5IGAA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with co-purified parahydroxybenzoate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SMEVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with co-purified parahydroxybenzoate
rcsb
source organism Uncultured bacterium
molecule tags Transport protein
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2016-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5igaA00
4N17A 4PBQA 2XWVA 4PAKA 4X8RA 4MEVA 4MMPA 4PETA 4X04A 2ZZXA 4OVRA 4N4UA 4PF6A 4PFBA 4XFEA 4PBHA 4P1LA 4OVQA 4MNPA 4NX1A 4NG7A 4OVTA 4PCDA 3B50A 4N6DA 4UABA 5IGAA 4N91A 5CM6A 4OA4A 4PF8A 2XWIA 2PFZA 4NHBA 2XWKA 4P9KA 4OVSA 4O94A 5I7IA 4P1EA 2WYKA 4MNIA 4PGNA 2ZZVA 4P8BA 4XEQA 5IM2A 4DI3D 4NN3A 2XA5A 2CEXA 2HZKA 4PAFA 2HPGA 3U65A 2VPNA 4N8GA 2XWOA 4LN5A 4NQ8A 4NAPA 4PAIA 2ZZWA 3GYYA 2WX9A 4NF0A 4MIJA 2PFYA 2WYPA 4OVPA 4P3LA 4PDHA 2XXKA 3FXBA 4YICA 4PDDA 4PE3A 4PFRA 4O8MA 4OANA 4MNCA 4P47A 4MCOA 4N8YA 2HZLA 4NGUA 5IZZA 4PC9A 2VPOA 4P56A 4YZZA 5LTCA 4O7MA 2V4CA 4XF5A 4MHFA 4PGPA 4PFIA 4DI4B 4MX6A 5I5PA 2CEYA 4N15A 4N6KA 4MAGA
chains in the Genus database with same CATH superfamily
4XKRA 4HE0A 3MAMA 1NV3A 1FPEA 1IXIA 4GWSA 2OWTA 4G68B 4LZ5A 2CZLA 3QUFA 3CVGA 2REGA 3CI8A 3JZJA 1MY4A 4HE2A 4GL0A 4N6DA 3FVOA 2O7IA 3MBPA 4AQ4A 1FQAA 5AA4A 2ANJA 2PFZA 1AOVA 4NHBA 4LQ5A 1UIUA 3G3HA 3K6UA 3KZGA 2LAOA 4O94A 4XTCQ 1B3LA 1QUIA 2O6AA 1KA1A 1MXVA 3KGCA 5AA2B 1MS7A 2XA5A 4OVJA 1B0HA 1MQHA 2B3FA 3KN7A 3B6TA 4DXBA 3Q27A 1OLCA 3O2AA 1Q1KA 3CIJA 1YAEA 3PUWE 5I57A 3RUMA 2QSXA 2NXOA 4R6HA 2G93A 5EHMA 3RLFE 1XHYA 4RYAA 4BDQA 4HW8A 2I49A 1IMCA 5TP9A 3EF7A 3H6TA 3O29A 1RKMA 2FVZA 4AB5A 4F3SA 1OIBA 3U92A 3HFUA 3LUYA 1GV8A 1MRPA 5KCJA 1B5HA 4ESWA 1M5EA 4MHFA 4ZEKA 4DXCA 4EF1A 3PGFA 5TU0A 1PC3A 4DZ1A 1MXZA 2FYIA 3VXBA 5DVIA 4IO2A 4F31B 3K1MA 1LFIA 1LBBA 3JV9A 4LQ2A 3RGYA 3UN6A 4BDOA 4R75A 2QMWA 3MJNA 2Q8MA 5IZ3A 1KA0A 2A5SA 3S9MC 2DVCA 1N7XA 1NL5A 4H5GA 4RNSA 1N3WA 2I0CA 3EPEA 4DCXA 4NF8A 4H1XA 1MXWA 2IA4A 3CFXA 4OEUA 4ELPA 1B46A 1SVXB 4WKMA 4H0WA 4QSCA 4R74A 2I0BA 4XEQA 3KJ7A 3BKIB 1NUWA 1WDNA 2CEXA 4KD5A 4ZE9A 1O64A 1FQFA 3K1PA 2I4CA 3MP6A 2Q74A 1B7HA 3T93B 2H98A 3UGWA 2DS9A 3PPRA 3U65A 1FPDA 2VPNA 3IOWA 4JVCA 2WBDA 3MP1A 5ET8A 5A5XA 2ZZWA 1B32A 4ND9A 2NVUB 3TKDA 3QUJA 4IB2A 3IOUA 5K2YA 3M3LA 2RC8A 2GRVA 3FXBA 2UXAA 3QK6A 4MJOA 4RPNA 1N0TA 3Q25A 5KDTB 3IB1A 2XXXA 4OFJA 5HPQA 2CZKA 5IAIA 2RCBA 3C9HA 3HO7A 2PT1A 3L6GA 3DM0A 2F35A 3ZSFA 3CR9A 2PX1A 4MEVA 2ZNTA 4OTEA 2X26A 3IR1A 4E0WA 4F22A 4POXA 4MNPA 3FJ7A 3TODA 3TELA 1JW5A 2F6PA 1BLFA 3V83A 4IO5A 4H8IA 3W15C 4ONYA 4JWYA 3V89B 2XWIA 2Y7RA 4OETA 1I6AA 3N6TA 3FV2A 5I59A 1VE4A 4IR8A 3FJMA 4MNIA 2GQ1A 1OLAA 3H3GA 4KPTA 1Y3PA 3S2VA 1OVTA 3V8XB 1Q9DA 1Q35A 4NE4A 2HAUA 4RXLA 3O97A 2VT5A 4TLLB 1ANFA 4Z0IA 4NQ8A 4R6KA 5CMCA 2F6GA 5AA4B 3Q28A 1FBEA 3K4UA 4M1VA 3MZ9A 4IY6A 4F2QA 3IFCA 1LBVA 3L6HA 3LBSA 2XXRA 1VFDA 3IJXB 1HSEA 1VFEA 2VPOA 3PU5A 4FBPA 1Y20A 1LGBC 1SI1A 3Q29A 1LAHE 1LAFE 1SPIA 5EQ9A 1D9VA 4OXVA 4QF9A 2Z22A 3KBRA 3IX1A 4ELOA 5I57B 3B8BA 5H8HA 4JVDA 1NV5A 4IGTA 3OSRA 3O6IA 4N17A 3FVKA 4GBVA 1MPCA 4PAKA 2NWJA 1LLSA 3MC2A 3D4GA 1N84A 5TP9B 3V5AA 2GHAA 4R72A 1B2HA 1B05A 3PTYA 1JETA 2DYXA 2B4LA 3C32A 3HSTA 4F18A 3FVGA 4K3FA 1I6QA 4M4GA 2CMOA 3G3GA 1LEVA 3BBRA 3CG3A 1B4ZA 3ISPA 5BUUA 3N94A 4ZE8A 4GIZA 3BFUA 1FPLA 4U21A 4GLIA 3TCFA 4RK9A 3HHGA 4EUOA 1VDWA 1Z7ME 2O84X 2O1LA 5EYFA 1DMBA 4ZECA 5IZ1A 1ZBMA 5I2NA 1ZKBA 1NFTA 3LSXA 2V93A 2X7QA 1T0KA 4NF8B 1IXCA 1LAGE 3B6WA 1FBDA 3MP8A 3T22A 3KG2A 2Q9TA 3GLBA 4KR5A 4YICA 5DT6A 3ZS6A 1LB9A 1MDP1 1FTLA 4P56A 4I3YA 4BDMA 1VSOA 1BIYA 4GQOA 1FTJA 4AB6A 4DI4B 2DE2A 1FPBA 2FHYA 1A8FA 5A5XB 1P1OA 1HSJA 3ILUB 4U4XA 3E79A 4JDFA 3U1OA 3OMBA 2L5VA 3MVXA 4MF3A 1B7ZA 4QFLA 4N4UA 4NEDA 4QSEA 2ZYNA 3KC0A 4G2ZA 4H65A 3T66A 4NG7A 1ZTYA 4FORA 2ESNA 1A55A 2R71A 4FIMA 3VFJA 5KZTA 1AMFA 3PUXE 3U94A 3VE1B 1LCTA 1YCJA 1FQEA 3VLVA 2O51A 1SW1A 1MPBA 3PV0E 1MQDA 2XWKA 2RC9A 3FBPA 3IJOB 1KWHA 4EQ9A 2DOJA 3OD7A 4IO7A 2H99A 1BKAA 3RT6B 4QBAA 2AL5A 4YMAA 