5IGAA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with co-purified parahydroxybenzoate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SMEVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with co-purified parahydroxybenzoate
rcsb
source organism Uncultured bacterium
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2016-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5igaA00
4NN3A 5I7IA 2CEXA 4MX6A 4NHBA 4NAPA 4OA4A 5CM6A 4O8MA 4OVQA 2ZZVA 4UABA 4PAIA 2XWVA 4P3LA 4N8YA 5LTCA 4LN5A 4N6KA 4YICA 4PE3A 4MHFA 4P1EA 4PAKA 2VPNA 4PCDA 4MAGA 4N8GA 4P9KA 5IM2A 4N4UA 2XWKA 4NG7A 4NGUA 4N91A 5I5PA 2XWOA 4DI3D 4N17A 2WYKA 4P8BA 4N15A 4P56A 4YZZA 4PAFA 4PGNA 4O7MA 4P47A 2ZZXA 2CEYA 4O94A 2PFZA 4PFIA 5IGAA 4OVSA 4P1LA 4MNPA 4PF8A 4PFRA 4MIJA 2V4CA 4XEQA 4MNCA 2HZLA 4OANA 4PFBA 3FXBA 4NQ8A 4XFEA 4MNIA 2WX9A 3GYYA 2XXKA 2ZZWA 4MMPA 4PF6A 4MCOA 2HZKA 4XF5A 3U65A 4OVTA 2HPGA 4OVRA 2XWIA 2XA5A 4X04A 4DI4B 4PBQA 4X8RA 2VPOA 2WYPA 4PC9A 4PETA 4OVPA 4MEVA 5IZZA 4PDHA 4PGPA 2PFYA 4NF0A 4PDDA 4NX1A 4PBHA 4N6DA 3B50A
chains in the Genus database with same CATH superfamily
1EYIA 1P1NA 3PTYA 2I0BA 4GF8A 2FIEA 3S9MC 1JQFA 1Y4TA 2XXUA 1B6HA 4YKPA 5H8HA 5A5XA 3H03A 1CB6A 5L9MA 1SW1A 4N6KA 5CBRA 4P0GA 4F3SA 1KZ8A 2P1SA 3QYTA 3PUXE 3UORA 1N3XA 2FA7A 3S9LC 5IM2A 1B4HA 4F31B 5L9SA 1OLAA 5FHOA 1FBEA 1H3DA 1WVJA 4NGUA 1IITA 2D3IA 3JV9A 3N26A 5DVJA 2O51A 2WYKA 4R2FA 4U4XA 1NNKA 4BDNA 4WXJA 1DPPA 2ZZXA 4H5GA 4YKJA 3FJ7A 3H3GA 2F36A 4O7IA 3O66A 2DQVA 4GWSA 1QGXA 1LFHA 5CMMA 2D5WA 4BLAA 4EUOA 1EYKA 2L5VA 1P1QA 4PFBA 3FXBA 3M8UA 3FJGA 1Y20A 2NVUB 1P1UA 1BIYA 5HM4B 1XT8A 3PU5A 3KBZA 4MMPA 1H44A 1K9ZA 1WDNA 3MBPA 3U8QA 1EH3A 3TODA 1FQBA 1USYE 2XXIA 3KFMA 1FTMA 4F2OA 5A5LA 5H8FA 5I2KB 2R6GE 1IMFA 4OFLA 2OWTA 3PGFA 3U1OA 1Y3NA 4YKIA 3KEIA 3RPWA 4QFKA 3U72A 4JSOA 3RT8A 3N6UA 5K2YA 4KXPA 2HAUA 1B1HA 1H76A 4OENA 4R2BA 3FVNA 5H8NA 2NUVA 4GX6A 4U4SA 5ITPA 3T1BA 2NWJA 2Q8JA 1M5CA 2QJEA 5F24A 3OSRA 4EQ7A 4YB5A 2XX7A 4BDLA 4P56A 1DCUA 2KLFA 3SEXA 5IGAA 3PPOA 3TAJA 5CMKA 2YJPA 4N81A 4P1LA 1B2HA 2PT2A 3D4CA 3IOUA 3K01A 3E79A 2PX1A 1SI1A 5F1QA 1IMCA 2Z8EA 4MH5A 3T0JA 3MJNA 4RK2A 4HE1A 4YAHX 3RGYA 1IXIA 5LOMA 4H5FA 4MJOA 4XKPA 4NTLA 4PFTA 1OMPA 3A3CA 2X7QA 1FPEA 4HS7A 3PPRA 4R9FA 3K6VA 1FRPA 3MQ9A 4LA9A 3MPKA 2BJIA 4PDHA 5I59B 3OEKA 4ZEBA 3G3JA 1BP5A 3V89B 3LUYA 4ELQA 1FW0A 3BIHA 3GZGA 3IR1A 4LQ5A 4OVJA 3MAMA 4LQ2A 3ONMA 3L6GA 4EXKA 4JVCA 3N94A 4UABA 5KDTB 2OK2A 4KFQA 3NOHA 2ZNSA 3A3UA 1SW4A 2UYFA 2V25A 4G68A 4MLQA 1DK4A 3RNNA 2KR0A 2P3VA 3FASA 1I6BA 1M5BA 2Q88A 4G8MA 1UTHA 4F29A 1FTJA 1N04A 1Z7NE 4YZZA 4AB5A 1MY1A 4H8JA 4LUBA 4FE8A 1S50A 3V5AA 1MDP1 3A09A 5I57B 4JB7A 2RCBA 4XTCQ 1YTVA 3IB1A 4IO7A 2DSFA 3GYYA 1MQHA 1FPKA 2XXKA 2B3BA 5ET7A 3EQ1A 2WKYA 1H43A 3OO8A 4QFNA 1MM7A 4DCXA 4Q0CA 4R9GA 3HO7A 4Z0IA 2X7PA 1Y4CA 2WYPA 4OVPA 3DP8A 1R6ZA 4QFOA 1RDZA 4H1XA 4NN3A 1URDA 2CZLA 1QULA 1DOTA 1OQGA 2XXVA 4FEDA 1QW0A 3SZPA 1FBFA 4YU0A 2E1SA 3KJTA 3HV1A 3UA8A 2THIA 1PBPA 1IIWA 4XKNA 4F19A 1NV7A 3TTRA 3SKPA 5AA4A 5I2NB 2ONSA 4UA8A 4F2QA 2HCAA 2I3WA 1OVTA 1YXIA 1BTJA 1MQIA 5EQ7A 4N15A 4THIA 5H8QB 3H6VA 1K9YA 4DDDA 5DTBA 4MF3A 1JETA 1SBPA 5I56B 1VDWA 2PFZA 4PFIA 3VXCA 4OVSA 4H65A 1VFDA 3IFCA 2GHAA 1FBCA 5FBPA 4PFRA 2V84A 4JVDA 2V4CA 2CZKA 4R72A 4RA1A 3FBPA 3O6GA 5LDZA 2QFLA 2DOJA 2F6PA 3B6WA 3C33A 1JEUA 1PDAA 5FTIA 3CR9A 2XXYA 4IY5A 1NMUA 3Q29A 1EYJA 1XS5A 3RPLA 2B3FA 4IY6A 4FEBA 1SI0A 1N3WA 1B0HA 1YYZA 2W7YA 2I4CA 3QSLA 5IZ3B 2QVUA 2UVGA 3JZJA 4OQOA 3FV2A 2QL3A 2H25A 3UN6A 1VSOA 5DVIA 1HSLA 1FQDA 3RT6B 3CFZA 4MLVA 2HEUA 2PBWA 5EYGA 5J16A 2FVZA 3C31A 2O1LA 4LONB 1MY2A 2OWZA 3PMVA 3MYUA 5JTYA 3PV0E 1B3LA 4RJZA 3MVZA 3CVGA 2XXXA 3FZVA 1US4A 4X48A 3T9XB 3PUYE 3LSFB 4ZDMA 4I40A 3W15C 3O9PA 2GHBA 1NFTA 2FBPA 4PP0A 3TCGA 1QJMA 3I3VA 1LB9A 2F5XA 5HPQA 3PD9A 2Q74A 1VR5A 1A8FA 1HSJA 4Q8RA 4KYSA 3IB0A 3VLVA 1RDXA 3EHUA 4MCOA 3TELA 1LBWA 3TUSA 1AIVA 3O28A 1A54A 2F3DA 4OWDA 2DE2A 3ZKLA 1IMDA 4GD5A 4Q5TA 5DVFA 2XXTA 1MXVA 5DEXA 4TLLB 3KSJA 4OZ9A 4PBQA 5FHNA 1Q1KA 