5IG4A

Crystal structure of n. vectensis camkii-a hub
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
129
Chain Sequence
TAKVREQEIIRLTQKLITSITTGDYDTYSKLVDPHVTCFEPFSNGNLVEGLEFHKFYFDNTLSKVPINTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFHISGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Predicted protein
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Transferase
total genus 34
structure length 129
sequence length 131
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig4A00
4L8OA 3KZTA 4HZBB 4Q53A 3LZAA 2B1XB 3B8LA 1K41A 5AEWB 3SOYA 5CK6A 2HMOB 3NHXA 2XSHB 3MKIA 3B4OA 3KE7A 2RGQA 1BUQA 4CDLA 1JKGA 3I0YA 4XM4A 5D83A 3EN1B 4R9KA 1W00A 3LYGA 1JKGB 5IG4A 5AIFA 3JUNA 3OXAA 1SJWA 4XBXA 1NDOB 1E3VA 1O7MB 3FF2A 1STDA 4WP5A 5D81A 2RCDA 3CPOA 5DREA 3EX9A 3MHEA 4J8TA 4J9AA 1WQLB 2HMLB 5KP3A 1ULIB 4U13A 1GY7A 5KP1A 3EQQB 2Z76A 3FF0A 3MG2A 3KKGA 4XBTA 5JPPA 1OH0A 3IPTA 2B24B 4KVHA 5IEPA 1OF5A 2Z77A 3GWRA 3MSOA 2RFRA 4HM4B 3BB9A 3F14A 1OF5B 2CKFB 1ZX2A 2BNGA 3RGAA 3JUOA 4L8PA 1C7HA 1Q42A 5IG5A 4N3VA 1O7NB 4HM5B 3OWSA 3DXOA 1IDPA 4WYKA 3GZBA 1EA2A 1O7HB 3UNLA 1TP6A 3Q90A 1JB5A 1OCVA 4WYKB 1QMAA 3F8HA 1JB4A 3FH1A 1QJGA 2BMOB 3CU3A 2HMJB 2HMNB 1W01A 2UX0A 5BXQA 2HMKB 4K1UA 5CLKA 3S5CA 3NV0A 5FW5A 5IERA 2IMJA 4K1VA 1ASKA 7STDA 1AR0A 3MYTA 3DZLA 2XR8B 3NV0B 2Z7AA 2F98A 2YFIB 4R1KA 1S5AA 4XB5A 4X2HA 3FZWA 5AEUB 3F7XA 2A15A 3FGYA 4HM7B 1VZZA 2F86B 3T8NA 5TGNA 2GEXA 3NM2A 3JUMA 2INXA 3K0ZA 4STDA 3DUKA 5AI1A 3BLZA 1ISKA 3OX9A 4MJDA 3T8UA 3GRDA 4LEHA 3HK4A 5IG0A 4HM8B 3GZYB 6STDA 2W2CA 3ROBA 1E3RA 1OHOA 4XDWA 2YFJB 4FCMA 4WWUC 1OGXA 3FKAA 5HGRA 2CHCA 3CNMA 1JB2A 2I9WA 1W6YA 3VSYA 2K54A 2GBWB 1TUHA 3E99A 3H51A 1CQSA 2GBXB 5AIHA 2BMQB 2HMMB 5EVHA 2PZVA 5STDA 1HKXA 1W02A 1GYBA 4IIAA 3FLJA 5KP4A 4FCJA 3G0KA 1DMMA 4R9LA 1OGZA 1GS3A 1NWWA 3EBYA 4HKVB 3A76A 3B7CA 2GXFA 1O7PB 2R4IA 3K7CA 1Z1SA 3JUQA 1E97A 5IG3A 1OHSA 2QIYA 3VGNA 1NU3A 1OUNA 2XRXB 3ER7A 5AIIA 2F99A 1DMNA 3DM8A 3EBTA 3EF8A 1O7GB 3OV4A 4LGQA 3UJMA 5IENA 3EHCA 3OWUA 3H3HA 5IF6A 3OWYA 4X2OA 2OWPA 5IEOA 1ZO2A 3SEDA 3F40A 1JN5A 3M8CA 2JQ5A 3NBRA 4HM2B 1UUVB 3EN8A 3F9SA 3NUVA 1JN5B 5DRVA 4LMIA 1OHPA 5CXOA 2YFLB 3DMCA 1A2KA 1EG9B 4HM3B 3EC9A 2STDA 1Q40A 1UUWB 4GB5A 3GZXB 3F7SA 1Q40B 4L7KA 4RZMA 5AIGA 4HZ9B 1ULJB 2QGUA 3D9RA 3RGRA 4HM0B 2BMRB 3WMDA 3G8ZA 1U5OA 4HM1B 4OUQA 4HJLB 5D82A 3FSDA 2GEYA 3ECFA 5BVBA 3STDA 4OVMA 1GY6A 3HX8A 1DMQA 5JPUA 4XBYA 4XDVA 1O7WB 4PEJA 4HVNA 4I4KA 4ORLA 3MG3A 4H3UA 3G16A 3JUPA 8CHOA 4HM6B 3F8XA 3GZRA 5CF1A 1OPYA 1GY5A 3EJVA 2XSOB 3NXJA 5CF2A 3MG1A 5G2GA 3HZPA 3KSPA 3CNXA 3SOAA 3B4PA
chains in the Genus database with same CATH superfamily
3IJEB 3BNBA 1LQGC 3HIGA 2HOHA 4L8OA 1BSCA 2CC3A 3KZTA 1IT7A 3DGLA 2K0MA 3CCQ3 4HZBB 2OQEA 4Q53A 3OW22 2XH9A 2KAAA 3BIRA 3LZAA 1B2MA 3WR2A 3LTAA 1NO3A 2B1XB 3B8LA 1K41A 1V57A 1EEJA 5AEWB 1BRHA 3SOYA 1LNIA 1SARA 4K61A 1BRKA 5CK6A 2R41A 3WOFB 2HMOB 3BNDA 2CG1A 3NHXA 2XSHB 1Q7HA 1EKMA 4N6LA 4RBNA 3MKIA 4HAAA 3WA3A 1N5PA 3B4OA 1GOVA 1IK3A 1S723 1JNQA 1A2PA 1I2FA 3KE7A 1M1XB 1RJOA 5EEOA 1RNTA 5BU4A 2UGIA 1MWRA 2RGQA 3CC43 1R4CA 2KF5A 2P38A 4CCVA 1BUQA 4CDLA 1JKGA 1LOWA 3I0YA 4XM4A 5D83A 2YX9A 1T2HA 3EN1B 4R9KA 1W00A 3LYGA 4GL6A 2WGQA 1VQ43 1BSBA 1CEWI 1JKGB 1KSIA 1LRAA 4O3VA 5IG4A 3AGOA 1RTUA 1RRLA 5AIFA 3JUNA 1TRPA 3DGNA 3OXAA 3ZFZA 4BIRA 1RDSA 1N5HA 1SJWA 1IQXA 2OCTA 4NREA 4XBXA 4N6OB 1VQ73 1NDOB 1E3VA 1FUSA 1O7MB 1STDA 2WOFA 3FF2A 4WP5A 3CMA3 1MOLA 5D81A 1QAFA 2RCDA 3CPOA 5DREA 3D5GA 3MPHA 1LNHA 1W2B2 3EX9A 5I97A 3MHEA 5FGOA 1QAKA 2XFTA 2GU3A 3LTCA 3Q3FA 4J8TA 4J9AA 1YGEA 1FW7A 3S29A 1WQLB 1R4YA 2HMLB 4IPBA 3JVCA 5KP3A 1VQQA 2M7OA 1KD14 3CCR3 2P0MA 3AHSA 3CCL3 3NM7A 1K9M4 1I3IA 1RMSA 1ULIB 1FGTA 1QALA 3KIIA 3N9HA 4U13A 1DYUA 1GY7A 5AYRB 5LC7A 2MC8A 5KP1A 2WGOA 3EQQB 2Z76A 3CCE3 3FF0A 3MG2A 2Y73A 1GOUA 3KKGA 4XBTA 1UCKA 2J8XB 1B2SA 5JPPA 1VQ63 4RNTA 1OH0A 3DH2A 2OOVC 4O2HA 3NBBA 3IPTA 3EB8A 1N9EA 2B24B 1K28A 4KVHA 4DKIA 1RN4A 3RDEA 5IEPA 3FG3A 1EUIC 2CWTA 3N8BA 1ZGXA 1W4NA 3SVAA 1OF5A 2Z77A 3BNCA 3GWRA 1RN1A 3MSOA 2RFRA 3N54B 2CW9A 1DVDA 3CCS3 4HM4B 1VQ53 3BB9A 3F14A 1OF5B 3UL6A 1DVCA 1IVXA 2CKFB 1HU9A 4NHFA 4N6V0 1ZX2A 5RNTA 1A67A 3G4S3 2BNGA 4J5GA 1W6CA 3RGAA 1IQ8A 1UW1A 2C11A 1IVWA 3QK9A 3JUOA 