4ZEIA 3G3FA 4O3BA 3OO9A 5AA2D 2XXWA 4FEBA 1IEJA 4N8GA 1NV0A 1QVSA 3IAZA 2D21A 1FQBA 4YKJA 1R9QA 5CRYA 2PT2A 4MIJA 4F2OA 1XI6A 3OO8A 2VD3A 5I59B 3K1NA 3FXUA 3TMGA 3OO7A 1B3GA 1IMBA 4PDHA 3VDFA 2PCRA 1QW0A 3I5OA 4QFNA 2HFBA 3O66A 4NGUA 1A7LA 5AA3A 5LTCA 4JB7A 1EYKA 3H7MA 1DCUA 1II5A 1H76A 3FD3A 3EN3A 1MXXA 2P3VA 4N15A 5LOMA 2XXTA 4GWUA 5BWJA 5I2KA 3E9XA 2VGQA 5ITOA 3RYDA 2XWVA 2V3QA 1GVCA 3KOSA 1MH4A 4TLMB 4OVQA 2RC7A 2HAVA 4FEDA 4ZEDA 4AS4A 4NF5B 1FSAA 4JSDA 3SESA 1B3HA 1QUJA 5FHOA 4LA9A 1ZLQA 1A40A 1B58A 4X9TA 2JJKA 3SEYA 1QJMA 5H8HB 2DDKA 1PBPA 2R9JA 1KZ8A 4YKKA 3TEPA 4O7IA 3TFLA 1DPEA 2ONRA 2OWZA 4PAFA 1B7UA 4IO3A 5I56A 1QUKA 3TCGA 4H67A 4U23A 2Z23A 3VLWA 2OZZA 3FUZA 4WXJA 3G3KA 1Y4CA 2X7PA 3B6QA 4RPOA 3GZGA 2KQZA 3BIHA 3H4ZA 3PUVE 3TTNA 4MLVA 3TQLA 3PMVA 2AIXA 4PFRA 1GTKA 4ZZEA 4MCOA 3IL1B 3RY3A 4PFWA 1MH3A 4C0RA 2QS3A 1URDA 2V4CA 2V84A 1DOTA 1FTAA 1Z7NE 2RCAA 2CEYA 1Y1MA 3A29A 4DLDA 2REJA 1EZPA 2B65A 4U2RA 5TPAA 4GFRA 1FBHA 4KYEA 2DVZA 2H9BA 4PE5B 2XX8A 3G7WA 5F24A 3IB2A 5CMMA 2NOOA 4OA4A 4PF8A 2Z8DA 2HXWA 4GL8A 2YLNA 3A3UA 3IB0A 2XHDA 4EQBA 4F3GA 4OVSA 1Y3QA 1D9QA 4ISUA 4P1EA 4P0GA 1RDZA 4F3BA 4JBZA 4P8BA 5IM2A 1BP5A 2F36A 5H8FA 3AXFA 1ZU0A 3MW0A 5L9MA 4X1BA 4E0XA 2HCAA 1NV2A 5JK4A 4LVQA 1SW5A 4OERA 5I3SA 2QJEA 4NF0A 1LFGA 2FA7A 1F9BA 2PVUA 2PFYA 2B3BA 1XVXA 3IK6B 2I4BA 2XD3A 1IQ7A 1XS5A 5EQ8A 4KCCA 4O3AA 1M5DA 5ESYA 1PB8A 4RA1A 2XXYA 1NNPA 5B7DA 1FPGA 3TPAA 4RY1A 5T3JA 2VOZA 2E1SA 1IXHA 4Q8RA 2ZNSA 4QFPA 2F78A 5JEIA 2UVHA 2O69A 3H6UA 1P1QA 3LSLA 1DBZA 3TQWA 3MVYA 1DK4A 4PF6A 4XFEA 4PBHA 1J1NA 3LV0A 4H45A 3WAFA 3UP9A 1WVJA 4G61A 3Q26A 4XIGQ 1N3XA 2FNCA 1M5CA 3LSWA 4N6PA 4RK2A 1B6HA 1P1UA 2CZIA 4PFUA 2ALUA 3PUYE 4GX3A 2OCUA 3K0VA 5I2KB 1MQIA 5M2VA 3E13X 3RPWA 4Q0CA 5ICQA 1PB7A 5K2XA 4EXKA 4QSDA 5AE4A 5FBPA 3SDFA 2OLBA 3DP4A 2Z8EA 4F19A 2V25A 5CI5A 2DSFA 2XXUA 1IUDA 4N13A 3LC8A 3TTLA 4NTLA 1B3FA 3ECRA 5LDZA 4HS7A 1YPNA 5I84A 3MPLA 1MXYA 1JVXA 1UQWA 4NF6A 2GH9A 1NNKA 2QS2A 1Y1ZA 4FE8A 1S7YA 4YMBA 1TWYA 3BFTA 1TFDA 5I56B 2BJIA 1TXFA 4I1DA 1IMDA 4YKIA 3CFZA 1EH3A 1FTOA 3LUZA 4GWOA 3NOHA 4ESXA 1I69A 4PETA 1ZJLA 4PP0A 1P1WA 4XKPA 1IMEA 4ZEFA 1GGGA 4OVTA 4DDDA 1P1NA 5ET7A 5HBCA 1US4A 1LSTA 3EKIA 3IOVA 5CM6A 1NV7A 3HV1A 2WKYA 4KXPA 1B9JA 2F7CA 2M8CA 5I7IA 1MM6A 1LB8A 1IIWA 3D1RA 1RYXA 4XKNA 3FXRA 4H6DA 4NF4A 2O68A 4IGRA 3S9LC 3C33A 3MVWA 2H25A 4GWXA 3ONMA 3C36A 4Q5TA 2RKMA 4KFQA 4FJPA 5KCJB 2VP1A 2R8TA 4FECA 3H06B 3VXCA 3UORA 3HPIA 3U8QA 4NAPA 3KN3A 5A5LA 1Y4TA 5CMKA 4JWOA 1S9TA 3PUZE 2IEEA 4OZ9A 3TCHA 3USDA 5IZ3B 4F29A 2DE4A 4GBWA 5DYHA 5H8FB 3GXAA 4F1VA 3H6WA 1US5A 3W9WA 5FTIA 4GWYA 2PYYA 4I9DA 1AIVA 3PD8A 5DEXA 2UVGA 2B4MA 1FQDA 4MX6A 2NUVA 1MY1A 3FATA 4TOZA 4ZDMA 5EHSA 3ILTB 2GFEA 4MBPA 2CZHA 3OELA 4MAGA 4HE1A 4JXIA 3PMXA 4ELQA 2XXIA 3R26A 2OK2A 4H5FA 1URSA 3O28A 1L5TA 3DP8A 3MZBA 1Y9UA 2YPNA 4F1YA 2KLFA 2A5TA 2I6EA 3I3VA 3GBBA 4R9GA 3TDJA 5L9OA 1WODA 3ROJA 3DP6A 5ELVA 2GHBA 4R73A 1ZIUA 1JW4A 3TTKA 3E78A 4TQUQ 4H46A 3IORA 4I8CA 1MXUA 1YYZA 1NUYA 4DI3D 1FQCA 1NMUA 1AH5A 4F1UA 4LONB 3ZKKA 1H44A 3WAEA 4UA8A 4G77A 1UIVA 4I40A 3GYYA 4OQOA 3OOAA 3R7XA 1FBPA 1SQYA 3E3KA 4I62A 4EF2A 1NNFA 2QFLA 1A99A 2OWSA 3IO6A 5H8NA 2F97A 1YXIA 2XXKA 4PDDA 5FHMA 2QPQA 1RDXA 3T9HB 1IXGA 1AWBA 1XVYA 4XF5A 4PFYA 3EHTA 4X1DA 1USYH 4U22A 2F3DA 1TFAA 4N6KA 2XX7A 5ISUA 3S9NC 2P2AA 1EYIA 1UTHA 1PEBA 4PFTA 5I58A 1XC1A 1NUZA 3T96B 1MG1A 2ZZXA 4OVRA 1MPDA 3EQ1A 1MDQA 4MH5A 2DP8A 4R2FA 2XXHA 3B50A 5JTYA 1FJ9A 4NF6B 4PQJA 3K6VA 3CFLA 1B4HA 4YB7A 1FPKA 2F7BA 1ZMGA 2QS1A 1DPPA 4OHNA 3S4UA 2VD2A 1LFHA 2HEUA 4WEPA 4AS5A 4GVOA 5CC2A 4OWDA 1POY1 2ZZVA 2XX9A 4IO4A 3TAJA 4NN3A 1HSLA 3KC1A 4OENA 3C35A 1NV4A 4QFKA 2HHMA 4GD5A 5EQ7A 4YAHX 1SYHA 4YU0A 2W7YA 2Y5LA 3QIMA 4XKQA 1AL3A 1H43A 3C4MA 4IO6A 3FXQA 1A54A 2R6GE 1NNTA 5DVJA 4O3CA 3C31A 4NF4B 4IY5A 3IOTA 2XXPA 2Y7IA 1JEVA 2Y7WA 2ONSA 1D9YA 4YZZA 3G3IA 4GXAA 4LUBA 2DWIA 4O7MA 2Z8FA 5H8QA 4G68C 1JP4A 1INPA 1IZ1A 3IFAA 4PFIA 3UK4A 4GX6A 2UVIA 1LAXA 3CHGA 1NKXA 4FATA 5FHNA 4MLQA 4X8RA 1URGA 3CSGA 4ECFA 3TTRA 