3RY3A 2DP8A 2OJTA 1PEBA 2PFYA 2V93A 2UVHA 2I6EA 1RYOA 4PBHA 2F7AA 2WBDA 5T3JA 2I3VA 4YMAA 3LC8A 4IR8A 5TP9A 1Y1MA 1UIUA 1NUXA 3T93B 1AOVA 5JK4A 5ELVA 4OVQA 5AA3A 1Z7ME 1FPFA 1FQEA 3VDFA 4AQ4A 5ESYA 5I58A 1LB8A 4GL8A 4GL0A 4LN5A 4YB6A 4YICA 3CFXA 3UP9A 3THIA 4NF5A 3T96B 1MXYA 1SYHA 3RUMA 1FQFA 1VFEA 2XWKA 3TTLA 3KOTA 1LLSA 1FBHA 3EHSA 3TDJA 1MM6A 1II5A 3AXFA 1Y1ZA 4ESWA 5ET5A 1LBZA 3K1PA 5H8SA 3MC2A 4YKKA 4I8CA 1UIVA 1IQ7A 4LATA 1R1NA 2XX8A 3TQWA 4YMBA 3SEUA 4XFEA 4LVQA 5B7DA 1MDQA 3VLUA 4M1VA 2HZKA 2Y84A 4N13A 1NL5A 1TFAA 5ICQA 4O3CA 1FJ6A 1JW4A 4DZ1A 4JSDA 2F97A 4H8IA 3ILUB 5H8HB 1NH7A 2DWHA 3DLNA 2DS9A 2UVJA 2QMXA 4KD5A 2VPOA 3EHTA 2F7BA 2HXWA 4PDDA 1DTGA 3W9WA 3FJMA 1IXGA 4EF2A 2CZHA 4AB6A 1N0TA 1PC3A 3G3HA 1MH3A 2VD3A 4NHBA 4OA4A 5CM6A 2O69A 1KWHA 1LBCA 3C32A 2F8DA 1XHYA 2M8CA 4ECFA 1FPGA 4WEPA 3OMBA 1ZJLA 4X1DA 3U94A 4IB2A 4NMYA 4R6YA 2UYEA 2Y7IA 5CMCA 3V8XB 4EF1A 2H98A 5AA1A 1R9QA 4C1TA 3RLFE 4EXLA 4BDMA 1RKMA 3E3KA 1NUWA 4NG7A 2HQ0A 4RY1A 3IOWA 3GLBA 3PUZE 4P8BA 1EU8A 2E0SA 1MXZA 2XXWA 2ONKE 2A5TB 2DE3A 1FPJA 1B5JA 2H99A 3RYDA 2Z8FA 1JEVA 3C34A 4BDRA 4MIJA 3QXMA 4POXA 4AS5A 5AA2B 1DTZA 4U2RA 1FPBA 1BKAA 1M5DA 3K1NA 3KZGA 1KA0A 4RXLA 4G8NA 4GQOA 4RNSA 4M4GA 1D9VA 5IAIA 5KZTA 3FXRA 4NEDA 4TLMB 2XXRA 2DDKA 4U1OA 4PC9A 4HTGA 1B0LA 2AYSA 1NV2A 5IKBA 1FBPA 3B50A 3T22A 4DE8A 4RPNA 2Q2AA 3D1RA 1I6QA 2RF1A 3BFUA 5FHMA 3L6HA 3KJ7A 4NAPA 2JJKA 1ZTYA 4ZE8A 4FBPA 4N8YA 5LTCA 1LGBC 4OMBA 4H45A 2ESNA 3HHFA 3KN8A 2XX9A 3RQTA 2V3TA 1I69A 4DXBA 4NE4A 4Z7EA 1PB7A 4JWXA 3OSQA 3PMXA 1ZMGA 2F35A 5EQ9A 2XHDA 3BKIB 5H8NB 3LSLA 4N17A 3VE1B 4IO3A 4GIZA 1N84A 1F9BA 3IAZA 3MZ1A 3G7WA 3KOSA 3MWBA 1LAHE 1YCJA 4G8HA 5K2XA 4GX4A 1NUZA 4JBZA 1DBZA 3DP6A 3CFLA 4OANA 4HE2A 4JDFA 4OEUA 1NI9A 3FXQA 3PUVE 1VE4A 4WKMA 2UXAA 2P0SA 4I1DA 1L5TA 1B7UA 1CE2A 3UIFA 3U65A 2Q8MA 3S2VA 4Q30B 2HPGA 4OESA 2XA5A 3FD3A 3FVOA 3OXNA 3ILTB 2V3UA 1AL3A 3H4ZA 2Y7KA 3KN7A 1LBBA 1EZ9A 4PGPA 1J1NA 5ITOA 4MBPA 1LAFE 3MP1A 4FORA 1G0HA 3LUZA 3D4GA 3CIJA 4OETA 5M2VA 3S9EA 1B7ZA 4KQPA 3ISPA 4ZZEA 1NNFA 4I3YA 3DM0A 1US5A 1MH4A 1SPIA 3TZAA 3LSWA 3M3KA 3RTWB 4PAIA 1QVSA 3TPAA 2Q9TA 1MQDA 1B58A 4PE3A 1FJ9A 4BDOA 1FCKA 3QMFA 4GWUA 3HN0A 3S9NC 1B32A 2P3NA 4IGRA 1JVXA 5I2KA 3OEMA 4G61A 4XKRA 3G3GA 1MXWA 3WAEA 2QRYA 5DEXB 1LAGE 3PPNA 2BJJX 4ZZAA 3T9HB 2QS2A 2DVCA 1UQWA 4NF8B 2XXQA 2I0CA 3ZSFA 3R7XA 3FGSA 5ISUA 2GRVA 3M3LA 1A7LA 5EQAA 2PCRA 2ZZWA 1XVYA 1FTAA 2ABHA 5I3SA 1GVCA 1GV8A 3MP6A 4RK9A 5CRYA 1S7YA 3K4UA 1FPLA 1Y3PA 4BDQA 3VLWA 2FYIA 1QUIA 1B46A 3WAFA 2A5SA 1SYIA 3FVGA 3CG1A 3C36A 3SEYA 3K02A 4ZEIA 5L8DA 5CMBA 5I7IA 4R75A 3IJOB 1H45A 3K6UA 3MPLA 1G0IA 3K6WA 3TTNA 4ISUA 4XIGQ 4HXVA 2Q89A 3IFAA 2GQ1A 4E0XA 1ZBMA 1MPBA 1INPA 1LFIA 3I5OA 1NV1A 4GRKA 4JWOA 4F22A 3G3IA 3QUJA 5ET8A 2UVIA 1MPCA 2Y5LA 4NWCA 2HAVA 1AMFA 1P99A 4N4UA 2R8TA 4NF8A 1CNQA 5EHSA 2XD2A 3S4UA 4DIGA 4F3PA 2Z22A 4O7MA 2I58A 1FBDA 1WODA 3LV0A 2DVZA 4IGTA 3H6WA 4HE0A 1T0KA 1FTLA 3E78A 2ZYOA 1RDYA 2QVVA 1FBGA 5FTHA 4U21A 2R71A 3SERA 5BWJA 1LCTA 3MW0A 1IXHA 3HHGA 2KQZA 3KBRA 3IORA 3IK6B 3PD8A 4G68B 2F3BA 5ICTA 1AH5A 1TWYA 3MUQA 4KR5A 1MY0A 3K6XA 3HPIA 1M5FA 5B70A 2OWSA 2OX3A 1IMAA 1NNTA 2DWAA 4I62A 2QVRA 4P11A 4DI4B 1B7HA 1NH8A 2G93A 4FECA 1JP4A 5IZ3A 3KSXA 2IA4A 2I49A 1IXCA 3Q28A 1SW5A 2CEXA 1DPEA 2DWIA 4E0WA 3K00A 5AA2A 2HXRA 3MP8A 4F1VA 1A99A 1YAEA 4O8MA 2FHYA 2ZZVA 3FXUA 3SDFA 1PB9A 2H5YA 2GFEA 3FIRA 4ZEFA 2Y5KA 4GBVA 4N6PA 2F6GA 1B40A 1ELJA 4PAKA 4PCDA 1IUDA 2YPNA 3OO7A 3IL1B 5DYHA 2ONRA 1MQGA 3EPEA 2ZYNA 2HFBA 1D9YA 3G3KA 4GX3A 3VVFA 4DI3D 4KPTA 3MVYA 2VP1A 3ECRA 1LEVA 5AE4A 4JXIA 1SVXB 5KCJA 3KN3A 2PYYA 4MNPA 4OYVA 3MZ9A 4JVIA 4KCDA 3PPPA 4XEQA 1D3KA 1MXUA 2OZZA 2CZIA 1SDXA 4NF5B 2QPQA 2WX9A 1ATGA 4GLIA 1LFGA 1MPDA 1YZ0A 5TPAA 2RINA 3LBSA 3KC1A 2HHMA 5I57A 4LZ5A 2VOZA 2CMOA 1DMBA 2B65A 3IOTA 4QF9A 2AIXA 5ET6A 3CRBA 3K1MA 4ZE9A 4KYDA 2RC9A 4OFOA 4GBWA 2Q2CA 4NF0A 4RYAA 3IO4A 4X9TA 1P1OA 3MVWA 1R9LA 2P2AA 4GWXA 4QFLA 1I6AA 1MG1A 3V83A 1NV4A 4R74A 4WEDA 4HW8A 4IO2A 2YLNA 3TTMA 3Q25A 2RKMA 1D9QA 