5IG4A

Crystal structure of n. vectensis camkii-a hub
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
131
structure length
129
Chain Sequence
b'TAKVREQEIIRLTQKLITSITTGDYDTYSKLVDPHVTCFEPFSNGNLVEGLEFHKFYFDNTLSKVPINTTILSPHVHVLGEDAACICYMRLTQSVNSSGEAKTLQQEETRVWQKKGGNWINVHFHISGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Predicted protein
publication title Molecular mechanism of activation-triggered subunit exchange in Ca(2+)/calmodulin-dependent protein kinase II.
pubmed doi rcsb
source organism Nematostella vectensis
molecule tags Transferase
total genus 34
structure length 129
sequence length 131
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2016-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5ig4A00
2F98A 4HZ9B 3EBYA 3M8CA 3HZPA 4N3VA 3EN8A 2OWPA 1OHOA 2HMNB 1JKGA 4OUQA 1GY7A 3B8LA 1Q42A 3EHCA 5BXQA 1OF5B 3CNXA 3EJVA 2JQ5A 2STDA 3LZAA 1ASKA 5BVBA 4L8PA 4ORLA 5D82A 4HM3B 2XR8B 1UUWB 4MJDA 1OHSA 3KE7A 3OX9A 5CLKA 1Q40B 2YFIB 2GEYA 5CF2A 3NV0B 4HM4B 3GZBA 2I9WA 1QJGA 2CHCA 4R1KA 3GZYB 1OHPA 1BUQA 3EF8A 3K7CA 2Z7AA 1DMNA 4LEHA 5AIIA 1ULJB 1OCVA 5DRVA 1U5OA 4WP5A 5CF1A 4I4KA 1NDOB 4HM5B 1O7GB 4HJLB 5JPUA 3KKGA 3H3HA 2HMLB 3RGAA 3F14A 5AEWB 4HKVB 3D9RA 5IF6A 4RZMA 2A15A 2YFLB 1IDPA 3DUKA 3NUVA 1JKGB 1W00A 2HMMB 4Q53A 2QIYA 4H3UA 3SOAA 1K41A 5CXOA 3HX8A 2YFJB 3STDA 2GBWB 3LYGA 5AEUB 3KSPA 1O7WB 3H51A 1NU3A 4XM4A 4CDLA 2R4IA 5STDA 3NXJA 5CK6A 1JN5A 4L7KA 4LGQA 1UUVB 1E97A 3MKIA 1HKXA 3ECFA 3T8NA 3JUOA 5IEPA 4HVNA 5TGNA 4XBTA 3ROBA 3B4OA 1TP6A 4J9AA 3OWSA 2B24B 1OH0A 2Z77A 4WYKA 1O7NB 2QGUA 3BLZA 2GXFA 1JB2A 3OV4A 3DXOA 5D83A 4FCMA 2GBXB 2IMJA 3CU3A 3BB9A 5IEOA 3MSOA 4STDA 3JUMA 3S5CA 1W02A 3SOYA 4X2HA 4GB5A 3FLJA 3FZWA 1S5AA 1EG9B 3I0YA 3EX9A 1STDA 2RCDA 4LMIA 3HK4A 3WMDA 3RGRA 1SJWA 4XB5A 3JUPA 5IG4A 3NHXA 3B7CA 4XDWA 1DMQA 4FCJA 3FGYA 1OUNA 3EC9A 1JB4A 3GRDA 3A76A 2BMOB 2XRXB 1TUHA 1ZX2A 1C7HA 1Q40A 5IERA 1EA2A 3NV0A 3G8ZA 2HMKB 2GEXA 3GWRA 2B1XB 1ULIB 2BNGA 3ER7A 4U13A 3EBTA 5IG5A 4WYKB 4K1UA 2CKFB 1O7PB 3UNLA 1A2KA 3MHEA 3IPTA 3F40A 7STDA 1GYBA 4XBYA 3NM2A 5KP4A 1OGXA 2XSOB 1Z1SA 5KP3A 5EVHA 3MG2A 3EN1B 3GZRA 5DREA 3Q90A 5AI1A 3F9SA 5AIHA 4K1VA 2K54A 3G16A 2HMOB 3F7XA 2XSHB 2RGQA 2HMJB 3OWUA 1O7MB 3F8XA 3CPOA 4HM6B 3FF2A 3MYTA 1GY6A 1WQLB 2RFRA 5AIGA 1O7HB 3VGNA 5JPPA 3GZXB 3FH1A 4HZBB 4XDVA 3JUQA 4HM8B 6STDA 5IG0A 2Z76A 4J8TA 3FSDA 1GY5A 3K0ZA 3EQQB 4R9KA 3E99A 1CQSA 5AIFA 4OVMA 3OXAA 5IENA 2BMQB 2UX0A 3FF0A 5IG3A 1GS3A 1OF5A 1E3VA 2BMRB 4X2OA 4HM0B 3JUNA 1JB5A 3CNMA 1DMMA 3DM8A 2INXA 5KP1A 1JN5B 3G0KA 3SEDA 1QMAA 1E3RA 1W01A 3MG1A 1AR0A 4HM1B 1OGZA 1ZO2A 3DMCA 4L8OA 5G2GA 3VSYA 4XBXA 4IIAA 4HM2B 5D81A 2W2CA 3KZTA 3F7SA 4R9LA 5FW5A 2F99A 8CHOA 2F86B 3FKAA 3UJMA 2PZVA 3NBRA 4KVHA 1W6YA 1VZZA 3DZLA 3B4PA 4WWUC 3T8UA 1ISKA 4HM7B 3OWYA 1NWWA 3MG3A 4PEJA 1OPYA 5HGRA 3F8HA
chains in the Genus database with same CATH superfamily
2F98A 3D79A 4HZ9B 3LTAA 5IW9A 4JF8A 1L5GB 1DETA 2P38A 3EBYA 3RNTA 2RBIA 1GMQA 2OCTA 3LT9A 3M8CA 5G1KA 1I2EA 1SPUA 2Q07A 3HZPA 1G96A 1R4YA 3PCRA 3RDEA 3EE1A 1M1XB 4CCVA 1N9JA 2MF7A 1GOVA 3IMAB 2F4YA 3LOYA 3EN8A 2OWPA 2XGNA 2RNTA 4N3VA 1A90A 1OHOA 2BU4A 1BRJA 2C10A 2HMNB 1JKGA 1LRAA 4OUQA 1VQM3 1GY7A 3B8LA 1Q42A 1X1UA 3EHCA 3AHSA 7GSPA 1BNEA 4J5KA 1I2GA 5BXQA 2OOVA 1OF5B 3CNXA 3EJVA 1JBSA 1Q9EA 3UB1A 1I0XA 1LQGC 1UDII 2GSPA 2JQ5A 2STDA 1LOWA 1ASKA 3LZAA 5BVBA 1US1A 4L8PA 4ORLA 5D82A 3T0UA 3S28A 2KF3A 1BSEA 3BNBA 4HM3B 2ZL8A 3IJEB 2XR8B 3MWZA 2WOFA 1BRIA 1T2IA 2W56B 1UUWB 2KXGA 4MJDA 3CCM3 1OHSA 1KSIA 3KE7A 1U8CB 3PXMA 1BGSA 3OX9A 2AADA 2O3OA 1NNVA 5CLKA 1Q40B 2YFIB 3CCV3 2GU3A 3LTCA 2GEYA 1JV2B 1ZS7A 3J7Yd 5CF2A 3EB8A 3GSPA 1N5PA 3NV0B 2XFSA 4HM4B 1IT8A 3GZBA 2I9WA 1RNTA 1QJGA 2CHCA 4FMCA 3OW22 4R1KA 3GZYB 1RGFA 4EYCA 2W9PA 1OHPA 3V92A 4N6V0 2D42A 2C11A 1IK3A 1FUTA 1LOVA 1MWSA 3LTDA 1VQ43 1BUQA 3EF8A 3K7CA 2Z7AA 1DMNA 1ROVA 4LEHA 4FR9A 5AIIA 4DKIA 1BSDA 1QAKA 1ULJB 1V57A 3SYUA 1OCVA 1NB5I 2CC3A 5DRVA 3AHWA 2E2UA 1W4NA 4MEIA 1U5OA 1I0VA 2H0GA 1QVF2 4WP5A 5CF1A 3X41A 4CJNA 2OQEC 4I4KA 4KFEA 1NDOB 1RTUA 2KCDA 1B2ZA 4HM5B 4KZ1A 1G0TA 1C54A 2P0XA 1TFOA 4TX4A 3BIRA 5GSPA 1O7GB 1TJDA 1BIRA 3ZG5A 1YJW3 4HJLB 5JPUA 1G02A 1RRLA 2D1WA 2H0IA 1BNFA 1N9EA 3AGNA 3KKGA 2JDIH 3H3HA 2HMLB 1IVUA 3RGAA 4O3VA 3F14A 