4KYSA 4GRKA 4NX1A 2FBPA 1MY3A 4C1TA 3N6UA 4UABA 5I2NB 5IGAA 3KN8A 3E4RA 4GOTA 3VV5A 2F7AA 2XXVA 1IMAA 2HQ0A 4L17A 4KI0E 5DEXB 3M3KA 1NI9A 2WYKA 3C34A 2QVUA 3M3FA 1QKBA 3DELB 2G29A 4PGNA 3TUSA 1B51A 3SKPA 5EYHA 3EHUA 3F11A 3FVNA 1SDXA 1FPIA 3RNNA 1B3EA 2XXQA 3K6WA 3KOTA 3VVEA 1D3KA 3FIRA 3T9XB 4GWWA 1IITA 1G0HA 5ICTA 2A5TB 3A09A 1BTJA 2OBGA 4HCYA 2ZYMA 3VLUA 1H45A 5ET6A 4U1OA 3OEKA 2Q8JA 3UIFA 2QS4A 1FTMA 4GWZA 1JEUA 5AA1A 4P47A 3QAXA 4KCDA 1SW4A 2WEFA 2PBWA 2I3VA 5DTBA 1POTA 3B7DA 3N5LA 4LZ7A 4NWDA 1B1XA 1JQFA 3PPPA 5I5PA 3KBZA 5HM4B 4ZEBA 3UA8A 4F39A 1A8EA 3EHSA 5CBRA 1LBCA 1DTZA 5H8NB 1P99A 4GX4A 3JYRA 3FASA 4PCDA 4LATA 5DVFA 3O6GA 1NV6A 3MUQA 1OMPA 2H5YA 3BIGA 1LBZA 1OQHA 2Q2AA 3RT8A 4DCYA 1R1NA 2QMXA 3H6VA 4N07A 5FTHA 3TTMA 5H8SA 1NUXA 4GF8A 3MVZA 1EU8A 2QVRA 1UTHB 5I58B 3THIA 2ONKE 2XD2A 4PTKA 1ELJA 5CMBA 1MQGA 4BDLA 3RPLA 1LBWA 2P0SA 4YB6A 2HPGA 1USYE 5JTYB 5F1QA 1QULA 2UVJA 4PAIA 4OMBA 2O7UA 3FJGA 3OXNA 3FV1A 2WYPA 2DWAA 4OVPA 4NWCA 4LP2B 2HXRA 2ABHA 3RTFB 1B5IA 1S50A 4N8YA 3KSJA 2ZYOA 4HTGA 1OQGA 2OJTA 3OO6A 1Y3NA 3OEMA 2ZNUA 2D3IA 4BDRA 1K9YA 3MQ9A 2F5XA 2THIA 3RTWB 4JWXA 1LBXA 3KJTA 3O6HA 3GBAA 4ZS9A 4PBQA 3HCQA 3PD9A 4MMPA 3T0JA 4X04A 1PBQA 4KQPA 1FW0A 1CB6A 2DWHA 4P1LA 3T1BA 4G8NA 3IO4A 2KR0A 1MM7A 4N91A 4HXVA 5H8QB 5CBSA 1PB9A 3KSXA 4OEVA 2Y7PA 2DE3A 1B52A 3HHFA 2YJPA 2DXYA 1EZOA 1NH8A 4P9KA 1FRPA 1MY0A 1SD3A 2FIEA 4X48A 1EYJA 3RQTA 1UTBA 3K2DA 5ITPA 3U93A 3PPNA 2AL4A 1SYIA 3QYTA 4C1UA 2Q89A 1FTKA 1D4NA 4OESA 2V3UA 2HZKA 3DLNA 2I48A 1NH7A 4MFIA 3S9EA 1FPFA 3K02A 3PPOA 2WBBA 1LCFA 4QXDA 1FPJA 4NF5A 2ZXTA 4QFOA 4DIGA 3K6XA 3SEUA 1JNFA 2F8DA 4HCWA 2I3WA 3N26A 2H4IA 3CG1A 1RDYA 2QRYA 3D4CA 4P3LA 1FBFA 4G68A 5TPAB 1IMFA 1TT1A 2ZYKA 5EYGA 3QXMA 4OANA 5ET5A 2DWJA 4R2BA 3TYHA 3K00A 1DSNA 5IZZA 4EXLA 5F7VA 1O7TA 2O1MA 3T9VA 3SEXA 1CE2A 4U4SA 4DE8A 2V3TA 4RJZA 2Q2CA 2VHAA 4POWA 2P3NA 3H03A 1G0IA 4BDNA 3MPKA 1JVYA 1NV1A 5AA2A 4KHZE 3I6VA 3PMWA 3KFMA 4FAJA 5DW8A 1YZ0A 1B0LA 4G8MA 4PFBA 2Q88A 3VVDA 1B40A 1VR5A 3TZAA 4H8JA 4ZZAA 5EQAA 1JW1A 3HN0A 4G8HA 2E0SA 2FIXA 2RINA 4P0IA 4OFLA 2UYEA 2OX3A 3P7IA 1YTVA 3KEIA 4LZ8A 1FJ6A 2F3BA 4GXSB 1R6ZA 3R6UA 4Z7EA 1R9LA 4JVIA 1FBGA 4LN5A 2AYSA 4BLAA 3FZVA 5B70A 3MWBA 1SBPA 1QKAA 3K01A 4QHQA 2I58A 2ZMBA 5L8DA 3QMFA 1RYOA 4PE3A 1H3DA 2MKZA 1K9ZA 4PC9A 2Y7KA 1BK4A 1I6BA 1O63A 3G3JA 3FGSA 2BJJX 3RPLB 1M5FA 4Q30B 2D5WA 3SERA 2DQVA 3RN8A 4OYVA 4WEDA 1N7WA 3U72A 5L9SA 3LR1A 1MY2A 3ODBA 4YB5A 1N04A 3OENA 1N76A 1QGXA 3W9VA 1B5JA 1SW2A 3MYUA 4P11A 3SEWA 1LBYA 1XT8A 1B1HA 2QL3A 3QSLA 4THIA 4KYDA 2RF1A 1EZ9A 2DXRA 1ATGA 1GR2A 4EDPA 4OFOA 5KDTA 4I3EA 1FBCA 2Y84A 3PPQA 4F3PA 2QVVA 3SZPA 2XWOA 2UYFA 4QRZA 2P1SA 3SETA 3M8UA 5J16A 3CRBA 2WX9A 1DTGA 2PMSA 3LSFB 1OVBA 3T9UA 4XXUA 1SI0A 5IKBA 4DXUA 3MSTA 3OSQA 4JSOA 1UTBB 5J1DA 4EQ7A 4UACA 4U1ZA 4O8MA 4R9FA 3SEVA 4YKPA 4MNCA 2HZLA 3CSBA 4NMYA 1M5BA 1MQJA 3O9PA 3ZKLA 3A3CA 2F34A 3VVFA 2Y5KA 1XOCA 4PGPA 4R6YA 4ELRA 4N81A 1PDAA 1FCKA 4G4PA 3MZ1A 1CNQA
chains in the Genus database with same CATH topology
3NOHA 4HE0A 3E79A 1NV3A 1FPEA 4PETA 2L5VA 4GWSA 4N4UA 4GX4A 1IMEA 3KC0A 4NG7A 4OVTA 4PCDA 1NV6A 5ET7A 4HE2A 4N6DA 3EKIA 3BIGA 1LBZA 5CM6A 1NV7A 2PFZA 4NHBA 2XWKA 4KXPA 4O94A 1NUXA 5I7IA 3FBPA 3D1RA 1KA1A 2QVRA 4GWXA 2XA5A 4QBAA 4PTKA 2R8TA 3RPLA 1LBWA 2HPGA 4N8GA 1NV0A 4NAPA 4PAIA 4MIJA 1XI6A 5A5LA 2WYPA 4OVPA 1IMBA 4PDHA 2PCRA 1IMCA 2HXRA 5IZ3B 2DE4A 4GBWA 2FVZA 4N8YA 4NGUA 4F1VA 3HFUA 5LTCA 3W9WA 1EYKA 4GWYA 1DCUA 4MHFA 1K9YA 2B4MA 2F5XA 4MX6A 2P3VA 1LBXA 4N15A 2CZHA 4GWUA 4MAGA 4PBQA 4HE1A 3RYDA 2XWVA 4MMPA 3T0JA 4X04A 2Q8MA 2V3QA 4P1LA 5IZ3A 4OVQA 3T1BA 1KA0A 4AS4A 1FSAA 2KR0A 4N91A 3ROJA 4HXVA 2DE3A 4P9KA 1FRPA 2FIEA 4X9TA 2JJKA 1EYJA 3E78A 2DDKA 4H46A 4XEQA 1KZ8A 1NUWA 1YYZA 1NUYA 4DI3D 4O7IA 2CEXA 2HZKA 4F1UA 2Q74A 2OWZA 1FPFA 4PAFA 2WBBA 4QXDA 1FPJA 3U65A 1FPDA 2VPNA 4JVCA 2WBDA 4I40A 5ET8A 2ZZWA 3GYYA 2KQZA 4HCWA 3BIHA 1FBPA 2QFLA 1RDYA 4P3LA 1FBFA 1YXIA 2XXKA 3FXBA 1IMFA 4MJOA 4PDDA 5EYGA 4PFRA 4OANA 5ET5A 4MCOA 5IZZA 2QPQA 1RDXA 