3I6VA 2NXOA 2D21A 1EZOA 3IB2A 3O97A 2Z8DA 4N8GA 1LBXA 2ZNTA 3SEWA 1ZU0A 1IEJA 3O6HA 3SETA 3G3FA 5I5PA 5CI5A 1FQCA 1B3EA 3QUFA 3HCQA 4PGNA 3H7MA 4P47A 1NUYA 3CSGA 1N76A 2OLBA 2DXRA 3O6IA 3R26A 4K3FA 1URSA 4PE5B 4FJPA 5DT6A 4L17A 4MNCA 5AA2D 4NQ8A 4P0IA 4H67A 1O63A 4IO6A 1S9TA 5DW8A 3BIGA 3B7DA 3VVEA 4H6DA 1NV5A 3JYRA 2I48A 1OLCA 1FQAA 4QFPA 3TYHA 4GOTA 4KCCA 5IZZA 5H8QA 4X1BA 1IZ1A 3E13X 4NF6B 4GXAA 3TQLA 2O1MA 3IO6A 4ELOA 4IO4A 4PFYA 3W9VA 1M5EA 1PB8A 2ZNUA 4UACA 1KA1A 3B6TA 2XD3A 3IOVA 1A40A 2B4MA 4OHNA 4MX6A 3RPLB 4LZ8A 1POY1 1TFDA 2XWVA 2RC8A 4HCWA 2OBGA 3TKDA 3OOAA 4NWDA 4TQUQ 3CHGA 4OTEA 4OERA 1UTBA 3OELA 4MAGA 3QIMA 3C4MA 2PT1A 5I56A 3P7IA 1MY3A 5EQ8A 4PAFA 1NV6A 3M3FA 3MVXA 3H06B 3FATA 4YB7A 3ZS6A 1PBQA 1ZKBA 5JEIA 1FTKA 3KC0A 2QS3A 2VGQA 1JVYA 1QKAA 4XXUA 1FTOA 5AA4B 3EF7A 3HSTA 1NNPA 2QMWA 1LCFA 5L9OA 4OEVA 4F3GA 4NF4B 3H6TA 4PF6A 4ELPA 4GWWA 3C35A 4XF5A 1A8EA 1Y9UA 1MS7A 5I58B 4OVRA 1POTA 3VXBA 1OVBA 2O84X 3MSTA 4PETA 3A29A 1JW5A 1JNFA 1TXFA 2ZXTA 3PPQA 4G77A 4F1YA 3BFTA 4U23A 3K2DA 1MY4A 1QUJA 2O7UA 4ONYA 2XXPA 1ZLQA 3LR1A 4QSEA 3Q26A 4P3LA 5CBSA 1D4NA 5KDTA 1SD3A 5A5XB 3EN3A 4DLDA 2MKZA 3T9VA 2G29A 2VD2A 3BBRA 3EKIA 1SQYA 4DCYA 5BUUA 1MXXA 4EQ9A 3R6UA 1FSAA 2PVUA 3F11A 1QKBA 3GXAA 2H9BA 4N91A 4NF6A 5KCJB 4OFJA 4C1UA 2XWOA 5I2NA 1SW2A 4F3BA 3UK4A 2CEYA 2F7CA 3H6UA 3E4RA 2O6AA 2QSXA 3T66A 4EQBA 4C0RA 4PF8A 2AL4A 2VT5A 2XXHA 2HZLA 3ODBA 4POWA 3PUWE 4OXVA 1YPNA 1N7XA 4R6KA 3DP4A 3OO9A 3USDA 4LP2B 3E9XA 3C9HA 1ZIUA 1A55A 1IMBA 1B52A 1BK4A 2XWIA 4U1ZA 1DSNA 4FATA 1B4ZA 3Q27A 3O2AA 4ZEDA 1NKXA 2ZYMA 1O64A 2AL5A 2RCAA 3FUZA 4ESXA 5TU0A 3TCHA 4N6DA 2PMSA 3RTFB 4RPOA 3VFJA 1NV3A 5I59A 1O7TA 3GBAA 2NOOA 4GWYA 3KG2A 2VHAA 3TTKA 1AWBA 1MQJA 1XVXA 4ZEKA 3IJXB 3ROJA 2WEFA 3FV1A 3TCFA 3VV5A 4PTKA 4QSDA 1B3FA 2Y7WA 1B9JA 4G2ZA 4G68C 4XKQA 3U93A 4G4PA 2Z23A 4MHFA 1B1XA 2LAOA 1BLFA 1GR2A 1XI6A 2VPNA 3K0VA 3KGCA 4P9KA 2R9JA 3SEVA 4PFWA 5I84A 4ZS9A 4KYEA 5J1DA 3OD7A 3RN8A 3TMGA 2OCUA 4ND9A 5JTYB 3B8BA 4PQJA 4KI0E 1B5IA 4QRZA 2IEEA 4R73A 3IX1A 2RC7A 2O7IA 4O94A 4F18A 3OO6A 3SESA 1FPIA 2REGA 4ELRA 5F7VA 4GWZA 4FAJA 5TPAB 1RYXA 1ANFA 2H4IA 2X26A 2DE4A 3N6TA 4MNIA 5EYFA 2FIXA 3PMWA 1Y3QA 5CC2A 1B51A 5HBCA 4EDPA 4OVTA 1B3GA 1B05A 4QSCA 2Y7PA 4DXCA 4O3BA 4QHQA 1FPDA 3TEPA 5TP9B 2I4BA 4NX1A 4U22A 3QAXA 1XOCA 4GWOA 3DELB 2FNCA 4ZECA 1UTBB 3TFLA 1Q9DA 3VVDA 1HSEA 2QS4A 3N5LA 1LSTA 2WBBA 4I3EA 1TT1A 1IMEA 2F34A 4KHZE 1GTKA 4AS4A 4HCYA 1P1WA 4NF4A 5IZ1A 1JW1A 1LBYA 4GXSB 4P1EA 4FIMA 1B5HA 1XC1A 2V3QA 3B6QA 3T9UA 1OIBA 4F39A 2ALUA 1NV0A 4MFIA 1QUKA 4F1UA 4QXDA 2F78A 4H0WA 2O68A 1OQHA 4GFRA 4IO5A 2REJA 2ANJA 3GBBA 3CSBA 4LZ7A 2ZMBA 4JWYA 3MZBA 4TOZA 3O29A 2A5TA 2GH9A 1EZPA 3QK6A 1Q35A 3FVKA 1UTHB 2DWJA 3OENA 1LBVA 3ZKKA 1B3HA 5H8FB 1N7WA 4R6HA 2B4LA 1USYH 4N07A 4QBAA 3LSXA 4O3AA 2QS1A 2DXYA 2ZYKA 3UGWA 2Y7RA 1LAXA 5EHMA 4DXUA 3CG3A 2DYXA 4X04A 3U92A 4GVOA 4X8RA 1GGGA 1URGA 3CI8A 4MEVA 4H46A 1MRPA 4I9DA 4PFUA 5EYHA 3HFUA
chains in the Genus database with same CATH topology
4NN3A 1EYIA 1NV4A 2CZHA 3ISPA 5I7IA 3PTYA 1NV3A 2QVUA 3BIHA 3D1RA 4I3YA 4IR8A 2CEXA 5DW8A 5IZ3B 3W9VA 2FIEA 4GWYA 1KA1A 1G0IA 1AWBA 1NUXA 1SPIA 2B4MA 2HXRA 4F1VA 1Q9DA 4MX6A 3RPLB 5JK4A 4KXPA 4HXVA 4JVCA 4NAPA 4NHBA 4OA4A 3IFAA 4O8MA 2FHYA 2JJKA 2WEFA 3ROJA 2GQ1A 4OVQA 2ZZVA 4UABA 2WBBA 4I3EA 3SZPA 1FBFA 4PTKA 1FPFA 1IMEA 2XWVA 3NOHA 4FBPA 4HCWA 4PAIA 5ESYA 1FPGA 4P3LA 4N8YA 1INPA 5LTCA 1NV1A 4AS4A 1D9QA 4HCYA 4LN5A 4H45A 2Q9TA 2Y5KA 2MKZA 3CHGA 4GBVA 4GX6A 4N6KA 4YICA 2FVZA 5EYGA 5IZ1A 1LBYA 4MIJA 4PE3A 1KZ8A 3EKIA 1DK4A 1FJ9A 4MHFA 4P1EA 5J16A 3T1BA 4F19A 2KR0A 1NV7A 1XI6A 2VPNA 4PAKA 2V3QA 4MAGA 4PCDA 5T3JA 2OWZA 4N8GA 1LBXA 5ET8A 3MYUA 4P9KA 2P3VA 5F24A 5IM2A 3QMFA 2Y5LA 4GWUA 1FSAA 1NV0A 4N4UA 5J1DA 2R8TA 5EQ9A 1FBEA 4QXDA 4F1UA 1YXIA 1NUWA 2XWKA 1CNQA 4GX3A 4NG7A 4NGUA 4N91A 5I5PA 2P3NA 4AS5A 2XWOA 4DI3D 4N17A 2WYKA 3B8BA 4P8BA 5EQ7A 4N15A 4P56A 4G61A 4YZZA 5EQ8A 4PAFA 4PGNA 1K9YA 1FBHA 4O7MA 1DCUA 2ZZXA 1NV6A 4I40A 2CEYA 4P47A 2DE3A 1FPJA 1NUYA 1LEVA 3RYDA 