2Y74A 1BSDA 2CFLA 1L5GB 3V92A 1JRQA 3CC23 1YIT3 2Z6BA 2AADA 1Q814 1BSAA 1IVVA 4L8PA 1C7HA 1Q42A 1I3FA 2FGTA 5IG5A 1B2XA 1W7CA 4N3VA 3CCM3 1O7NB 2CK3H 1PYLA 3DXOA 3OWSA 4FMAA 4HM5B 1IDPA 4WYKA 1D6YA 2E2VA 2BHMA 1FGRA 3GZBA 1EA2A 1O7HB 4IT7A 3UNLA 1RCLA 2IA7A 1TP6A 2RBIA 1CH0A 2C4BA 2XFSA 4J5KA 3Q90A 5BIRA 1JB5A 4JRFA 1OCVA 4WYKB 1LXEA 1I0XA 2XGLA 1QMAA 9RNTA 3F8HA 4BTXA 1US1A 1BAOA 1JB4A 3FH1A 2SARA 1Y4KA 1FZUA 2W9QA 2F56A 1QJGA 2BO9B 3K9MC 3KFQC 1M904 2BMOB 3CU3A 2HMJB 1C54A 1DETA 4KT3B 4N6NB 3WHOA 2HMNB 1FUTA 4LSOA 3X3YA 1W01A 2CIUA 2UX0A 5BXQA 3BU4A 2HMKB 3DGOA 3GSPA 4K1UA 5CLKA 4QWTA 3S5CA 3D5IA 2OQEC 1IVUA 1LOYA 2P05A 1VQ93 3CCV3 3NV0A 5FW5A 5IERA 2P09A 3L0RA 2IMJA 1TFKA 2KF3A 4JF8A 1WNHA 7GSPA 4K1VA 1ASKA 7STDA 1AR0A 3MYTA 4BU4A 1GMQA 4KFDA 3DZLA 1UDII 2XR8B 1JBSA 3NV0B 1IT8A 2Z7AA 2F98A 3WDGB 1N8QA 2CX0A 2W6JH 2YFIB 4R1KA 4EV5A 3PCRA 2P0XA 1S5AA 1UI8A 4X2HA 4XB5A 2CFKA 1GOYA 3FZWA 5AEUB 3F7XA 2A15A 3FGYA 4HM7B 4KFFA 2E2TA 1VZZA 3DGMA 4GSPA 3X41A 1N8R4 2F86B 1BANA 1MWSA 4AKZA 4EC6A 3KCHA 1VQL3 2RNTA 5G1KA 3CD63 3T8NA 5TGNA 3LTBA 2GEXA 1T2IA 1GD4A 1UCJA 2JDIH 2FNQA 3K5TA 3NBJA 3BNEA 2RSXA 4ZM8A 4KZ1A 1NNVA 3NM2A 4EV2A 3JUMA 2INXA 1JV2B 2CH9A 3PS8A 2W0QA 3I563 3HOHA 1YNVX 4FMDA 3Q2PA 1JZOA 3K0ZA 3G713 1QVF2 1V74A 2BT3A 4STDA 1X1UA 3SLUA 4EYCA 7RNTA 2CFDA 3DUKA 5AI1A 1M1K4 3BLZA 1G96A 2ZA4A 3GAXA 2WO0A 2LQVA 1ISKA 3OX9A 1SPUA 1VQP3 5M18A 2CWUA 4MJDA 1DE3A 3T8UA 2WOHA 4OK0A 4BTYA 3I553 3GRDA 4LEHA 1B27A 3HK4A 1Q824 5A0OB 3ZG0A 1UI7A 1X1XA 5IG0A 4HM8B 1BNGA 3TDGA 1W6GA 3GZYB 1FYSA 4R4KA 6STDA 2W2CA 2ZL8A 1BRSA 2ML5A 1VQ83 4MMZB 3ROBA 1AV4A 3HIIA 1E3RA 1NJI4 1M9GA 1X1WA 1OHOA 4O02B 1BNSA 1JBRA 3WA2X 4XDWA 1AQZA 3O8YA 1EQKA 2YFJB 1FUWA 1KQS2 4FCMA 4GHOA 4WWUC 1OGXA 2IYJA 3FKAA 2CHCA 3CNMA 5HGRA 1JB2A 3NQYA 2ZDJA 2I9WA 1W6YA 3PGBA 2F4YA 3VSYA 5M1AA 2OOVA 1AVKA 1TJDA 2K54A 3X42A 2GBWB 1KWIA 1B21A 4AKYA 1TUHA 1RLSA 3E99A 3H51A 1CQSA 3UL5A 1NB5I 6GSPA 1TTOA 4HYZA 2UUGC 2GBXB 3URPA 5G1LA 1TU5A 5AIHA 1BRNL 3CCU3 2W03A 2FXTA 1YJW3 3WODG 5AYSC 3S27A 2KCDA 3V99A 2BMQB 2HMMB 1UCLA 5EVHA 3D3LA 3X3ZA 3HI7A 2PZVA 1I2GA 2O9UX 3S28A 5ELJA 5STDA 1STFI 1HKXA 1W02A 3LOYA 3PZWA 1PFPA 2O3OA 1GYBA 1BNRA 2C10A 4IIAA 3FLJA 2MF7A 1AVLA 4EW5A 1RSNA 5KP4A 1VQM3 1UUGB 3FCSB 3SXXA 3PYJA 4MEIA 1IU7A 4FCJA 3X40A 4BL2A 1W5ZA 3G0KA 1DMMA 4CJNA 3X3XA 2E2UA 1FGQA 1MWUA 3AGNA 4R9LA 1OGZA 1GS3A 2GU1A 1I70A 1GD3A 2L1SA 1ZS7A 3FG1A 4EBGA 1NWWA 3EBYA 1BUJA 3FG4A 3A76A 4HKVB 1RRHA 2KF4A 3B7CA 2GXFA 1O7PB 1BRJA 2R4IA 3CXC2 2CWVA 2V1LA 1JBTA 3DY5A 3K7CA 1Z1SA 1D6ZA 2GSPA 2L4VA 3JUQA 1E97A 1QVG2 1RGCA 1I8VA 1ROAA 5ELUA 2BIRA 5IG3A 1TIJA 1OHSA 1N9JA 1JJ22 1HYFA 1YVBI 2QIYA 3QRDA 3VGNA 1TFOA 1NU3A 1OUNA 1Q864 2XRXB 1I2EA 3ER7A 4N6UA 4WHAA 1YVSA 3WOEB 1SIHA 1RGHA 3RNTA 5AIIA 1IV7A 1WMNA 2ML6A 1U8CB 3LXUX 1RGAA 1BNFA 4CPKA 4FMCA 1YJN3 1A2VA 1A90A 2F99A 1DMNA 3DM8A 4BL3A 3EBTA 4TX4A 3V98A 3EF8A 1O7GB 4K90B 3D79A 3OV4A 4LGQA 1YGWA 3UJMA 4G1MB 2W9PA 5IENA 3EHCA 3SX1A 4R80A 1IYYA 1RNBA 3OWUA 2OTJ3 1PU4A 3H3HA 1YI23 5IF6A 3OWYA 2QA43 4X2OA 5EQLA 1HZ1A 2OWPA 1LOXA 1WTHA 4EXRA 3SYUA 2K3DA 4MMXB 1RCKA 5IEOA 1BNIA 1ZO2A 5GSPA 1B2ZA 1Q9EA 3SEDA 4BTWA 3F40A 1Q7Y4 1MGWA 2LYXA 1JN5A 3M8CA 1I0VA 2JQ5A 2IUKA 1LQMB 3NBRA 4ILFA 3Q1CA 4N6MA 2D42A 4HM2B 1FA3A 1T3BA 4KFEA 1UUVB 3EN8A 2CG0A 3F9SA 1B2UA 1G0TA 1JN5B 3NUVA 5DRVA 3UB1A 1LOVA 1JZDA 2F5MA 1YHQ3 1UGIA 1WMPA 1BIRA 4LMIA 1OHPA 1RGGA 1MGRA 3IMAB 5CXOA 1GSPA 1FGOA 2YFLB 1CYUA 1UGHI 2XF3A 3DMCA 4LYLB 3K63A 4FR9A 1A2KA 1X1YA 2CFGA 1CYVA 2KXGA 3T0UA 3A5EA 4N6TA 1RHLA 2H0GA 1EG9B 1RGLA 2F5WA 1BVIA 4HM3B 1BRGA 1SQWA 3EC9A 2STDA 1Q40A 2OTL3 1UUWB 4HOHA 1BSEA 2BU4A 2KF6A 3LT9A 1B20A 3CCJ3 4GB5A 3GZXB 3F7SA 2IUJA 1Q40B 4L7KA 1VQK3 4FCZA 3NQZA 1OACA 4WFOA 4RZMA 5AIGA 4HZ9B 1YJ93 1UCIA 1ULJB 2QGUA 4RNZA 1VQN3 3D9RA 3RGRA 4RNYA 4FMBA 4HM0B 1ROVA 1AY7A 2H0HA 2BMRB 3WMDA 2XEPA 3G6E3 2KRTA 4HBRA 3ALAA 3G8ZA 1U5OA 1BNEA 1BU4A 4HM1B 4OUQA 1YIJ3 3DGYA 2IY2A 1V58A 2PNCA 3CME3 4HJLB 3LH4A 3MWZA 2H0IA 3PXMA 5D82A 4AEQA 3FSDA 3PCSA 2GEYA 3LT8A 3ECFA 3KSED 2AAEA 5BVBA 2XGNA 3NX0A 1IV9A 4LZIA 6RNTA 1BNJA 3STDA 2ZHXB 1B3SA 4OVMA 5IW9A 1T5YA 3KN4A 1GMPA 1RGFA 1GY6A 4H61A 1F8NA 2SBLA 3AMOA 3HX8A 8RNTA 1DMQA 5JPUA 4NPBA 4XBYA 4XDVA 1O7WB 4PEJA 3EE1A 1K734 3J7Yd 1RGKA 4HVNA 1W2ZA 1NB3I 4I4KA 3AMOB 1FGMA 2W56A 1RN7A 4ORLA 2D1WA 3CPW2 1RGEA 3MG3A 2CFWA 4H3UA 1LVNA 3G16A 3JUPA 3LTDA 4I5QA 8CHOA 5JBSA 4HM6B 3F8XA 3GZRA 5CF1A 1GMRA 1PY3A 5LC6A 3AHWA 2W56B 3CC73 3VF1A 5HOHA 1D6UA 2CX1A 1OPYA 1BRIA 1SIIA 1GY5A 3EJVA 1RKYA 1J2BA 1BOXA 3U1WA 2XSOB 3NXJA 1MWTA 4MMYB 1MNLA 5CF2A 3LMLA 1TRQA 3MG1A 1G02A 5G2GA 5M19A 1VQO3 1KC84 3ZG5A 3U97A 1WMOA 2W04A 4O8SA 3HZPA 3KSPA 1K8A4 3S67A 3D4AA 2Q07A 3CNXA 1IQYA 3SOAA 1BGSA 2QEX3 3B4PA