1AWBA 2V4CA 4XF5A 2CZKA 2P3NA 1FTAA 2CEYA 2F3DA 1G0IA 4N6KA 1EYIA 1NV1A 3A29A 1NUZA 4MEVA 5DW8A 1YZ0A 2ZZXA 4OVRA 4PFBA 1FBHA 4MNPA 2DVZA 3B50A 1FJ9A 5F24A 5EQAA 1FPKA 4OA4A 4PF8A 2XWIA 2FIXA 4OVSA 1D9QA 4AS5A 4P1EA 4IR8A 2OX3A 1RDZA 4MNIA 2GQ1A 2ZZVA 4P8BA 5IM2A 1FJ6A 4NN3A 2F3BA 1Q9DA 3KC1A 1NV4A 2HHMA 4JVIA 1NV2A 5EQ7A 2VT5A 2Y5LA 5JK4A 1FBGA 4LN5A 4NQ8A 5I3SA 4NF0A 1FBEA 4M1VA 2PFYA 3IFCA 1LBVA 5EQ8A 3QMFA 4PE3A 5ESYA 2MKZA 1K9ZA 4PC9A 2VPOA 1BK4A 4YZZA 4FBPA 4O7MA 1FPGA 3RPLB 1SPIA 1JP4A 1INPA 5EQ9A 3IFAA 4PFIA 5T3JA 4GX6A 3B8BA 3CHGA 4JVDA 1NV5A 4N17A 4GBVA 4PAKA 1DBZA 4X8RA 1DK4A 4PF6A 4XFEA 4PBHA 3LV0A 4H45A 4NX1A 2FBPA 3PTYA 4G61A 1QGXA 3W9VA 4UABA 2B4LA 5IGAA 3MYUA 4F18A 1LBYA 1IMAA 2CZIA 1LEVA 1NI9A 2WYKA 2QVUA 4PGNA 4GX3A 3ISPA 1FPLA 5EYHA 1FPIA 4I3EA 1FBCA 1VDWA 2QVVA 4GWWA 3SZPA 1G0HA 2XWOA 5IZ1A 5FBPA 4HCYA 4F19A 5J16A 2WX9A 1FBDA 5ET6A 3MSTA 5LDZA 2Q9TA 5J1DA 4YICA 4GWZA 4O8MA 4MNCA 4P47A 2HZLA 4P56A 4I3YA 2WEFA 2Y5KA 2BJIA 4PGPA 4N81A 1IMDA 4DI4B 2DE2A 1FPBA 5I5PA 2FHYA 3KBZA 3LUZA 1CNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N17 A;  4PBQ A;  2XWV A;  4PAK A;  4X8R A;  4MEV A;  4MMP A;  4PET A;  4X04 A;  2ZZX A;  4OVR A;  4N4U A;  4PF6 A;  4PFB A;  4XFE A;  4PBH A;  4P1L A;  4OVQ A;  4MNP A;  4NX1 A;  4NG7 A;  4OVT A;  4PCD A;  3B50 A;  4N6D A;  4UAB A;  5IGA A;  4N91 A;  5CM6 A;  4OA4 A;  4PF8 A;  2XWI A;  2PFZ A;  4NHB A;  2XWK A;  4P9K A;  4OVS A;  4O94 A;  5I7I A;  4P1E A;  2WYK A;  4MNI A;  4PGN A;  2ZZV A;  4P8B A;  4XEQ A;  5IM2 A;  4DI3 D;  4NN3 A;  2XA5 A;  2CEX A;  2HZK A;  4PAF A;  2HPG A;  3U65 A;  2VPN A;  4N8G A;  2XWO A;  4LN5 A;  4NQ8 A;  4NAP A;  4PAI A;  2ZZW A;  3GYY A;  2WX9 A;  4NF0 A;  4MIJ A;  2PFY A;  2WYP A;  4OVP A;  4P3L A;  4PDH A;  2XXK A;  3FXB A;  4YIC A;  4PDD A;  4PE3 A;  4PFR A;  4O8M A;  4OAN A;  4MNC A;  4P47 A;  4MCO A;  4N8Y A;  2HZL A;  4NGU A;  5IZZ A;  4PC9 A;  2VPO A;  4P56 A;  4YZZ A;  5LTC A;  4O7M A;  2V4C A;  4XF5 A;  4MHF A;  4PGP A;  4PFI A;  4DI4 B;  4MX6 A;  5I5P A;  2CEY A;  4N15 A;  4N6K A;  4MAG A; 
#chains in the Genus database with same CATH topology
 4XKR A;  4HE0 A;  3MAM A;  1NV3 A;  1FPE A;  1IXI A;  4GWS A;  2OWT A;  4G68 B;  4LZ5 A;  2CZL A;  3QUF A;  3CVG A;  2REG A;  3CI8 A;  3JZJ A;  1MY4 A;  4HE2 A;  4GL0 A;  4N6D A;  3FVO A;  2O7I A;  3MBP A;  4AQ4 A;  1FQA A;  5AA4 A;  2ANJ A;  2PFZ A;  1AOV A;  4NHB A;  4LQ5 A;  1UIU A;  3G3H A;  3K6U A;  3KZG A;  2LAO A;  4O94 A;  4XTC Q;  1B3L A;  1QUI A;  2O6A A;  1KA1 A;  1MXV A;  3KGC A;  5AA2 B;  1MS7 A;  2XA5 A;  4OVJ A;  1B0H A;  1MQH A;  2B3F A;  3KN7 A;  3B6T A;  4DXB A;  3Q27 A;  1OLC A;  3O2A A;  1Q1K A;  3CIJ A;  1YAE A;  3PUW E;  5I57 A;  3RUM A;  2QSX A;  2NXO A;  4R6H A;  2G93 A;  5EHM A;  3RLF E;  1XHY A;  4RYA A;  4BDQ A;  4HW8 A;  2I49 A;  1IMC A;  5TP9 A;  3EF7 A;  3H6T A;  3O29 A;  1RKM A;  2FVZ A;  4AB5 A;  4F3S A;  1OIB A;  3U92 A;  3HFU A;  3LUY A;  1GV8 A;  1MRP A;  5KCJ A;  1B5H A;  4ESW A;  1M5E A;  4MHF A;  4ZEK A;  4DXC A;  4EF1 A;  3PGF A;  5TU0 A;  1PC3 A;  4DZ1 A;  1MXZ A;  2FYI A;  3VXB A;  5DVI A;  4IO2 A;  4F31 B;  3K1M A;  1LFI A;  1LBB A;  3JV9 A;  4LQ2 A;  3RGY A;  3UN6 A;  4BDO A;  4R75 A;  2QMW A;  3MJN A;  2Q8M A;  5IZ3 A;  1KA0 A;  2A5S A;  3S9M C;  2DVC A;  1N7X A;  1NL5 A;  4H5G A;  4RNS A;  1N3W A;  2I0C A;  3EPE A;  4DCX A;  4NF8 A;  4H1X A;  1MXW A;  2IA4 A;  3CFX A;  4OEU A;  4ELP A;  1B46 A;  1SVX B;  4WKM A;  4H0W A;  4QSC A;  4R74 A;  2I0B A;  4XEQ A;  3KJ7 A;  3BKI B;  1NUW A;  1WDN A;  2CEX A;  4KD5 A;  4ZE9 A;  1O64 A;  1FQF A;  3K1P A;  2I4C A;  3MP6 A;  2Q74 A;  1B7H A;  3T93 B;  2H98 A;  3UGW A;  2DS9 A;  3PPR A;  3U65 A;  1FPD A;  2VPN A;  3IOW A;  4JVC A;  2WBD A;  3MP1 A;  5ET8 A;  5A5X A;  2ZZW A;  1B32 A;  4ND9 A;  2NVU B;  3TKD A;  3QUJ A;  4IB2 A;  3IOU A;  5K2Y A;  3M3L A;  2RC8 A;  2GRV A;  3FXB A;  2UXA A;  3QK6 A;  4MJO A;  4RPN A;  1N0T A;  3Q25 A;  5KDT B;  3IB1 A;  2XXX A;  4OFJ A;  5HPQ A;  2CZK A;  5IAI A;  2RCB