4O94A 2FBPA 5ET5A 1FBDA 1LBZA 4F18A 1VDWA 2PFZA 4O7IA 3LV0A 4GWSA 4PFIA 5IGAA 4OVSA 3KC0A 1QGXA 2DVZA 4N81A 1FPIA 4GX4A 4P1LA 3IFCA 1FBCA 4MNPA 4PF8A 4PF6A 4PFRA 5FBPA 1NUZA 4GWZA 1EYKA 1DBZA 2F5XA 2L5VA 2VT5A 4JVDA 4HE0A 2Q74A 4JVIA 2V4CA 3E79A 4XEQA 2CZKA 1LBVA 2HZLA 4MNCA 1IMCA 1RDYA 4OANA 4HE2A 2QVVA 1FBGA 3FXBA 4PFBA 4NQ8A 2DE4A 4XFEA 3T0JA 4MMPA 1NI9A 4HE1A 4MNIA 2CZIA 1FPBA 2QPQA 3FBPA 2WX9A 2KQZA 3GYYA 5LDZA 5EQAA 2FIXA 1FPKA 2XXKA 2B4LA 2PCRA 1RDXA 1KA0A 2QFLA 1YZ0A 2ZZWA 3KBZA 4M1VA 4MCOA 1K9ZA 2HZKA 4GWWA 4MJOA 1FTAA 1LBWA 2F3BA 2HHMA 3KC1A 3BIGA 4QBAA 4XF5A 5I3SA 4GWXA 5ET7A 3U65A 2F3DA 1FJ6A 1NV5A 2DE2A 4OVTA 2Q8MA 1IMBA 1IMDA 1BK4A 1FPEA 2HPGA 2XWIA 4OVRA 1FPLA 2XA5A 1EYJA 4X04A 2OX3A 1IMAA 3RPLA 1FRPA 5CM6A 4DI4B 2QVRA 1FPDA 4PBQA 2VPOA 2DDKA 2WYPA 4X8RA 3MSTA 4PC9A 4PETA 5ET6A 5A5LA 4OVPA 4MEVA 5IZZA 2BJIA 4GBWA 3A29A 4PDHA 4PGPA 2PFYA 1IMFA 4NF0A 1JP4A 1NV2A 1YYZA 4PDDA 5IZ3A 1FBPA 4H46A 4X9TA 1G0HA 3LUZA 4NX1A 5EYHA 4PBHA 3E78A 3W9WA 3HFUA 4N6DA 3B50A 2WBDA 1RDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN3 A;  5I7I A;  2CEX A;  4MX6 A;  4NHB A;  4NAP A;  4OA4 A;  5CM6 A;  4O8M A;  4OVQ A;  2ZZV A;  4UAB A;  4PAI A;  2XWV A;  4P3L A;  4N8Y A;  5LTC A;  4LN5 A;  4N6K A;  4YIC A;  4PE3 A;  4MHF A;  4P1E A;  4PAK A;  2VPN A;  4PCD A;  4MAG A;  4N8G A;  4P9K A;  5IM2 A;  4N4U A;  2XWK A;  4NG7 A;  4NGU A;  4N91 A;  5I5P A;  2XWO A;  4DI3 D;  4N17 A;  2WYK A;  4P8B A;  4N15 A;  4P56 A;  4YZZ A;  4PAF A;  4PGN A;  4O7M A;  4P47 A;  2ZZX A;  2CEY A;  4O94 A;  2PFZ A;  4PFI A;  5IGA A;  4OVS A;  4P1L A;  4MNP A;  4PF8 A;  4PFR A;  4MIJ A;  2V4C A;  4XEQ A;  4MNC A;  2HZL A;  4OAN A;  4PFB A;  3FXB A;  4NQ8 A;  4XFE A;  4MNI A;  2WX9 A;  3GYY A;  2XXK A;  2ZZW A;  4MMP A;  4PF6 A;  4MCO A;  2HZK A;  4XF5 A;  3U65 A;  4OVT A;  2HPG A;  4OVR A;  2XWI A;  2XA5 A;  4X04 A;  4DI4 B;  4PBQ A;  4X8R A;  2VPO A;  2WYP A;  4PC9 A;  4PET A;  4OVP A;  4MEV A;  5IZZ A;  4PDH A;  4PGP A;  2PFY A;  4NF0 A;  4PDD A;  4NX1 A;  4PBH A;  4N6D A;  3B50 A; 
#chains in the Genus database with same CATH topology
 1EYI A;  1P1N A;  3PTY A;  2I0B A;  4GF8 A;  2FIE A;  3S9M C;  1JQF A;  1Y4T A;  2XXU A;  1B6H A;  4YKP A;  5H8H A;  5A5X A;  3H03 A;  1CB6 A;  5L9M A;  1SW1 A;  4N6K A;  5CBR A;  4P0G A;  4F3S A;  1KZ8 A;  2P1S A;  3QYT A;  3PUX E;  3UOR A;  1N3X A;  2FA7 A;  3S9L C;  5IM2 A;  1B4H A;  4F31 B;  5L9S A;  1OLA A;  5FHO A;  1FBE A;  1H3D A;  1WVJ A;  4NGU A;  1IIT A;  2D3I A;  3JV9 A;  3N26 A;  5DVJ A;  2O51 A;  2WYK A;  4R2F A;  4U4X A;  1NNK A;  4BDN A;  4WXJ A;  1DPP A;  2ZZX A;  4H5G A;  4YKJ A;  3FJ7 A;  3H3G A;  2F36 A;  4O7I A;  3O66 A;  2DQV A;  4GWS A;  1QGX A;  1LFH A;  5CMM A;  2D5W A;  4BLA A;  4EUO A;  1EYK A;  2L5V A;  1P1Q A;  4PFB A;  3FXB A;  3M8U A;  3FJG A;  1Y20 A;  2NVU B;  1P1U A;  1BIY A;  5HM4 B;  1XT8 A;  3PU5 A;  3KBZ A;  4MMP A;  1H44 A;  1K9Z A;  1WDN A;  3MBP A;  3U8Q A;  1EH3 A;  3TOD A;  1FQB A;  1USY E;  2XXI A;  3KFM A;  1FTM A;  4F2O A;  5A5L A;  5H8F A;  5I2K B;  2R6G E;  1IMF A;  4OFL A;  2OWT A;  3PGF A;  3U1O A;  1Y3N A;  4YKI A;  3KEI A;  3RPW A;  4QFK A;  3U72 A;  4JSO A;  3RT8 A;  3N6U A;  5K2Y A;  4KXP A;  2HAU A;  1B1H A;  1H76 A;  4OEN A;  4R2B A;  3FVN A;  5H8N A;  2NUV A;  4GX6 A;  4U4S A;  5ITP A;  3T1B A;  2NWJ A;  2Q8J A;  1M5C A;  2QJE A;  5F24 A;  3OSR A;  4EQ7 A;  4YB5 A;  2XX7 A;  4BDL A;  4P56 A;  1DCU A;  2KLF A;  3SEX A;  5IGA A;  3PPO A;  3TAJ A;  5CMK A;  2YJP A;  4N81 A;  4P1L A;  1B2H A;  2PT2 A;  3D4C A;  3IOU A;  3K01 A;  3E79 A;  2PX1 A;  1SI1 A;  5F1Q A;  1IMC A;  2Z8E A;  4MH5 A;  3T0J A;  3MJN A;  4RK2 A;  4HE1 A;  4YAH X;  3RGY A;  1IXI A;  5LOM A;  4H5F A;  4MJO A;  4XKP A;  4NTL A;  4PFT A;  1OMP A;  3A3C A;  2X7Q A;  1FPE A;  4HS7 A;  3PPR A;  4R9F A;  3K6V A;  1FRP A;  3MQ9 A;  4LA9 A;  3MPK A;  2BJI A;  4PDH A;  5I59 B;  3OEK A;  4ZEB A;  3G3J A;  1BP5 A;  3V89 B;  3LUY A;  4ELQ A;  1FW0 A;  3BIH A;  3GZG A;  3IR1 A;  4LQ5 A;  