3FCSB 4FMBA 4HKVB 5AEWB 1LNHA 1W6CA 3D9RA 5IF6A 1QVG2 3ZFZA 2L4VA 4N6LA 2OOVC 2WGOA 1HYFA 3O8YA 4RZMA 2A15A 3AMOA 2CFGA 3KIIA 1MGRA 1A2PA 1VQO3 2CFLA 2YFLB 1STFI 1IVWA 1IDPA 3HIGA 1PU4A 4O8SA 1W2ZA 2CFDA 5BIRA 1IQXA 3DUKA 3CCU3 1VQL3 3NUVA 1JKGB 1W00A 2HMMB 1GD4A 4Q53A 2QIYA 1TIJA 4H3UA 3SOAA 1IV9A 1AVLA 4ILFA 3LXUX 1K41A 3N9HA 3Q3FA 4QWTA 5CXOA 3HX8A 1MNLA 2YFJB 4O02B 3STDA 2CWUA 1SIHA 2GBWB 3LYGA 2KF4A 3MPHA 5AEUB 1HZ1A 3KSPA 1O7WB 1RGAA 1NU3A 1RN4A 3H51A 3PZWA 1UCLA 4FMDA 3S67A 4HOHA 4XM4A 1BRGA 2H0HA 4RBNA 3PGBA 1B2UA 4CDLA 2BHMA 3X42A 1GOUA 1JBRA 1IYYA 2R4IA 5STDA 3LMLA 3NX0A 3NXJA 5M18A 3SVAA 5CK6A 1WNHA 3L0RA 1JN5A 4BIRA 4L7KA 2F56A 1W6GA 1UUVB 4LGQA 1E97A 5G1LA 2BIRA 3MKIA 3K5TA 1HKXA 3ECFA 3T8NA 2IY2A 3I553 1UUGB 3JUOA 2P09A 1FGOA 1BSAA 1I8VA 2CG1A 1DE3A 5IEPA 3CCS3 3LT8A 3PCSA 4HVNA 5TGNA 1QALA 2QEX3 4N6NB 1Q7HA 4XBTA 3ROBA 3B4OA 1I70A 2J8XB 5A0OB 1RGHA 1TP6A 4J9AA 1AV4A 2LYXA 1LVNA 3OWSA 1A2VA 1OH0A 2B24B 2Z77A 3Q1CA 4WYKA 1A67A 4KFDA 1T5YA 2XH9A 1BRNL 1PFPA 1O7NB 2QGUA 3BLZA 1BNGA 4AKZA 3SXXA 5HOHA 1JJ22 2GXFA 1X1XA 2IUKA 1JB2A 1YHQ3 1M904 1DYUA 2CW9A 1B2MA 3OV4A 3X3YA 3DXOA 3KCHA 5D83A 2Y74A 5LC7A 1J2BA 4FCMA 2GBXB 2IMJA 2BT3A 3CU3A 1N5HA 3BB9A 1IQ8A 5IEOA 2CG0A 3MSOA 4K90B 1RGCA 2Z6BA 4STDA 3CCL3 4KT3B 1BVIA 4GL6A 1EQKA 2GU1A 1CH0A 3JUMA 1CYUA 3CCQ3 3S5CA 1DVDA 1RJOA 2CWTA 1W02A 2OTL3 1DVCA 2WO0A 3PS8A 5RNTA 6GSPA 2W9QA 3DGLA 4EV2A 3SOYA 3CC23 4FMAA 1AVKA 4RNTA 3V99A 1YIJ3 4X2HA 1K9M4 1B2SA 2CH9A 4GB5A 3FLJA 2HOHA 3X3XA 3WOFB 3HI7A 2V1LA 1PY3A 1GSPA 4BL2A 1B2XA 6RNTA 1D6ZA 3URPA 3FZWA 5I97A 1RGEA 1RGLA 1UCJA 1UGHI 3I563 4LZIA 4WFOA 1Q824 1B21A 1N8QA 1S5AA 1W2B2 3CPW2 1JRQA 1EG9B 3V98A 3I0YA 1Q864 3EX9A 2IYJA 3WA2X 5FGOA 1STDA 1B27A 3S27A 2RCDA 1BSCA 5M1AA 2UGIA 4IT7A 1EKMA 1RCLA 2O9UX 3KN4A 4LMIA 1FUSA 2ZA4A 3HK4A 3WMDA 3X3ZA 3N54B 3RGRA 1SJWA 2SARA 3PYJA 1YJ93 2E2VA 3GAXA 4HBRA 4XB5A 3JUPA 5IG4A 3ZG0A 1TFKA 1VQN3 1RSNA 3NHXA 1X1WA 3B7CA 3NQYA 4XDWA 4GSPA 1DMQA 1VQK3 1K8A4 1HU9A 1GD3A 2YX9A 4FCJA 5ELUA 3FGYA 1UI8A 1OUNA 3EC9A 1JB4A 2XFTA 3GRDA 3D5IA 3WDGB 1CYVA 4O2HA 1Y4KA 2P0MA 1Q7Y4 3A76A 1FGMA 1YVBI 2BMOB 2W03A 2XRXB 1TUHA 1ZX2A 3NM7A 1IQYA 4EXRA 1C7HA 1VQ93 1NO3A 3D3LA 1Q40A 1OACA 3SLUA 5IERA 4CPKA 1BAOA 3DGYA 4FCZA 1EA2A 1F8NA 1K28A 3NV0A 3G8ZA 2SBLA 3LH4A 3NBBA 1I2FA 1RCKA 2HMKB 1RKYA 3CCJ3 1RMSA 2GEXA 5EEOA 3GWRA 2B1XB 5BU4A 3X40A 4MMYB 5M19A 1ULIB 4LSOA 1GMPA 2CX1A 1VQ53 2FGTA 2BNGA 3ER7A 4U13A 3EBTA 5IG5A 1JZOA 1VQ63 1TRQA 4WYKB 1EEJA 1Q814 1UGIA 1MWTA 3ALAA 1IVXA 7RNTA 2CIUA 3K63A 3N8BA 2CKFB 4K1UA 4N6UA 1O7PB 3UNLA 1A2KA 3BU4A 1YIT3 1MWRA 1GMRA 3MHEA 2M7OA 3IPTA 1MWUA 3VF1A 2CWVA 2F5MA 3UL6A 2ZDJA 3F40A 1YNVX 3Q2PA 4AEQA 5AYSC 7STDA 1LQMB 1GYBA 4NPBA 3DGOA 4MMXB 4XBYA 3NM2A 2C4BA 5KP4A 1KWIA 1FGQA 2XEPA 5LC6A 3CC43 1OGXA 2XSOB 1UCKA 1Z1SA 3FG1A 5EVHA 5AYRB 5KP3A 3WHOA 3MG2A 1X1YA 1W7CA 3EN1B 2AAEA 4R80A 3GZRA 4BU4A 5AI1A 3Q90A 4N6MA 5DREA 3F9SA 2W6JH 5AIHA 4K1VA 3UL5A 2K54A 4ZM8A 3AGOA 2KF5A 3CME3 4BL3A 3HOHA 4JRFA 3G16A 1R4CA 1TTOA 1B3SA 2HMOB 3F7XA 2XSHB 1LNIA 4RNZA 2RGQA 1VQQA 2KRTA 2HMJB 3OWUA 4GHOA 1N8R4 1RDSA 1S723 1O7MB 1D6UA 3F8XA 4PEJA 2MC8A 1KC84 4EBGA 1LOYA 3CPOA 1T3BA 4HM6B 2CX0A 4OK0A 3FF2A 2XGLA 4EW5A 3MYTA 1JBTA 1GY6A 1WQLB 1K734 1WMPA 1FA3A 2RFRA 1ROAA 1WMNA 2W0QA 1BNIA 5AIGA 1BRSA 1AQZA 4AKYA 8RNTA 1O7HB 3G713 3VGNA 2WGQA 3GZXB 5JPPA 3FH1A 1FW7A 4HZBB 4XDVA 3JUQA 3QRDA 2ZHXB 1BSBA 2ML5A 3AMOB 4HM8B 3CD63 2E2TA 3DGNA 5ELJA 6STDA 1RRHA 5IG0A 9RNTA 1IVVA 2LQVA 4NHFA 1YJN3 1IT7A 2Z76A 3BNEA 3DGMA 4J8TA 2ML6A 3LTBA 3CCE3 1WMOA 3FSDA 3JVCA 2XF3A 2Y73A 5JBSA 1M9GA 3DY5A 1GY5A 3K0ZA 1FUWA 4NREA 3EQQB 4R9KA 4KFFA 1JZDA 3NQZA 1UW1A 1BANA 1LOXA 1T2HA 3E99A 4N6OB 4EC6A 1CQSA 5AIFA 1RGKA 3OXAA 4OVMA 5IENA 4K61A 2BMQB 2RSXA 2UX0A 3FF0A 3CMA3 1JNQA 4LYLB 1W5ZA 1GS3A 5IG3A 1OF5A 1UCIA 3D5GA 1VQP3 1CEWI 1YGEA 1E3VA 2BMRB 2CK3H 4X2OA 1NJI4 4HM0B 1RN1A 1RGGA 3JUNA 1BNJA 4BTWA 1YI23 1YGWA 2FNQA 1JB5A 1FGTA 5EQLA 3CNMA 1BUJA 1BRHA 3D4AA 3DH2A 3KFQC 1DMMA 1UI7A 2K0MA 3DM8A 1IU7A 2INXA 4HAAA 1AY7A 1B20A 2WOHA 2W56A 5KP1A 1JN5B 2FXTA 3G0KA 4RNYA 1TRPA 3SEDA 1QMAA 3WOEB 1E3RA 1BNSA 1W01A 1AR0A 2UUGC 1EUIC 3BNDA 3MG1A 2P05A 2KAAA 1FZUA 4HYZA 1WTHA 4MMZB 3TDGA 4HM1B 1PYLA 1OGZA 2KF6A 1YVSA 2F5WA 1RN7A 4G1MB 4N6TA 1TU5A 