A;  3C9H A;  3HO7 A;  2PT1 A;  3L6G A;  3DM0 A;  2F35 A;  3ZSF A;  3CR9 A;  2PX1 A;  4MEV A;  2ZNT A;  4OTE A;  2X26 A;  3IR1 A;  4E0W A;  4F22 A;  4POX A;  4MNP A;  3FJ7 A;  3TOD A;  3TEL A;  1JW5 A;  2F6P A;  1BLF A;  3V83 A;  4IO5 A;  4H8I A;  3W15 C;  4ONY A;  4JWY A;  3V89 B;  2XWI A;  2Y7R A;  4OET A;  1I6A A;  3N6T A;  3FV2 A;  5I59 A;  1VE4 A;  4IR8 A;  3FJM A;  4MNI A;  2GQ1 A;  1OLA A;  3H3G A;  4KPT A;  1Y3P A;  3S2V A;  1OVT A;  3V8X B;  1Q9D A;  1Q35 A;  4NE4 A;  2HAU A;  4RXL A;  3O97 A;  2VT5 A;  4TLL B;  1ANF A;  4Z0I A;  4NQ8 A;  4R6K A;  5CMC A;  2F6G A;  5AA4 B;  3Q28 A;  1FBE A;  3K4U A;  4M1V A;  3MZ9 A;  4IY6 A;  4F2Q A;  3IFC A;  1LBV A;  3L6H A;  3LBS A;  2XXR A;  1VFD A;  3IJX B;  1HSE A;  1VFE A;  2VPO A;  3PU5 A;  4FBP A;  1Y20 A;  1LGB C;  1SI1 A;  3Q29 A;  1LAH E;  1LAF E;  1SPI A;  5EQ9 A;  1D9V A;  4OXV A;  4QF9 A;  2Z22 A;  3KBR A;  3IX1 A;  4ELO A;  5I57 B;  3B8B A;  5H8H A;  4JVD A;  1NV5 A;  4IGT A;  3OSR A;  3O6I A;  4N17 A;  3FVK A;  4GBV A;  1MPC A;  4PAK A;  2NWJ A;  1LLS A;  3MC2 A;  3D4G A;  1N84 A;  5TP9 B;  3V5A A;  2GHA A;  4R72 A;  1B2H A;  1B05 A;  3PTY A;  1JET A;  2DYX A;  2B4L A;  3C32 A;  3HST A;  4F18 A;  3FVG A;  4K3F A;  1I6Q A;  4M4G A;  2CMO A;  3G3G A;  1LEV A;  3BBR A;  3CG3 A;  1B4Z A;  3ISP A;  5BUU A;  3N94 A;  4ZE8 A;  4GIZ A;  3BFU A;  1FPL A;  4U21 A;  4GLI A;  3TCF A;  4RK9 A;  3HHG A;  4EUO A;  1VDW A;  1Z7M E;  2O84 X;  2O1L A;  5EYF A;  1DMB A;  4ZEC A;  5IZ1 A;  1ZBM A;  5I2N A;  1ZKB A;  1NFT A;  3LSX A;  2V93 A;  2X7Q A;  1T0K A;  4NF8 B;  1IXC A;  1LAG E;  3B6W A;  1FBD A;  3MP8 A;  3T22 A;  3KG2 A;  2Q9T A;  3GLB A;  4KR5 A;  4YIC A;  5DT6 A;  3ZS6 A;  1LB9 A;  1MDP 1;  1FTL A;  4P56 A;  4I3Y A;  4BDM A;  1VSO A;  1BIY A;  4GQO A;  1FTJ A;  4AB6 A;  4DI4 B;  2DE2 A;  1FPB A;  2FHY A;  1A8F A;  5A5X B;  1P1O A;  1HSJ A;  3ILU B;  4U4X A;  3E79 A;  4JDF A;  3U1O A;  3OMB A;  2L5V A;  3MVX A;  4MF3 A;  1B7Z A;  4QFL A;  4N4U A;  4NED A;  4QSE A;  2ZYN A;  3KC0 A;  4G2Z A;  4H65 A;  3T66 A;  4NG7 A;  1ZTY A;  4FOR A;  2ESN A;  1A55 A;  2R71 A;  4FIM A;  3VFJ A;  5KZT A;  1AMF A;  3PUX E;  3U94 A;  3VE1 B;  1LCT A;  1YCJ A;  1FQE A;  3VLV A;  2O51 A;  1SW1 A;  1MPB A;  3PV0 E;  1MQD A;  2XWK A;  2RC9 A;  3FBP A;  3IJO B;  1KWH A;  4EQ9 A;  2DOJ A;  3OD7 A;  4IO7 A;  2H99 A;  1BKA A;  3RT6 B;  4QBA A;  2AL5 A;  4YMA A;  4ZEI A;  3G3F A;  4O3B A;  3OO9 A;  5AA2 D;  2XXW A;  4FEB A;  1IEJ A;  4N8G A;  1NV0 A;  1QVS A;  3IAZ A;  2D21 A;  1FQB A;  4YKJ A;  1R9Q A;  5CRY A;  2PT2 A;  4MIJ A;  4F2O A;  1XI6 A;  3OO8 A;  2VD3 A;  5I59 B;  3K1N A;  3FXU A;  3TMG A;  3OO7 A;  1B3G A;  1IMB A;  4PDH A;  3VDF A;  2PCR A;  1QW0 A;  3I5O A;  4QFN A;  2HFB A;  3O66 A;  4NGU A;  1A7L A;  5AA3 A;  5LTC A;  4JB7 A;  1EYK A;  3H7M A;  1DCU A;  1II5 A;  1H76 A;  3FD3 A;  3EN3 A;  1MXX A;  2P3V A;  4N15 A;  5LOM A;  2XXT A;  4GWU A;  5BWJ A;  5I2K A;  3E9X A;  2VGQ A;  5ITO A;  3RYD A;  2XWV A;  2V3Q A;  1GVC A;  3KOS A;  1MH4 A;  4TLM B;  4OVQ A;  2RC7 A;  2HAV A;  4FED A;  4ZED A;  4AS4 A;  4NF5 B;  1FSA A;  4JSD A;  3SES A;  1B3H A;  1QUJ A;  5FHO A;  4LA9 A;  1ZLQ A;  1A40 A;  1B58 A;  4X9T A;  2JJK A;  3SEY A;  1QJM A;  5H8H B;  2DDK A;  1PBP A;  2R9J A;  1KZ8 A;  4YKK A;  3TEP A;  4O7I A;  3TFL A;  1DPE A;  2ONR A;  2OWZ A;  4PAF A;  1B7U A;  4IO3 A;  5I56 A;  1QUK A;  3TCG A;  4H67 A;  4U23 A;  2Z23 A;  3VLW A;  2OZZ A;  3FUZ A;  4WXJ A;  3G3K A;  1Y4C A;  2X7P A;  3B6Q A;  4RPO A;  3GZG A;  2KQZ A;  3BIH A;  3H4Z A;  3PUV E;  3TTN A;  4MLV A;  3TQL A;  3PMV A;  2AIX A;  4PFR A;  1GTK A;  4ZZE A;  4MCO A;  3IL1 B;  3RY3 A;  4PFW A;  1MH3 A;  4C0R A;  2QS3 A;  1URD A;  2V4C A;  2V84 A;  1DOT A;  1FTA A;  1Z7N E;  2RCA A;  2CEY A;  1Y1M A;  3A29 A;  4DLD A;  2REJ A;  1EZP A;  2B65 A;  4U2R A;  5TPA A;  4GFR A;  1FBH A;  4KYE A;  2DVZ A;  2H9B A;  4PE5 B;  2XX8 A;  3G7W A;  5F24 A;  3IB2 A;  5CMM A;  2NOO A;  4OA4 A;  4PF8 A;  2Z8D A;  2HXW A;  4GL8 A;  2YLN