5IGAA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with co-purified parahydroxybenzoate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
b'SMEVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with co-purified parahydroxybenzoate
rcsb
source organism Uncultured bacterium
molecule tags Transport protein
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2016-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5igaA00
2CEYA 4MMPA 2VPNA 4PFIA 2WX9A 4MNPA 4N4UA 4UABA 4P8BA 4NQ8A 4O7MA 2V4CA 4N15A 5CM6A 4PFRA 4PAFA 4PCDA 4N8YA 4PBQA 2HPGA 2HZLA 4MNCA 4MCOA 4PFBA 4X04A 3GYYA 4NGUA 5I7IA 4PF6A 4N17A 4N8GA 4YICA 2PFZA 2XA5A 4P1EA 4P9KA 2XWKA 4PDDA 4N91A 4PAIA 4N6DA 4OVSA 2WYPA 4O8MA 4NAPA 4PF8A 4MEVA 4DI4B 4OVRA 5I5PA 4P3LA 5IGAA 4NHBA 3U65A 4X8RA 4MNIA 4P1LA 2WYKA 2VPOA 4N6KA 2CEXA 4O94A 5IM2A 4PDHA 4DI3D 2HZKA 4PGNA 2ZZVA 4MAGA 4OA4A 4YZZA 3B50A 4OVQA 4LN5A 4PE3A 4MIJA 2ZZXA 2XXKA 4OVPA 4XEQA 3FXBA 2PFYA 4NF0A 4PAKA 4PGPA 2ZZWA 4PC9A 4OVTA 4NG7A 2XWVA 4XFEA 4PBHA 5IZZA 2XWIA 5LTCA 4MX6A 4P47A 4P56A 4NX1A 4OANA 2XWOA 4XF5A 4PETA 4MHFA 4NN3A
chains in the Genus database with same CATH superfamily
1OVTA 3K1PA 4TLLB 4PE5B 2RF1A 2V3TA 3QK6A 1P1WA 3BFTA 5AA4A 2F7AA 1IUDA 3FATA 2HAUA 4O7MA 1ZIUA 4Q30B 4KXPA 3CG1A 2HPGA 4OFLA 4PFBA 3PUXE 2ZYNA 3EQ1A 1N3XA 4FECA 2P3VA 4N17A 4N8GA 3FXQA 2X26A 5CRYA 2PVUA 3PD9A 1OLCA 3G3JA 1MY4A 3A09A 4OQOA 3ECRA 4FEBA 4R73A 4OEVA 5DVFA 2KLFA 4LZ7A 5F7VA 5L9MA 5CMKA 3MC2A 3VE1B 4ZS9A 1QUKA 4MEVA 4HCWA 3PUVE 1XVXA 2Q74A 1OIBA 5A5XB 2NXOA 2AL5A 4I62A 3O6GA 4ZDMA 3OMBA 3ZKLA 2I48A 2XX7A 1UTBA 3SEYA 3VDFA 1K9ZA 2DQVA 4MAGA 1G0IA 1FBEA 1FTMA 3IR1A 4OVPA 3PGFA 1WDNA 4DZ1A 3VVEA 4QFPA 3RTWB 2ZNTA 3PUWE 2XXYA 3CFXA 2XD3A 3HSTA 1B52A 4FJPA 1GV8A 3O97A 4I3EA 4GVOA 3IO4A 4EQ7A 4WXJA 4X1BA 1IMDA 1MQGA 1B46A 4XKRA 1S9TA 5EQ7A 5ET8A 4U21A 1A40A 1I69A 2ZYOA 4N6PA 4GD5A 4YB6A 1NL5A 2VGQA 3CSBA 2O6AA 1B3HA 3MQ9A 3TELA 5I3SA 3K6XA 2XX9A 2QVUA 2W7YA 5A5XA 5H8QB 1QUJA 5IKBA 1RDZA 3E79A 5F24A 2O69A 1IXHA 4ZEDA 1HSJA 2B3BA 4IO2A 4R9FA 2XWKA 4TLMB 4F39A 2D21A 1LBXA 4BDMA 1P1OA 3MZ1A 3ZKKA 1SYHA 3MW0A 2WYPA 3RPWA 1B1XA 2UXAA 3LSXA 1NNKA 4H5FA 5J16A 4F2QA 3RYDA 3CSGA 5IGAA 2F6PA 2YLNA 1MH4A 3E4RA 3SEWA 2I3VA 4NF5B 1DBZA 1JW4A 4G2ZA 2HZKA 4OA4A 2QPQA 5LOMA 4IO5A 2VD2A 3UORA 1SVXB 5JEIA 4LONB 1Z7ME 5DTBA 1PB9A 3MBPA 1HSEA 4I3YA 3N94A 1TXFA 4GX4A 4MH5A 4IB2A 5H8NB 2ONKE 4YKJA 1NV6A 3FGSA 1A54A 3C9HA 2H99A 3Q28A 1ZJLA 3RGYA 1A99A 2Y7PA 4H45A 3T1BA 1RKMA 3ZSFA 1EH3A 1M5FA 3KC0A 4PFRA 4OVJA 3O2AA 4PFWA 1MPBA 2XXTA 4EF2A 3G3GA 4OERA 1FBCA 4QRZA 3VLUA 1D9VA 4GIZA 3HV1A 1M5BA 1XVYA 4U1OA 2RINA 1D9YA 3O9PA 1R6ZA 3MVZA 5I57B 4GL0A 4OXVA 2I3WA 1UTHA 2FBPA 5AA2B 1FBDA 1MRPA 2B3FA 3MPLA 1FRPA 3GBBA 1SW5A 1J1NA 2P2AA 2I4BA 4LA9A 3U92A 1IEJA 4YZZA 4U4SA 3BIGA 4LZ8A 4PE3A 1B1HA 1YZ0A 1US4A 4PFUA 5ET7A 4GX3A 4GWSA 1WVJA 2ZZWA 4ECFA 4BDQA 4C1TA 4F22A 4QBAA 1XOCA 4NG7A 5FBPA 1URDA 4G77A 3RLFE 1VFDA 1B58A 4YKPA 1B3LA 5JTYB 3SERA 4Q0CA 1UIVA 4OMBA 4GBWA 2NVUB 4PETA 4ZEKA 3T9UA 3PV0E 5DYHA 2V3UA 4KCCA 3ODBA 3KBRA 3D1RA 1FSAA 3T9XB 4ZE8A 2Q9TA 3QSLA 1L5TA 2ONRA 2I4CA 3BIHA 1IXIA 2AL4A 2H25A 1JW1A 4F1UA 1GR2A 2GHBA 3V89B 4GWZA 4P9KA 1US5A 4QF9A 5L8DA 4FORA 4YMAA 3FASA 3VXBA 3S2VA 3MVWA 1ELJA 4Q8RA 3S9MC 1NH7A 4E0WA 4ZZEA 5TP9A 1G0HA 1AH5A 3QIMA 4TQUQ 1I6AA 3H4ZA 3O6HA 1EYKA 5EYGA 3IJXB 3KJTA 1N3WA 1FQBA 3W9WA 4IGRA 3IB0A 4XKPA 3SKPA 2THIA 3OO7A 2F7CA 1SD3A 4WKMA 4N07A 3D4CA 4U4XA 3PU5A 4OFOA 1PC3A 2XXXA 3TEPA 4AB5A 3U93A 3QAXA 4PC9A 4OVTA 2PT1A 1BK4A 3ONMA 4FATA 5H8HA 3IB1A 4XF5A 1YAEA 1B40A 2XXUA 2HEUA 4IO6A 3EHUA 3UIFA 5HBCA 3S9LC 3T9VA 1FTAA 2DP8A 3RQTA 4H8JA 5KDTA 4NWDA 1N7WA 2QJEA 3C36A 4JB7A 2Z23A 1DK4A 2Y5KA 4H65A 1NUZA 1NV7A 4MCOA 3ILTB 5J1DA 4C0RA 3LBSA 4PF6A 4NWCA 4RYAA 1YPNA 3TTLA 1FQFA 1JEUA 1LFHA 4PDDA 1FPDA 1TT1A 3I5OA 3T93B 1SI0A 4O3CA 2O7UA 2Q88A 2B4MA 1N84A 3THIA 3Q29A 1LAGE 4LP2B 1EYJA 1Q35A 2GFEA 3H7MA 4DIGA 5A5LA 3TKDA 4NF8A 1EZ9A 3M8UA 3OEKA 4H46A 4R6KA 1B5HA 5AA4B 4OEUA 3TPAA 1A7LA 4OETA 2Z8FA 4KHZE 