1SARA 3FG4A 4I5QA 1SIIA 1RNBA 1ZO2A 3DMCA 4L8OA 5G2GA 3VSYA 4XBXA 4IIAA 4WHAA 3BNCA 1BNRA 2IUJA 3WODG 1GOYA 4HM2B 3FG3A 3WA3A 2L1SA 3G4S3 2BO9B 5D81A 1KD14 1BU4A 1ZGXA 1IV7A 1D6YA 2W2CA 3KZTA 4BTYA 4EV5A 1RLSA 3F7SA 1LXEA 4BTXA 1BRKA 1V58A 4R9LA 5FW5A 1NB3I 2R41A 2OTJ3 1QAFA 3U1WA 2F99A 2CFWA 8CHOA 3G6E3 1M1K4 3NBJA 1MGWA 2F86B 3FKAA 3UJMA 2IA7A 3S29A 1I3FA 2QA43 2PNCA 1I3IA 2K3DA 2PZVA 3K9MC 1SQWA 4R4KA 3NBRA 1V74A 3A5EA 4H61A 2CFKA 4KVHA 1W6YA 1BOXA 1VZZA 3DZLA 3U97A 4IPBA 3WR2A 1VQ83 3B4PA 1KQS2 4WWUC 3T8UA 1ISKA 3HIIA 4HM7B 1FYSA 3KSED 3OWYA 3SX1A 3QK9A 4J5GA 1NWWA 3MG3A 3CC73 2W04A 3CXC2 1MOLA 2OQEA 1VQ73 1FGRA 1RHLA 1OPYA 3CCR3 5HGRA 3F8HA
chains in the Genus database with same CATH topology
2F98A 4HZ9B 3LTAA 5IW9A 4JF8A 1L5GB 2P38A 3EBYA 3M8CA 2OCTA 3LT9A 1SPUA 2Q07A 3HZPA 1G96A 3PCRA 3RDEA 3EE1A 1M1XB 4CCVA 1N9JA 2MF7A 4N3VA 3IMAB 3LOYA 3EN8A 2OWPA 2XGNA 1A90A 1OHOA 2C10A 2HMNB 1JKGA 4OUQA 1VQM3 1GY7A 3B8LA 1Q42A 3EHCA 5BXQA 2OOVA 1OF5B 3CNXA 3EJVA 3UB1A 2JQ5A 2STDA 3LZAA 1ASKA 5BVBA 1US1A 4L8PA 4ORLA 5D82A 3T0UA 3S28A 3BNBA 4HM3B 2ZL8A 3IJEB 2XR8B 3MWZA 2WOFA 2W56B 1UUWB 2KXGA 4MJDA 3CCM3 1OHSA 1KSIA 3KE7A 1U8CB 3PXMA 3OX9A 2O3OA 5CLKA 3CCV3 1Q40B 2YFIB 2GU3A 3LTCA 2GEYA 1JV2B 3J7Yd 5CF2A 3EB8A 1N5PA 3NV0B 2XFSA 4HM4B 1IT8A 3GZBA 2I9WA 1QJGA 2CHCA 4FMCA 3OW22 4R1KA 3GZYB 4EYCA 2W9PA 1OHPA 3V92A 4N6V0 2D42A 2C11A 1IK3A 1VQ43 1BUQA 3LTDA 3EF8A 3K7CA 2Z7AA 1DMNA 1ROVA 4LEHA 4FR9A 5AIIA 1QAKA 1ULJB 1OCVA 1NB5I 2CC3A 5DRVA 2E2UA 1W4NA 4MEIA 1U5OA 1QVF2 4WP5A 5CF1A 3X41A 2OQEC 4I4KA 4KFEA 1NDOB 2KCDA 4HM5B 4KZ1A 2P0XA 1TFOA 4TX4A 1O7GB 1YJW3 4HJLB 5JPUA 1RRLA 2D1WA 1N9EA 3KKGA 2JDIH 3H3HA 2HMLB 1IVUA 3RGAA 4O3VA 3F14A 3FCSB 4FMBA 4HKVB 5AEWB 1LNHA 1W6CA 3D9RA 5IF6A 1QVG2 2L4VA 4N6LA 2OOVC 2WGOA 3O8YA 4RZMA 2A15A 3AMOA 2CFGA 3KIIA 1VQO3 2CFLA 2YFLB 1STFI 1IVWA 1IDPA 3HIGA 1PU4A 4O8SA 2CFDA 1W2ZA 1IQXA 3DUKA 3CCU3 1VQL3 3NUVA 1JKGB 1W00A 2HMMB 1GD4A 4Q53A 2QIYA 1TIJA 4H3UA 3SOAA 1IV9A 1AVLA 3LXUX 1K41A 3N9HA 4QWTA 5CXOA 3HX8A 1MNLA 2YFJB 4O02B 3STDA 2CWUA 1SIHA 2GBWB 3LYGA 3MPHA 5AEUB 3KSPA 1O7WB 3H51A 1NU3A 3PZWA 4FMDA 3S67A 4XM4A 4RBNA 3PGBA 4CDLA 2BHMA 3X42A 2R4IA 5STDA 3LMLA 3NX0A 3NXJA 3SVAA 5CK6A 1WNHA 3L0RA 1JN5A 4L7KA 4LGQA 1W6GA 1UUVB 1E97A 3MKIA 3K5TA 1HKXA 3ECFA 3T8NA 3I553 3JUOA 2P09A 1FGOA 2CG1A 5IEPA 3CCS3 3LT8A 3PCSA 4HVNA 5TGNA 1QALA 2QEX3 4N6NB 4XBTA 3ROBA 3B4OA 5A0OB 1TP6A 4J9AA 1AV4A 2LYXA 1LVNA 3OWSA 1A2VA 1OH0A 2B24B 2Z77A 3Q1CA 4WYKA 1A67A 4KFDA 1T5YA 2XH9A 1PFPA 1O7NB 2QGUA 3BLZA 1JJ22 4AKZA 3SXXA 2GXFA 2IUKA 1JB2A 1YHQ3 1M904 1DYUA 2CW9A 3OV4A 3X3YA 3DXOA 5D83A 2Y74A 5LC7A 1J2BA 4FCMA 2GBXB 2IMJA 2BT3A 3CU3A 1N5HA 3BB9A 1IQ8A 5IEOA 2CG0A 3MSOA 4K90B 2Z6BA 4STDA 3CCL3 4GL6A 1EQKA 2GU1A 3JUMA 1CYUA 3CCQ3 3S5CA 1DVDA 1RJOA 2CWTA 1W02A 2OTL3 1DVCA 2WO0A 3PS8A 3CC23 2W9QA 3DGLA 4EV2A 3SOYA 4FMAA 1AVKA 3V99A 1YIJ3 4X2HA 1K9M4 2CH9A 4GB5A 3FLJA 3X3XA 3WOFB 3HI7A 2V1LA 1D6ZA 3FZWA 5I97A 3I563 4LZIA 4WFOA 1Q824 1N8QA 1S5AA 1W2B2 3CPW2 1JRQA 1EG9B 3V98A 3I0YA 1Q864 3EX9A 3WA2X 5FGOA 1STDA 3S27A 2RCDA 4IT7A 1EKMA 3KN4A 2O9UX 4LMIA 3HK4A 3X3ZA 3WMDA 3N54B 3RGRA 1SJWA 3PYJA 1YJ93 2E2VA 3GAXA 4HBRA 4XB5A 3JUPA 5IG4A 1TFKA 1VQN3 3NHXA 3B7CA 3NQYA 4XDWA 1VQK3 1DMQA 1K8A4 1HU9A 1GD3A 2YX9A 4FCJA 5ELUA 3FGYA 1UI8A 1OUNA 3EC9A 1JB4A 2XFTA 3GRDA 3WDGB 1VQ73 1CYVA 4O2HA 1Y4KA 2P0MA 1Q7Y4 3A76A 1FGMA 1YVBI 2BMOB 2W03A 2XRXB 1TUHA 1ZX2A 3NM7A 1IQYA 4EXRA 1C7HA 1VQ93 1NO3A 3D3LA 1Q40A 1OACA 3SLUA 5IERA 4FCZA 1EA2A 1F8NA 1K28A 3NV0A 3G8ZA 2SBLA 3LH4A 3NBBA 2HMKB 1RKYA 3CCJ3 2GEXA 5EEOA 3GWRA 2B1XB 3X40A 4MMYB 1ULIB 4LSOA 1VQ53 2FGTA 2BNGA 3ER7A 4U13A 3EBTA 5IG5A 1VQ63 4WYKB 1Q814 3ALAA 1IVXA 2CIUA 3K63A 3N8BA 2CKFB 4K1UA 4N6UA 1O7PB 3UNLA 1A2KA 1YIT3 3MHEA 2M7OA 3IPTA 3VF1A 2CWVA 3UL6A 2ZDJA 3F40A 3Q2PA 4AEQA 5AYSC 7STDA 1GYBA 3DGOA 4MMXB 4XBYA 3NM2A 5KP4A 1KWIA 1FGQA 2XEPA 5LC6A 3CC43 1OGXA 2XSOB 1Z1SA 3FG1A 5EVHA 5AYRB 5KP3A 3MG2A 3EN1B 1W7CA 4R80A 3GZRA 2QA43 5AI1A 3Q90A 4N6MA 5DREA 3F9SA 2W6JH 5AIHA 4K1VA 3UL5A 2K54A 4ZM8A 3CME3 4JRFA 3G16A 1R4CA 2HMOB 3F7XA 2XSHB 4RNZA 2RGQA 2KRTA 2HMJB 3OWUA 1N8R4 1S723 1O7MB 1D6UA 3F8XA 2MC8A 1KC84 4EBGA 3CPOA 4HM6B 4OK0A 3FF2A 2XGLA 3MYTA 1GY6A 1WQLB 1K734 1WMPA 1FA3A 2RFRA 1ROAA 2W0QA 1WMNA 