chains in the Genus database with same CATH topology
3IJEB 3BNBA 3HIGA 4L8OA 2CC3A 3KZTA 1IT7A 3DGLA 2K0MA 3CCQ3 4HZBB 2OQEA 4Q53A 3OW22 2XH9A 3LZAA 3LTAA 1NO3A 2B1XB 3B8LA 1K41A 5AEWB 3SOYA 4K61A 5CK6A 3WOFB 2HMOB 3BNDA 2CG1A 3NHXA 2XSHB 1EKMA 4N6LA 4RBNA 3MKIA 3WA3A 1N5PA 3B4OA 1IK3A 1S723 1JNQA 3KE7A 1M1XB 1RJOA 5EEOA 2RGQA 3CC43 1R4CA 2P38A 4CCVA 1BUQA 4CDLA 1JKGA 3I0YA 4XM4A 5D83A 2YX9A 3EN1B 4R9KA 1W00A 3LYGA 4GL6A 2WGQA 1VQ43 1CEWI 1KSIA 1JKGB 4O3VA 5IG4A 1RRLA 5AIFA 3JUNA 3DGNA 3OXAA 1N5HA 1SJWA 1IQXA 2OCTA 4NREA 4XBXA 4N6OB 1VQ73 1NDOB 1E3VA 1O7MB 2WOFA 1STDA 3FF2A 4WP5A 3CMA3 1MOLA 5D81A 1QAFA 2RCDA 3CPOA 5DREA 3MPHA 1LNHA 1W2B2 3EX9A 5I97A 3MHEA 5FGOA 1QAKA 2XFTA 2GU3A 3LTCA 4J8TA 4J9AA 1YGEA 3S29A 1WQLB 2HMLB 4IPBA 3JVCA 5KP3A 2M7OA 1KD14 3CCR3 2P0MA 3CCL3 3NM7A 1K9M4 1ULIB 5AYRB 3KIIA 1FGTA 1QALA 3N9HA 4U13A 5LC7A 1GY7A 1DYUA 2MC8A 5KP1A 2WGOA 3EQQB 2Z76A 3CCE3 3FF0A 3MG2A 2Y73A 3KKGA 4XBTA 5JPPA 1VQ63 1OH0A 2OOVC 4O2HA 3NBBA 3IPTA 3EB8A 1N9EA 2B24B 1K28A 4KVHA 3RDEA 5IEPA 3FG3A 2CWTA 3N8BA 1W4NA 3SVAA 1OF5A 2Z77A 3BNCA 3GWRA 3MSOA 2RFRA 3N54B 2CW9A 1DVDA 3CCS3 4HM4B 1VQ53 3BB9A 3F14A 1OF5B 3UL6A 1DVCA 1IVXA 2CKFB 1HU9A 4NHFA 4N6V0 1ZX2A 1A67A 3G4S3 2BNGA 1W6CA 3RGAA 1IQ8A 1UW1A 2C11A 1IVWA 3QK9A 3JUOA 2Y74A 2CFLA 1L5GB 3V92A 1JRQA 3CC23 1YIT3 2Z6BA 1Q814 4L8PA 1IVVA 1C7HA 1Q42A 2FGTA 5IG5A 1W7CA 4N3VA 3CCM3 1O7NB 2CK3H 3OWSA 3DXOA 4FMAA 4HM5B 1IDPA 4WYKA 1D6YA 2E2VA 2BHMA 1FGRA 3GZBA 1EA2A 1O7HB 4IT7A 3UNLA 2IA7A 1TP6A 2XFSA 3Q90A 1JB5A 4JRFA 1OCVA 4WYKB 1LXEA 2XGLA 1QMAA 3F8HA 4BTXA 1US1A 1JB4A 3FH1A 1Y4KA 2W9QA 3K9MC 1QJGA 2BO9B 3KFQC 1M904 2BMOB 3CU3A 2HMJB 4N6NB 2HMNB 4LSOA 3X3YA 1W01A 2CIUA 2UX0A 5BXQA 2HMKB 3DGOA 4K1UA 5CLKA 4QWTA 3S5CA 2OQEC 1IVUA 2P05A 1VQ93 3CCV3 3NV0A 5FW5A 5IERA 2P09A 3L0RA 2IMJA 1TFKA 4JF8A 1WNHA 4K1VA 1ASKA 7STDA 1AR0A 3MYTA 4KFDA 3DZLA 2XR8B 3NV0B 1IT8A 2Z7AA 2F98A 3WDGB 1N8QA 2W6JH 2YFIB 4EV5A 4R1KA 3PCRA 2P0XA 1S5AA 1UI8A 4X2HA 4XB5A 2CFKA 3FZWA 5AEUB 3F7XA 2A15A 3FGYA 4HM7B 4KFFA 2E2TA 1VZZA 3DGMA 3X41A 1N8R4 2F86B 4AKZA 4EC6A 1VQL3 3CD63 3T8NA 5TGNA 3LTBA 2GEXA 1GD4A 2JDIH 2FNQA 3K5TA 3NBJA 3BNEA 2RSXA 4ZM8A 4KZ1A 3NM2A 4EV2A 3JUMA 2INXA 1JV2B 2CH9A 3PS8A 2W0QA 3I563 4FMDA 3Q2PA 3K0ZA 3G713 1QVF2 1V74A 2BT3A 4STDA 3SLUA 4EYCA 2CFDA 3DUKA 5AI1A 1M1K4 3BLZA 1G96A 3GAXA 2WO0A 2LQVA 1ISKA 3OX9A 1SPUA 1VQP3 2CWUA 4MJDA 3T8UA 2WOHA 4OK0A 4BTYA 3I553 3GRDA 4LEHA 3HK4A 1Q824 5A0OB 1UI7A 5IG0A 4HM8B 3TDGA 1W6GA 3GZYB 6STDA 4R4KA 2W2CA 2ZL8A 2ML5A 1VQ83 4MMZB 3ROBA 1AV4A 3HIIA 1E3RA 1NJI4 1M9GA 1OHOA 4O02B 3WA2X 4XDWA 3O8YA 1EQKA 2YFJB 1FUWA 1KQS2 4FCMA 4WWUC 1OGXA 3FKAA 5HGRA 2CHCA 3CNMA 1JB2A 3NQYA 2ZDJA 2I9WA 1W6YA 3PGBA 3VSYA 2OOVA 3X42A 1AVKA 2K54A 2GBWB 1KWIA 4AKYA 1TUHA 3E99A 3H51A 1CQSA 3UL5A 1NB5I 4HYZA 2GBXB 1TU5A 5AIHA 3CCU3 2W03A 2FXTA 1YJW3 3WODG 5AYSC 3S27A 2KCDA 3V99A 2BMQB 2HMMB 5EVHA 3D3LA 3X3ZA 3HI7A 2PZVA 2O9UX 3S28A 5ELJA 5STDA 1STFI 1HKXA 1W02A 3LOYA 3PZWA 1PFPA 2O3OA 1GYBA 2C10A 4IIAA 3FLJA 2MF7A 1AVLA 5KP4A 1VQM3 3FCSB 3SXXA 3PYJA 4MEIA 1IU7A 4FCJA 3X40A 1W5ZA 3G0KA 1DMMA 3X3XA 2E2UA 1FGQA 4R9LA 1OGZA 1GS3A 2GU1A 1GD3A 3FG1A 4EBGA 1NWWA 3EBYA 3FG4A 3A76A 4HKVB 1RRHA 3B7CA 2GXFA 1O7PB 2R4IA 3CXC2 2CWVA 2V1LA 3DY5A 3K7CA 1Z1SA 1D6ZA 2L4VA 3JUQA 1E97A 1QVG2 1ROAA 5ELUA 5IG3A 1TIJA 1OHSA 1N9JA 1JJ22 1YVBI 2QIYA 3QRDA 3VGNA 1TFOA 1NU3A 1OUNA 1Q864 2XRXB 3ER7A 4N6UA 4WHAA 3WOEB 1SIHA 5AIIA 1IV7A 1WMNA 2ML6A 1U8CB 3LXUX 1YJN3 4FMCA 1A2VA 1A90A 2F99A 1DMNA 3DM8A 3EBTA 4TX4A 3V98A 3EF8A 1O7GB 4K90B 3OV4A 4LGQA 3UJMA 4G1MB 2W9PA 5IENA 3EHCA 3SX1A 4R80A 3OWUA 2OTJ3 1PU4A 3H3HA 1YI23 5IF6A 3OWYA 2QA43 4X2OA 5EQLA 4EXRA 2OWPA 1LOXA 1WTHA 4MMXB 5IEOA 1ZO2A 3SEDA 4BTWA 3F40A 1Q7Y4 2LYXA 