5IGAA

Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with co-purified parahydroxybenzoate
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
320
structure length
320
Chain Sequence
SMEVVLKFHSFPPMPANSNAKFVKPWSEKVLAESNGEIKVEIYPAMQLGGKPPQLVDQVRDGVVDIVWTVAGYTPGRFPHLEAFELPFMPASAEATSQALQEYVDTVAASDLKDYKVLAVFCHAPGKIHTKEKVIASAADLNGMKMRGPTRVITKMLEGLGATPVGMPVPAVAGALSKGVIDGMVVPWEIMPSFKLHELTAAHTTVSGSRGLYTTPFLFLMNKAKYESLSDEHKKVIDNNAGLALAKLAGQLWDGFEVPARKLALDAGGTIHSLSGGPLAEMKAAGEGLEADWIKSANDRGLDGAMLVKTAKDLISKYDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a marine metagenome TRAP solute binding protein specific for aromatic acid ligands (Sorcerer II Global Ocean Sampling Expedition, unidentified microbe, locus tag GOS_1523157, Triple Surface Mutant K158A_K223A_K313A) in complex with co-purified parahydroxybenzoate
rcsb
source organism Uncultured bacterium
molecule tags Transport protein
molecule keywords TRAP TRANSPORTER SOLUTE BINDING PROTEIN
total genus 108
structure length 320
sequence length 320
ec nomenclature
pdb deposition date 2016-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 5igaA00
4OVSA 4PAFA 4PFIA 4N91A 4PGNA 2ZZXA 4OVPA 5I5PA 2ZZWA 4O94A 4P47A 4XF5A 4MNPA 4PF6A 2XWVA 4PDHA 5IGAA 4N8GA 5IM2A 2CEYA 4MEVA 4PFBA 3GYYA 4MHFA 4NX1A 2WX9A 4DI3D 4O7MA 4MNCA 4MX6A 4O8MA 4PAKA 4OVRA 3U65A 4N6KA 3FXBA 4N6DA 4PF8A 4LN5A 2PFZA 2VPNA 2WYPA 4X04A 2HZLA 2ZZVA 4NAPA 4NQ8A 2XWKA 4MAGA 2XWOA 2VPOA 4PAIA 4PBHA 2XA5A 4PGPA 4X8RA 4OANA 5LTCA 4PCDA 4N8YA 2XXKA 4YICA 4N15A 2CEXA 2XWIA 4NHBA 4MCOA 4P56A 4XEQA 4NG7A 4PDDA 4MNIA 4YZZA 2PFYA 4P8BA 4P9KA 4P3LA 2HZKA 4PE3A 5IZZA 4PFRA 2HPGA 4MMPA 5CM6A 4DI4B 5I7IA 4PETA 2WYKA 4PBQA 3B50A 4UABA 4NGUA 4NN3A 4OA4A 4PC9A 4P1EA 4NF0A 4P1LA 4XFEA 4N17A 4MIJA 4OVQA 2V4CA 4OVTA 4N4UA