5AIGA 4AKYA 1O7HB 3G713 3VGNA 2WGQA 3GZXB 5JPPA 3FH1A 4HZBB 4XDVA 3JUQA 3QRDA 2ML5A 3AMOB 4HM8B 3CD63 2E2TA 3DGNA 5ELJA 6STDA 1RRHA 5IG0A 1IVVA 2LQVA 4NHFA 1YJN3 1IT7A 2Z76A 3BNEA 3DGMA 4J8TA 2ML6A 3LTBA 3CCE3 1WMOA 3FSDA 3JVCA 2XF3A 2Y73A 5JBSA 1M9GA 3DY5A 1GY5A 3K0ZA 1FUWA 4NREA 3EQQB 4R9KA 4KFFA 3NQZA 1UW1A 1LOXA 3E99A 4N6OB 4EC6A 1CQSA 5AIFA 4OVMA 3OXAA 5IENA 4K61A 2BMQB 2RSXA 2UX0A 3FF0A 3CMA3 1JNQA 5IG3A 1W5ZA 1GS3A 1OF5A 1VQP3 1CEWI 1YGEA 1E3VA 2BMRB 2CK3H 4X2OA 1NJI4 4HM0B 3JUNA 4BTWA 1YI23 2FNQA 1JB5A 1FGTA 5EQLA 3CNMA 3KFQC 1DMMA 1UI7A 2K0MA 3DM8A 1IU7A 2INXA 2WOHA 2W56A 5KP1A 1JN5B 2FXTA 3G0KA 4RNYA 3SEDA 1QMAA 3WOEB 1E3RA 1W01A 3MG1A 1AR0A 3BNDA 4HYZA 3TDGA 2P05A 4MMZB 1WTHA 4HM1B 1OGZA 1TU5A 1RN7A 4G1MB 4N6TA 3FG4A 1SIIA 1ZO2A 3DMCA 4L8OA 5G2GA 3VSYA 4XBXA 4IIAA 4WHAA 3BNCA 2IUJA 3WODG 4HM2B 3FG3A 3WA3A 3G4S3 2BO9B 5D81A 1KD14 1IV7A 1D6YA 2W2CA 3KZTA 4BTYA 4EV5A 3F7SA 4BTXA 1LXEA 4R9LA 5FW5A 1NB3I 2OTJ3 1QAFA 3U1WA 2F99A 2CFWA 8CHOA 3G6E3 1M1K4 3NBJA 2F86B 3FKAA 3UJMA 2IA7A 3S29A 2PNCA 2PZVA 3K9MC 1SQWA 4R4KA 3NBRA 1V74A 4H61A 2CFKA 4KVHA 1W6YA 3U97A 1VZZA 3DZLA 4IPBA 1VQ83 3B4PA 1KQS2 4WWUC 3T8UA 1ISKA 3HIIA 4HM7B 3KSED 3OWYA 3SX1A 3QK9A 3CC73 1NWWA 3MG3A 2W04A 3CXC2 1MOLA 2OQEA 1FGRA 4PEJA 1OPYA 3CCR3 5HGRA 3F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F98 A;  4HZ9 B;  3EBY A;  3M8C A;  3HZP A;  4N3V A;  3EN8 A;  2OWP A;  1OHO A;  2HMN B;  1JKG A;  4OUQ A;  1GY7 A;  3B8L A;  1Q42 A;  3EHC A;  5BXQ A;  1OF5 B;  3CNX A;  3EJV A;  2JQ5 A;  2STD A;  3LZA A;  1ASK A;  5BVB A;  4L8P A;  4ORL A;  5D82 A;  4HM3 B;  2XR8 B;  1UUW B;  4MJD A;  1OHS A;  3KE7 A;  3OX9 A;  5CLK A;  1Q40 B;  2YFI B;  2GEY A;  5CF2 A;  3NV0 B;  4HM4 B;  3GZB A;  2I9W A;  1QJG A;  2CHC A;  4R1K A;  3GZY B;  1OHP A;  1BUQ A;  3EF8 A;  3K7C A;  2Z7A A;  1DMN A;  4LEH A;  5AII A;  1ULJ B;  1OCV A;  5DRV A;  1U5O A;  4WP5 A;  5CF1 A;  4I4K A;  1NDO B;  4HM5 B;  1O7G B;  4HJL B;  5JPU A;  3KKG A;  3H3H A;  2HML B;  3RGA A;  3F14 A;  5AEW B;  4HKV B;  3D9R A;  5IF6 A;  4RZM A;  2A15 A;  2YFL B;  1IDP A;  3DUK A;  3NUV A;  1JKG B;  1W00 A;  2HMM B;  4Q53 A;  2QIY A;  4H3U A;  3SOA A;  1K41 A;  5CXO A;  3HX8 A;  2YFJ B;  3STD A;  2GBW B;  3LYG A;  5AEU B;  3KSP A;  1O7W B;  3H51 A;  1NU3 A;  4XM4 A;  4CDL A;  2R4I A;  5STD A;  3NXJ A;  5CK6 A;  1JN5 A;  4L7K A;  4LGQ A;  1UUV B;  1E97 A;  3MKI A;  1HKX A;  3ECF A;  3T8N A;  3JUO A;  5IEP A;  4HVN A;  5TGN A;  4XBT A;  3ROB A;  3B4O A;  1TP6 A;  4J9A A;  3OWS A;  2B24 B;  1OH0 A;  2Z77 A;  4WYK A;  1O7N B;  2QGU A;  3BLZ A;  2GXF A;  1JB2 A;  3OV4 A;  3DXO A;  5D83 A;  4FCM A;  2GBX B;  2IMJ A;  3CU3 A;  3BB9 A;  5IEO A;  3MSO A;  4STD A;  3JUM A;  3S5C A;  1W02 A;  3SOY A;  4X2H A;  4GB5 A;  3FLJ A;  3FZW A;  1S5A A;  1EG9 B;  3I0Y A;  3EX9 A;  1STD A;  2RCD A;  4LMI A;  3HK4 A;  3WMD A;  3RGR A;  1SJW A;  4XB5 A;  3JUP A;  5IG4 A;  3NHX A;  3B7C A;  4XDW A;  1DMQ A;  4FCJ A;  3FGY A;  1OUN A;  3EC9 A;  1JB4 A;  3GRD A;  3A76 A;  2BMO B;  2XRX B;  1TUH A;  1ZX2 A;  1C7H A;  1Q40 A;  5IER A;  1EA2 A;  3NV0 A;  3G8Z A;  2HMK B;  2GEX A;  3GWR A;  2B1X B;  1ULI B;  2BNG A;  3ER7 A;  4U13 A;  3EBT A;  5IG5 A;  4WYK B;  4K1U A;  2CKF B;  1O7P B;  3UNL A;  1A2K A;  3MHE A;  3IPT A;  3F40 A;  7STD A;  1GYB A;  4XBY A;  3NM2 A;  5KP4 A;  1OGX A;  2XSO B;  1Z1S A;  5KP3 A;  5EVH A;  3MG2 A;  3EN1 B;  3GZR A;  5DRE A;  3Q90 A;  5AI1 A;  3F9S A;  5AIH A;  4K1V A;  2K54 A;  3G16 A;  2HMO B;  3F7X A;  2XSH B;  2RGQ A;  2HMJ B;  3OWU A;  1O7M B;  3F8X A;  3CPO A;  4HM6 B;  3FF2 A;  3MYT A;  1GY6 A;  1WQL B;  2RFR A;  5AIG A;  1O7H B;  3VGN A;  5JPP A;  3GZX B;  3FH1 A;  4HZB B;  4XDV A;  3JUQ A;  4HM8 B;  6STD A;  5IG0 A;  2Z76 A;  4J8T A;  3FSD A;  1GY5 A;  3K0Z A;  3EQQ B;  4R9K A;  3E99 A;  1CQS A;  5AIF A;  4OVM A;  3OXA A;  5IEN A;  2BMQ B;  2UX0 A;  3FF0 A;  5IG3 A;  1GS3 A;  1OF5 A;  1E3V A;  2BMR B;  4X2O A;  4HM0 B;  3JUN A;  1JB5 A;  3CNM A;  1DMM A;  3DM8 A;  2INX A;  5KP1 A;  1JN5 B;  3G0K A;  3SED A;  1QMA A;  1E3R A;  1W01 A;  3MG1 A;  1AR0 A;  4HM1 B;  1OGZ A;  1ZO2 A;  3DMC A;  4L8O A;  5G2G A;  3VSY A;  4XBX A;  4IIA A;  4HM2 B;  5D81 A;  2W2C A;  3KZT A;  3F7S A;  4R9L A;  5FW5 A;  2F99 A;  8CHO A;  2F86 B;  3FKA A;  3UJM A;  2PZV A;  3NBR A;  4KVH A;  1W6Y A;  1VZZ A;  3DZL A;  3B4P A;  4WWU C;  3T8U A;  1ISK A;  4HM7 B;  3OWY A;  1NWW A;  3MG3 A;  4PEJ A;  1OPY A;  5HGR A;  3F8H A; 