1JN5A 3M8CA 2JQ5A 2IUKA 3NBRA 3Q1CA 4N6MA 2D42A 4HM2B 1FA3A 4KFEA 1UUVB 3EN8A 2CG0A 3F9SA 3NUVA 3UB1A 1JN5B 5DRVA 1YHQ3 1WMPA 4LMIA 1OHPA 3IMAB 5CXOA 1FGOA 2YFLB 1CYUA 2XF3A 3DMCA 3K63A 4FR9A 1A2KA 2CFGA 1CYVA 2KXGA 3T0UA 4N6TA 1EG9B 4HM3B 1SQWA 3EC9A 2STDA 1Q40A 2OTL3 1UUWB 3LT9A 3CCJ3 4GB5A 3GZXB 3F7SA 2IUJA 1Q40B 4L7KA 1VQK3 4FCZA 3NQZA 1OACA 4WFOA 4RZMA 5AIGA 4HZ9B 1YJ93 1VQN3 1ULJB 2QGUA 4RNZA 3D9RA 3RGRA 4RNYA 4FMBA 4HM0B 1ROVA 2BMRB 3WMDA 2XEPA 3G6E3 2KRTA 4HBRA 3ALAA 3G8ZA 1U5OA 4HM1B 4OUQA 1YIJ3 2PNCA 3CME3 4HJLB 3LH4A 3MWZA 3PXMA 5D82A 4AEQA 3FSDA 3PCSA 2GEYA 3LT8A 3ECFA 3KSED 5BVBA 2XGNA 3NX0A 1IV9A 4LZIA 3STDA 4OVMA 5IW9A 1T5YA 3KN4A 1GY6A 4H61A 1F8NA 2SBLA 3AMOA 3HX8A 1DMQA 5JPUA 4XBYA 4XDVA 1O7WB 4PEJA 3EE1A 1K734 3J7Yd 4HVNA 1W2ZA 1NB3I 4I4KA 3AMOB 1FGMA 2W56A 1RN7A 4ORLA 2D1WA 3CPW2 3MG3A 2CFWA 4H3UA 1LVNA 3G16A 3JUPA 3LTDA 8CHOA 5JBSA 4HM6B 3F8XA 3GZRA 5CF1A 5LC6A 2W56B 3CC73 3VF1A 1D6UA 1OPYA 1SIIA 1GY5A 3EJVA 1RKYA 1J2BA 3U1WA 2XSOB 3NXJA 4MMYB 1MNLA 5CF2A 3LMLA 3MG1A 5G2GA 1VQO3 1KC84 3U97A 1WMOA 2W04A 4O8SA 3HZPA 3KSPA 1K8A4 3S67A 2Q07A 3CNXA 1IQYA 3SOAA 2QEX3 3B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L8O A;  3KZT A;  4HZB B;  4Q53 A;  3LZA A;  2B1X B;  3B8L A;  1K41 A;  5AEW B;  3SOY A;  5CK6 A;  2HMO B;  3NHX A;  2XSH B;  3MKI A;  3B4O A;  3KE7 A;  2RGQ A;  1BUQ A;  4CDL A;  1JKG A;  3I0Y A;  4XM4 A;  5D83 A;  3EN1 B;  4R9K A;  1W00 A;  3LYG A;  1JKG B;  5IG4 A;  5AIF A;  3JUN A;  3OXA A;  1SJW A;  4XBX A;  1NDO B;  1E3V A;  1O7M B;  3FF2 A;  1STD A;  4WP5 A;  5D81 A;  2RCD A;  3CPO A;  5DRE A;  3EX9 A;  3MHE A;  4J8T A;  4J9A A;  1WQL B;  2HML B;  5KP3 A;  1ULI B;  4U13 A;  1GY7 A;  5KP1 A;  3EQQ B;  2Z76 A;  3FF0 A;  3MG2 A;  3KKG A;  4XBT A;  5JPP A;  1OH0 A;  3IPT A;  2B24 B;  4KVH A;  5IEP A;  1OF5 A;  2Z77 A;  3GWR A;  3MSO A;  2RFR A;  4HM4 B;  3BB9 A;  3F14 A;  1OF5 B;  2CKF B;  1ZX2 A;  2BNG A;  3RGA A;  3JUO A;  4L8P A;  1C7H A;  1Q42 A;  5IG5 A;  4N3V A;  1O7N B;  4HM5 B;  3OWS A;  3DXO A;  1IDP A;  4WYK A;  3GZB A;  1EA2 A;  1O7H B;  3UNL A;  1TP6 A;  3Q90 A;  1JB5 A;  1OCV A;  4WYK B;  1QMA A;  3F8H A;  1JB4 A;  3FH1 A;  1QJG A;  2BMO B;  3CU3 A;  2HMJ B;  2HMN B;  1W01 A;  2UX0 A;  5BXQ A;  2HMK B;  4K1U A;  5CLK A;  3S5C A;  3NV0 A;  5FW5 A;  5IER A;  2IMJ A;  4K1V A;  1ASK A;  7STD A;  1AR0 A;  3MYT A;  3DZL A;  2XR8 B;  3NV0 B;  2Z7A A;  2F98 A;  2YFI B;  4R1K A;  1S5A A;  4XB5 A;  4X2H A;  3FZW A;  5AEU B;  3F7X A;  2A15 A;  3FGY A;  4HM7 B;  1VZZ A;  2F86 B;  3T8N A;  5TGN A;  2GEX A;  3NM2 A;  3JUM A;  2INX A;  3K0Z A;  4STD A;  3DUK A;  5AI1 A;  3BLZ A;  1ISK A;  3OX9 A;  4MJD A;  3T8U A;  3GRD A;  4LEH A;  3HK4 A;  5IG0 A;  4HM8 B;  3GZY B;  6STD A;  2W2C A;  3ROB A;  1E3R A;  1OHO A;  4XDW A;  2YFJ B;  4FCM A;  4WWU C;  1OGX A;  3FKA A;  5HGR A;  2CHC A;  3CNM A;  1JB2 A;  2I9W A;  1W6Y A;  3VSY A;  2K54 A;  2GBW B;  1TUH A;  3E99 A;  3H51 A;  1CQS A;  2GBX B;  5AIH A;  2BMQ B;  2HMM B;  5EVH A;  2PZV A;  5STD A;  1HKX A;  1W02 A;  1GYB A;  4IIA A;  3FLJ A;  5KP4 A;  4FCJ A;  3G0K A;  1DMM A;  4R9L A;  1OGZ A;  1GS3 A;  1NWW A;  3EBY A;  4HKV B;  3A76 A;  3B7C A;  2GXF A;  1O7P B;  2R4I A;  3K7C A;  1Z1S A;  3JUQ A;  1E97 A;  5IG3 A;  1OHS A;  2QIY A;  3VGN A;  1NU3 A;  1OUN A;  2XRX B;  3ER7 A;  5AII A;  2F99 A;  1DMN A;  3DM8 A;  3EBT A;  3EF8 A;  1O7G B;  3OV4 A;  4LGQ A;  3UJM A;  5IEN A;  3EHC A;  3OWU A;  3H3H A;  5IF6 A;  3OWY A;  4X2O A;  2OWP A;  5IEO A;  1ZO2 A;  3SED A;  3F40 A;  1JN5 A;  3M8C A;  2JQ5 A;  3NBR A;  4HM2 B;  1UUV B;  3EN8 A;  3F9S A;  3NUV A;  1JN5 B;  5DRV A;  4LMI A;  1OHP A;  5CXO A;  2YFL B;  3DMC A;  1A2K A;  1EG9 B;  4HM3 B;  3EC9 A;  2STD A;  1Q40 A;  1UUW B;  4GB5 A;  3GZX B;  3F7S A;  1Q40 B;  4L7K A;  4RZM A;  5AIG A;  4HZ9 B;  1ULJ B;  2QGU A;  3D9R A;  3RGR A;  4HM0 B;  2BMR B;  3WMD A;  3G8Z A;  1U5O A;  4HM1 B;  4OUQ A;  4HJL B;  5D82 A;  3FSD A;  2GEY A;  3ECF A;  5BVB A;  3STD A;  4OVM A;  1GY6 A;  3HX8 A;  1DMQ A;  5JPU A;  4XBY A;  4XDV A;  1O7W B;  4PEJ A;  4HVN A;  4I4K A;  4ORL A;  3MG3 A;  4H3U A;  3G16 A;  3JUP A;  8CHO A;  4HM6 B;  3F8X A;  3GZR A;  5CF1 A;  1OPY A;  1GY5 A;  3EJV A;  2XSO B;  3NXJ A;  5CF2 A;  3MG1 A;  5G2G A;  3HZP A;  3KSP A;  3CNX A;  3SOA A;  3B4P A; 