3C32A 1NV2A 5IZ3A 3FV2A 2XXKA 2Q2AA 2D5WA 3PUYE 1NV3A 3SEUA 2Q8MA 3IX1A 4PAKA 2QVVA 2DVZA 3OOAA 3E78A 3KBZA 5EQAA 1Y3QA 2GH9A 4JVIA 4OYVA 2DWJA 1MY2A 4OANA 3OEMA 2XWOA 4FAJA 2Q89A 3EHSA 5M2VA 1MDQA 4DLDA 4N15A 5CI5A 5DEXA 1ZBMA 4RY1A 3JZJA 4I40A 1VE4A 4N8YA 4M4GA 5DVJA 4QFLA 1LFIA 4PFTA 3OSRA 3HCQA 1NH8A 4NGUA 1POY1 3AXFA 3ROJA 3VVDA 2GHAA 1UTBB 4Z7EA 2VHAA 4N13A 5DW8A 4RNSA 2DWAA 4MBPA 1OVBA 3E3KA 3O66A 4H67A 5I2KA 4UACA 4HS7A 2XXIA 3QYTA 1XS5A 3EHTA 1BTJA 4R9GA 1POTA 4YAHX 5I59A 1N7XA 4YKKA 1TFAA 4NHBA 4OWDA 3MZBA 1EZOA 4F31B 4P1LA 2DDKA 4LUBA 2Y5LA 2ONSA 1FTLA 4MLQA 4NF6A 5L9SA 1H43A 1SPIA 1R9LA 4KQPA 4F3BA 2F3BA 2WBBA 1IIWA 4EDPA 4ZZAA 2XXPA 3F11A 3KN8A 4R75A 3U8QA 3DP6A 3T9HB 4H8IA 3TCGA 5CC2A 4H5GA 1MXVA 3VLWA 3SEVA 1A55A 4RJZA 4C1UA 3H06B 1GTKA 1SBPA 3QUJA 3FXRA 1MXWA 5BUUA 3Q25A 3OSQA 4P56A 2F34A 3FXUA 1AMFA 2UVGA 2QVRA 4GQOA 4JDFA 5ICQA 2Y7KA 4P0GA 2UVHA 1TFDA 3MPKA 1DPEA 3JV9A 2P0SA 4PFYA 4MNCA 1KZ8A 3PPQA 3LUZA 3RY3A 5CBSA 1FW0A 3GYYA 3TTKA 2OBGA 1ANFA 3DP8A 1JQFA 3D4GA 3CI8A 3G3KA 3LUYA 3U94A 4YB5A 4NE4A 1O63A 2QS4A 4G68A 1Y1MA 1LBCA 2UYFA 2V93A 4IO7A 5DT6A 3RT6B 3T96B 3IOTA 3KSXA 1YXIA 2ZXTA 1DSNA 1NNTA 2Z8DA 2PMSA 4ZE9A 2Q2CA 3CG3A 1FTOA 1VFEA 1DOTA 4F29A 1B4ZA 1LBZA 3N5LA 4OFJA 1HSLA 2OJTA 5EHMA 4FIMA 1MY3A 1LAXA 3TCFA 2HXWA 4YB7A 1GVCA 5EYHA 1B7ZA 3RUMA 5H8FA 4NX1A 3KFMA 4NTLA 1KWHA 3R26A 2LAOA 4QHQA 4R72A 1A8FA 4P8BA 4AQ4A 1NV5A 1UTHB 3TDJA 3LSLA 1FPIA 2I0BA 4PBQA 2GRVA 2HHMA 2QSXA 4JVDA 2XXVA 4DXUA 1UIUA 1R9QA 2H4IA 5AA2D 5ISUA 2R71A 1XC1A 3KG2A 1VDWA 1B7UA 1B32A 4RPNA 1B3FA 3V8XB 3TTRA 1ZLQA 3KN7A 4HCYA 3S4UA 4O3AA 2WBDA 3MAMA 3MZ9A 4EF1A 1MDP1 5KCJA 5ET5A 5L9OA 4JWXA 1QW0A 1NUXA 3FVGA 3IK6B 2E0SA 1NI9A 3DP4A 5KZTA 3TZAA 1FQEA 3IOWA 4QFOA 3C31A 3W15C 2ALUA 2CEXA 1H45A 1IQ7A 3EN3A 5ESYA 3RPLA 3V83A 1N0TA 4HE0A 4H1XA 3PD8A 4GWYA 4MF3A 1AOVA 3C4MA 1NUYA 1Y9UA 4OHNA 1ZTYA 1LB9A 4THIA 3IFAA 3M3FA 1USYE 3OO9A 2I49A 3IO6A 1FCKA 2DVCA 2O7IA 1XT8A 4MHFA 3KZGA 5I84A 1MM7A 1NV1A 1MQIA 3O28A 4Z0IA 1MY1A 3GZGA 5EQ9A 3TUSA 3B6WA 3B6TA 4KI0E 1B3EA 2Z8EA 1A8EA 3N26A 5TP9B 1P1NA 4PTKA 4FBPA 4PCDA 1T0KA 2HQ0A 3OO6A 4QSCA 1R1NA 4JWOA 2RC8A 4FEDA 3M3LA 2OK2A 2Q8JA 2DE4A 2F78A 1MXXA 1IMCA 2MKZA 4OENA 4HTGA 3PMWA 2QMWA 1NNFA 2OWSA 1II5A 3K6VA 4N6DA 3A29A 4FE8A 2DWHA 3IORA 4O7IA 3SETA 1VSOA 5BWJA 5K2YA 3K01A 5IZ1A 3USDA 2ZYMA 4OVRA 5H8HB 4KYSA 1D3KA 2NUVA 3MVYA 3FJMA 3FV1A 2XD2A 2XXRA 3K00A 4QFNA 1LCTA 2A5TA 3DM0A 2DXYA 4EQBA 5I2NA 5ET6A 1VR5A 3MWBA 1DTGA 5I56B 4N81A 4POWA 5KDTB 2ZZXA 1SYIA 3FJGA 4PGPA 4O3BA 1LBVA 3A3UA 1MH3A 3E9XA 2H9BA 4OESA 1FPFA 4ZEIA 2FHYA 1ZMGA 4IO4A 1RDYA 3TFLA 5B70A 1ZU0A 2PCRA 3EPEA 5FTIA 4R6HA 2CEYA 1BIYA 4I8CA 2IA4A 4N4UA 4P0IA 4XXUA 3MP1A 1B0HA 3R7XA 2O84X 3FZVA 5CM6A 3CFZA 4R6YA 2Y7IA 2YJPA 3N6TA 4JWYA 1FQDA 4R2FA 1MQJA 3H6WA 1LB8A 2Z22A 4NF8B 2HAVA 4WEPA 4BDOA 4EXLA 3MP8A 3PUZE 1JNFA 3K1NA 4JSDA 2QMXA 4P1EA 3WAFA 2F7BA 1PEBA 3QXMA 4EUOA 1B4HA 3N6UA 5IZ3B 5I56A 3I3VA 2FYIA 1LAFE 3OO8A 5AA1A 4EQ9A 2B65A 3MP6A 1FPJA 1UQWA 4F18A 4QSEA 1NV0A 1ATGA 5TPAA 4IY5A 2PYYA 2DYXA 3U65A 4GL8A 4RK2A 2DWIA 4DXBA 2VPOA 4BDRA 2F8DA 4P11A 1Q1KA 4DI3D 2O1LA 3B50A 4MIJA 5DEXB 2OCUA 4X1DA 4ISUA 2FA7A 2FIEA 1MQDA 2L5VA 3EKIA 3CHGA 4RA1A 4GFRA 2RC7A 3T22A 4XKQA 3G3IA 3NOHA 2XWVA 4HW8A 2E1SA 1PBQA 2XWIA 3MYUA 1LAHE 1QVSA 1P1UA 4U22A 3LR1A 1IXCA 1MXZA 3SEXA 4NN3A 5T3JA 1QUIA 4ELQA 5I2KB 1FQAA 4Q5TA 1SW2A 3ISPA 3SESA 3GXAA 1SW1A 5I59B 5HPQA 1FJ9A 1FTJA 2V84A 3CIJA 1IZ1A 2G93A 5I7IA 4R74A 1CE2A 3QUFA 4DCXA 2XA5A 1IXGA 4NF6B 1MQHA 3FIRA 1LGBC 1LBYA 4HE2A 1JETA 3UK4A 5ICTA 3FBPA 1USYH 1O64A 4NF4A 5CBRA 1JVYA 3Q26A 3H6TA 4OVSA 2A5SA 2QRYA 2Y7WA 3TCHA 1LLSA 3CVGA 1FPKA 4RXLA 3TMGA 3IAZA 3H6UA 3FD3A 1MPDA 2VP1A 2CZIA 3OD7A 1N76A 2IEEA 4QSDA 4U23A 2DE3A 2ZZVA 3VFJA 4JBZA 2X7PA 1B3GA 4F3SA 4JSOA 3B8BA 1NUWA 2WKYA 3KOSA 1F9BA 3GBAA 2ESNA 3FVOA 1D4NA 2KQZA 4YKIA 4PBHA 4JVCA 3A3CA 3IB2A 3DLNA 3LV0A 3RT8A 2ABHA 4GOTA 1B51A 1URGA 1RYOA 4DDDA 3L6HA 3HPIA 2CZKA 5I58A 4GLIA 4G68B 2VPNA 1B0LA 2ZNUA 4OTEA 1MY0A 5CMBA 3K4UA 3HHFA 