#chains in the Genus database with same CATH topology
 2F98 A;  3D79 A;  4HZ9 B;  3LTA A;  5IW9 A;  4JF8 A;  1L5G B;  1DET A;  2P38 A;  3EBY A;  3RNT A;  2RBI A;  1GMQ A;  2OCT A;  3LT9 A;  3M8C A;  5G1K A;  1I2E A;  1SPU A;  2Q07 A;  3HZP A;  1G96 A;  1R4Y A;  3PCR A;  3RDE A;  3EE1 A;  1M1X B;  4CCV A;  1N9J A;  2MF7 A;  1GOV A;  3IMA B;  2F4Y A;  3LOY A;  3EN8 A;  2OWP A;  2XGN A;  2RNT A;  4N3V A;  1A90 A;  1OHO A;  2BU4 A;  1BRJ A;  2C10 A;  2HMN B;  1JKG A;  1LRA A;  4OUQ A;  1VQM 3;  1GY7 A;  3B8L A;  1Q42 A;  1X1U A;  3EHC A;  3AHS A;  7GSP A;  1BNE A;  4J5K A;  1I2G A;  5BXQ A;  2OOV A;  1OF5 B;  3CNX A;  3EJV A;  1JBS A;  1Q9E A;  3UB1 A;  1I0X A;  1LQG C;  1UDI I;  2GSP A;  2JQ5 A;  2STD A;  1LOW A;  1ASK A;  3LZA A;  5BVB A;  1US1 A;  4L8P A;  4ORL A;  5D82 A;  3T0U A;  3S28 A;  2KF3 A;  1BSE A;  3BNB A;  4HM3 B;  2ZL8 A;  3IJE B;  2XR8 B;  3MWZ A;  2WOF A;  1BRI A;  1T2I A;  2W56 B;  1UUW B;  2KXG A;  4MJD A;  3CCM 3;  1OHS A;  1KSI A;  3KE7 A;  1U8C B;  3PXM A;  1BGS A;  3OX9 A;  2AAD A;  2O3O A;  1NNV A;  5CLK A;  1Q40 B;  2YFI B;  3CCV 3;  2GU3 A;  3LTC A;  2GEY A;  1JV2 B;  1ZS7 A;  3J7Y d;  5CF2 A;  3EB8 A;  3GSP A;  1N5P A;  3NV0 B;  2XFS A;  4HM4 B;  1IT8 A;  3GZB A;  2I9W A;  1RNT A;  1QJG A;  2CHC A;  4FMC A;  3OW2 2;  4R1K A;  3GZY B;  1RGF A;  4EYC A;  2W9P A;  1OHP A;  3V92 A;  4N6V 0;  2D42 A;  2C11 A;  1IK3 A;  1FUT A;  1LOV A;  1MWS A;  3LTD A;  1VQ4 3;  1BUQ A;  3EF8 A;  3K7C A;  2Z7A A;  1DMN A;  1ROV A;  4LEH A;  4FR9 A;  5AII A;  4DKI A;  1BSD A;  1QAK A;  1ULJ B;  1V57 A;  3SYU A;  1OCV A;  1NB5 I;  2CC3 A;  5DRV A;  3AHW A;  2E2U A;  1W4N A;  4MEI A;  1U5O A;  1I0V A;  2H0G A;  1QVF 2;  4WP5 A;  5CF1 A;  3X41 A;  4CJN A;  2OQE C;  4I4K A;  4KFE A;  1NDO B;  1RTU A;  2KCD A;  1B2Z A;  4HM5 B;  4KZ1 A;  1G0T A;  1C54 A;  2P0X A;  1TFO A;  4TX4 A;  3BIR A;  5GSP A;  1O7G B;  1TJD A;  1BIR A;  3ZG5 A;  1YJW 3;  4HJL B;  5JPU A;  1G02 A;  1RRL A;  2D1W A;  2H0I A;  1BNF A;  1N9E A;  3AGN A;  3KKG A;  2JDI H;  3H3H A;  2HML B;  1IVU A;  3RGA A;  4O3V A;  3F14 A;  3FCS B;  4FMB A;  4HKV B;  5AEW B;  1LNH A;  1W6C A;  3D9R A;  5IF6 A;  1QVG 2;  3ZFZ A;  2L4V A;  4N6L A;  2OOV C;  2WGO A;  1HYF A;  3O8Y A;  4RZM A;  2A15 A;  3AMO A;  2CFG A;  3KII A;  1MGR A;  1A2P A;  1VQO 3;  2CFL A;  2YFL B;  1STF I;  1IVW A;  1IDP A;  3HIG A;  1PU4 A;  4O8S A;  1W2Z A;  2CFD A;  5BIR A;  1IQX A;  3DUK A;  3CCU 3;  1VQL 3;  3NUV A;  1JKG B;  1W00 A;  2HMM B;  1GD4 A;  4Q53 A;  2QIY A;  1TIJ A;  4H3U A;  3SOA A;  1IV9 A;  1AVL A;  4ILF A;  3LXU X;  1K41 A;  3N9H A;  3Q3F A;  4QWT A;  5CXO A;  3HX8 A;  1MNL A;  2YFJ B;  4O02 B;  3STD A;  2CWU A;  1SIH A;  2GBW B;  3LYG A;  2KF4 A;  3MPH A;  5AEU B;  1HZ1 A;  3KSP A;  1O7W B;  1RGA A;  1NU3 A;  1RN4 A;  3H51 A;  3PZW A;  1UCL A;  4FMD A;  3S67 A;  4HOH A;  4XM4 A;  1BRG A;  2H0H A;  4RBN A;  3PGB A;  1B2U A;  4CDL A;  2BHM A;  3X42 A;  1GOU A;  1JBR A;  1IYY A;  2R4I A;  5STD A;  3LML A;  3NX0 A;  3NXJ A;  5M18 A;  3SVA A;  5CK6 A;  1WNH A;  3L0R A;  1JN5 A;  4BIR A;  4L7K A;  2F56 A;  1W6G A;  1UUV B;  4LGQ A;  1E97 A;  5G1L A;  2BIR A;  3MKI A;  3K5T A;  1HKX A;  3ECF A;  3T8N A;  2IY2 A;  3I55 3;  1UUG B;  3JUO A;  2P09 A;  1FGO A;  1BSA A;  1I8V A;  2CG1 A;  1DE3 A;  5IEP A;  3CCS 3;  3LT8 A;  3PCS A;  4HVN A;  5TGN A;  1QAL A;  2QEX 3;  4N6N B;  1Q7H A;  4XBT A;  3ROB A;  3B4O A;  1I70 A;  2J8X B;  5A0O B;  1RGH A;  1TP6 A;  4J9A A;  1AV4 A;  2LYX A;  1LVN A;  3OWS A;  1A2V A;  1OH0 A;  2B24 B;  2Z77 A;  3Q1C A;  4WYK A;  1A67 A;  4KFD A;  1T5Y A;  2XH9 A;  1BRN L;  1PFP A;  1O7N B;  2QGU A;  3BLZ A;  1BNG A;  4AKZ A;  3SXX A;  5HOH A;  1JJ2 2;  2GXF A;  1X1X A;  2IUK A;  1JB2 A;  1YHQ 3;  1M90 4;  1DYU A;  2CW9 A;  1B2M A;  3OV4 A;  3X3Y A;  3DXO A;  3KCH A;  5D83 A;  2Y74 A;  5LC7 A;  1J2B A;  4FCM A;  2GBX B;  2IMJ A;  2BT3 A;  3CU3 A;  1N5H A;  3BB9 A;  1IQ8 A;  5IEO A;  2CG0 A;  3MSO A;  4K90 B;  1RGC A;  2Z6B A;  4STD A;  3CCL 3;  4KT3 B;  1BVI A;  4GL6 A;  1EQK A;  2GU1 A;  1CH0 