4OVJ A;  3MAM A;  4LQ2 A;  3ONM A;  3L6G A;  4EXK A;  4JVC A;  3N94 A;  4UAB A;  5KDT B;  2OK2 A;  4KFQ A;  3NOH A;  2ZNS A;  3A3U A;  1SW4 A;  2UYF A;  2V25 A;  4G68 A;  4MLQ A;  1DK4 A;  3RNN A;  2KR0 A;  2P3V A;  3FAS A;  1I6B A;  1M5B A;  2Q88 A;  4G8M A;  1UTH A;  4F29 A;  1FTJ A;  1N04 A;  1Z7N E;  4YZZ A;  4AB5 A;  1MY1 A;  4H8J A;  4LUB A;  4FE8 A;  1S50 A;  3V5A A;  1MDP 1;  3A09 A;  5I57 B;  4JB7 A;  2RCB A;  4XTC Q;  1YTV A;  3IB1 A;  4IO7 A;  2DSF A;  3GYY A;  1MQH A;  1FPK A;  2XXK A;  2B3B A;  5ET7 A;  3EQ1 A;  2WKY A;  1H43 A;  3OO8 A;  4QFN A;  1MM7 A;  4DCX A;  4Q0C A;  4R9G A;  3HO7 A;  4Z0I A;  2X7P A;  1Y4C A;  2WYP A;  4OVP A;  3DP8 A;  1R6Z A;  4QFO A;  1RDZ A;  4H1X A;  4NN3 A;  1URD A;  2CZL A;  1QUL A;  1DOT A;  1OQG A;  2XXV A;  4FED A;  1QW0 A;  3SZP A;  1FBF A;  4YU0 A;  2E1S A;  3KJT A;  3HV1 A;  3UA8 A;  2THI A;  1PBP A;  1IIW A;  4XKN A;  4F19 A;  1NV7 A;  3TTR A;  3SKP A;  5AA4 A;  5I2N B;  2ONS A;  4UA8 A;  4F2Q A;  2HCA A;  2I3W A;  1OVT A;  1YXI A;  1BTJ A;  1MQI A;  5EQ7 A;  4N15 A;  4THI A;  5H8Q B;  3H6V A;  1K9Y A;  4DDD A;  5DTB A;  4MF3 A;  1JET A;  1SBP A;  5I56 B;  1VDW A;  2PFZ A;  4PFI A;  3VXC A;  4OVS A;  4H65 A;  1VFD A;  3IFC A;  2GHA A;  1FBC A;  5FBP A;  4PFR A;  2V84 A;  4JVD A;  2V4C A;  2CZK A;  4R72 A;  4RA1 A;  3FBP A;  3O6G A;  5LDZ A;  2QFL A;  2DOJ A;  2F6P A;  3B6W A;  3C33 A;  1JEU A;  1PDA A;  5FTI A;  3CR9 A;  2XXY A;  4IY5 A;  1NMU A;  3Q29 A;  1EYJ A;  1XS5 A;  3RPL A;  2B3F A;  4IY6 A;  4FEB A;  1SI0 A;  1N3W A;  1B0H A;  1YYZ A;  2W7Y A;  2I4C A;  3QSL A;  5IZ3 B;  2QVU A;  2UVG A;  3JZJ A;  4OQO A;  3FV2 A;  2QL3 A;  2H25 A;  3UN6 A;  1VSO A;  5DVI A;  1HSL A;  1FQD A;  3RT6 B;  3CFZ A;  4MLV A;  2HEU A;  2PBW A;  5EYG A;  5J16 A;  2FVZ A;  3C31 A;  2O1L A;  4LON B;  1MY2 A;  2OWZ A;  3PMV A;  3MYU A;  5JTY A;  3PV0 E;  1B3L A;  4RJZ A;  3MVZ A;  3CVG A;  2XXX A;  3FZV A;  1US4 A;  4X48 A;  3T9X B;  3PUY E;  3LSF B;  4ZDM A;  4I40 A;  3W15 C;  3O9P A;  2GHB A;  1NFT A;  2FBP A;  4PP0 A;  3TCG A;  1QJM A;  3I3V A;  1LB9 A;  2F5X A;  5HPQ A;  3PD9 A;  2Q74 A;  1VR5 A;  1A8F A;  1HSJ A;  4Q8R A;  4KYS A;  3IB0 A;  3VLV A;  1RDX A;  3EHU A;  4MCO A;  3TEL A;  1LBW A;  3TUS A;  1AIV A;  3O28 A;  1A54 A;  2F3D A;  4OWD A;  2DE2 A;  3ZKL A;  1IMD A;  4GD5 A;  4Q5T A;  5DVF A;  2XXT A;  1MXV A;  5DEX A;  4TLL B;  3KSJ A;  4OZ9 A;  4PBQ A;  5FHN A;  1Q1K A;  3RY3 A;  2DP8 A;  2OJT A;  1PEB A;  2PFY A;  2V93 A;  2UVH A;  2I6E A;  1RYO A;  4PBH A;  2F7A A;  2WBD A;  5T3J A;  2I3V A;  4YMA A;  3LC8 A;  4IR8 A;  5TP9 A;  1Y1M A;  1UIU A;  1NUX A;  3T93 B;  1AOV A;  5JK4 A;  5ELV A;  4OVQ A;  5AA3 A;  1Z7M E;  1FPF A;  1FQE A;  3VDF A;  4AQ4 A;  5ESY A;  5I58 A;  1LB8 A;  4GL8 A;  4GL0 A;  4LN5 A;  4YB6 A;  4YIC A;  3CFX A;  3UP9 A;  3THI A;  4NF5 A;  3T96 B;  1MXY A;  1SYH A;  3RUM A;  1FQF A;  1VFE A;  2XWK A;  3TTL A;  3KOT A;  1LLS A;  1FBH A;  3EHS A;  3TDJ A;  1MM6 A;  1II5 A;  3AXF A;  1Y1Z A;  4ESW A;  5ET5 A;  1LBZ A;  3K1P A;  5H8S A;  3MC2 A;  4YKK A;  4I8C A;  1UIV A;  1IQ7 A;  4LAT A;  1R1N A;  2XX8 A;  3TQW A;  4YMB A;  3SEU A;  4XFE A;  4LVQ A;  5B7D A;  1MDQ A;  3VLU A;  4M1V A;  2HZK A;  2Y84 A;  4N13 A;  1NL5 A;  1TFA A;  5ICQ A;  4O3C A;  1FJ6 A;  1JW4 A;  4DZ1 A;  4JSD A;  2F97 A;  4H8I A;  3ILU B;  5H8H B;  1NH7 A;  2DWH A;  3DLN A;  2DS9 A;  2UVJ A;  2QMX A;  4KD5 A;  2VPO A;  3EHT A;  2F7B A;  2HXW A;  4PDD A;  1DTG A;  3W9W A;  3FJM A;  1IXG A;  4EF2 A;  2CZH A;  4AB6 A;  1N0T A;  1PC3 A;  3G3H A;  1MH3 A;  2VD3 A;  4NHB A;  4OA4 A;  5CM6 A;  2O69 A;  1KWH A;  1LBC A;  3C32 A;  2F8D A;  1XHY A;  2M8C A;  4ECF A;  1FPG A;  4WEP A;  3OMB A;  1ZJL A;  4X1D A;  3U94 A;  4IB2 A;  4NMY A;  4R6Y A;  2UYE A;  2Y7I A;  5CMC A;  3V8X B;  4EF1 A;  2H98 A;  5AA1 A;  1R9Q A;  4C1T A;  3RLF E;  4EXL A;  4BDM A;  1RKM A;  3E3K A;  1NUW A;  4NG7 A;  2HQ0 A;  4RY1 A;  3IOW A;  3GLB A;  3PUZ E;  4P8B A;  1EU8 A;  2E0S A;  1MXZ A;  2XXW A;  2ONK E;  