chains in the Genus database with same CATH superfamily
1PB7A 4F3BA 1DSNA 1SPIA 1BLFA 2A5TB 3PD8A 1IEJA 1Y20A 3HV1A 1EH3A 4HE1A 4FAJA 1R6ZA 3HFUA 4G77A 2OZZA 4O3CA 3GZGA 3T0JA 2XWVA 2Q2AA 1HSJA 4OENA 3CI8A 4G8HA 5CC2A 3ECRA 1UIUA 5IM2A 5CMMA 1FPEA 2Z8DA 3S2VA 4ZECA 3FVKA 3O97A 2GRVA 2D3IA 4Z7EA 3OO9A 4PAKA 1H45A 2XXYA 3PUYE 1QULA 4I1DA 4PF8A 2NWJA 3UK4A 2MKZA 4X04A 3E79A 1UQWA 5HM4B 2WKYA 5ET7A 5FHOA 3CIJA 2Y84A 2PT1A 4PBHA 4JBZA 4DLDA 2QS1A 4N8YA 1K9ZA 1LAHE 1POTA 2XXTA 3FATA 3O6GA 4OESA 2ZNSA 2X7QA 1XVXA 4RXLA 4XXUA 1R9LA 5ITPA 4Q8RA 1US4A 4HXVA 2B4MA 1D9QA 3SKPA 4P8BA 4H65A 4LQ2A 4OHNA 4AQ4A 1B52A 5H8NB 3ODBA 4MMPA 4XKQA 3U94A 1GR2A 3CVGA 1NV3A 4MF3A 4HCYA 1FQDA 4RYAA 2GH9A 2ALUA 4G68C 1FTAA 1H44A 4YB5A 1NUXA 1Y3NA 1LCTA 3OSQA 3EHTA 4N4UA 3DP4A 1SYHA 2P0SA 4U1OA 3G3GA 1QJMA 4KXPA 3FUZA 2BJIA 3LUYA 4O3BA 1M5BA 3E3KA 3MQ9A 3PTYA 1FTLA 4BDLA 3NOHA 3KC1A 3MWBA 3GBAA 5CMKA 5CBRA 1MDP1 4QBAA 1N0TA 4H6DA 1MY3A 3OELA 5TP9B 4ELPA 1N3XA 2QVUA 4YKKA 3S9LC 4TOZA 3TEPA 4O8MA 4RK2A 1JEUA 3B8BA 1N76A 2GQ1A 1NUWA 1H76A 2HAUA 2HZLA 4LATA 2ZZVA 4MAGA 1IXIA 2DVZA 4BLAA 3FJGA 1MXWA 4WKMA 1ZU0A 3K6XA 3GBBA 4OEVA 1NL5A 2UVGA 3KEIA 1YPNA 5KCJA 4KPTA 3CR9A 3QXMA 4O7IA 4MLVA 3IORA 3IOTA 2Q89A 1NNKA 1SVXB 2O51A 2F3BA 2JJKA 1QUJA 5T3JA 1SYIA 2I4CA 3D4CA 2VGQA 2LAOA 3O28A 1LBCA 2DOJA 1JW5A 2O1LA 1B0LA 4X9TA 4LZ5A 4EQBA 3PPPA 3PPRA 1FJ9A 2DP8A 3PUWE 4JWXA 5DVIA 3B7DA 1JW4A 3W9VA 1ZTYA 3MZ9A 4IY6A 1VDWA 4Q30B 3B6TA 1KA1A 4PF6A 4NF4A 1RDXA 4F31B 4YB6A 1A55A 3OO6A 4ZS9A 1HSEA 1KWHA 3TCHA 1NI9A 3VXBA 1SBPA 5KDTB 2F3DA 3RNNA 5I59B 4YKIA 1JP4A 2FYIA 1B7HA 2I49A 2VOZA 2G29A 1FPIA 4F1VA 4YKJA 3C35A 3H6WA 4NQ8A 3LV0A 2WBBA 3ISPA 2IEEA 2B4LA 2A5SA 2XD2A 3PMVA 3RT6B 2UXAA 1PDAA 