A;  3JUM A;  1CYU A;  3CCQ 3;  3S5C A;  1DVD A;  1RJO A;  2CWT A;  1W02 A;  2OTL 3;  1DVC A;  2WO0 A;  3PS8 A;  5RNT A;  6GSP A;  2W9Q A;  3DGL A;  4EV2 A;  3SOY A;  3CC2 3;  4FMA A;  1AVK A;  4RNT A;  3V99 A;  1YIJ 3;  4X2H A;  1K9M 4;  1B2S A;  2CH9 A;  4GB5 A;  3FLJ A;  2HOH A;  3X3X A;  3WOF B;  3HI7 A;  2V1L A;  1PY3 A;  1GSP A;  4BL2 A;  1B2X A;  6RNT A;  1D6Z A;  3URP A;  3FZW A;  5I97 A;  1RGE A;  1RGL A;  1UCJ A;  1UGH I;  3I56 3;  4LZI A;  4WFO A;  1Q82 4;  1B21 A;  1N8Q A;  1S5A A;  1W2B 2;  3CPW 2;  1JRQ A;  1EG9 B;  3V98 A;  3I0Y A;  1Q86 4;  3EX9 A;  2IYJ A;  3WA2 X;  5FGO A;  1STD A;  1B27 A;  3S27 A;  2RCD A;  1BSC A;  5M1A A;  2UGI A;  4IT7 A;  1EKM A;  1RCL A;  2O9U X;  3KN4 A;  4LMI A;  1FUS A;  2ZA4 A;  3HK4 A;  3WMD A;  3X3Z A;  3N54 B;  3RGR A;  1SJW A;  2SAR A;  3PYJ A;  1YJ9 3;  2E2V A;  3GAX A;  4HBR A;  4XB5 A;  3JUP A;  5IG4 A;  3ZG0 A;  1TFK A;  1VQN 3;  1RSN A;  3NHX A;  1X1W A;  3B7C A;  3NQY A;  4XDW A;  4GSP A;  1DMQ A;  1VQK 3;  1K8A 4;  1HU9 A;  1GD3 A;  2YX9 A;  4FCJ A;  5ELU A;  3FGY A;  1UI8 A;  1OUN A;  3EC9 A;  1JB4 A;  2XFT A;  3GRD A;  3D5I A;  3WDG B;  1CYV A;  4O2H A;  1Y4K A;  2P0M A;  1Q7Y 4;  3A76 A;  1FGM A;  1YVB I;  2BMO B;  2W03 A;  2XRX B;  1TUH A;  1ZX2 A;  3NM7 A;  1IQY A;  4EXR A;  1C7H A;  1VQ9 3;  1NO3 A;  3D3L A;  1Q40 A;  1OAC A;  3SLU A;  5IER A;  4CPK A;  1BAO A;  3DGY A;  4FCZ A;  1EA2 A;  1F8N A;  1K28 A;  3NV0 A;  3G8Z A;  2SBL A;  3LH4 A;  3NBB A;  1I2F A;  1RCK A;  2HMK B;  1RKY A;  3CCJ 3;  1RMS A;  2GEX A;  5EEO A;  3GWR A;  2B1X B;  5BU4 A;  3X40 A;  4MMY B;  5M19 A;  1ULI B;  4LSO A;  1GMP A;  2CX1 A;  1VQ5 3;  2FGT A;  2BNG A;  3ER7 A;  4U13 A;  3EBT A;  5IG5 A;  1JZO A;  1VQ6 3;  1TRQ A;  4WYK B;  1EEJ A;  1Q81 4;  1UGI A;  1MWT A;  3ALA A;  1IVX A;  7RNT A;  2CIU A;  3K63 A;  3N8B A;  2CKF B;  4K1U A;  4N6U A;  1O7P B;  3UNL A;  1A2K A;  3BU4 A;  1YIT 3;  1MWR A;  1GMR A;  3MHE A;  2M7O A;  3IPT A;  1MWU A;  3VF1 A;  2CWV A;  2F5M A;  3UL6 A;  2ZDJ A;  3F40 A;  1YNV X;  3Q2P A;  4AEQ A;  5AYS C;  7STD A;  1LQM B;  1GYB A;  4NPB A;  3DGO A;  4MMX B;  4XBY A;  3NM2 A;  2C4B A;  5KP4 A;  1KWI A;  1FGQ A;  2XEP A;  5LC6 A;  3CC4 3;  1OGX A;  2XSO B;  1UCK A;  1Z1S A;  3FG1 A;  5EVH A;  5AYR B;  5KP3 A;  3WHO A;  3MG2 A;  1X1Y A;  1W7C A;  3EN1 B;  2AAE A;  4R80 A;  3GZR A;  4BU4 A;  5AI1 A;  3Q90 A;  4N6M A;  5DRE A;  3F9S A;  2W6J H;  5AIH A;  4K1V A;  3UL5 A;  2K54 A;  4ZM8 A;  3AGO A;  2KF5 A;  3CME 3;  4BL3 A;  3HOH A;  4JRF A;  3G16 A;  1R4C A;  1TTO A;  1B3S A;  2HMO B;  3F7X A;  2XSH B;  1LNI A;  4RNZ A;  2RGQ A;  1VQQ A;  2KRT A;  2HMJ B;  3OWU A;  4GHO A;  1N8R 4;  1RDS A;  1S72 3;  1O7M B;  1D6U A;  3F8X A;  4PEJ A;  2MC8 A;  1KC8 4;  4EBG A;  1LOY A;  3CPO A;  1T3B A;  4HM6 B;  2CX0 A;  4OK0 A;  3FF2 A;  2XGL A;  4EW5 A;  3MYT A;  1JBT A;  1GY6 A;  1WQL B;  1K73 4;  1WMP A;  1FA3 A;  2RFR A;  1ROA A;  1WMN A;  2W0Q A;  1BNI A;  5AIG A;  1BRS A;  1AQZ A;  4AKY A;  8RNT A;  1O7H B;  3G71 3;  3VGN A;  2WGQ A;  3GZX B;  5JPP A;  3FH1 A;  1FW7 A;  4HZB B;  4XDV A;  3JUQ A;  3QRD A;  2ZHX B;  1BSB A;  2ML5 A;  3AMO B;  4HM8 B;  3CD6 3;  2E2T A;  3DGN A;  5ELJ A;  6STD A;  1RRH A;  5IG0 A;  9RNT A;  1IVV A;  2LQV A;  4NHF A;  1YJN 3;  1IT7 A;  2Z76 A;  3BNE A;  3DGM A;  4J8T A;  2ML6 A;  3LTB A;  3CCE 3;  1WMO A;  3FSD A;  3JVC A;  2XF3 A;  2Y73 A;  5JBS A;  1M9G A;  3DY5 A;  1GY5 A;  3K0Z A;  1FUW A;  4NRE A;  3EQQ B;  4R9K A;  4KFF A;  1JZD A;  3NQZ A;  1UW1 A;  1BAN A;  1LOX A;  1T2H A;  3E99 A;  4N6O B;  4EC6 A;  1CQS A;  5AIF A;  1RGK A;  3OXA A;  4OVM A;  5IEN A;  4K61 A;  2BMQ B;  2RSX A;  2UX0 A;  3FF0 A;  3CMA 3;  1JNQ A;  4LYL B;  1W5Z A;  1GS3 A;  5IG3 A;  1OF5 A;  1UCI A;  3D5G A;  1VQP 3;  1CEW I;  1YGE A;  1E3V A;  2BMR B;  2CK3 H;  4X2O A;  1NJI 4;  4HM0 B;  1RN1 A;  1RGG A;  3JUN A;  1BNJ A;  4BTW A;  1YI2 3;  1YGW A;  2FNQ A;  1JB5 A;  1FGT A;  5EQL A;  3CNM A;  1BUJ A;  1BRH A;  3D4A A;  3DH2 A;  3KFQ C;  1DMM A;  1UI7 A;  2K0M A;  3DM8 A;  1IU7 A;  2INX A;  4HAA A;  1AY7 A;  1B20 A;  2WOH A;  2W56 A;  5KP1 A;  1JN5 B;  2FXT A;  3G0K A;  4RNY A;  1TRP A;  3SED A;  1QMA A;  3WOE B;  1E3R A;  1BNS A;  1W01 A;  1AR0 A;  2UUG C;  1EUI C;  3BND A;  