2P1SA 1PBPA 3IJOB 1YCJA 3FVKA 4IGTA 3P7IA 1OQGA 3LC8A 1SW4A 3MVXA 2HZLA 3DELB 2CMOA 3PPOA 3BFUA 4LQ2A 1B5JA 4H0WA 1IMBA 4YICA 2ZMBA 1Y3PA 2ZYKA 5EHSA 4ND9A 2F36A 4G61A 1SI1A 1OQHA 4IY6A 4KPTA 4GRKA 1D9QA 4NAPA 1O7TA 5FHOA 3OELA 1N04A 5H8FB 5I5PA 4P3LA 2V25A 3K6WA 1CB6A 2I58A 2QS1A 4F2OA 3G7WA 3HN0A 2WYKA 3G3HA 3IOVA 4MJOA 1OMPA 5IM2A 4GF8A 2FNCA 3K2DA 3H3GA 1INPA 2VOZA 1NV4A 1B9JA 2PFYA 4F1YA 5AE4A 3OENA 1B05A 2CZHA 1IITA 4G8HA 1JEVA 1RDXA 5ITPA 3VVFA 2M8CA 2ANJA 3JYRA 3T0JA 3VLVA 4LVQA 5LTCA 4DE8A 4U2RA 1LBBA 1MG1A 4R2BA 4BDNA 2RCBA 3C35A 1MXYA 5TU0A 1M5DA 2ZNSA 4OZ9A 4ELOA 2H5YA 1Y20A 4PFIA 5KCJB 3G3FA 4UA8A 2WX9A 4MNPA 3HHGA 3K0VA 4UABA 4G8NA 4NQ8A 2G29A 2XX8A 4PAFA 1LBWA 1ZKBA 4XIGQ 1FPBA 4AB6A 3H6VA 1LCFA 4QFKA 1IMEA 1BKAA 2P3NA 1DTZA 2I0CA 4GXSB 4ESXA 3RPLB 2I6EA 2OLBA 2KR0A 4PAIA 2OX3A 2DSFA 4WEDA 2VD3A 4GWUA 2B4LA 3TTNA 3EF7A 2HFBA 2O68A 3TYHA 4F1VA 4LQ5A 2F6GA 3B7DA 4X8RA 5H8QA 2DXRA 1EU8A 1FBGA 4PP0A 2XXWA 3MSTA 4O94A 2RC9A 2XHDA 2Y7RA 4PGNA 2F35A 2XXQA 2V3QA 3W9VA 4F19A 3LSFB 4NF0A 3I6VA 3FUZA 1KA0A 3QMFA 2AYSA 4KYEA 5HM4B 2OWZA 4POXA 1PB8A 3ZS6A 1Q9DA 1EYIA 2QFLA 4RPOA 3Q27A 4MX6A 1FTKA 2UVJA 2DOJA 4GWWA 1I6BA 1NFTA 2QS2A 4ELPA 2O51A 4NF5A 2JJKA 1YTVA 1Y3NA 2REJA 1OLAA 2V4CA 2R9JA 4QXDA 1B5IA 1WODA 3FJ7A 3R6UA 2A5TB 3WAEA 1BP5A 1JVXA 1B7HA 3TODA 5I2NB 2GQ1A 5H8NA 5EQ8A 2NOOA 1K9YA 3HFUA 4KYDA 4BLAA 4O8MA 3SZPA 3VV5A 3C33A 3OXNA 2PX1A 5F1QA 4GWXA 4U1ZA 1H3DA 3CRBA 4X9TA 1Y1ZA 1AIVA 4ONYA 4AS4A 2XXHA 4N6KA 4YU0A 1PDAA 1M5CA 3PPPA 3RNNA 1QGXA 3RTFB 1JP4A 5CMMA 3KC1A 4TOZA 1B6HA 2FIXA 1FPEA 3TQLA 2BJJX 1FBFA 4XEQA 4MFIA 3U1OA 4G8MA 3BKIB 2UVIA 3S9NC 4F3GA 3K1MA 1IMFA 4I1DA 4LATA 4YMBA 2X7QA 2VT5A 4GX6A 5I57A 1BLFA 1FPGA 3MJNA 5IZZA 2QS3A 2FVZA 5AA2A 4DXCA 3KJ7A 3PTYA 3TAJA 5FHMA 1QKBA 1QULA 4MMPA 4HXVA 4BDLA 3KGCA 3V5AA 1TWYA 3U72A 3TTMA 5TPAB 2HXRA 1IMAA 5LDZA 1MM6A 1Y4CA 1P99A 5FTHA 1LEVA 4HE1A 3O29A 3K6UA 3VXCA 3C34A 4X04A 3IOUA 4LZ5A 1MPCA 1FBPA 2PFZA 3CR9A 2CZLA 2F5XA 3KOTA 5JTYA 1S7YA 3KN3A 2DE2A 4N91A 3L6GA 1SDXA 2NWJA 2F97A 4DCYA 2UYEA 3B6QA 2RKMA 4PF8A 1H44A 1DCUA 3PMXA 2D3IA 4RK9A 3PPRA 4XKNA 1Z7NE 5AA3A 2REGA 1FBHA 4GXAA 1B2HA 3HO7A 4I9DA 3UGWA 3UA8A 3FVNA 4KFQA 4F3PA 4PDHA 4H6DA 5K2XA 4NMYA 1XI6A 3T66A 4G4PA 4ESWA 3KSJA 3UP9A 1YYZA 2PT2A 2R6GE 1AL3A 3O6IA 3PPNA 2DS9A 1GGGA 3H03A 1NKXA 5FHNA 3TQWA 2QL3A 1P1QA 3SDFA 2HCAA 1DPPA 4JXIA 4P47A 1MXUA 5CMCA 4NF4B 4GWOA 4KR5A 4ZEBA 2OZZA 1NNPA 5JK4A 4ZEFA 3IFCA 1CNQA 4IR8A 1QJMA 4MLVA 4NEDA 1Y4TA 4XTCQ 5EYFA 4AS5A 3IL1B 5B7DA 3GLBA 3E13X 1URSA 4KD5A 1AWBA 1KA1A 1I6QA 3UN6A 3K02A 1H76A 5DVIA 2F3DA 4EXKA 4ZECA 4ELRA 1RYXA 4DI4B 5H8SA 3KEIA 3CFLA 3LSWA 2OWTA 4GBVA 5I58B 1S50A 4X48A 4MNIA 4L17A 4IO3A 3M3KA 5ELVA 1LSTA 3BBRA 2R8TA 1M5EA 3ILUB 1EZPA 3RN8A 1NMUA 4PQJA 1PB7A 4OVQA 1XHYA 3S9EA 5IAIA 4LN5A 4G68C 1DMBA 2O1MA 1FJ6A 2YPNA 2BJIA 4M1VA 5ITOA 2WEFA 3FXBA 1MS7A 4E0XA 2AIXA 2H98A 1SQYA 4KCDA 3MUQA 1LFGA 4K3FA 1FPLA 4XFEA 2PBWA 2RCAA 3PMVA 1QKAA 1JW5A 1FQCA 2Y84A
chains in the Genus database with same CATH topology
1NV1A 4PFIA 2WX9A 4MNPA 5EQ9A 1FTAA 4UABA 4NQ8A 4O7MA 4KXPA 4PAFA 4PTKA 1LBWA 4FBPA 4PCDA 1DK4A 2HPGA 2Y5KA 1NUZA 1NV7A 4MCOA 4PFBA 5J1DA 1FPBA 4PF6A 2P3VA 4N17A 4N8GA 1IMEA 2P3NA 2DE4A 1IMCA 3RPLB 2MKZA 4PDDA 1FPDA 2KR0A 4PAIA 2OX3A 4N6DA 3A29A 2B4MA 4O7IA 4GWUA 4MEVA 5IZ1A 2B4LA 4HCWA 4OVRA 2Q74A 1EYJA 4F1VA 4X8RA 5A5LA 1FBGA 3MSTA 4O94A 4H46A 5ET6A 1K9ZA 4PGNA 4MAGA 1G0IA 1FBEA 2V3QA 4N81A 3W9VA 4F19A 1NV2A 2ZZXA 5IZ3A 2XXKA 4OVPA 1NV3A 2Q8MA 4NF0A 4PAKA 2QVVA 2DVZA 3QMFA 1KA0A 4PGPA 3E78A 1LBVA 3KBZA 2OWZA 5EQAA 1FPFA 1Q9DA 1EYIA 2QFLA 4I3EA 2FHYA 4JVIA 1RDYA 4MX6A 1IMDA 5EQ7A 5ET8A 4GWWA 4OANA 2XWOA 2PCRA 2CEYA 2JJKA 4N4UA 2V4CA 4N15A 5CM6A 4QXDA 5I3SA 4I40A 4N8YA 2QVUA 4NGUA 1RDZA 3E79A 3ROJA 5F24A 4P1EA 2GQ1A 5EQ8A 5DW8A 1K9YA 5IZ3B 2XWKA 1LBXA 3HFUA 2WYPA 4O8MA 1FPJA 3SZPA 4F18A 1NV0A 5J16A 4GWXA 3RYDA 5IGAA 4NHBA 3U65A 4X9TA 4P1LA 4AS4A 4N6KA 2VPOA 1DBZA 2DDKA 2Y5LA 4DI3D 1QGXA 2HZKA 4OA4A 1JP4A 1SPIA 3KC1A 2QPQA 3B50A 2F3BA 2FIXA 