2A5T B;  2DE3 A;  1FPJ A;  1B5J A;  2H99 A;  3RYD A;  2Z8F A;  1JEV A;  3C34 A;  4BDR A;  4MIJ A;  3QXM A;  4POX A;  4AS5 A;  5AA2 B;  1DTZ A;  4U2R A;  1FPB A;  1BKA A;  1M5D A;  3K1N A;  3KZG A;  1KA0 A;  4RXL A;  4G8N A;  4GQO A;  4RNS A;  4M4G A;  1D9V A;  5IAI A;  5KZT A;  3FXR A;  4NED A;  4TLM B;  2XXR A;  2DDK A;  4U1O A;  4PC9 A;  4HTG A;  1B0L A;  2AYS A;  1NV2 A;  5IKB A;  1FBP A;  3B50 A;  3T22 A;  4DE8 A;  4RPN A;  2Q2A A;  3D1R A;  1I6Q A;  2RF1 A;  3BFU A;  5FHM A;  3L6H A;  3KJ7 A;  4NAP A;  2JJK A;  1ZTY A;  4ZE8 A;  4FBP A;  4N8Y A;  5LTC A;  1LGB C;  4OMB A;  4H45 A;  2ESN A;  3HHF A;  3KN8 A;  2XX9 A;  3RQT A;  2V3T A;  1I69 A;  4DXB A;  4NE4 A;  4Z7E A;  1PB7 A;  4JWX A;  3OSQ A;  3PMX A;  1ZMG A;  2F35 A;  5EQ9 A;  2XHD A;  3BKI B;  5H8N B;  3LSL A;  4N17 A;  3VE1 B;  4IO3 A;  4GIZ A;  1N84 A;  1F9B A;  3IAZ A;  3MZ1 A;  3G7W A;  3KOS A;  3MWB A;  1LAH E;  1YCJ A;  4G8H A;  5K2X A;  4GX4 A;  1NUZ A;  4JBZ A;  1DBZ A;  3DP6 A;  3CFL A;  4OAN A;  4HE2 A;  4JDF A;  4OEU A;  1NI9 A;  3FXQ A;  3PUV E;  1VE4 A;  4WKM A;  2UXA A;  2P0S A;  4I1D A;  1L5T A;  1B7U A;  1CE2 A;  3UIF A;  3U65 A;  2Q8M A;  3S2V A;  4Q30 B;  2HPG A;  4OES A;  2XA5 A;  3FD3 A;  3FVO A;  3OXN A;  3ILT B;  2V3U A;  1AL3 A;  3H4Z A;  2Y7K A;  3KN7 A;  1LBB A;  1EZ9 A;  4PGP A;  1J1N A;  5ITO A;  4MBP A;  1LAF E;  3MP1 A;  4FOR A;  1G0H A;  3LUZ A;  3D4G A;  3CIJ A;  4OET A;  5M2V A;  3S9E A;  1B7Z A;  4KQP A;  3ISP A;  4ZZE A;  1NNF A;  4I3Y A;  3DM0 A;  1US5 A;  1MH4 A;  1SPI A;  3TZA A;  3LSW A;  3M3K A;  3RTW B;  4PAI A;  1QVS A;  3TPA A;  2Q9T A;  1MQD A;  1B58 A;  4PE3 A;  1FJ9 A;  4BDO A;  1FCK A;  3QMF A;  4GWU A;  3HN0 A;  3S9N C;  1B32 A;  2P3N A;  4IGR A;  1JVX A;  5I2K A;  3OEM A;  4G61 A;  4XKR A;  3G3G A;  1MXW A;  3WAE A;  2QRY A;  5DEX B;  1LAG E;  3PPN A;  2BJJ X;  4ZZA A;  3T9H B;  2QS2 A;  2DVC A;  1UQW A;  4NF8 B;  2XXQ A;  2I0C A;  3ZSF A;  3R7X A;  3FGS A;  5ISU A;  2GRV A;  3M3L A;  1A7L A;  5EQA A;  2PCR A;  2ZZW A;  1XVY A;  1FTA A;  2ABH A;  5I3S A;  1GVC A;  1GV8 A;  3MP6 A;  4RK9 A;  5CRY A;  1S7Y A;  3K4U A;  1FPL A;  1Y3P A;  4BDQ A;  3VLW A;  2FYI A;  1QUI A;  1B46 A;  3WAF A;  2A5S A;  1SYI A;  3FVG A;  3CG1 A;  3C36 A;  3SEY A;  3K02 A;  4ZEI A;  5L8D A;  5CMB A;  5I7I A;  4R75 A;  3IJO B;  1H45 A;  3K6U A;  3MPL A;  1G0I A;  3K6W A;  3TTN A;  4ISU A;  4XIG Q;  4HXV A;  2Q89 A;  3IFA A;  2GQ1 A;  4E0X A;  1ZBM A;  1MPB A;  1INP A;  1LFI A;  3I5O A;  1NV1 A;  4GRK A;  4JWO A;  4F22 A;  3G3I A;  3QUJ A;  5ET8 A;  2UVI A;  1MPC A;  2Y5L A;  4NWC A;  2HAV A;  1AMF A;  1P99 A;  4N4U A;  2R8T A;  4NF8 A;  1CNQ A;  5EHS A;  2XD2 A;  3S4U A;  4DIG A;  4F3P A;  2Z22 A;  4O7M A;  2I58 A;  1FBD A;  1WOD A;  3LV0 A;  2DVZ A;  4IGT A;  3H6W A;  4HE0 A;  1T0K A;  1FTL A;  3E78 A;  2ZYO A;  1RDY A;  2QVV A;  1FBG A;  5FTH A;  4U21 A;  2R71 A;  3SER A;  5BWJ A;  1LCT A;  3MW0 A;  1IXH A;  3HHG A;  2KQZ A;  3KBR A;  3IOR A;  3IK6 B;  3PD8 A;  4G68 B;  2F3B A;  5ICT A;  1AH5 A;  1TWY A;  3MUQ A;  4KR5 A;  1MY0 A;  3K6X A;  3HPI A;  1M5F A;  5B70 A;  2OWS A;  2OX3 A;  1IMA A;  1NNT A;  2DWA A;  4I62 A;  2QVR A;  4P11 A;  4DI4 B;  1B7H A;  1NH8 A;  2G93 A;  4FEC A;  1JP4 A;  5IZ3 A;  3KSX A;  2IA4 A;  2I49 A;  1IXC A;  3Q28 A;  1SW5 A;  2CEX A;  1DPE A;  2DWI A;  4E0W A;  3K00 A;  5AA2 A;  2HXR A;  3MP8 A;  4F1V A;  1A99 A;  1YAE A;  4O8M A;  2FHY A;  2ZZV A;  3FXU A;  3SDF A;  1PB9 A;  2H5Y A;  2GFE A;  3FIR A;  4ZEF A;  2Y5K A;  4GBV A;  4N6P A;  2F6G A;  1B40 A;  1ELJ A;  4PAK A;  4PCD A;  1IUD A;  2YPN A;  3OO7 A;  3IL1 B;  5DYH A;  2ONR A;  1MQG A;  3EPE A;  2ZYN A;  2HFB A;  1D9Y A;  3G3K A;  4GX3 A;  3VVF A;  4DI3 D;  4KPT A;  3MVY A;  2VP1 A;  3ECR A;  1LEV A;  5AE4 A;  4JXI A;  1SVX B;  5KCJ A;  3KN3 A;  2PYY A;  4MNP A;  4OYV A;  3MZ9 A;  4JVI A;  4KCD A;  3PPP A;  4XEQ A;  1D3K A;  1MXU A;  2OZZ A;  2CZI A;  1SDX A;  4NF5 B;  2QPQ A;  2WX9 A;  1ATG A;  4GLI A;  1LFG A;  1MPD A;  1YZ0 A;  5TPA