3MG1 A;  2P05 A;  2KAA A;  1FZU A;  4HYZ A;  1WTH A;  4MMZ B;  3TDG A;  4HM1 B;  1PYL A;  1OGZ A;  2KF6 A;  1YVS A;  2F5W A;  1RN7 A;  4G1M B;  4N6T A;  1TU5 A;  1SAR A;  3FG4 A;  4I5Q A;  1SII A;  1RNB A;  1ZO2 A;  3DMC A;  4L8O A;  5G2G A;  3VSY A;  4XBX A;  4IIA A;  4WHA A;  3BNC A;  1BNR A;  2IUJ A;  3WOD G;  1GOY A;  4HM2 B;  3FG3 A;  3WA3 A;  2L1S A;  3G4S 3;  2BO9 B;  5D81 A;  1KD1 4;  1BU4 A;  1ZGX A;  1IV7 A;  1D6Y A;  2W2C A;  3KZT A;  4BTY A;  4EV5 A;  1RLS A;  3F7S A;  1LXE A;  4BTX A;  1BRK A;  1V58 A;  4R9L A;  5FW5 A;  1NB3 I;  2R41 A;  2OTJ 3;  1QAF A;  3U1W A;  2F99 A;  2CFW A;  8CHO A;  3G6E 3;  1M1K 4;  3NBJ A;  1MGW A;  2F86 B;  3FKA A;  3UJM A;  2IA7 A;  3S29 A;  1I3F A;  2QA4 3;  2PNC A;  1I3I A;  2K3D A;  2PZV A;  3K9M C;  1SQW A;  4R4K A;  3NBR A;  1V74 A;  3A5E A;  4H61 A;  2CFK A;  4KVH A;  1W6Y A;  1BOX A;  1VZZ A;  3DZL A;  3U97 A;  4IPB A;  3WR2 A;  1VQ8 3;  3B4P A;  1KQS 2;  4WWU C;  3T8U A;  1ISK A;  3HII A;  4HM7 B;  1FYS A;  3KSE D;  3OWY A;  3SX1 A;  3QK9 A;  4J5G A;  1NWW A;  3MG3 A;  3CC7 3;  2W04 A;  3CXC 2;  1MOL A;  2OQE A;  1VQ7 3;  1FGR A;  1RHL A;  1OPY A;  3CCR 3;  5HGR A;  3F8H A; 
#chains in the Genus database with same CATH homology
 2F98 A;  4HZ9 B;  3LTA A;  5IW9 A;  4JF8 A;  1L5G B;  2P38 A;  3EBY A;  3M8C A;  2OCT A;  3LT9 A;  1SPU A;  2Q07 A;  3HZP A;  1G96 A;  3PCR A;  3RDE A;  3EE1 A;  1M1X B;  4CCV A;  1N9J A;  2MF7 A;  4N3V A;  3IMA B;  3LOY A;  3EN8 A;  2OWP A;  2XGN A;  1A90 A;  1OHO A;  2C10 A;  2HMN B;  1JKG A;  4OUQ A;  1VQM 3;  1GY7 A;  3B8L A;  1Q42 A;  3EHC A;  5BXQ A;  2OOV A;  1OF5 B;  3CNX A;  3EJV A;  3UB1 A;  2JQ5 A;  2STD A;  3LZA A;  1ASK A;  5BVB A;  1US1 A;  4L8P A;  4ORL A;  5D82 A;  3T0U A;  3S28 A;  3BNB A;  4HM3 B;  2ZL8 A;  3IJE B;  2XR8 B;  3MWZ A;  2WOF A;  2W56 B;  1UUW B;  2KXG A;  4MJD A;  3CCM 3;  1OHS A;  1KSI A;  3KE7 A;  1U8C B;  3PXM A;  3OX9 A;  2O3O A;  5CLK A;  3CCV 3;  1Q40 B;  2YFI B;  2GU3 A;  3LTC A;  2GEY A;  1JV2 B;  3J7Y d;  5CF2 A;  3EB8 A;  1N5P A;  3NV0 B;  2XFS A;  4HM4 B;  1IT8 A;  3GZB A;  2I9W A;  1QJG A;  2CHC A;  4FMC A;  3OW2 2;  4R1K A;  3GZY B;  4EYC A;  2W9P A;  1OHP A;  3V92 A;  4N6V 0;  2D42 A;  2C11 A;  1IK3 A;  1VQ4 3;  1BUQ A;  3LTD A;  3EF8 A;  3K7C A;  2Z7A A;  1DMN A;  1ROV A;  4LEH A;  4FR9 A;  5AII A;  1QAK A;  1ULJ B;  1OCV A;  1NB5 I;  2CC3 A;  5DRV A;  2E2U A;  1W4N A;  4MEI A;  1U5O A;  1QVF 2;  4WP5 A;  5CF1 A;  3X41 A;  2OQE C;  4I4K A;  4KFE A;  1NDO B;  2KCD A;  4HM5 B;  4KZ1 A;  2P0X A;  1TFO A;  4TX4 A;  1O7G B;  1YJW 3;  4HJL B;  5JPU A;  1RRL A;  2D1W A;  1N9E A;  3KKG A;  2JDI H;  3H3H A;  2HML B;  1IVU A;  3RGA A;  4O3V A;  3F14 A;  3FCS B;  4FMB A;  4HKV B;  5AEW B;  1LNH A;  1W6C A;  3D9R A;  5IF6 A;  1QVG 2;  2L4V A;  4N6L A;  2OOV C;  2WGO A;  3O8Y A;  4RZM A;  2A15 A;  3AMO A;  2CFG A;  3KII A;  1VQO 3;  2CFL A;  2YFL B;  1STF I;  1IVW A;  1IDP A;  3HIG A;  1PU4 A;  4O8S A;  2CFD A;  1W2Z A;  1IQX A;  3DUK A;  3CCU 3;  1VQL 3;  3NUV A;  1JKG B;  1W00 A;  2HMM B;  1GD4 A;  4Q53 A;  2QIY A;  1TIJ A;  4H3U A;  3SOA A;  1IV9 A;  1AVL A;  3LXU X;  1K41 A;  3N9H A;  4QWT A;  5CXO A;  3HX8 A;  1MNL A;  2YFJ B;  4O02 B;  3STD A;  2CWU A;  1SIH A;  2GBW B;  3LYG A;  3MPH A;  5AEU B;  3KSP A;  1O7W B;  3H51 A;  1NU3 A;  3PZW A;  4FMD A;  3S67 A;  4XM4 A;  4RBN A;  3PGB A;  4CDL A;  2BHM A;  3X42 A;  2R4I A;  5STD A;  3LML A;  3NX0 A;  3NXJ A;  3SVA A;  5CK6 A;  1WNH A;  3L0R A;  1JN5 A;  4L7K A;  4LGQ A;  1W6G A;  1UUV B;  1E97 A;  3MKI A;  3K5T A;  1HKX A;  3ECF A;  3T8N A;  3I55 3;  3JUO A;  2P09 A;  1FGO A;  2CG1 A;  5IEP A;  3CCS 3;  3LT8 A;  3PCS A;  4HVN A;  5TGN A;  1QAL A;  2QEX 3;  4N6N B;  4XBT A;  3ROB A;  3B4O A;  5A0O B;  1TP6 A;  4J9A A;  1AV4 A;  2LYX A;  1LVN A;  3OWS A;  1A2V A;  1OH0 A;  2B24 B;  2Z77 A;  3Q1C A;  4WYK A;  1A67 A;  4KFD A;  1T5Y A;  2XH9 A;  1PFP A;  1O7N B;  2QGU A;  3BLZ A;  1JJ2 2;  4AKZ A;  3SXX A;  2GXF A;  2IUK A;  1JB2 A;  1YHQ 3;  1M90 4;  1DYU A;  2CW9 A;  3OV4 A;  3X3Y A;  3DXO A;  5D83 A;  2Y74 A;  5LC7 A;  1J2B A;  4FCM A;  2GBX B;  2IMJ A;  2BT3 A;  3CU3 A;  1N5H A;  3BB9 A;  1IQ8 A;  5IEO A;  2CG0 A;  3MSO A;  4K90 B;  2Z6B A;  4STD A;  3CCL 3;  4GL6 A;  1EQK