#chains in the Genus database with same CATH topology
 3IJE B;  3BNB A;  1LQG C;  3HIG A;  2HOH A;  4L8O A;  1BSC A;  2CC3 A;  3KZT A;  1IT7 A;  3DGL A;  2K0M A;  3CCQ 3;  4HZB B;  2OQE A;  4Q53 A;  3OW2 2;  2XH9 A;  2KAA A;  3BIR A;  3LZA A;  1B2M A;  3WR2 A;  3LTA A;  1NO3 A;  2B1X B;  3B8L A;  1K41 A;  1V57 A;  1EEJ A;  5AEW B;  1BRH A;  3SOY A;  1LNI A;  1SAR A;  4K61 A;  1BRK A;  5CK6 A;  2R41 A;  3WOF B;  2HMO B;  3BND A;  2CG1 A;  3NHX A;  2XSH B;  1Q7H A;  1EKM A;  4N6L A;  4RBN A;  3MKI A;  4HAA A;  3WA3 A;  1N5P A;  3B4O A;  1GOV A;  1IK3 A;  1S72 3;  1JNQ A;  1A2P A;  1I2F A;  3KE7 A;  1M1X B;  1RJO A;  5EEO A;  1RNT A;  5BU4 A;  2UGI A;  1MWR A;  2RGQ A;  3CC4 3;  1R4C A;  2KF5 A;  2P38 A;  4CCV A;  1BUQ A;  4CDL A;  1JKG A;  1LOW A;  3I0Y A;  4XM4 A;  5D83 A;  2YX9 A;  1T2H A;  3EN1 B;  4R9K A;  1W00 A;  3LYG A;  4GL6 A;  2WGQ A;  1VQ4 3;  1BSB A;  1CEW I;  1JKG B;  1KSI A;  1LRA A;  4O3V A;  5IG4 A;  3AGO A;  1RTU A;  1RRL A;  5AIF A;  3JUN A;  1TRP A;  3DGN A;  3OXA A;  3ZFZ A;  4BIR A;  1RDS A;  1N5H A;  1SJW A;  1IQX A;  2OCT A;  4NRE A;  4XBX A;  4N6O B;  1VQ7 3;  1NDO B;  1E3V A;  1FUS A;  1O7M B;  1STD A;  2WOF A;  3FF2 A;  4WP5 A;  3CMA 3;  1MOL A;  5D81 A;  1QAF A;  2RCD A;  3CPO A;  5DRE A;  3D5G A;  3MPH A;  1LNH A;  1W2B 2;  3EX9 A;  5I97 A;  3MHE A;  5FGO A;  1QAK A;  2XFT A;  2GU3 A;  3LTC A;  3Q3F A;  4J8T A;  4J9A A;  1YGE A;  1FW7 A;  3S29 A;  1WQL B;  1R4Y A;  2HML B;  4IPB A;  3JVC A;  5KP3 A;  1VQQ A;  2M7O A;  1KD1 4;  3CCR 3;  2P0M A;  3AHS A;  3CCL 3;  3NM7 A;  1K9M 4;  1I3I A;  1RMS A;  1ULI B;  1FGT A;  1QAL A;  3KII A;  3N9H A;  4U13 A;  1DYU A;  1GY7 A;  5AYR B;  5LC7 A;  2MC8 A;  5KP1 A;  2WGO A;  3EQQ B;  2Z76 A;  3CCE 3;  3FF0 A;  3MG2 A;  2Y73 A;  1GOU A;  3KKG A;  4XBT A;  1UCK A;  2J8X B;  1B2S A;  5JPP A;  1VQ6 3;  4RNT A;  1OH0 A;  3DH2 A;  2OOV C;  4O2H A;  3NBB A;  3IPT A;  3EB8 A;  1N9E A;  2B24 B;  1K28 A;  4KVH A;  4DKI A;  1RN4 A;  3RDE A;  5IEP A;  3FG3 A;  1EUI C;  2CWT A;  3N8B A;  1ZGX A;  1W4N A;  3SVA A;  1OF5 A;  2Z77 A;  3BNC A;  3GWR A;  1RN1 A;  3MSO A;  2RFR A;  3N54 B;  2CW9 A;  1DVD A;  3CCS 3;  4HM4 B;  1VQ5 3;  3BB9 A;  3F14 A;  1OF5 B;  3UL6 A;  1DVC A;  1IVX A;  2CKF B;  1HU9 A;  4NHF A;  4N6V 0;  1ZX2 A;  5RNT A;  1A67 A;  3G4S 3;  2BNG A;  4J5G A;  1W6C A;  3RGA A;  1IQ8 A;  1UW1 A;  2C11 A;  1IVW A;  3QK9 A;  3JUO A;  2Y74 A;  1BSD A;  2CFL A;  1L5G B;  3V92 A;  1JRQ A;  3CC2 3;  1YIT 3;  2Z6B A;  2AAD A;  1Q81 4;  1BSA A;  1IVV A;  4L8P A;  1C7H A;  1Q42 A;  1I3F A;  2FGT A;  5IG5 A;  1B2X A;  1W7C A;  4N3V A;  3CCM 3;  1O7N B;  2CK3 H;  1PYL A;  3DXO A;  3OWS A;  4FMA A;  4HM5 B;  1IDP A;  4WYK A;  1D6Y A;  2E2V A;  2BHM A;  1FGR A;  3GZB A;  1EA2 A;  1O7H B;  4IT7 A;  3UNL A;  1RCL A;  2IA7 A;  1TP6 A;  2RBI A;  1CH0 A;  2C4B A;  2XFS A;  4J5K A;  3Q90 A;  5BIR A;  1JB5 A;  4JRF A;  1OCV A;  4WYK B;  1LXE A;  1I0X A;  2XGL A;  1QMA A;  9RNT A;  3F8H A;  4BTX A;  1US1 A;  1BAO A;  1JB4 A;  3FH1 A;  2SAR A;  1Y4K A;  1FZU A;  2W9Q A;  2F56 A;  1QJG A;  2BO9 B;  3K9M C;  3KFQ C;  1M90 4;  2BMO B;  3CU3 A;  2HMJ B;  1C54 A;  1DET A;  4KT3 B;  4N6N B;  3WHO A;  2HMN B;  1FUT A;  4LSO A;  3X3Y A;  1W01 A;  2CIU A;  2UX0 A;  5BXQ A;  3BU4 A;  2HMK B;  3DGO A;  3GSP A;  4K1U A;  5CLK A;  4QWT A;  3S5C A;  3D5I A;  2OQE C;  1IVU A;  1LOY A;  2P05 A;  1VQ9 3;  3CCV 3;  3NV0 A;  5FW5 A;  5IER A;  2P09 A;  3L0R A;  2IMJ A;  1TFK A;  2KF3 A;  4JF8 A;  1WNH A;  7GSP A;  4K1V A;  1ASK A;  7STD A;  1AR0 A;  3MYT A;  4BU4 A;  1GMQ A;  4KFD A;  3DZL A;  1UDI I;  2XR8 B;  1JBS A;  3NV0 B;  1IT8 A;  2Z7A A;  2F98 A;  3WDG B;  1N8Q A;  2CX0 A;  2W6J H;  2YFI B;  4R1K A;  4EV5 A;  3PCR A;  2P0X A;  1S5A A;  1UI8 A;  4X2H A;  4XB5 A;  2CFK A;  1GOY A;  3FZW A;  5AEU B;  3F7X A;  2A15 A;  3FGY A;  4HM7 B;  4KFF A;  2E2T A;  1VZZ A;  3DGM A;  4GSP A;  3X41 A;  1N8R 4;  2F86 B;  1BAN A;  1MWS A;  4AKZ A;  4EC6 A;  3KCH A;  1VQL 3;  2RNT A;  5G1K A;  3CD6 3;  3T8N A;  5TGN A;  3LTB A;  2GEX A;  1T2I A;  1GD4 A;  1UCJ A;  2JDI H;  2FNQ A;  3K5T A;  3NBJ A;  3BNE A;  2RSX A;  4ZM8 A;  