A;  3A3U A;  3IB0 A;  2XHD A;  4EQB A;  4F3G A;  4OVS A;  1Y3Q A;  1D9Q A;  4ISU A;  4P1E A;  4P0G A;  1RDZ A;  4F3B A;  4JBZ A;  4P8B A;  5IM2 A;  1BP5 A;  2F36 A;  5H8F A;  3AXF A;  1ZU0 A;  3MW0 A;  5L9M A;  4X1B A;  4E0X A;  2HCA A;  1NV2 A;  5JK4 A;  4LVQ A;  1SW5 A;  4OER A;  5I3S A;  2QJE A;  4NF0 A;  1LFG A;  2FA7 A;  1F9B A;  2PVU A;  2PFY A;  2B3B A;  1XVX A;  3IK6 B;  2I4B A;  2XD3 A;  1IQ7 A;  1XS5 A;  5EQ8 A;  4KCC A;  4O3A A;  1M5D A;  5ESY A;  1PB8 A;  4RA1 A;  2XXY A;  1NNP A;  5B7D A;  1FPG A;  3TPA A;  4RY1 A;  5T3J A;  2VOZ A;  2E1S A;  1IXH A;  4Q8R A;  2ZNS A;  4QFP A;  2F78 A;  5JEI A;  2UVH A;  2O69 A;  3H6U A;  1P1Q A;  3LSL A;  1DBZ A;  3TQW A;  3MVY A;  1DK4 A;  4PF6 A;  4XFE A;  4PBH A;  1J1N A;  3LV0 A;  4H45 A;  3WAF A;  3UP9 A;  1WVJ A;  4G61 A;  3Q26 A;  4XIG Q;  1N3X A;  2FNC A;  1M5C A;  3LSW A;  4N6P A;  4RK2 A;  1B6H A;  1P1U A;  2CZI A;  4PFU A;  2ALU A;  3PUY E;  4GX3 A;  2OCU A;  3K0V A;  5I2K B;  1MQI A;  5M2V A;  3E13 X;  3RPW A;  4Q0C A;  5ICQ A;  1PB7 A;  5K2X A;  4EXK A;  4QSD A;  5AE4 A;  5FBP A;  3SDF A;  2OLB A;  3DP4 A;  2Z8E A;  4F19 A;  2V25 A;  5CI5 A;  2DSF A;  2XXU A;  1IUD A;  4N13 A;  3LC8 A;  3TTL A;  4NTL A;  1B3F A;  3ECR A;  5LDZ A;  4HS7 A;  1YPN A;  5I84 A;  3MPL A;  1MXY A;  1JVX A;  1UQW A;  4NF6 A;  2GH9 A;  1NNK A;  2QS2 A;  1Y1Z A;  4FE8 A;  1S7Y A;  4YMB A;  1TWY A;  3BFT A;  1TFD A;  5I56 B;  2BJI A;  1TXF A;  4I1D A;  1IMD A;  4YKI A;  3CFZ A;  1EH3 A;  1FTO A;  3LUZ A;  4GWO A;  3NOH A;  4ESX A;  1I69 A;  4PET A;  1ZJL A;  4PP0 A;  1P1W A;  4XKP A;  1IME A;  4ZEF A;  1GGG A;  4OVT A;  4DDD A;  1P1N A;  5ET7 A;  5HBC A;  1US4 A;  1LST A;  3EKI A;  3IOV A;  5CM6 A;  1NV7 A;  3HV1 A;  2WKY A;  4KXP A;  1B9J A;  2F7C A;  2M8C A;  5I7I A;  1MM6 A;  1LB8 A;  1IIW A;  3D1R A;  1RYX A;  4XKN A;  3FXR A;  4H6D A;  4NF4 A;  2O68 A;  4IGR A;  3S9L C;  3C33 A;  3MVW A;  2H25 A;  4GWX A;  3ONM A;  3C36 A;  4Q5T A;  2RKM A;  4KFQ A;  4FJP A;  5KCJ B;  2VP1 A;  2R8T A;  4FEC A;  3H06 B;  3VXC A;  3UOR A;  3HPI A;  3U8Q A;  4NAP A;  3KN3 A;  5A5L A;  1Y4T A;  5CMK A;  4JWO A;  1S9T A;  3PUZ E;  2IEE A;  4OZ9 A;  3TCH A;  3USD A;  5IZ3 B;  4F29 A;  2DE4 A;  4GBW A;  5DYH A;  5H8F B;  3GXA A;  4F1V A;  3H6W A;  1US5 A;  3W9W A;  5FTI A;  4GWY A;  2PYY A;  4I9D A;  1AIV A;  3PD8 A;  5DEX A;  2UVG A;  2B4M A;  1FQD A;  4MX6 A;  2NUV A;  1MY1 A;  3FAT A;  4TOZ A;  4ZDM A;  5EHS A;  3ILT B;  2GFE A;  4MBP A;  2CZH A;  3OEL A;  4MAG A;  4HE1 A;  4JXI A;  3PMX A;  4ELQ A;  2XXI A;  3R26 A;  2OK2 A;  4H5F A;  1URS A;  3O28 A;  1L5T A;  3DP8 A;  3MZB A;  1Y9U A;  2YPN A;  4F1Y A;  2KLF A;  2A5T A;  2I6E A;  3I3V A;  3GBB A;  4R9G A;  3TDJ A;  5L9O A;  1WOD A;  3ROJ A;  3DP6 A;  5ELV A;  2GHB A;  4R73 A;  1ZIU A;  1JW4 A;  3TTK A;  3E78 A;  4TQU Q;  4H46 A;  3IOR A;  4I8C A;  1MXU A;  1YYZ A;  1NUY A;  4DI3 D;  1FQC A;  1NMU A;  1AH5 A;  4F1U A;  4LON B;  3ZKK A;  1H44 A;  3WAE A;  4UA8 A;  4G77 A;  1UIV A;  4I40 A;  3GYY A;  4OQO A;  3OOA A;  3R7X A;  1FBP A;  1SQY A;  3E3K A;  4I62 A;  4EF2 A;  1NNF A;  2QFL A;  1A99 A;  2OWS A;  3IO6 A;  5H8N A;  2F97 A;  1YXI A;  2XXK A;  4PDD A;  5FHM A;  2QPQ A;  1RDX A;  3T9H B;  1IXG A;  1AWB A;  1XVY A;  4XF5 A;  4PFY A;  3EHT A;  4X1D A;  1USY H;  4U22 A;  2F3D A;  1TFA A;  4N6K A;  2XX7 A;  5ISU A;  3S9N C;  2P2A A;  1EYI A;  1UTH A;  1PEB A;  4PFT A;  5I58 A;  1XC1 A;  1NUZ A;  3T96 B;  1MG1 A;  2ZZX A;  4OVR A;  1MPD A;  3EQ1 A;  1MDQ A;  4MH5 A;  2DP8 A;  4R2F A;  2XXH A;  3B50 A;  5JTY A;  1FJ9 A;  4NF6 B;  4PQJ A;  3K6V A;  3CFL A;  1B4H A;  4YB7 A;  1FPK A;  2F7B A;  1ZMG A;  2QS1 A;  1DPP A;  4OHN A;  3S4U A;  2VD2 A;  1LFH A;  2HEU A;  4WEP A;  4AS5 A;  4GVO A;  5CC2 A;  4OWD A;  1POY 1;  2ZZV A;  2XX9 A;  4IO4 A;  3TAJ A;  4NN3 A;  1HSL A;  3KC1 A;  4OEN A;  3C35 A;  1NV4 A;  4QFK A;  2HHM A;  4GD5 A;  5EQ7 A;  4YAH X;  1SYH A;  4YU0 A;  2W7Y A;  2Y5L A;  3QIM A;  4XKQ A;  1AL3 A;  1H43 A;  3C4M A;  4IO6 A;  3FXQ A;  1A54 A;  2R6G E;  1NNT A;  5DVJ A;  4O3C A;  3C31 A;  4NF4 B;  4IY5 A;  3IOT A;  2XXP A;  2Y7I A;  1JEV A;  2Y7W A;  2ONS A;  1D9Y A;  4YZZ A;  3G3I A;  4GXA A;  4LUB A;  2DWI A;  4O7M A;  2Z8F A;  5H8Q A;  4G68 C;  1JP4 A;  1INP A;  1IZ1 A;  3IFA A;  4PFI A;  3UK4 A;  4GX6 A;  2UVI A;  1LAX A;  3CHG A;  1NKX A;  4FAT A;  5FHN A;  4MLQ A;  4X8R A;  1URG A;  3CSG A;  4ECF A;  3TTR A;  4KYS A;  4GRK A;  4NX1 A;  2FBP A;  1MY3 A;  4C1T A;  3N6U A;  4UAB A;  5I2N B;  5IGA A;  3KN8 A;  3E4R A;  4GOT A;  3VV5 A;  2F7A A;  2XXV A;  1IMA A;  2HQ0 A;  4L17 A;  4KI0 E;  5DEX B;  3M3K A;  1NI9 A;  2WYK A;  3C34 A;  2QVU A;  3M3F A;  1QKB A;  3DEL B;  2G29 A;  4PGN A;  3TUS A;  1B51 A;  3SKP A;  5EYH A;  3EHU A;  3F11 A;  3FVN A;  1SDX A;  1FPI A;  3RNN A;  1B3E A;  2XXQ A;  3K6W A;  3KOT A;  3VVE A;  1D3K A;  3FIR A;  3T9X B;  4GWW A;  1IIT A;  1G0H A;  5ICT A;  2A5T B;  3A09 A;  1BTJ A;  2OBG A;  4HCY A;  2ZYM A;  3VLU A;  1H45 A;  5ET6 A;  4U1O A;  3OEK A;  2Q8J A;  3UIF A;  2QS4 A;  1FTM A;  4GWZ A;  1JEU A;  5AA1 A;  4P47 A;  3QAX A;  4KCD A;  1SW4 A;  2WEF A;  2PBW A;  2I3V A;  5DTB A;  1POT A;  3B7D A;  3N5L A;  4LZ7 A;  4NWD A;  1B1X A;  1JQF A;  3PPP A;  5I5P A;  3KBZ A;  5HM4 B;  4ZEB A;  3UA8 A;  4F39 A;  1A8E A;  3EHS A;  5CBR A;  1LBC A;  1DTZ A;  5H8N B;  1P99 A;  4GX4 A;  3JYR A;  3FAS A;  4PCD A;  4LAT A;  5DVF A;  3O6G A;  1NV6 A;  3MUQ A;  1OMP A;  2H5Y A;  3BIG A;  1LBZ A;  1OQH A;  2Q2A A;  3RT8 A;  4DCY A;  1R1N A;  2QMX A;  3H6V A;  4N07 A;  5FTH A;  3TTM A;  5H8S A;  1NUX A;  4GF8 A;  3MVZ A;  1EU8 A;  2QVR A;  1UTH B;  5I58 B;  3THI A;  2ONK E;  2XD2 A;  4PTK A;  1ELJ A;  5CMB A;  1MQG A;  4BDL A;  3RPL A;  1LBW A;  2P0S A;  4YB6 A;  2HPG A;  1USY E;  5JTY B;  5F1Q A;  1QUL A;  2UVJ A;  4PAI A;  4OMB A;  2O7U A;  3FJG A;  3OXN A;  3FV1 A;  2WYP A;  2DWA A;  4OVP A;  4NWC A;  4LP2 B;  2HXR A;  2ABH A;  3RTF B;  1B5I A;  1S50 A;  4N8Y A;  3KSJ A;  2ZYO A;  4HTG A;  1OQG A;  2OJT A;  3OO6 A;  1Y3N A;  3OEM A;  2ZNU A;  2D3I A;  4BDR A;  1K9Y A;  3MQ9 A;  2F5X A;  2THI A;  3RTW B;  4JWX A;  1LBX A;  3KJT A;  3O6H A;  3GBA A;  4ZS9 A;  4PBQ A;  3HCQ A;  3PD9 A;  4MMP A;  3T0J A;  4X04 A;  1PBQ A;  4KQP A;  1FW0 A;  1CB6 A;  2DWH A;  4P1L A;  3T1B A;  4G8N A;  3IO4 A;  2KR0 A;  1MM7 A;  4N91 A;  4HXV A;  5H8Q B;  5CBS A;  1PB9 A;  3KSX A;  4OEV A;  2Y7P A;  2DE3 A;  1B52 A;  3HHF A;  2YJP A;  2DXY A;  1EZO A;  1NH8 A;  4P9K A;  1FRP A;  1MY0 A;  1SD3 A;  2FIE A;  4X48 A;  1EYJ A;  3RQT A;  1UTB A;  3K2D A;  5ITP A;  3U93 A;  3PPN A;  2AL4 A;  1SYI A;  3QYT A;  4C1U A;  2Q89 A;  1FTK A;  1D4N A;  4OES A;  2V3U A;  2HZK A;  3DLN A;  2I48 A;  1NH7 A;  4MFI A;  3S9E A;  1FPF A;  3K02 A;  3PPO A;  2WBB A;  1LCF A;  4QXD A;  1FPJ A;  4NF5 A;  2ZXT A;  4QFO A;  4DIG A;  3K6X A;  3SEU A;  1JNF A;  2F8D A;  4HCW A;  2I3W A;  3N26 A;  2H4I A;  3CG1 A;  1RDY A;  2QRY A;  3D4C A;  4P3L A;  1FBF A;  4G68 A;  5TPA B;  1IMF A;  1TT1 A;  2ZYK A;  5EYG A;  3QXM A;  4OAN A;  5ET5 A;  2DWJ A;  4R2B A;  3TYH A;  3K00 A;  1DSN A;  5IZZ A;  4EXL A;  5F7V A;  1O7T A;  2O1M A;  3T9V A;  3SEX A;  1CE2 A;  4U4S A;  4DE8 A;  2V3T A;  4RJZ A;  2Q2C A;  2VHA A;  4POW A;  2P3N A;  3H03 A;  1G0I A;  4BDN A;  3MPK A;  1JVY A;  1NV1 A;  5AA2 A;  4KHZ E;  3I6V A;  3PMW A;  3KFM A;  4FAJ A;  5DW8 A;  1YZ0 A;  1B0L A;  4G8M A;  4PFB A;  2Q88 A;  3VVD A;  1B40 A;  1VR5 A;  3TZA A;  4H8J A;  4ZZA A;  5EQA A;  1JW1 A;  3HN0 A;  4G8H A;  2E0S A;  2FIX A;  2RIN A;  4P0I A;  4OFL A;  2UYE A;  2OX3 A;  3P7I A;  1YTV A;  3KEI A;  4LZ8 A;  1FJ6 A;  2F3B A;  4GXS B;  1R6Z A;  3R6U A;  4Z7E A;  1R9L A;  4JVI A;  1FBG A;  4LN5 A;  2AYS A;  4BLA A;  3FZV A;  5B70 A;  3MWB A;  1SBP A;  1QKA A;  3K01 A;  4QHQ A;  2I58 A;  2ZMB A;  5L8D A;  3QMF A;  1RYO A;  4PE3 A;  1H3D A;  2MKZ A;  1K9Z A;  4PC9 A;  2Y7K A;  1BK4 A;  1I6B A;  1O63 A;  3G3J A;  3FGS A;  2BJJ X;  3RPL B;  1M5F A;  4Q30 B;  2D5W A;  3SER A;  2DQV A;  3RN8 A;  4OYV A;  4WED A;  1N7W