A;  2RIN A;  3LBS A;  3KC1 A;  2HHM A;  5I57 A;  4LZ5 A;  2VOZ A;  2CMO A;  1DMB A;  2B65 A;  3IOT A;  4QF9 A;  2AIX A;  5ET6 A;  3CRB A;  3K1M A;  4ZE9 A;  4KYD A;  2RC9 A;  4OFO A;  4GBW A;  2Q2C A;  4NF0 A;  4RYA A;  3IO4 A;  4X9T A;  1P1O A;  3MVW A;  1R9L A;  2P2A A;  4GWX A;  4QFL A;  1I6A A;  1MG1 A;  3V83 A;  1NV4 A;  4R74 A;  4WED A;  4HW8 A;  4IO2 A;  2YLN A;  3TTM A;  3Q25 A;  2RKM A;  1D9Q A;  3I6V A;  2NXO A;  2D21 A;  1EZO A;  3IB2 A;  3O97 A;  2Z8D A;  4N8G A;  1LBX A;  2ZNT A;  3SEW A;  1ZU0 A;  1IEJ A;  3O6H A;  3SET A;  3G3F A;  5I5P A;  5CI5 A;  1FQC A;  1B3E A;  3QUF A;  3HCQ A;  4PGN A;  3H7M A;  4P47 A;  1NUY A;  3CSG A;  1N76 A;  2OLB A;  2DXR A;  3O6I A;  3R26 A;  4K3F A;  1URS A;  4PE5 B;  4FJP A;  5DT6 A;  4L17 A;  4MNC A;  5AA2 D;  4NQ8 A;  4P0I A;  4H67 A;  1O63 A;  4IO6 A;  1S9T A;  5DW8 A;  3BIG A;  3B7D A;  3VVE A;  4H6D A;  1NV5 A;  3JYR A;  2I48 A;  1OLC A;  1FQA A;  4QFP A;  3TYH A;  4GOT A;  4KCC A;  5IZZ A;  5H8Q A;  4X1B A;  1IZ1 A;  3E13 X;  4NF6 B;  4GXA A;  3TQL A;  2O1M A;  3IO6 A;  4ELO A;  4IO4 A;  4PFY A;  3W9V A;  1M5E A;  1PB8 A;  2ZNU A;  4UAC A;  1KA1 A;  3B6T A;  2XD3 A;  3IOV A;  1A40 A;  2B4M A;  4OHN A;  4MX6 A;  3RPL B;  4LZ8 A;  1POY 1;  1TFD A;  2XWV A;  2RC8 A;  4HCW A;  2OBG A;  3TKD A;  3OOA A;  4NWD A;  4TQU Q;  3CHG A;  4OTE A;  4OER A;  1UTB A;  3OEL A;  4MAG A;  3QIM A;  3C4M A;  2PT1 A;  5I56 A;  3P7I A;  1MY3 A;  5EQ8 A;  4PAF A;  1NV6 A;  3M3F A;  3MVX A;  3H06 B;  3FAT A;  4YB7 A;  3ZS6 A;  1PBQ A;  1ZKB A;  5JEI A;  1FTK A;  3KC0 A;  2QS3 A;  2VGQ A;  1JVY A;  1QKA A;  4XXU A;  1FTO A;  5AA4 B;  3EF7 A;  3HST A;  1NNP A;  2QMW A;  1LCF A;  5L9O A;  4OEV A;  4F3G A;  4NF4 B;  3H6T A;  4PF6 A;  4ELP A;  4GWW A;  3C35 A;  4XF5 A;  1A8E A;  1Y9U A;  1MS7 A;  5I58 B;  4OVR A;  1POT A;  3VXB A;  1OVB A;  2O84 X;  3MST A;  4PET A;  3A29 A;  1JW5 A;  1JNF A;  1TXF A;  2ZXT A;  3PPQ A;  4G77 A;  4F1Y A;  3BFT A;  4U23 A;  3K2D A;  1MY4 A;  1QUJ A;  2O7U A;  4ONY A;  2XXP A;  1ZLQ A;  3LR1 A;  4QSE A;  3Q26 A;  4P3L A;  5CBS A;  1D4N A;  5KDT A;  1SD3 A;  5A5X B;  3EN3 A;  4DLD A;  2MKZ A;  3T9V A;  2G29 A;  2VD2 A;  3BBR A;  3EKI A;  1SQY A;  4DCY A;  5BUU A;  1MXX A;  4EQ9 A;  3R6U A;  1FSA A;  2PVU A;  3F11 A;  1QKB A;  3GXA A;  2H9B A;  4N91 A;  4NF6 A;  5KCJ B;  4OFJ A;  4C1U A;  2XWO A;  5I2N A;  1SW2 A;  4F3B A;  3UK4 A;  2CEY A;  2F7C A;  3H6U A;  3E4R A;  2O6A A;  2QSX A;  3T66 A;  4EQB A;  4C0R A;  4PF8 A;  2AL4 A;  2VT5 A;  2XXH A;  2HZL A;  3ODB A;  4POW A;  3PUW E;  4OXV A;  1YPN A;  1N7X A;  4R6K A;  3DP4 A;  3OO9 A;  3USD A;  4LP2 B;  3E9X A;  3C9H A;  1ZIU A;  1A55 A;  1IMB A;  1B52 A;  1BK4 A;  2XWI A;  4U1Z A;  1DSN A;  4FAT A;  1B4Z A;  3Q27 A;  3O2A A;  4ZED A;  1NKX A;  2ZYM A;  1O64 A;  2AL5 A;  2RCA A;  3FUZ A;  4ESX A;  5TU0 A;  3TCH A;  4N6D A;  2PMS A;  3RTF B;  4RPO A;  3VFJ A;  1NV3 A;  5I59 A;  1O7T A;  3GBA A;  2NOO A;  4GWY A;  3KG2 A;  2VHA A;  3TTK A;  1AWB A;  1MQJ A;  1XVX A;  4ZEK A;  3IJX B;  3ROJ A;  2WEF A;  3FV1 A;  3TCF A;  3VV5 A;  4PTK A;  4QSD A;  1B3F A;  2Y7W A;  1B9J A;  4G2Z A;  4G68 C;  4XKQ A;  3U93 A;  4G4P A;  2Z23 A;  4MHF A;  1B1X A;  2LAO A;  1BLF A;  1GR2 A;  1XI6 A;  2VPN A;  3K0V A;  3KGC A;  4P9K A;  2R9J A;  3SEV A;  4PFW A;  5I84 A;  4ZS9 A;  4KYE A;  5J1D A;  3OD7 A;  3RN8 A;  3TMG A;  2OCU A;  4ND9 A;  5JTY B;  3B8B A;  4PQJ A;  4KI0 E;  1B5I A;  4QRZ A;  2IEE A;  4R73 A;  3IX1 A;  2RC7 A;  2O7I A;  4O94 A;  4F18 A;  3OO6 A;  3SES A;  1FPI A;  2REG A;  4ELR A;  5F7V A;  4GWZ A;  4FAJ A;  5TPA B;  1RYX A;  1ANF A;  2H4I A;  2X26 A;  2DE4 A;  3N6T A;  4MNI A;  5EYF A;  2FIX A;  3PMW A;  1Y3Q A;  5CC2 A;  1B51 A;  5HBC A;  4EDP A;  4OVT A;  1B3G A;  1B05 A;  4QSC A;  2Y7P A;  4DXC A;  4O3B A;  4QHQ A;  1FPD A;  3TEP A;  5TP9 B;  2I4B A;  4NX1 A;  4U22 A;  3QAX A;  1XOC A;  4GWO A;  3DEL B;  2FNC A;  4ZEC A;  1UTB B;  3TFL A;  1Q9D A;  3VVD A;  1HSE A;  2QS4 A;  3N5L A;  1LST A;  2WBB A;  