1FPEA 4MIJA 2WBBA 1FBFA 2FIEA 4XEQA 2L5VA 3EKIA 3CHGA 1IMFA 2VT5A 4GX6A 4I3YA 3NOHA 2XWVA 1FPGA 4GX4A 5IZZA 2FVZA 2XWIA 3MYUA 4P56A 1NV6A 2QVRA 3PTYA 4NN3A 5T3JA 4MMPA 4HXVA 3ISPA 4H45A 3T1BA 3KC0A 4PFRA 2HXRA 1IMAA 5LDZA 1FJ9A 4MNCA 1KZ8A 1LEVA 4HE1A 3LUZA 4X04A 1FBCA 3GYYA 5I7IA 1FBPA 2PFZA 2XA5A 2F5XA 1LBYA 4HE2A 3FBPA 2DE2A 4N91A 4OVSA 1FPKA 4PF8A 1DCUA 2FBPA 1FBDA 1YXIA 1FBHA 1FRPA 2CZIA 2DE3A 4PDHA 2ZZVA 4YZZA 3BIGA 4PE3A 1XI6A 3B8BA 1YZ0A 1NUWA 1LBZA 5ET7A 4GX3A 4GWSA 1YYZA 2ZZWA 2KQZA 4QBAA 4NG7A 5FBPA 4PBHA 4JVCA 3LV0A 5EYHA 4P47A 4GBWA 2CZKA 4NX1A 4PETA 3D1RA 2VPNA 5JK4A 1FSAA 2Q9TA 3IFCA 1CNQA 4P8BA 1NV5A 4IR8A 3BIHA 1FPIA 4PBQA 2HHMA 2HZLA 4JVDA 4AS5A 4F1UA 1IMBA 4YICA 4GWZA 4P9KA 1VDWA 1AWBA 4G61A 1KA1A 4HCYA 2WBDA 2F3DA 5ET5A 1D9QA 4NAPA 4DI4B 1NUXA 1G0HA 5I5PA 4P3LA 1NI9A 4GBVA 1EYKA 4MNIA 5EYGA 2WYKA 3W9WA 2CEXA 2R8TA 4MJOA 5IM2A 1INPA 4OVQA 4LN5A 3RPLA 5ESYA 1NV4A 4HE0A 1FJ6A 2BJIA 4M1VA 2WEFA 3FXBA 2PFYA 4GWYA 2CZHA 1NUYA 1RDXA 4PC9A 4OVTA 1FPLA 4XFEA 3IFAA 1BK4A 3T0JA 5LTCA 4XF5A 4MHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CEY A;  4MMP A;  2VPN A;  4PFI A;  2WX9 A;  4MNP A;  4N4U A;  4UAB A;  4P8B A;  4NQ8 A;  4O7M A;  2V4C A;  4N15 A;  5CM6 A;  4PFR A;  4PAF A;  4PCD A;  4N8Y A;  4PBQ A;  2HPG A;  2HZL A;  4MNC A;  4MCO A;  4PFB A;  4X04 A;  3GYY A;  4NGU A;  5I7I A;  4PF6 A;  4N17 A;  4N8G A;  4YIC A;  2PFZ A;  2XA5 A;  4P1E A;  4P9K A;  2XWK A;  4PDD A;  4N91 A;  4PAI A;  4N6D A;  4OVS A;  2WYP A;  4O8M A;  4NAP A;  4PF8 A;  4MEV A;  4DI4 B;  4OVR A;  5I5P A;  4P3L A;  5IGA A;  4NHB A;  3U65 A;  4X8R A;  4MNI A;  4P1L A;  2WYK A;  2VPO A;  4N6K A;  2CEX A;  4O94 A;  5IM2 A;  4PDH A;  4DI3 D;  2HZK A;  4PGN A;  2ZZV A;  4MAG A;  4OA4 A;  4YZZ A;  3B50 A;  4OVQ A;  4LN5 A;  4PE3 A;  4MIJ A;  2ZZX A;  2XXK A;  4OVP A;  4XEQ A;  3FXB A;  2PFY A;  4NF0 A;  4PAK A;  4PGP A;  2ZZW A;  4PC9 A;  4OVT A;  4NG7 A;  2XWV A;  4XFE A;  4PBH A;  5IZZ A;  2XWI A;  5LTC A;  4MX6 A;  4P47 A;  4P56 A;  4NX1 A;  4OAN A;  2XWO A;  4XF5 A;  4PET A;  4MHF A;  4NN3 A; 
#chains in the Genus database with same CATH topology
 1OVT A;  3K1P A;  4TLL B;  4PE5 B;  2RF1 A;  2V3T A;  3QK6 A;  1P1W A;  3BFT A;  5AA4 A;  2F7A A;  1IUD A;  3FAT A;  2HAU A;  4O7M A;  1ZIU A;  4Q30 B;  4KXP A;  3CG1 A;  2HPG A;  4OFL A;  4PFB A;  3PUX E;  2ZYN A;  3EQ1 A;  1N3X A;  4FEC A;  2P3V A;  4N17 A;  4N8G A;  3FXQ A;  2X26 A;  5CRY A;  2PVU A;  3PD9 A;  1OLC A;  3G3J A;  1MY4 A;  3A09 A;  4OQO A;  3ECR A;  4FEB A;  4R73 A;  4OEV A;  5DVF A;  2KLF A;  4LZ7 A;  5F7V A;  5L9M A;  5CMK A;  3MC2 A;  3VE1 B;  4ZS9 A;  1QUK A;  4MEV A;  4HCW A;  3PUV E;  1XVX A;  2Q74 A;  1OIB A;  5A5X B;  2NXO A;  2AL5 A;  4I62 A;  3O6G A;  4ZDM A;  3OMB A;  3ZKL A;  2I48 A;  2XX7 A;  1UTB A;  3SEY A;  3VDF A;  1K9Z A;  2DQV A;  4MAG A;  1G0I A;  1FBE A;  1FTM A;  3IR1 A;  4OVP A;  3PGF A;  1WDN A;  4DZ1 A;  3VVE A;  4QFP A;  3RTW B;  2ZNT A;  3PUW E;  2XXY A;  3CFX A;  2XD3 A;  3HST A;  1B52 A;  4FJP A;  1GV8 A;  3O97 A;  4I3E A;  4GVO A;  3IO4 A;  4EQ7 A;  4WXJ A;  4X1B A;  1IMD A;  1MQG A;  1B46 A;  4XKR A;  1S9T A;  5EQ7 A;  5ET8 A;  4U21 A;  1A40 A;  1I69 A;  2ZYO A;  4N6P A;  4GD5 A;  4YB6 A;  1NL5 A;  2VGQ A;  3CSB A;  2O6A A;  1B3H A;  3MQ9 A;  3TEL A;  5I3S A;  3K6X A;  2XX9 A;  2QVU A;  2W7Y A;  5A5X A;  5H8Q B;  1QUJ A;  5IKB A;  1RDZ A;  3E79 A;  5F24 A;  2O69 A;  1IXH A;  4ZED A;  1HSJ A;  2B3B A;  4IO2 A;  4R9F A;  2XWK A;  4TLM B;  4F39 A;  2D21 A;  1LBX A;  4BDM A;  1P1O A;  3MZ1 A;  3ZKK A;  1SYH A;  3MW0 A;  2WYP A;  3RPW A;  1B1X A;  2UXA A;  3LSX A;  1NNK A;  4H5F A;  5J16 A;  4F2Q A;  3RYD A;  3CSG A;  5IGA A;  2F6P A;  2YLN A;  1MH4 A;  3E4R A;  3SEW A;  2I3V A;  4NF5 B;  1DBZ A;  1JW4 A;  4G2Z A;  2HZK A;  4OA4 A;  2QPQ A;  5LOM A;  4IO5 A;  2VD2 A;  3UOR A;  1SVX B;  5JEI A;  4LON B;  1Z7M E;  5DTB A;  1PB9 A;  3MBP A;  1HSE A;  4I3Y A;  3N94 A;  1TXF A;  4GX4 A;  4MH5 A;  4IB2 A;  5H8N B;  2ONK E;  4YKJ A;  1NV6 A;  