GL6 A;  2JQ5 A;  2P0X A;  2IUJ A;  3H3H A;  3DM8 A;  1E97 A;  1JN5 A;  3NV0 A;  3DGM A;  1WNH A;  3EJV A;  2C10 A;  1TU5 A;  1FA3 A;  1W6C A;  1F8N A;  4ZM8 A;  4O3V A;  3G8Z A;  3EBT A;  3WOE B;  3F7X A;  2W9P A;  2HMM B;  3NBJ A;  3RGA A;  1GS3 A;  3L0R A;  2GEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...