4I3E A;  1TT1 A;  1IME A;  2F34 A;  4KHZ E;  1GTK A;  4AS4 A;  4HCY A;  1P1W A;  4NF4 A;  5IZ1 A;  1JW1 A;  1LBY A;  4GXS B;  4P1E A;  4FIM A;  1B5H A;  1XC1 A;  2V3Q A;  3B6Q A;  3T9U A;  1OIB A;  4F39 A;  2ALU A;  1NV0 A;  4MFI A;  1QUK A;  4F1U A;  4QXD A;  2F78 A;  4H0W A;  2O68 A;  1OQH A;  4GFR A;  4IO5 A;  2REJ A;  2ANJ A;  3GBB A;  3CSB A;  4LZ7 A;  2ZMB A;  4JWY A;  3MZB A;  4TOZ A;  3O29 A;  2A5T A;  2GH9 A;  1EZP A;  3QK6 A;  1Q35 A;  3FVK A;  1UTH B;  2DWJ A;  3OEN A;  1LBV A;  3ZKK A;  1B3H A;  5H8F B;  1N7W A;  4R6H A;  2B4L A;  1USY H;  4N07 A;  4QBA A;  3LSX A;  4O3A A;  2QS1 A;  2DXY A;  2ZYK A;  3UGW A;  2Y7R A;  1LAX A;  5EHM A;  4DXU A;  3CG3 A;  2DYX A;  4X04 A;  3U92 A;  4GVO A;  4X8R A;  1GGG A;  1URG A;  3CI8 A;  4MEV A;  4H46 A;  1MRP A;  4I9D A;  4PFU A;  5EYH A;  3HFU A; 
#chains in the Genus database with same CATH homology
 4NN3 A;  1EYI A;  1NV4 A;  2CZH A;  3ISP A;  5I7I A;  3PTY A;  1NV3 A;  2QVU A;  3BIH A;  3D1R A;  4I3Y A;  4IR8 A;  2CEX A;  5DW8 A;  5IZ3 B;  3W9V A;  2FIE A;  4GWY A;  1KA1 A;  1G0I A;  1AWB A;  1NUX A;  1SPI A;  2B4M A;  2HXR A;  4F1V A;  1Q9D A;  4MX6 A;  3RPL B;  5JK4 A;  4KXP A;  4HXV A;  4JVC A;  4NAP A;  4NHB A;  4OA4 A;  3IFA A;  4O8M A;  2FHY A;  2JJK A;  2WEF A;  3ROJ A;  2GQ1 A;  4OVQ A;  2ZZV A;  4UAB A;  2WBB A;  4I3E A;  3SZP A;  1FBF A;  4PTK A;  1FPF A;  1IME A;  2XWV A;  3NOH A;  4FBP A;  4HCW A;  4PAI A;  5ESY A;  1FPG A;  4P3L A;  4N8Y A;  1INP A;  5LTC A;  1NV1 A;  4AS4 A;  1D9Q A;  4HCY A;  4LN5 A;  4H45 A;  2Q9T A;  2Y5K A;  2MKZ A;  3CHG A;  4GBV A;  4GX6 A;  4N6K A;  4YIC A;  2FVZ A;  5EYG A;  5IZ1 A;  1LBY A;  4MIJ A;  4PE3 A;  1KZ8 A;  3EKI A;  1DK4 A;  1FJ9 A;  4MHF A;  4P1E A;  5J16 A;  3T1B A;  4F19 A;  2KR0 A;  1NV7 A;  1XI6 A;  2VPN A;  4PAK A;  2V3Q A;  4MAG A;  4PCD A;  5T3J A;  2OWZ A;  4N8G A;  1LBX A;  5ET8 A;  3MYU A;  4P9K A;  2P3V A;  5F24 A;  5IM2 A;  3QMF A;  2Y5L A;  4GWU A;  1FSA A;  1NV0 A;  4N4U A;  5J1D A;  2R8T A;  5EQ9 A;  1FBE A;  4QXD A;  4F1U A;  1YXI A;  1NUW A;  2XWK A;  1CNQ A;  4GX3 A;  4NG7 A;  4NGU A;  4N91 A;  5I5P A;  2P3N A;  4AS5 A;  2XWO A;  4DI3 D;  4N17 A;  2WYK A;  3B8B A;  4P8B A;  5EQ7 A;  4N15 A;  4P56 A;  4G61 A;  4YZZ A;  5EQ8 A;  4PAF A;  4PGN A;  1K9Y A;  1FBH A;  4O7M A;  1DCU A;  2ZZX A;  1NV6 A;  4I40 A;  2CEY A;  4P47 A;  2DE3 A;  1FPJ A;  1NUY A;  1LEV A;  3RYD A;  4O94 A;  2FBP A;  5ET5 A;  1FBD A;  1LBZ A;  4F18 A;  1VDW A;  2PFZ A;  4O7I A;  3LV0 A;  4GWS A;  4PFI A;  5IGA A;  4OVS A;  3KC0 A;  1QGX A;  2DVZ A;  4N81 A;  1FPI A;  4GX4 A;  4P1L A;  3IFC A;  1FBC A;  4MNP A;  4PF8 A;  4PF6 A;  4PFR A;  5FBP A;  1NUZ A;  4GWZ A;  1EYK A;  1DBZ A;  2F5X A;  2L5V A;  2VT5 A;  4JVD A;  4HE0 A;  2Q74 A;  4JVI A;  2V4C A;  3E79 A;  4XEQ A;  2CZK A;  1LBV A;  2HZL A;  4MNC A;  1IMC A;  1RDY A;  4OAN A;  4HE2 A;  2QVV A;  1FBG A;  3FXB A;  4PFB A;  4NQ8 A;  2DE4 A;  4XFE A;  3T0J A;  4MMP A;  1NI9 A;  4HE1 A;  4MNI A;  2CZI A;  1FPB A;  2QPQ A;  3FBP A;  2WX9 A;  2KQZ A;  3GYY A;  5LDZ A;  5EQA A;  2FIX A;  1FPK A;  2XXK A;  2B4L A;  2PCR A;  1RDX A;  1KA0 A;  2QFL A;  1YZ0 A;  2ZZW A;  3KBZ A;  4M1V A;  4MCO A;  1K9Z A;  2HZK A;  4GWW A;  4MJO A;  1FTA A;  1LBW A;  2F3B A;  2HHM A;  3KC1 A;  3BIG A;  4QBA A;  4XF5 A;  5I3S A;  4GWX A;  5ET7 A;  3U65 A;  2F3D A;  1FJ6 A;  1NV5 A;  2DE2 A;  4OVT A;  2Q8M A;  1IMB A;  1IMD A;  1BK4 A;  1FPE A;  2HPG A;  2XWI A;  4OVR A;  1FPL A;  2XA5 A;  1EYJ A;  4X04 A;  2OX3 A;  1IMA A;  3RPL A;  1FRP A;  5CM6 A;  4DI4 B;  2QVR A;  1FPD A;  4PBQ A;  2VPO A;  2DDK A;  2WYP A;  4X8R A;  3MST A;  4PC9 A;  4PET A;  5ET6 A;  5A5L A;  4OVP A;  4MEV A;  5IZZ A;  2BJI A;  4GBW A;  3A29 A;  4PDH A;  4PGP A;  2PFY A;  1IMF A;  4NF0 A;  1JP4 A;  1NV2 A;  1YYZ A;  4PDD A;  5IZ3 A;  1FBP A;  4H46 A;  4X9T A;  1G0H A;  3LUZ A;  4NX1 A;  5EYH A;  4PBH A;  3E78 A;  3W9W A;  3HFU A;  4N6D A;  3B50 A;  2WBD A;  1RDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...