3FGS A;  1A54 A;  3C9H A;  2H99 A;  3Q28 A;  1ZJL A;  3RGY A;  1A99 A;  2Y7P A;  4H45 A;  3T1B A;  1RKM A;  3ZSF A;  1EH3 A;  1M5F A;  3KC0 A;  4PFR A;  4OVJ A;  3O2A A;  4PFW A;  1MPB A;  2XXT A;  4EF2 A;  3G3G A;  4OER A;  1FBC A;  4QRZ A;  3VLU A;  1D9V A;  4GIZ A;  3HV1 A;  1M5B A;  1XVY A;  4U1O A;  2RIN A;  1D9Y A;  3O9P A;  1R6Z A;  3MVZ A;  5I57 B;  4GL0 A;  4OXV A;  2I3W A;  1UTH A;  2FBP A;  5AA2 B;  1FBD A;  1MRP A;  2B3F A;  3MPL A;  1FRP A;  3GBB A;  1SW5 A;  1J1N A;  2P2A A;  2I4B A;  4LA9 A;  3U92 A;  1IEJ A;  4YZZ A;  4U4S A;  3BIG A;  4LZ8 A;  4PE3 A;  1B1H A;  1YZ0 A;  1US4 A;  4PFU A;  5ET7 A;  4GX3 A;  4GWS A;  1WVJ A;  2ZZW A;  4ECF A;  4BDQ A;  4C1T A;  4F22 A;  4QBA A;  1XOC A;  4NG7 A;  5FBP A;  1URD A;  4G77 A;  3RLF E;  1VFD A;  1B58 A;  4YKP A;  1B3L A;  5JTY B;  3SER A;  4Q0C A;  1UIV A;  4OMB A;  4GBW A;  2NVU B;  4PET A;  4ZEK A;  3T9U A;  3PV0 E;  5DYH A;  2V3U A;  4KCC A;  3ODB A;  3KBR A;  3D1R A;  1FSA A;  3T9X B;  4ZE8 A;  2Q9T A;  3QSL A;  1L5T A;  2ONR A;  2I4C A;  3BIH A;  1IXI A;  2AL4 A;  2H25 A;  1JW1 A;  4F1U A;  1GR2 A;  2GHB A;  3V89 B;  4GWZ A;  4P9K A;  1US5 A;  4QF9 A;  5L8D A;  4FOR A;  4YMA A;  3FAS A;  3VXB A;  3S2V A;  3MVW A;  1ELJ A;  4Q8R A;  3S9M C;  1NH7 A;  4E0W A;  4ZZE A;  5TP9 A;  1G0H A;  1AH5 A;  3QIM A;  4TQU Q;  1I6A A;  3H4Z A;  3O6H A;  1EYK A;  5EYG A;  3IJX B;  3KJT A;  1N3W A;  1FQB A;  3W9W A;  4IGR A;  3IB0 A;  4XKP A;  3SKP A;  2THI A;  3OO7 A;  2F7C A;  1SD3 A;  4WKM A;  4N07 A;  3D4C A;  4U4X A;  3PU5 A;  4OFO A;  1PC3 A;  2XXX A;  3TEP A;  4AB5 A;  3U93 A;  3QAX A;  4PC9 A;  4OVT A;  2PT1 A;  1BK4 A;  3ONM A;  4FAT A;  5H8H A;  3IB1 A;  4XF5 A;  1YAE A;  1B40 A;  2XXU A;  2HEU A;  4IO6 A;  3EHU A;  3UIF A;  5HBC A;  3S9L C;  3T9V A;  1FTA A;  2DP8 A;  3RQT A;  4H8J A;  5KDT A;  4NWD A;  1N7W A;  2QJE A;  3C36 A;  4JB7 A;  2Z23 A;  1DK4 A;  2Y5K A;  4H65 A;  1NUZ A;  1NV7 A;  4MCO A;  3ILT B;  5J1D A;  4C0R A;  3LBS A;  4PF6 A;  4NWC A;  4RYA A;  1YPN A;  3TTL A;  1FQF A;  1JEU A;  1LFH A;  4PDD A;  1FPD A;  1TT1 A;  3I5O A;  3T93 B;  1SI0 A;  4O3C A;  2O7U A;  2Q88 A;  2B4M A;  1N84 A;  3THI A;  3Q29 A;  1LAG E;  4LP2 B;  1EYJ A;  1Q35 A;  2GFE A;  3H7M A;  4DIG A;  5A5L A;  3TKD A;  4NF8 A;  1EZ9 A;  3M8U A;  3OEK A;  4H46 A;  4R6K A;  1B5H A;  5AA4 B;  4OEU A;  3TPA A;  1A7L A;  4OET A;  2Z8F A;  4KHZ E;  3C32 A;  1NV2 A;  5IZ3 A;  3FV2 A;  2XXK A;  2Q2A A;  2D5W A;  3PUY E;  1NV3 A;  3SEU A;  2Q8M A;  3IX1 A;  4PAK A;  2QVV A;  2DVZ A;  3OOA A;  3E78 A;  3KBZ A;  5EQA A;  1Y3Q A;  2GH9 A;  4JVI A;  4OYV A;  2DWJ A;  1MY2 A;  4OAN A;  3OEM A;  2XWO A;  4FAJ A;  2Q89 A;  3EHS A;  5M2V A;  1MDQ A;  4DLD A;  4N15 A;  5CI5 A;  5DEX A;  1ZBM A;  4RY1 A;  3JZJ A;  4I40 A;  1VE4 A;  4N8Y A;  4M4G A;  5DVJ A;  4QFL A;  1LFI A;  4PFT A;  3OSR A;  3HCQ A;  1NH8 A;  4NGU A;  1POY 1;  3AXF A;  3ROJ A;  3VVD A;  2GHA A;  1UTB B;  4Z7E A;  2VHA A;  4N13 A;  5DW8 A;  4RNS A;  2DWA A;  4MBP A;  1OVB A;  3E3K A;  3O66 A;  4H67 A;  5I2K A;  4UAC A;  4HS7 A;  2XXI A;  3QYT A;  1XS5 A;  3EHT A;  1BTJ A;  4R9G A;  1POT A;  4YAH X;  5I59 A;  1N7X A;  4YKK A;  1TFA A;  4NHB A;  4OWD A;  3MZB A;  1EZO A;  4F31 B;  4P1L A;  2DDK A;  4LUB A;  2Y5L A;  2ONS A;  1FTL A;  4MLQ A;  4NF6 A;  5L9S A;  1H43 A;  1SPI A;  1R9L A;  4KQP A;  4F3B A;  2F3B A;  2WBB A;  1IIW A;  4EDP A;  4ZZA A;  2XXP A;  3F11 A;  3KN8 A;  4R75 A;  3U8Q A;  3DP6 A;  3T9H B;  4H8I A;  3TCG A;  5CC2 A;  4H5G A;  1MXV A;  3VLW A;  3SEV A;  1A55 A;  4RJZ A;  4C1U A;  3H06 B;  1GTK A;  1SBP A;  3QUJ A;  3FXR A;  1MXW A;  5BUU A;  3Q25 A;  3OSQ A;  4P56 A;  2F34 A;  3FXU A;  1AMF A;  2UVG A;  2QVR A;  4GQO A;  4JDF A;  5ICQ A;  2Y7K A;  4P0G A;  2UVH A;  1TFD A;  3MPK A;  1DPE A;  3JV9 A;  2P0S A;  4PFY A;  4MNC A;  1KZ8 A;  3PPQ A;  3LUZ A;  3RY3 A;  5CBS A;  1FW0 A;  3GYY A;  3TTK A;  2OBG A;  1ANF A;  3DP8 A;  1JQF A;  3D4G A;  3CI8 A;  3G3K A;  3LUY A;  3U94 A;  4YB5 A;  4NE4 A;  1O63 A;  2QS4 