A;  3U72 A;  5L9S A;  3LR1 A;  1MY2 A;  3ODB A;  4YB5 A;  1N04 A;  3OEN A;  1N76 A;  1QGX A;  3W9V A;  1B5J A;  1SW2 A;  3MYU A;  4P11 A;  3SEW A;  1LBY A;  1XT8 A;  1B1H A;  2QL3 A;  3QSL A;  4THI A;  4KYD A;  2RF1 A;  1EZ9 A;  2DXR A;  1ATG A;  1GR2 A;  4EDP A;  4OFO A;  5KDT A;  4I3E A;  1FBC A;  2Y84 A;  3PPQ A;  4F3P A;  2QVV A;  3SZP A;  2XWO A;  2UYF A;  4QRZ A;  2P1S A;  3SET A;  3M8U A;  5J16 A;  3CRB A;  2WX9 A;  1DTG A;  2PMS A;  3LSF B;  1OVB A;  3T9U A;  4XXU A;  1SI0 A;  5IKB A;  4DXU A;  3MST A;  3OSQ A;  4JSO A;  1UTB B;  5J1D A;  4EQ7 A;  4UAC A;  4U1Z A;  4O8M A;  4R9F A;  3SEV A;  4YKP A;  4MNC A;  2HZL A;  3CSB A;  4NMY A;  1M5B A;  1MQJ A;  3O9P A;  3ZKL A;  3A3C A;  2F34 A;  3VVF A;  2Y5K A;  1XOC A;  4PGP A;  4R6Y A;  4ELR A;  4N81 A;  1PDA A;  1FCK A;  4G4P A;  3MZ1 A;  1CNQ A; 
#chains in the Genus database with same CATH homology
 3NOH A;  4HE0 A;  3E79 A;  1NV3 A;  1FPE A;  4PET A;  2L5V A;  4GWS A;  4N4U A;  4GX4 A;  1IME A;  3KC0 A;  4NG7 A;  4OVT A;  4PCD A;  1NV6 A;  5ET7 A;  4HE2 A;  4N6D A;  3EKI A;  3BIG A;  1LBZ A;  5CM6 A;  1NV7 A;  2PFZ A;  4NHB A;  2XWK A;  4KXP A;  4O94 A;  1NUX A;  5I7I A;  3FBP A;  3D1R A;  1KA1 A;  2QVR A;  4GWX A;  2XA5 A;  4QBA A;  4PTK A;  2R8T A;  3RPL A;  1LBW A;  2HPG A;  4N8G A;  1NV0 A;  4NAP A;  4PAI A;  4MIJ A;  1XI6 A;  5A5L A;  2WYP A;  4OVP A;  1IMB A;  4PDH A;  2PCR A;  1IMC A;  2HXR A;  5IZ3 B;  2DE4 A;  4GBW A;  2FVZ A;  4N8Y A;  4NGU A;  4F1V A;  3HFU A;  5LTC A;  3W9W A;  1EYK A;  4GWY A;  1DCU A;  4MHF A;  1K9Y A;  2B4M A;  2F5X A;  4MX6 A;  2P3V A;  1LBX A;  4N15 A;  2CZH A;  4GWU A;  4MAG A;  4PBQ A;  4HE1 A;  3RYD A;  2XWV A;  4MMP A;  3T0J A;  4X04 A;  2Q8M A;  2V3Q A;  4P1L A;  5IZ3 A;  4OVQ A;  3T1B A;  1KA0 A;  4AS4 A;  1FSA A;  2KR0 A;  4N91 A;  3ROJ A;  4HXV A;  2DE3 A;  4P9K A;  1FRP A;  2FIE A;  4X9T A;  2JJK A;  1EYJ A;  3E78 A;  2DDK A;  4H46 A;  4XEQ A;  1KZ8 A;  1NUW A;  1YYZ A;  1NUY A;  4DI3 D;  4O7I A;  2CEX A;  2HZK A;  4F1U A;  2Q74 A;  2OWZ A;  1FPF A;  4PAF A;  2WBB A;  4QXD A;  1FPJ A;  3U65 A;  1FPD A;  2VPN A;  4JVC A;  2WBD A;  4I40 A;  5ET8 A;  2ZZW A;  3GYY A;  2KQZ A;  4HCW A;  3BIH A;  1FBP A;  2QFL A;  1RDY A;  4P3L A;  1FBF A;  1YXI A;  2XXK A;  3FXB A;  1IMF A;  4MJO A;  4PDD A;  5EYG A;  4PFR A;  4OAN A;  5ET5 A;  4MCO A;  5IZZ A;  2QPQ A;  1RDX A;  1AWB A;  2V4C A;  4XF5 A;  2CZK A;  2P3N A;  1FTA A;  2CEY A;  2F3D A;  1G0I A;  4N6K A;  1EYI A;  1NV1 A;  3A29 A;  1NUZ A;  4MEV A;  5DW8 A;  1YZ0 A;  2ZZX A;  4OVR A;  4PFB A;  1FBH A;  4MNP A;  2DVZ A;  3B50 A;  1FJ9 A;  5F24 A;  5EQA A;  1FPK A;  4OA4 A;  4PF8 A;  2XWI A;  2FIX A;  4OVS A;  1D9Q A;  4AS5 A;  4P1E A;  4IR8 A;  2OX3 A;  1RDZ A;  4MNI A;  2GQ1 A;  2ZZV A;  4P8B A;  5IM2 A;  1FJ6 A;  4NN3 A;  2F3B A;  1Q9D A;  3KC1 A;  1NV4 A;  2HHM A;  4JVI A;  1NV2 A;  5EQ7 A;  2VT5 A;  2Y5L A;  5JK4 A;  1FBG A;  4LN5 A;  4NQ8 A;  5I3S A;  4NF0 A;  1FBE A;  4M1V A;  2PFY A;  3IFC A;  1LBV A;  5EQ8 A;  3QMF A;  4PE3 A;  5ESY A;  2MKZ A;  1K9Z A;  4PC9 A;  2VPO A;  1BK4 A;  4YZZ A;  4FBP A;  4O7M A;  1FPG A;  3RPL B;  1SPI A;  1JP4 A;  1INP A;  5EQ9 A;  3IFA A;  4PFI A;  5T3J A;  4GX6 A;  3B8B A;  3CHG A;  4JVD A;  1NV5 A;  4N17 A;  4GBV A;  4PAK A;  1DBZ A;  4X8R A;  1DK4 A;  4PF6 A;  4XFE A;  4PBH A;  3LV0 A;  4H45 A;  4NX1 A;  2FBP A;  3PTY A;  4G61 A;  1QGX A;  3W9V A;  4UAB A;  2B4L A;  5IGA A;  3MYU A;  4F18 A;  1LBY A;  1IMA A;  2CZI A;  1LEV A;  1NI9 A;  2WYK A;  2QVU A;  4PGN A;  4GX3 A;  3ISP A;  1FPL A;  5EYH A;  1FPI A;  4I3E A;  1FBC A;  1VDW A;  2QVV A;  4GWW A;  3SZP A;  1G0H A;  2XWO A;  5IZ1 A;  5FBP A;  4HCY A;  4F19 A;  5J16 A;  2WX9 A;  1FBD A;  5ET6 A;  3MST A;  5LDZ A;  2Q9T A;  5J1D A;  4YIC A;  4GWZ A;  4O8M A;  4MNC A;  4P47 A;  2HZL A;  4P56 A;  4I3Y A;  2WEF A;  2Y5K A;  2BJI A;  4PGP A;  4N81 A;  1IMD A;  4DI4 B;  2DE2 A;  1FPB A;  5I5P A;  2FHY A;  3KBZ A;  3LUZ A;  1CNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...