4KZ1 A;  1NNV A;  3NM2 A;  4EV2 A;  3JUM A;  2INX A;  1JV2 B;  2CH9 A;  3PS8 A;  2W0Q A;  3I56 3;  3HOH A;  1YNV X;  4FMD A;  3Q2P A;  1JZO A;  3K0Z A;  3G71 3;  1QVF 2;  1V74 A;  2BT3 A;  4STD A;  1X1U A;  3SLU A;  4EYC A;  7RNT A;  2CFD A;  3DUK A;  5AI1 A;  1M1K 4;  3BLZ A;  1G96 A;  2ZA4 A;  3GAX A;  2WO0 A;  2LQV A;  1ISK A;  3OX9 A;  1SPU A;  1VQP 3;  5M18 A;  2CWU A;  4MJD A;  1DE3 A;  3T8U A;  2WOH A;  4OK0 A;  4BTY A;  3I55 3;  3GRD A;  4LEH A;  1B27 A;  3HK4 A;  1Q82 4;  5A0O B;  3ZG0 A;  1UI7 A;  1X1X A;  5IG0 A;  4HM8 B;  1BNG A;  3TDG A;  1W6G A;  3GZY B;  1FYS A;  4R4K A;  6STD A;  2W2C A;  2ZL8 A;  1BRS A;  2ML5 A;  1VQ8 3;  4MMZ B;  3ROB A;  1AV4 A;  3HII A;  1E3R A;  1NJI 4;  1M9G A;  1X1W A;  1OHO A;  4O02 B;  1BNS A;  1JBR A;  3WA2 X;  4XDW A;  1AQZ A;  3O8Y A;  1EQK A;  2YFJ B;  1FUW A;  1KQS 2;  4FCM A;  4GHO A;  4WWU C;  1OGX A;  2IYJ A;  3FKA A;  2CHC A;  3CNM A;  5HGR A;  1JB2 A;  3NQY A;  2ZDJ A;  2I9W A;  1W6Y A;  3PGB A;  2F4Y A;  3VSY A;  5M1A A;  2OOV A;  1AVK A;  1TJD A;  2K54 A;  3X42 A;  2GBW B;  1KWI A;  1B21 A;  4AKY A;  1TUH A;  1RLS A;  3E99 A;  3H51 A;  1CQS A;  3UL5 A;  1NB5 I;  6GSP A;  1TTO A;  4HYZ A;  2UUG C;  2GBX B;  3URP A;  5G1L A;  1TU5 A;  5AIH A;  1BRN L;  3CCU 3;  2W03 A;  2FXT A;  1YJW 3;  3WOD G;  5AYS C;  3S27 A;  2KCD A;  3V99 A;  2BMQ B;  2HMM B;  1UCL A;  5EVH A;  3D3L A;  3X3Z A;  3HI7 A;  2PZV A;  1I2G A;  2O9U X;  3S28 A;  5ELJ A;  5STD A;  1STF I;  1HKX A;  1W02 A;  3LOY A;  3PZW A;  1PFP A;  2O3O A;  1GYB A;  1BNR A;  2C10 A;  4IIA A;  3FLJ A;  2MF7 A;  1AVL A;  4EW5 A;  1RSN A;  5KP4 A;  1VQM 3;  1UUG B;  3FCS B;  3SXX A;  3PYJ A;  4MEI A;  1IU7 A;  4FCJ A;  3X40 A;  4BL2 A;  1W5Z A;  3G0K A;  1DMM A;  4CJN A;  3X3X A;  2E2U A;  1FGQ A;  1MWU A;  3AGN A;  4R9L A;  1OGZ A;  1GS3 A;  2GU1 A;  1I70 A;  1GD3 A;  2L1S A;  1ZS7 A;  3FG1 A;  4EBG A;  1NWW A;  3EBY A;  1BUJ A;  3FG4 A;  3A76 A;  4HKV B;  1RRH A;  2KF4 A;  3B7C A;  2GXF A;  1O7P B;  1BRJ A;  2R4I A;  3CXC 2;  2CWV A;  2V1L A;  1JBT A;  3DY5 A;  3K7C A;  1Z1S A;  1D6Z A;  2GSP A;  2L4V A;  3JUQ A;  1E97 A;  1QVG 2;  1RGC A;  1I8V A;  1ROA A;  5ELU A;  2BIR A;  5IG3 A;  1TIJ A;  1OHS A;  1N9J A;  1JJ2 2;  1HYF A;  1YVB I;  2QIY A;  3QRD A;  3VGN A;  1TFO A;  1NU3 A;  1OUN A;  1Q86 4;  2XRX B;  1I2E A;  3ER7 A;  4N6U A;  4WHA A;  1YVS A;  3WOE B;  1SIH A;  1RGH A;  3RNT A;  5AII A;  1IV7 A;  1WMN A;  2ML6 A;  1U8C B;  3LXU X;  1RGA A;  1BNF A;  4CPK A;  4FMC A;  1YJN 3;  1A2V A;  1A90 A;  2F99 A;  1DMN A;  3DM8 A;  4BL3 A;  3EBT A;  4TX4 A;  3V98 A;  3EF8 A;  1O7G B;  4K90 B;  3D79 A;  3OV4 A;  4LGQ A;  1YGW A;  3UJM A;  4G1M B;  2W9P A;  5IEN A;  3EHC A;  3SX1 A;  4R80 A;  1IYY A;  1RNB A;  3OWU A;  2OTJ 3;  1PU4 A;  3H3H A;  1YI2 3;  5IF6 A;  3OWY A;  2QA4 3;  4X2O A;  5EQL A;  1HZ1 A;  2OWP A;  1LOX A;  1WTH A;  4EXR A;  3SYU A;  2K3D A;  4MMX B;  1RCK A;  5IEO A;  1BNI A;  1ZO2 A;  5GSP A;  1B2Z A;  1Q9E A;  3SED A;  4BTW A;  3F40 A;  1Q7Y 4;  1MGW A;  2LYX A;  1JN5 A;  3M8C A;  1I0V A;  2JQ5 A;  2IUK A;  1LQM B;  3NBR A;  4ILF A;  3Q1C A;  4N6M A;  2D42 A;  4HM2 B;  1FA3 A;  1T3B A;  4KFE A;  1UUV B;  3EN8 A;  2CG0 A;  3F9S A;  1B2U A;  1G0T A;  1JN5 B;  3NUV A;  5DRV A;  3UB1 A;  1LOV A;  1JZD A;  2F5M A;  1YHQ 3;  1UGI A;  1WMP A;  1BIR A;  4LMI A;  1OHP A;  1RGG A;  1MGR A;  3IMA B;  5CXO A;  1GSP A;  1FGO A;  2YFL B;  1CYU A;  1UGH I;  2XF3 A;  3DMC A;  4LYL B;  3K63 A;  4FR9 A;  1A2K A;  1X1Y A;  2CFG A;  1CYV A;  2KXG A;  3T0U A;  3A5E A;  4N6T A;  1RHL A;  2H0G A;  1EG9 B;  1RGL A;  2F5W A;  1BVI A;  4HM3 B;  1BRG A;  1SQW A;  3EC9 A;  2STD A;  1Q40 A;  2OTL 3;  1UUW B;  4HOH A;  1BSE A;  2BU4 A;  2KF6 A;  3LT9 A;  1B20 A;  3CCJ 3;  4GB5 A;  3GZX B;  3F7S A;  2IUJ A;  1Q40 B;  4L7K A;  1VQK 3;  4FCZ A;  3NQZ A;  1OAC A;  4WFO A;  4RZM A;  5AIG A;  4HZ9 B;  1YJ9 3;  1UCI A;  1ULJ B;  2QGU A;  4RNZ A;  1VQN 3;  3D9R A;  3RGR A;  4RNY A;  4FMB A;  4HM0 B;  1ROV A;  1AY7 A;  2H0H A;  2BMR B;  3WMD A;  2XEP A;  3G6E 3;  2KRT A;  4HBR A;  3ALA A;  3G8Z A;  1U5O A;  1BNE A;  1BU4 A;  4HM1 B;  4OUQ A;  1YIJ 3;  3DGY A;  2IY2 A;  1V58 A;  2PNC A;  3CME 3;  4HJL B;  3LH4 A;  3MWZ A;  2H0I A;  3PXM A;  5D82 A;  4AEQ A;  3FSD A;  3PCS A;  2GEY A;  3LT8 A;  3ECF A;  3KSE D;  2AAE A;  5BVB A;  2XGN A;  3NX0 A;  1IV9 A;  4LZI A;  6RNT A;  1BNJ A;  3STD A;  2ZHX B;  1B3S A;  4OVM A;  5IW9 A;  1T5Y A;  3KN4 A;  1GMP A;  1RGF A;  1GY6 A;  4H61 A;  1F8N A;  2SBL A;  3AMO A;  3HX8 A;  8RNT A;  1DMQ A;  5JPU A;  4NPB A;  4XBY A;  4XDV A;  1O7W B;  4PEJ A;  3EE1 A;  1K73 4;  3J7Y d;  1RGK A;  4HVN A;  1W2Z A;  1NB3 I;  4I4K A;  3AMO B;  1FGM A;  2W56 A;  1RN7 A;  4ORL A;  2D1W A;  3CPW 2;  1RGE A;  3MG3 A;  2CFW A;  4H3U A;  1LVN A;  3G16 A;  3JUP A;  3LTD A;  4I5Q A;  8CHO A;  5JBS A;  4HM6 B;  3F8X A;  3GZR A;  5CF1 A;  1GMR A;  1PY3 A;  5LC6 A;  3AHW A;  2W56 B;  3CC7 3;  3VF1 A;  5HOH A;  1D6U A;  2CX1 A;  1OPY A;  1BRI A;  1SII A;  1GY5 A;  3EJV A;  1RKY A;  1J2B A;  1BOX A;  3U1W A;  2XSO B;  3NXJ A;  1MWT A;  4MMY B;  1MNL A;  5CF2 A;  3LML A;  1TRQ A;  3MG1 A;  1G02 A;  5G2G A;  5M19 A;  1VQO 3;  1KC8 4;  3ZG5 A;  3U97 A;  1WMO A;  2W04 A;  4O8S A;  3HZP A;  3KSP A;  1K8A 4;  3S67 A;  3D4A A;  2Q07 A;  3CNX A;  1IQY A;  3SOA A;  1BGS A;  2QEX 3;  3B4P A; 
#chains in the Genus database with same CATH homology
 3IJE B;  3BNB A;  3HIG A;  4L8O A;  2CC3 A;  3KZT A;  1IT7 A;  3DGL A;  2K0M A;  3CCQ 3;  4HZB B;  2OQE A;  4Q53 A;  3OW2 2;  2XH9 A;  3LZA A;  3LTA A;  1NO3 A;  2B1X B;  3B8L A;  1K41 A;  5AEW B;  3SOY A;  4K61 A;  5CK6 A;  3WOF B;  2HMO B;  3BND A;  2CG1 A;  3NHX A;  2XSH B;  1EKM A;  4N6L A;  4RBN A;  3MKI A;  3WA3 A;  1N5P A;  3B4O A;  1IK3 A;  1S72 3;  1JNQ A;  3KE7 A;  1M1X B;  1RJO A;  5EEO A;  2RGQ A;  3CC4 3;  1R4C A;  2P38 A;  4CCV A;  1BUQ A;  4CDL A;  1JKG A;  3I0Y A;  4XM4 A;  5D83 A;  2YX9 A;  3EN1 B;  4R9K A;  1W00 A;  3LYG A;  4GL6 A;  2WGQ A;  1VQ4 3;  1CEW I;  1KSI A;  1JKG B;  4O3V A;  5IG4 A;  1RRL A;  5AIF A;  3JUN A;  3DGN A;  3OXA A;  1N5H A;  1SJW A;  1IQX A;  2OCT A;  4NRE A;  4XBX A;  4N6O B;  1VQ7 3;  1NDO B;  1E3V A;  1O7M B;  2WOF A;  1STD A;  3FF2 A;  4WP5 A;  3CMA 3;  1MOL A;  5D81 A;  1QAF A;  2RCD A;  3CPO A;  5DRE A;  3MPH A;  1LNH A;  1W2B 2;  3EX9 A;  5I97 A;  3MHE A;  5FGO A;  1QAK A;  2XFT A;  2GU3 A;  3LTC A;  4J8T A;  4J9A A;  1YGE A;  3S29 A;  1WQL B;  2HML B;  4IPB A;  3JVC A;  5KP3 A;  2M7O A;  1KD1 4;  3CCR 3;  2P0M A;  3CCL 3;  3NM7 A;  1K9M 4;  1ULI B;  5AYR B;  3KII A;  1FGT A;  1QAL A;  3N9H A;  4U13 A;  5LC7 A;  1GY7 A;  1DYU A;  2MC8 A;  5KP1 A;  2WGO A;  3EQQ B;  2Z76 A;  3CCE 3;  3FF0 A;  3MG2 A;  2Y73 A;  3KKG A;  4XBT A;  5JPP A;  1VQ6 3;  1OH0 A;  2OOV C;  4O2H A;  3NBB A;  3IPT A;  3EB8 A;  1N9E A;  2B24 B;  1K28 A;  4KVH A;  3RDE A;  5IEP A;  3FG3 A;  2CWT A;  3N8B A;  1W4N A;  3SVA A;  1OF5 A;  2Z77 A;  3BNC A;  3GWR A;  3MSO A;  2RFR A;  3N54 B;  2CW9 A;  1DVD A;  3CCS 3;  4HM4 B;  1VQ5 3;  3BB9 A;  3F14 A;  1OF5 B;  3UL6 A;  1DVC A;  1IVX A;  2CKF B;  1HU9 A;  4NHF A;  4N6V 0;  1ZX2 A;  1A67 A;  3G4S 3;  2BNG A;  1W6C A;  3RGA A;  1IQ8 A;  1UW1 A;  2C11 A;  1IVW A;  3QK9 A;  3JUO A;  2Y74 A;  2CFL A;  1L5G B;  3V92 A;  1JRQ A;  3CC2 3;  1YIT 3;  2Z6B A;  1Q81 4;  4L8P A;  1IVV A;  1C7H A;  1Q42 A;  2FGT A;  5IG5 A;  1W7C A;  4N3V A;  3CCM 3;  1O7N B;  2CK3 H;  3OWS A;  3DXO A;  4FMA A;  4HM5 B;  1IDP A;  4WYK A;  1D6Y A;  2E2V A;  2BHM A;  1FGR A;  3GZB A;  1EA2 A;  1O7H B;  4IT7 A;  3UNL A;  2IA7 A;  1TP6 A;  2XFS A;  3Q90 A;  1JB5 A;  4JRF A;  1OCV A;  4WYK B;  1LXE A;  2XGL A;  1QMA A;  3F8H A;  4BTX A;  1US1 A;  1JB4 A;  3FH1 A;  1Y4K A;  2W9Q A;  3K9M C;  1QJG A;  2BO9 B;  3KFQ C;  1M90 4;  2BMO B;  3CU3 A;  2HMJ B;  4N6N B;  2HMN B;  4LSO A;  3X3Y A;  1W01 A;  2CIU A;  2UX0 A;  5BXQ A;  2HMK B;  3DGO A;  4K1U A;  5CLK A;  4QWT A;  3S5C A;  2OQE C;  1IVU A;  2P05 A;  1VQ9 3;  3CCV 3;  3NV0 A;  5FW5 A;  5IER A;  2P09 A;  3L0R A;  2IMJ A;  1TFK A;  4JF8 A;  1WNH A;  4K1V A;  1ASK A;  7STD A;  1AR0 A;  3MYT A;  4KFD A;  3DZL A;  2XR8 B;  3NV0 B;  1IT8 A;  2Z7A A;  2F98 A;  3WDG B;  1N8Q A;  2W6J H;  2YFI B;  4EV5 A;  4R1K A;  3PCR A;  2P0X A;  1S5A A;  1UI8 A;  4X2H A;  4XB5 A;  2CFK A;  3FZW A;  5AEU B;  3F7X A;  2A15 A;  3FGY A;  4HM7 B;  4KFF A;  2E2T A;  1VZZ A;  3DGM A;  3X41 A;  1N8R 4;  2F86 B;  4AKZ A;  4EC6 A;  1VQL 3;  