A;  4G68 A;  1Y1M A;  1LBC A;  2UYF A;  2V93 A;  4IO7 A;  5DT6 A;  3RT6 B;  3T96 B;  3IOT A;  3KSX A;  1YXI A;  2ZXT A;  1DSN A;  1NNT A;  2Z8D A;  2PMS A;  4ZE9 A;  2Q2C A;  3CG3 A;  1FTO A;  1VFE A;  1DOT A;  4F29 A;  1B4Z A;  1LBZ A;  3N5L A;  4OFJ A;  1HSL A;  2OJT A;  5EHM A;  4FIM A;  1MY3 A;  1LAX A;  3TCF A;  2HXW A;  4YB7 A;  1GVC A;  5EYH A;  1B7Z A;  3RUM A;  5H8F A;  4NX1 A;  3KFM A;  4NTL A;  1KWH A;  3R26 A;  2LAO A;  4QHQ A;  4R72 A;  1A8F A;  4P8B A;  4AQ4 A;  1NV5 A;  1UTH B;  3TDJ A;  3LSL A;  1FPI A;  2I0B A;  4PBQ A;  2GRV A;  2HHM A;  2QSX A;  4JVD A;  2XXV A;  4DXU A;  1UIU A;  1R9Q A;  2H4I A;  5AA2 D;  5ISU A;  2R71 A;  1XC1 A;  3KG2 A;  1VDW A;  1B7U A;  1B32 A;  4RPN A;  1B3F A;  3V8X B;  3TTR A;  1ZLQ A;  3KN7 A;  4HCY A;  3S4U A;  4O3A A;  2WBD A;  3MAM A;  3MZ9 A;  4EF1 A;  1MDP 1;  5KCJ A;  5ET5 A;  5L9O A;  4JWX A;  1QW0 A;  1NUX A;  3FVG A;  3IK6 B;  2E0S A;  1NI9 A;  3DP4 A;  5KZT A;  3TZA A;  1FQE A;  3IOW A;  4QFO A;  3C31 A;  3W15 C;  2ALU A;  2CEX A;  1H45 A;  1IQ7 A;  3EN3 A;  5ESY A;  3RPL A;  3V83 A;  1N0T A;  4HE0 A;  4H1X A;  3PD8 A;  4GWY A;  4MF3 A;  1AOV A;  3C4M A;  1NUY A;  1Y9U A;  4OHN A;  1ZTY A;  1LB9 A;  4THI A;  3IFA A;  3M3F A;  1USY E;  3OO9 A;  2I49 A;  3IO6 A;  1FCK A;  2DVC A;  2O7I A;  1XT8 A;  4MHF A;  3KZG A;  5I84 A;  1MM7 A;  1NV1 A;  1MQI A;  3O28 A;  4Z0I A;  1MY1 A;  3GZG A;  5EQ9 A;  3TUS A;  3B6W A;  3B6T A;  4KI0 E;  1B3E A;  2Z8E A;  1A8E A;  3N26 A;  5TP9 B;  1P1N A;  4PTK A;  4FBP A;  4PCD A;  1T0K A;  2HQ0 A;  3OO6 A;  4QSC A;  1R1N A;  4JWO A;  2RC8 A;  4FED A;  3M3L A;  2OK2 A;  2Q8J A;  2DE4 A;  2F78 A;  1MXX A;  1IMC A;  2MKZ A;  4OEN A;  4HTG A;  3PMW A;  2QMW A;  1NNF A;  2OWS A;  1II5 A;  3K6V A;  4N6D A;  3A29 A;  4FE8 A;  2DWH A;  3IOR A;  4O7I A;  3SET A;  1VSO A;  5BWJ A;  5K2Y A;  3K01 A;  5IZ1 A;  3USD A;  2ZYM A;  4OVR A;  5H8H B;  4KYS A;  1D3K A;  2NUV A;  3MVY A;  3FJM A;  3FV1 A;  2XD2 A;  2XXR A;  3K00 A;  4QFN A;  1LCT A;  2A5T A;  3DM0 A;  2DXY A;  4EQB A;  5I2N A;  5ET6 A;  1VR5 A;  3MWB A;  1DTG A;  5I56 B;  4N81 A;  4POW A;  5KDT B;  2ZZX A;  1SYI A;  3FJG A;  4PGP A;  4O3B A;  1LBV A;  3A3U A;  1MH3 A;  3E9X A;  2H9B A;  4OES A;  1FPF A;  4ZEI A;  2FHY A;  1ZMG A;  4IO4 A;  1RDY A;  3TFL A;  5B70 A;  1ZU0 A;  2PCR A;  3EPE A;  5FTI A;  4R6H A;  2CEY A;  1BIY A;  4I8C A;  2IA4 A;  4N4U A;  4P0I A;  4XXU A;  3MP1 A;  1B0H A;  3R7X A;  2O84 X;  3FZV A;  5CM6 A;  3CFZ A;  4R6Y A;  2Y7I A;  2YJP A;  3N6T A;  4JWY A;  1FQD A;  4R2F A;  1MQJ A;  3H6W A;  1LB8 A;  2Z22 A;  4NF8 B;  2HAV A;  4WEP A;  4BDO A;  4EXL A;  3MP8 A;  3PUZ E;  1JNF A;  3K1N A;  4JSD A;  2QMX A;  4P1E A;  3WAF A;  2F7B A;  1PEB A;  3QXM A;  4EUO A;  1B4H A;  3N6U A;  5IZ3 B;  5I56 A;  3I3V A;  2FYI A;  1LAF E;  3OO8 A;  5AA1 A;  4EQ9 A;  2B65 A;  3MP6 A;  1FPJ A;  1UQW A;  4F18 A;  4QSE A;  1NV0 A;  1ATG A;  5TPA A;  4IY5 A;  2PYY A;  2DYX A;  3U65 A;  4GL8 A;  4RK2 A;  2DWI A;  4DXB A;  2VPO A;  4BDR A;  2F8D A;  4P11 A;  1Q1K A;  4DI3 D;  2O1L A;  3B50 A;  4MIJ A;  5DEX B;  2OCU A;  4X1D A;  4ISU A;  2FA7 A;  2FIE A;  1MQD A;  2L5V A;  3EKI A;  3CHG A;  4RA1 A;  4GFR A;  2RC7 A;  3T22 A;  4XKQ A;  3G3I A;  3NOH A;  2XWV A;  4HW8 A;  2E1S A;  1PBQ A;  2XWI A;  3MYU A;  1LAH E;  1QVS A;  1P1U A;  4U22 A;  3LR1 A;  1IXC A;  1MXZ A;  3SEX A;  4NN3 A;  5T3J A;  1QUI A;  4ELQ A;  5I2K B;  1FQA A;  4Q5T A;  1SW2 A;  3ISP A;  3SES A;  3GXA A;  1SW1 A;  5I59 B;  5HPQ A;  1FJ9 A;  1FTJ A;  2V84 A;  3CIJ A;  1IZ1 A;  2G93 A;  5I7I A;  4R74 A;  1CE2 A;  3QUF A;  4DCX A;  2XA5 A;  1IXG A;  4NF6 B;  1MQH A;  3FIR A;  1LGB C;  1LBY A;  4HE2 A;  1JET A;  3UK4 A;  5ICT A;  3FBP A;  1USY H;  1O64 A;  4NF4 A;  5CBR A;  1JVY A;  3Q26 A;  3H6T A;  4OVS A;  2A5S A;  2QRY A;  2Y7W A;  3TCH A;  1LLS A;  3CVG A;  1FPK A;  4RXL A;  3TMG A;  3IAZ A;  3H6U A;  3FD3 A;  1MPD A;  2VP1 A;  2CZI A;  3OD7 A;  1N76 A;  2IEE A;  4QSD A;  4U23 A;  2DE3 A;  2ZZV A;  3VFJ A;  4JBZ A;  2X7P A;  1B3G A;  4F3S A;  4JSO A;  3B8B A;  1NUW A;  2WKY A;  3KOS A;  1F9B A;  3GBA A;  2ESN A;  3FVO A;  1D4N A;  2KQZ A;  4YKI A;  4PBH A;  4JVC A;  3A3C A;  3IB2 A;  3DLN A;  3LV0 A;  3RT8 A;  2ABH A;  4GOT A;  1B51 A;  1URG A;  1RYO A;  4DDD A;  3L6H A;  3HPI A;  2CZK A;  5I58 A;  4GLI A;  4G68 B;  2VPN A;  1B0L A;  2ZNU A;  4OTE A;  1MY0 A;  5CMB A;  3K4U A;  3HHF A;  2P1S A;  1PBP A;  3IJO B;  1YCJ A;  3FVK A;  4IGT A;  3P7I A;  1OQG A;  3LC8 A;  1SW4 A;  3MVX A;  2HZL A;  3DEL B;  2CMO A;  3PPO A;  3BFU A;  4LQ2 A;  1B5J A;  4H0W A;  1IMB A;  4YIC A;  2ZMB A;  1Y3P A;  2ZYK A;  5EHS A;  4ND9 A;  2F36 A;  4G61 A;  1SI1 A;  1OQH A;  4IY6 A;  4KPT A;  4GRK A;  1D9Q A;  4NAP A;  1O7T A;  5FHO A;  3OEL A;  1N04 A;  5H8F B;  5I5P A;  4P3L A;  2V25 A;  3K6W A;  1CB6 A;  2I58 A;  2QS1 A;  4F2O A;  3G7W A;  3HN0 A;  2WYK A;  3G3H A;  3IOV A;  4MJO A;  1OMP A;  5IM2 A;  4GF8 A;  2FNC A;  3K2D A;  3H3G A;  1INP A;  2VOZ A;  1NV4 A;  1B9J A;  2PFY A;  4F1Y A;  5AE4 A;  3OEN A;  1B05 A;  2CZH A;  1IIT A;  4G8H A;  1JEV A;  1RDX A;  5ITP A;  3VVF A;  2M8C A;  2ANJ A;  3JYR A;  3T0J A;  3VLV A;  4LVQ A;  5LTC A;  4DE8 A;  4U2R A;  1LBB A;  1MG1 A;  4R2B A;  4BDN A;  2RCB A;  3C35 A;  1MXY A;  5TU0 A;  1M5D A;  2ZNS A;  4OZ9 A;  4ELO A;  2H5Y A;  1Y20 A;  4PFI A;  5KCJ B;  3G3F A;  4UA8 A;  2WX9 A;  4MNP A;  3HHG A;  3K0V A;  4UAB A;  4G8N A;  4NQ8 A;  2G29 A;  2XX8 A;  4PAF A;  1LBW A;  1ZKB A;  4XIG Q;  1FPB A;  4AB6 A;  3H6V A;  1LCF A;  4QFK A;  1IME A;  1BKA A;  2P3N A;  1DTZ A;  2I0C A;  4GXS B;  4ESX A;  3RPL B;  2I6E A;  2OLB A;  2KR0 A;  4PAI A;  2OX3 A;  2DSF A;  4WED A;  2VD3 A;  4GWU A;  2B4L A;  3TTN A;  3EF7 A;  2HFB A;  2O68 A;  3TYH A;  4F1V A;  4LQ5 A;  2F6G A;  3B7D A;  4X8R A;  5H8Q A;  2DXR A;  1EU8 A;  1FBG A;  4PP0 A;  2XXW A;  3MST A;  4O94 A;  2RC9 A;  2XHD A;  2Y7R A;  4PGN A;  2F35 A;  2XXQ A;  2V3Q A;  3W9V A;  4F19 A;  3LSF B;  4NF0 A;  3I6V A;  3FUZ A;  1KA0 A;  3QMF A;  2AYS A;  4KYE A;  5HM4 B;  2OWZ A;  4POX A;  1PB8 A;  3ZS6 A;  1Q9D A;  1EYI A;  2QFL A;  4RPO A;  3Q27 A;  4MX6 A;  1FTK A;  2UVJ A;  2DOJ A;  4GWW A;  1I6B A;  1NFT A;  2QS2 A;  4ELP A;  2O51 A;  4NF5 A;  2JJK A;  1YTV A;  1Y3N A;  2REJ A;  1OLA A;  2V4C A;  2R9J A;  4QXD A;  1B5I A;  1WOD A;  3FJ7 A;  3R6U A;  2A5T B;  3WAE A;  1BP5 A;  1JVX A;  1B7H A;  3TOD A;  5I2N B;  2GQ1 A;  5H8N A;  5EQ8 A;  2NOO A;  1K9Y A;  3HFU A;  4KYD A;  4BLA A;  4O8M A;  3SZP A;  3VV5 A;  3C33 A;  3OXN A;  2PX1 A;  5F1Q A;  4GWX A;  4U1Z A;  1H3D A;  3CRB A;  4X9T A;  1Y1Z A;  1AIV A;  4ONY A;  4AS4 A;  2XXH A;  4N6K A;  4YU0 A;  1PDA A;  1M5C A;  3PPP A;  3RNN A;  1QGX A;  3RTF B;  1JP4 A;  5CMM A;  3KC1 A;  4TOZ A;  1B6H A;  2FIX A;  1FPE A;  3TQL A;  2BJJ X;  1FBF A;  4XEQ A;  4MFI A;  3U1O A;  4G8M A;  3BKI B;  2UVI A;  3S9N C;  4F3G A;  3K1M A;  1IMF A;  4I1D A;  4LAT A;  4YMB A;  2X7Q A;  2VT5 A;  4GX6 A;  5I57 A;  1BLF A;  1FPG A;  3MJN A;  5IZZ A;  2QS3 A;  2FVZ A;  5AA2 A;  4DXC A;  3KJ7 A;  3PTY A;  3TAJ A;  5FHM A;  1QKB A;  1QUL A;  4MMP A;  4HXV A;  4BDL A;  3KGC A;  3V5A A;  1TWY A;  3U72 A;  3TTM A;  5TPA B;  2HXR A;  1IMA A;  5LDZ A;  1MM6 A;  1Y4C A;  1P99 A;  5FTH A;  1LEV A;  4HE1 A;  3O29 A;  3K6U A;  3VXC A;  3C34 A;  4X04 A;  3IOU A;  4LZ5 A;  1MPC A;  1FBP A;  2PFZ A;  3CR9 A;  2CZL A;  2F5X A;  3KOT A;  5JTY A;  1S7Y A;  3KN3 A;  2DE2 A;  4N91 A;  3L6G A;  1SDX A;  2NWJ A;  2F97 A;  4DCY A;  2UYE A;  3B6Q A;  2RKM A;  4PF8 A;  1H44 A;  1DCU A;  3PMX A;  2D3I A;  4RK9 A;  3PPR A;  4XKN A;  1Z7N E;  5AA3 A;  2REG A;  1FBH A;  4GXA A;  1B2H A;  3HO7 A;  4I9D A;  3UGW A;  3UA8 A;  3FVN A;  4KFQ A;  4F3P A;  4PDH A;  4H6D A;  5K2X A;  4NMY A;  1XI6 A;  3T66 A;  4G4P A;  4ESW A;  3KSJ A;  3UP9 A;  1YYZ A;  2PT2 A;  2R6G E;  1AL3 A;  3O6I A;  3PPN A;  2DS9 A;  1GGG A;  3H03 A;  1NKX A;  5FHN A;  3TQW A;  2QL3 A;  1P1Q A;  3SDF A;  2HCA A;  1DPP A;  4JXI A;  4P47 A;  1MXU A;  5CMC A;  4NF4 B;  4GWO A;  4KR5 A;  4ZEB