2F97A 2CEXA 2BJJX 4U4XA 1GTKA 4OFJA 1YYZA 3FJ7A 4U23A 2ZYNA 1MH3A 4QRZA 3P7IA 2NOOA 2I6EA 2F34A 5EHMA 3R7XA 1P1WA 1MY1A 5CM6A 4GX4A 1DMBA 5DEXB 1MS7A 4F2QA 4MIJA 4I62A 3LSWA 4K3FA 3S4UA 4XTCQ 1QGXA 1NUYA 1B5HA 1JQFA 1EYKA 1H43A 2ONSA 4LVQA 3K0VA 3FASA 3TYHA 1PEBA 5H8HB 1FQEA 1PC3A 3FXQA 4R2FA 4IGTA 4MHFA 2WX9A 4XKRA 4DI3D 4P0IA 3TQLA 1SW1A 5CI5A 1DK4A 1ANFA 4HTGA 1MXUA 2ZMBA 4R72A 3BFUA 4LN5A 1WDNA 1MQIA 1JVYA 4OZ9A 1JETA 4X48A 3H7MA 3LSFB 2P3VA 1PBQA 4PAIA 3RPLB 4PGPA 3TTKA 4JXIA 1EZPA 1IXCA 2NXOA 4R6YA 5H8SA 3JYRA 2AL5A 2REGA 4DCXA 4YZZA 2XXIA 5H8FB 4ZZAA 1B5IA 5TPAA 3EPEA 4LA9A 4P0GA 4H8JA 4JB7A 1QUIA 4NF8B 1IMCA 3K1MA 4ZEIA 4NWCA 2GHBA 3V83A 2XX8A 1INPA 3G3FA 4LZ8A 5J1DA 3T96B 2X26A 5AA4A 3EHSA 3FV1A 3N26A 4R9FA 5IZ1A 2ZZXA 3UGWA 5IAIA 5I5PA 2DQVA 4HCWA 4H5FA 4OTEA 2PMSA 1Y4CA 3TELA 2H9BA 3SEXA 1XS5A 4NF5B 3CSBA 5F24A 2OWTA 3H4ZA 4NWDA 1D4NA 2Q88A 4PFYA 3T66A 2V25A 1UTBB 1NH7A 3C36A 4N6PA 1LLSA 3FXBA 3H6VA 2XXUA 3FV2A 1RDZA 1XI6A 2I48A 3MVXA 1LBZA 1DCUA 1USYE 2CMOA 4MJOA 5I2KB 1R1NA 3HCQA 5F1QA 5AA1A 4G2ZA 1H3DA 1IMEA 4XKNA 4GVOA 1FTKA 3CFXA 3IB1A 2QVVA 4HS7A 3MSTA 1PBPA 4XEQA 5ET5A 5J16A 1LAFE 4LUBA 1FW0A 2DSFA 3KG2A 3MC2A 5AA2B 4ELQA 5EQ9A 1I6QA 3TTLA 2HHMA 2DS9A 5KCJB 3GLBA 1CB6A 4DI4B 5I7IA 1MQJA 4M1VA 1USYH 1FBPA 4QSDA 4ZDMA 3MJNA 5I56A 1I6BA 2QS4A 1AH5A 2DXRA 1I69A 2ABHA 4N17A 4U4SA 4OVQA 3RGYA 1OLAA 2QVRA 4FBPA 1NV5A 3JV9A 2ZZWA 3ILUB 3SZPA 4XF5A 3WAEA 1A40A 5L9OA 3SESA 1MQHA 1NMUA 5JEIA 5LDZA 1MQDA 4ZEFA 1SI0A 1FBHA 3CFZA 2F6PA 3I6VA 5ITOA 1ZMGA 3THIA 4MNCA 2I3WA 1D3KA 4I3YA 4AB5A 3M3KA 3FXUA 1ZKBA 3QIMA 3RY3A 3KZGA 3RTFB 2WYPA 1IITA 5A5XA 1AWBA 3HN0A 2R8TA 2XWKA 1EU8A 4R9GA 1B3FA 5AA3A 4ONYA 1P1UA 4ESWA 2QL3A 1B2HA 1US5A 5HPQA 1N04A 1FQAA 3KFMA 2OBGA 2O6AA 3CSGA 4H46A 3MAMA 2PFYA 1MXZA 2XXQA 1URSA 3H3GA 1DPEA 3CG3A 3H03A 3MYUA 1B9JA 3IB2A 2Y5KA 4GF8A 4TLLB 4E0XA 4NTLA 2NUVA 4N81A 4G68A 4QFNA 2UYEA 1R9QA 4GX6A 4R2BA 1ATGA 5I57A 2QRYA 3R6UA 2E1SA 3MP8A 1VR5A 4YMAA 1BK4A 2DE3A 1SDXA 2PT2A 3PMXA 3O6HA 1VSOA 1Z7NE 4OVPA 4QFKA 4AS5A 4JVIA 1IMDA 5B7DA 3DELB 1BP5A 4ESXA 4ELRA 3PPQA 4YU0A 3TFLA 2HEUA 3SEYA 1FPLA 1SW2A 2X7PA 5DYHA 3CG1A 1XOCA 1B1HA 1URGA 3MVYA 3QYTA 4QSCA 3S9NC 2FHYA 1MXVA 5H8HA 2F7CA 4EF2A 4OQOA 3O9PA 2FIEA 3JZJA 3TCGA 4HE0A 2XWOA 4H45A 1RDYA 4LQ5A 2HCAA 4PCDA 4L17A 1B3HA 1B32A 1LSTA 5DVFA 1FPGA 2DWAA 2XXVA 1JW1A 1DOTA 3DLNA 1B40A 4TLMB 1XHYA 4MNIA 2B65A 2R6GE 1B1XA 4FE8A 3T93B 4OXVA 3M8UA 2HZKA 3MW0A 3Q26A 3RTWB 3A29A 4KR5A 1AIVA 4KYSA 2Y7IA 1ZIUA 4ZEBA 3MPLA 4PBQA 3RUMA 4ZEDA 3EHUA 3T9HB 2H98A 3QUJA 3EQ1A 2KQZA 5EYHA 3KN8A 5DT6A 1AOVA 5CMCA 2UVJA 4NX1A 3VLUA 1UTHB 3FD3A 3FGSA 5ELVA 3T1BA 1FQFA 4EQ9A 4PDHA 1FPJA 2F6GA 1QUKA 4N8GA 3IR1A 1JNFA 4RPOA 4N07A 1CNQA 1B51A 1LBBA 3FJMA 3PUZE 3IJXB 3L6HA 4OVJA 5AA4B 1QVSA 4KHZE 4GFRA 4IO5A 2OWZA 4JVCA 4NF6B 3TQWA 2RCBA 4N6DA 4XIGQ 3PPNA 1N7XA 4HE2A 3KSXA 4FORA 3E4RA 1O7TA 4AS4A 1PB9A 4NF5A 3SETA 4GXSB 4NE4A 2I58A 2AYSA 4X8RA 3ZKKA 5L8DA 3MPKA 2P3NA 2ZNTA 2WEFA 3KJ7A 4EXLA 2RCAA 4JWYA 1LB8A 3TAJA 2QSXA 4QFLA 3D1RA 5HBCA 5I3SA 4MCOA 1ZBMA 2HFBA 2ZYMA 1FBGA 1TWYA 3PMWA 1GGGA 3QAXA 1AMFA 3HHFA 1B6HA 1FBCA 3IO4A 3A3CA 3L6GA 5DVJA 4ZEKA 2WYKA 1AL3A 4EQ7A 4AB6A 2DYXA 2ONKE 3T9VA 3BKIB 4JSOA 3PUVE 1MXXA 1Y4TA 2V93A 1FQBA 3S9MC 3C34A 4ECFA 2Q74A 4YB7A 3OEKA 3C33A 4R73A 4Z0IA 2V3QA 4PP0A 2DDKA 1BTJA 2OX3A 3DM0A 2UYFA 2RKMA 1WVJA 1MG1A 1D9YA 1B5JA 3OMBA 1D9VA 1OVBA 3FIRA 1S7YA 4OFOA 4GQOA 4PE5B 2GFEA 3UP9A 1VFEA 3W15C 5L9MA 1NV6A 4NF4B 4YKPA 2XXXA 3TZAA 4IO3A 2QFLA 1GVCA 1DPPA 3WAFA 1LBVA 2Q9TA 4RJZA 3K02A 