3CD6 3;  3T8N A;  5TGN A;  3LTB A;  2GEX A;  1GD4 A;  2JDI H;  2FNQ A;  3K5T A;  3NBJ A;  3BNE A;  2RSX A;  4ZM8 A;  4KZ1 A;  3NM2 A;  4EV2 A;  3JUM A;  2INX A;  1JV2 B;  2CH9 A;  3PS8 A;  2W0Q A;  3I56 3;  4FMD A;  3Q2P A;  3K0Z A;  3G71 3;  1QVF 2;  1V74 A;  2BT3 A;  4STD A;  3SLU A;  4EYC A;  2CFD A;  3DUK A;  5AI1 A;  1M1K 4;  3BLZ A;  1G96 A;  3GAX A;  2WO0 A;  2LQV A;  1ISK A;  3OX9 A;  1SPU A;  1VQP 3;  2CWU A;  4MJD A;  3T8U A;  2WOH A;  4OK0 A;  4BTY A;  3I55 3;  3GRD A;  4LEH A;  3HK4 A;  1Q82 4;  5A0O B;  1UI7 A;  5IG0 A;  4HM8 B;  3TDG A;  1W6G A;  3GZY B;  6STD A;  4R4K A;  2W2C A;  2ZL8 A;  2ML5 A;  1VQ8 3;  4MMZ B;  3ROB A;  1AV4 A;  3HII A;  1E3R A;  1NJI 4;  1M9G A;  1OHO A;  4O02 B;  3WA2 X;  4XDW A;  3O8Y A;  1EQK A;  2YFJ B;  1FUW A;  1KQS 2;  4FCM A;  4WWU C;  1OGX A;  3FKA A;  5HGR A;  2CHC A;  3CNM A;  1JB2 A;  3NQY A;  2ZDJ A;  2I9W A;  1W6Y A;  3PGB A;  3VSY A;  2OOV A;  3X42 A;  1AVK A;  2K54 A;  2GBW B;  1KWI A;  4AKY A;  1TUH A;  3E99 A;  3H51 A;  1CQS A;  3UL5 A;  1NB5 I;  4HYZ A;  2GBX B;  1TU5 A;  5AIH A;  3CCU 3;  2W03 A;  2FXT A;  1YJW 3;  3WOD G;  5AYS C;  3S27 A;  2KCD A;  3V99 A;  2BMQ B;  2HMM B;  5EVH A;  3D3L A;  3X3Z A;  3HI7 A;  2PZV A;  2O9U X;  3S28 A;  5ELJ A;  5STD A;  1STF I;  1HKX A;  1W02 A;  3LOY A;  3PZW A;  1PFP A;  2O3O A;  1GYB A;  2C10 A;  4IIA A;  3FLJ A;  2MF7 A;  1AVL A;  5KP4 A;  1VQM 3;  3FCS B;  3SXX A;  3PYJ A;  4MEI A;  1IU7 A;  4FCJ A;  3X40 A;  1W5Z A;  3G0K A;  1DMM A;  3X3X A;  2E2U A;  1FGQ A;  4R9L A;  1OGZ A;  1GS3 A;  2GU1 A;  1GD3 A;  3FG1 A;  4EBG A;  1NWW A;  3EBY A;  3FG4 A;  3A76 A;  4HKV B;  1RRH A;  3B7C A;  2GXF A;  1O7P B;  2R4I A;  3CXC 2;  2CWV A;  2V1L A;  3DY5 A;  3K7C A;  1Z1S A;  1D6Z A;  2L4V A;  3JUQ A;  1E97 A;  1QVG 2;  1ROA A;  5ELU A;  5IG3 A;  1TIJ A;  1OHS A;  1N9J A;  1JJ2 2;  1YVB I;  2QIY A;  3QRD A;  3VGN A;  1TFO A;  1NU3 A;  1OUN A;  1Q86 4;  2XRX B;  3ER7 A;  4N6U A;  4WHA A;  3WOE B;  1SIH A;  5AII A;  1IV7 A;  1WMN A;  2ML6 A;  1U8C B;  3LXU X;  1YJN 3;  4FMC A;  1A2V A;  1A90 A;  2F99 A;  1DMN A;  3DM8 A;  3EBT A;  4TX4 A;  3V98 A;  3EF8 A;  1O7G B;  4K90 B;  3OV4 A;  4LGQ A;  3UJM A;  4G1M B;  2W9P A;  5IEN A;  3EHC A;  3SX1 A;  4R80 A;  3OWU A;  2OTJ 3;  1PU4 A;  3H3H A;  1YI2 3;  5IF6 A;  3OWY A;  2QA4 3;  4X2O A;  5EQL A;  4EXR A;  2OWP A;  1LOX A;  1WTH A;  4MMX B;  5IEO A;  1ZO2 A;  3SED A;  4BTW A;  3F40 A;  1Q7Y 4;  2LYX A;  1JN5 A;  3M8C A;  2JQ5 A;  2IUK A;  3NBR A;  3Q1C A;  4N6M A;  2D42 A;  4HM2 B;  1FA3 A;  4KFE A;  1UUV B;  3EN8 A;  2CG0 A;  3F9S A;  3NUV A;  3UB1 A;  1JN5 B;  5DRV A;  1YHQ 3;  1WMP A;  4LMI A;  1OHP A;  3IMA B;  5CXO A;  1FGO A;  2YFL B;  1CYU A;  2XF3 A;  3DMC A;  3K63 A;  4FR9 A;  1A2K A;  2CFG A;  1CYV A;  2KXG A;  3T0U A;  4N6T A;  1EG9 B;  4HM3 B;  1SQW A;  3EC9 A;  2STD A;  1Q40 A;  2OTL 3;  1UUW B;  3LT9 A;  3CCJ 3;  4GB5 A;  3GZX B;  3F7S A;  2IUJ A;  1Q40 B;  4L7K A;  1VQK 3;  4FCZ A;  3NQZ A;  1OAC A;  4WFO A;  4RZM A;  5AIG A;  4HZ9 B;  1YJ9 3;  1VQN 3;  1ULJ B;  2QGU A;  4RNZ A;  3D9R A;  3RGR A;  4RNY A;  4FMB A;  4HM0 B;  1ROV A;  2BMR B;  3WMD A;  2XEP A;  3G6E 3;  2KRT A;  4HBR A;  3ALA A;  3G8Z A;  1U5O A;  4HM1 B;  4OUQ A;  1YIJ 3;  2PNC A;  3CME 3;  4HJL B;  3LH4 A;  3MWZ A;  3PXM A;  5D82 A;  4AEQ A;  3FSD A;  3PCS A;  2GEY A;  3LT8 A;  3ECF A;  3KSE D;  5BVB A;  2XGN A;  3NX0 A;  1IV9 A;  4LZI A;  3STD A;  4OVM A;  5IW9 A;  1T5Y A;  3KN4 A;  1GY6 A;  4H61 A;  1F8N A;  2SBL A;  3AMO A;  3HX8 A;  1DMQ A;  5JPU A;  4XBY A;  4XDV A;  1O7W B;  4PEJ A;  3EE1 A;  1K73 4;  3J7Y d;  4HVN A;  1W2Z A;  1NB3 I;  4I4K A;  3AMO B;  1FGM A;  2W56 A;  1RN7 A;  4ORL A;  2D1W A;  3CPW 2;  3MG3 A;  2CFW A;  4H3U A;  1LVN A;  3G16 A;  3JUP A;  3LTD A;  8CHO A;  5JBS A;  4HM6 B;  3F8X A;  3GZR A;  5CF1 A;  5LC6 A;  2W56 B;  3CC7 3;  3VF1 A;  1D6U A;  1OPY A;  1SII A;  1GY5 A;  3EJV A;  1RKY A;  1J2B A;  3U1W A;  2XSO B;  3NXJ A;  4MMY B;  1MNL A;  5CF2 A;  3LML A;  3MG1 A;  5G2G A;  1VQO 3;  1KC8 4;  3U97 A;  1WMO A;  2W04 A;  4O8S A;  3HZP A;  3KSP A;  1K8A 4;  3S67 A;  2Q07 A;  3CNX A;  1IQY A;  3SOA A;  2QEX 3;  3B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...