A;  2OZZ A;  1NNP A;  5JK4 A;  4ZEF A;  3IFC A;  1CNQ A;  4IR8 A;  1QJM A;  4MLV A;  4NED A;  1Y4T A;  4XTC Q;  5EYF A;  4AS5 A;  3IL1 B;  5B7D A;  3GLB A;  3E13 X;  1URS A;  4KD5 A;  1AWB A;  1KA1 A;  1I6Q A;  3UN6 A;  3K02 A;  1H76 A;  5DVI A;  2F3D A;  4EXK A;  4ZEC A;  4ELR A;  1RYX A;  4DI4 B;  5H8S A;  3KEI A;  3CFL A;  3LSW A;  2OWT A;  4GBV A;  5I58 B;  1S50 A;  4X48 A;  4MNI A;  4L17 A;  4IO3 A;  3M3K A;  5ELV A;  1LST A;  3BBR A;  2R8T A;  1M5E A;  3ILU B;  1EZP A;  3RN8 A;  1NMU A;  4PQJ A;  1PB7 A;  4OVQ A;  1XHY A;  3S9E A;  5IAI A;  4LN5 A;  4G68 C;  1DMB A;  2O1M A;  1FJ6 A;  2YPN A;  2BJI A;  4M1V A;  5ITO A;  2WEF A;  3FXB A;  1MS7 A;  4E0X A;  2AIX A;  2H98 A;  1SQY A;  4KCD A;  3MUQ A;  1LFG A;  4K3F A;  1FPL A;  4XFE A;  2PBW A;  2RCA A;  3PMV A;  1QKA A;  1JW5 A;  1FQC A;  2Y84 A; 
#chains in the Genus database with same CATH homology
 1NV1 A;  4PFI A;  2WX9 A;  4MNP A;  5EQ9 A;  1FTA A;  4UAB A;  4NQ8 A;  4O7M A;  4KXP A;  4PAF A;  4PTK A;  1LBW A;  4FBP A;  4PCD A;  1DK4 A;  2HPG A;  2Y5K A;  1NUZ A;  1NV7 A;  4MCO A;  4PFB A;  5J1D A;  1FPB A;  4PF6 A;  2P3V A;  4N17 A;  4N8G A;  1IME A;  2P3N A;  2DE4 A;  1IMC A;  3RPL B;  2MKZ A;  4PDD A;  1FPD A;  2KR0 A;  4PAI A;  2OX3 A;  4N6D A;  3A29 A;  2B4M A;  4O7I A;  4GWU A;  4MEV A;  5IZ1 A;  2B4L A;  4HCW A;  4OVR A;  2Q74 A;  1EYJ A;  4F1V A;  4X8R A;  5A5L A;  1FBG A;  3MST A;  4O94 A;  4H46 A;  5ET6 A;  1K9Z A;  4PGN A;  4MAG A;  1G0I A;  1FBE A;  2V3Q A;  4N81 A;  3W9V A;  4F19 A;  1NV2 A;  2ZZX A;  5IZ3 A;  2XXK A;  4OVP A;  1NV3 A;  2Q8M A;  4NF0 A;  4PAK A;  2QVV A;  2DVZ A;  3QMF A;  1KA0 A;  4PGP A;  3E78 A;  1LBV A;  3KBZ A;  2OWZ A;  5EQA A;  1FPF A;  1Q9D A;  1EYI A;  2QFL A;  4I3E A;  2FHY A;  4JVI A;  1RDY A;  4MX6 A;  1IMD A;  5EQ7 A;  5ET8 A;  4GWW A;  4OAN A;  2XWO A;  2PCR A;  2CEY A;  2JJK A;  4N4U A;  2V4C A;  4N15 A;  5CM6 A;  4QXD A;  5I3S A;  4I40 A;  4N8Y A;  2QVU A;  4NGU A;  1RDZ A;  3E79 A;  3ROJ A;  5F24 A;  4P1E A;  2GQ1 A;  5EQ8 A;  5DW8 A;  1K9Y A;  5IZ3 B;  2XWK A;  1LBX A;  3HFU A;  2WYP A;  4O8M A;  1FPJ A;  3SZP A;  4F18 A;  1NV0 A;  5J16 A;  4GWX A;  3RYD A;  5IGA A;  4NHB A;  3U65 A;  4X9T A;  4P1L A;  4AS4 A;  4N6K A;  2VPO A;  1DBZ A;  2DDK A;  2Y5L A;  4DI3 D;  1QGX A;  2HZK A;  4OA4 A;  1JP4 A;  1SPI A;  3KC1 A;  2QPQ A;  3B50 A;  2F3B A;  2FIX A;  1FPE A;  4MIJ A;  2WBB A;  1FBF A;  2FIE A;  4XEQ A;  2L5V A;  3EKI A;  3CHG A;  1IMF A;  2VT5 A;  4GX6 A;  4I3Y A;  3NOH A;  2XWV A;  1FPG A;  4GX4 A;  5IZZ A;  2FVZ A;  2XWI A;  3MYU A;  4P56 A;  1NV6 A;  2QVR A;  3PTY A;  4NN3 A;  5T3J A;  4MMP A;  4HXV A;  3ISP A;  4H45 A;  3T1B A;  3KC0 A;  4PFR A;  2HXR A;  1IMA A;  5LDZ A;  1FJ9 A;  4MNC A;  1KZ8 A;  1LEV A;  4HE1 A;  3LUZ A;  4X04 A;  1FBC A;  3GYY A;  5I7I A;  1FBP A;  2PFZ A;  2XA5 A;  2F5X A;  1LBY A;  4HE2 A;  3FBP A;  2DE2 A;  4N91 A;  4OVS A;  1FPK A;  4PF8 A;  1DCU A;  2FBP A;  1FBD A;  1YXI A;  1FBH A;  1FRP A;  2CZI A;  2DE3 A;  4PDH A;  2ZZV A;  4YZZ A;  3BIG A;  4PE3 A;  1XI6 A;  3B8B A;  1YZ0 A;  1NUW A;  1LBZ A;  5ET7 A;  4GX3 A;  4GWS A;  1YYZ A;  2ZZW A;  2KQZ A;  4QBA A;  4NG7 A;  5FBP A;  4PBH A;  4JVC A;  3LV0 A;  5EYH A;  4P47 A;  4GBW A;  2CZK A;  4NX1 A;  4PET A;  3D1R A;  2VPN A;  5JK4 A;  1FSA A;  2Q9T A;  3IFC A;  1CNQ A;  4P8B A;  1NV5 A;  4IR8 A;  3BIH A;  1FPI A;  4PBQ A;  2HHM A;  2HZL A;  4JVD A;  4AS5 A;  4F1U A;  1IMB A;  4YIC A;  4GWZ A;  4P9K A;  1VDW A;  1AWB A;  4G61 A;  1KA1 A;  4HCY A;  2WBD A;  2F3D A;  5ET5 A;  1D9Q A;  4NAP A;  4DI4 B;  1NUX A;  1G0H A;  5I5P A;  4P3L A;  1NI9 A;  4GBV A;  1EYK A;  4MNI A;  5EYG A;  2WYK A;  3W9W A;  2CEX A;  2R8T A;  4MJO A;  5IM2 A;  1INP A;  4OVQ A;  4LN5 A;  3RPL A;  5ESY A;  1NV4 A;  4HE0 A;  1FJ6 A;  2BJI A;  4M1V A;  2WEF A;  3FXB A;  2PFY A;  4GWY A;  2CZH A;  1NUY A;  1RDX A;  4PC9 A;  4OVT A;  1FPL A;  4XFE A;  3IFA A;  1BK4 A;  3T0J A;  5LTC A;  4XF5 A;  4MHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...