A;  2GU1 A;  3JUM A;  1CYU A;  3CCQ 3;  3S5C A;  1DVD A;  1RJO A;  2CWT A;  1W02 A;  2OTL 3;  1DVC A;  2WO0 A;  3PS8 A;  3CC2 3;  2W9Q A;  3DGL A;  4EV2 A;  3SOY A;  4FMA A;  1AVK A;  3V99 A;  1YIJ 3;  4X2H A;  1K9M 4;  2CH9 A;  4GB5 A;  3FLJ A;  3X3X A;  3WOF B;  3HI7 A;  2V1L A;  1D6Z A;  3FZW A;  5I97 A;  3I56 3;  4LZI A;  4WFO A;  1Q82 4;  1N8Q A;  1S5A A;  1W2B 2;  3CPW 2;  1JRQ A;  1EG9 B;  3V98 A;  3I0Y A;  1Q86 4;  3EX9 A;  3WA2 X;  5FGO A;  1STD A;  3S27 A;  2RCD A;  4IT7 A;  1EKM A;  3KN4 A;  2O9U X;  4LMI A;  3HK4 A;  3X3Z A;  3WMD A;  3N54 B;  3RGR A;  1SJW A;  3PYJ A;  1YJ9 3;  2E2V A;  3GAX A;  4HBR A;  4XB5 A;  3JUP A;  5IG4 A;  1TFK A;  1VQN 3;  3NHX A;  3B7C A;  3NQY A;  4XDW A;  1VQK 3;  1DMQ A;  1K8A 4;  1HU9 A;  1GD3 A;  2YX9 A;  4FCJ A;  5ELU A;  3FGY A;  1UI8 A;  1OUN A;  3EC9 A;  1JB4 A;  2XFT A;  3GRD A;  3WDG B;  1VQ7 3;  1CYV A;  4O2H A;  1Y4K A;  2P0M A;  1Q7Y 4;  3A76 A;  1FGM A;  1YVB I;  2BMO B;  2W03 A;  2XRX B;  1TUH A;  1ZX2 A;  3NM7 A;  1IQY A;  4EXR A;  1C7H A;  1VQ9 3;  1NO3 A;  3D3L A;  1Q40 A;  1OAC A;  3SLU A;  5IER A;  4FCZ A;  1EA2 A;  1F8N A;  1K28 A;  3NV0 A;  3G8Z A;  2SBL A;  3LH4 A;  3NBB A;  2HMK B;  1RKY A;  3CCJ 3;  2GEX A;  5EEO A;  3GWR A;  2B1X B;  3X40 A;  4MMY B;  1ULI B;  4LSO A;  1VQ5 3;  2FGT A;  2BNG A;  3ER7 A;  4U13 A;  3EBT A;  5IG5 A;  1VQ6 3;  4WYK B;  1Q81 4;  3ALA A;  1IVX A;  2CIU A;  3K63 A;  3N8B A;  2CKF B;  4K1U A;  4N6U A;  1O7P B;  3UNL A;  1A2K A;  1YIT 3;  3MHE A;  2M7O A;  3IPT A;  3VF1 A;  2CWV A;  3UL6 A;  2ZDJ A;  3F40 A;  3Q2P A;  4AEQ A;  5AYS C;  7STD A;  1GYB A;  3DGO A;  4MMX B;  4XBY A;  3NM2 A;  5KP4 A;  1KWI A;  1FGQ A;  2XEP A;  5LC6 A;  3CC4 3;  1OGX A;  2XSO B;  1Z1S A;  3FG1 A;  5EVH A;  5AYR B;  5KP3 A;  3MG2 A;  3EN1 B;  1W7C A;  4R80 A;  3GZR A;  2QA4 3;  5AI1 A;  3Q90 A;  4N6M A;  5DRE A;  3F9S A;  2W6J H;  5AIH A;  4K1V A;  3UL5 A;  2K54 A;  4ZM8 A;  3CME 3;  4JRF A;  3G16 A;  1R4C A;  2HMO B;  3F7X A;  2XSH B;  4RNZ A;  2RGQ A;  2KRT A;  2HMJ B;  3OWU A;  1N8R 4;  1S72 3;  1O7M B;  1D6U A;  3F8X A;  2MC8 A;  1KC8 4;  4EBG A;  3CPO A;  4HM6 B;  4OK0 A;  3FF2 A;  2XGL A;  3MYT A;  1GY6 A;  1WQL B;  1K73 4;  1WMP A;  1FA3 A;  2RFR A;  1ROA A;  2W0Q A;  1WMN A;  5AIG A;  4AKY A;  1O7H B;  3G71 3;  3VGN A;  2WGQ A;  3GZX B;  5JPP A;  3FH1 A;  4HZB B;  4XDV A;  3JUQ A;  3QRD A;  2ML5 A;  3AMO B;  4HM8 B;  3CD6 3;  2E2T A;  3DGN A;  5ELJ A;  6STD A;  1RRH A;  5IG0 A;  1IVV A;  2LQV A;  4NHF A;  1YJN 3;  1IT7 A;  2Z76 A;  3BNE A;  3DGM A;  4J8T A;  2ML6 A;  3LTB A;  3CCE 3;  1WMO A;  3FSD A;  3JVC A;  2XF3 A;  2Y73 A;  5JBS A;  1M9G A;  3DY5 A;  1GY5 A;  3K0Z A;  1FUW A;  4NRE A;  3EQQ B;  4R9K A;  4KFF A;  3NQZ A;  1UW1 A;  1LOX A;  3E99 A;  4N6O B;  4EC6 A;  1CQS A;  5AIF A;  4OVM A;  3OXA A;  5IEN A;  4K61 A;  2BMQ B;  2RSX A;  2UX0 A;  3FF0 A;  3CMA 3;  1JNQ A;  5IG3 A;  1W5Z A;  1GS3 A;  1OF5 A;  1VQP 3;  1CEW I;  1YGE A;  1E3V A;  2BMR B;  2CK3 H;  4X2O A;  1NJI 4;  4HM0 B;  3JUN A;  4BTW A;  1YI2 3;  2FNQ A;  1JB5 A;  1FGT A;  5EQL A;  3CNM A;  3KFQ C;  1DMM A;  1UI7 A;  2K0M A;  3DM8 A;  1IU7 A;  2INX A;  2WOH A;  2W56 A;  5KP1 A;  1JN5 B;  2FXT A;  3G0K A;  4RNY A;  3SED A;  1QMA A;  3WOE B;  1E3R A;  1W01 A;  3MG1 A;  1AR0 A;  3BND A;  4HYZ A;  3TDG A;  2P05 A;  4MMZ B;  1WTH A;  4HM1 B;  1OGZ A;  1TU5 A;  1RN7 A;  4G1M B;  4N6T A;  3FG4 A;  1SII A;  1ZO2 A;  3DMC A;  4L8O A;  5G2G A;  3VSY A;  4XBX A;  4IIA A;  4WHA A;  3BNC A;  2IUJ A;  3WOD G;  4HM2 B;  3FG3 A;  3WA3 A;  3G4S 3;  2BO9 B;  5D81 A;  1KD1 4;  1IV7 A;  1D6Y A;  2W2C A;  3KZT A;  4BTY A;  4EV5 A;  3F7S A;  4BTX A;  1LXE A;  4R9L A;  5FW5 A;  1NB3 I;  2OTJ 3;  1QAF A;  3U1W A;  2F99 A;  2CFW A;  8CHO A;  3G6E 3;  1M1K 4;  3NBJ A;  2F86 B;  3FKA A;  3UJM A;  2IA7 A;  3S29 A;  2PNC A;  2PZV A;  3K9M C;  1SQW A;  4R4K A;  3NBR A;  1V74 A;  4H61 A;  2CFK A;  4KVH A;  1W6Y A;  3U97 A;  1VZZ A;  3DZL A;  4IPB A;  1VQ8 3;  3B4P A;  1KQS 2;  4WWU C;  3T8U A;  1ISK A;  3HII A;  4HM7 B;  3KSE D;  3OWY A;  3SX1 A;  3QK9 A;  3CC7 3;  1NWW A;  3MG3 A;  2W04 A;  3CXC 2;  1MOL A;  2OQE A;  1FGR A;  4PEJ A;  1OPY A;  3CCR 3;  5HGR A;  3F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...