2D21A 1BIYA 5K2XA 4IB2A 4FATA 3MP1A 1SI1A 3FXRA 1NUZA 2B3FA 1VFDA 2AL4A 3DP6A 4OETA 1B3LA 5DEXA 1FBFA 3OO7A 1FPFA 1A7LA 2DVCA 2VT5A 4FECA 4JDFA 2A5TA 4KCDA 3LR1A 4DIGA 3O2AA 3VE1B 5EQ8A 4ZE9A 3TMGA 5AE4A 2RC9A 4DXUA 3E9XA 3K1NA 3KGCA 3IOUA 3PD9A 2VD3A 4P1LA 4XFEA 4G4PA 4GRKA 3K6VA 4KI0E 4OVSA 2F35A 3A09A 3LUZA 2V84A 4GIZA 3C9HA 2F5XA 4MNPA 2D5WA 3CRBA 4IGRA 3MUQA 1MH4A 4GL0A 4BDOA 4DE8A 5H8QA 1RKMA 1NV4A 4GWXA 3FVOA 3O6IA 4EF1A 3SDFA 4EXKA 4X1DA 2ESNA 2R71A 3ROJA 4F18A 2I0CA 2QMWA 3OENA 3IFCA 3C4MA 1J1NA 3KN3A 5EQAA 3G3JA 5DTBA 2OK2A 1EYJA 3E78A 2FVZA 4F39A 1LBXA 3QK6A 4N15A 2RC7A 5KDTA 3R26A 3FBPA 4ND9A 3G3KA 2NVUB 2XXRA 5IZ3A 3U1OA 1FPBA 2XXPA 3M3FA 4ISUA 3MVZA 3MZBA 3BFTA 5BUUA 3OD7A 2Q8MA 1M5CA 3KBZA 4PE3A 4U2RA 1T0KA 4MBPA 3LSXA 1OQGA 2DE2A 2Y7PA 3TCFA 1IMBA 4POWA 1O64A 4JSDA 1IMAA 4GWYA 5EYGA 4KYEA 4PC9A 1OIBA 1Y3PA 3SEUA 1MQGA 2UVHA 5TP9A 5H8FA 3GXAA 4PFWA 1NNFA 2O68A 4PAFA 3KN7A 4P47A 3ILTB 4KFQA 5FTHA 3C32A 1SW4A 1UIVA 3OO8A 1DBZA 3IL1B 3VVFA 5EHSA 4BDQA 2QPQA 2I3VA 2ZYOA 4WXJA 4KD5A 1LCFA 3I3VA 4BDMA 4DZ1A 2DXYA 2KLFA 1P1QA 4H8IA 4OVRA 2PVUA 2VD2A 4NEDA 1MDQA 3I5OA 5ET6A 2F8DA 3T9XB 5FBPA 3VDFA 3K1PA 4U1ZA 2Y5LA 1FTJA 4QHQA 4UA8A 2YJPA 1Z7ME 5LTCA 4G8MA 1L5TA 3QMFA 5H8NA 4PFTA 3LC8A 4DCYA 1B3GA 3FZVA 4GWSA 4OFLA 5F7VA 3VLWA 1M5EA 3RQTA 2YLNA 3OEMA 3ONMA 4IO2A 4LP2B 3V5AA 5BWJA 2O7IA 1IIWA 2UVIA 5FHMA 1FRPA 1Y9UA 3M3LA 4GWUA 4LONB 1OQHA 5EQ7A 2B3BA 1EZ9A 3E13X 3OOAA 4NN3A 2OWSA 1SD3A 1NH8A 4NF0A 2DWIA 4RY1A 2PX1A 4TQUQ 2ONRA 5AA2A 2R9JA 4JWOA 3SEVA 4KYDA 4N91A 3FVNA 2FA7A 5M2VA 4I9DA 3Q29A 2FBPA 2Y7KA 3CHGA 3ZSFA 4PFBA 3GYYA 3HO7A 2O1MA 3Q25A 5I2NB 1FTMA 4ELOA 2QS3A 1JVXA 1EZOA 4X1BA 5JTYA 4WEPA 4ZZEA 5KZTA 3G7WA 3IOVA 3IX1A 1QKBA 1N7WA 3VV5A 4OMBA 2Q2CA 2G93A 3RT8A 4THIA 2QJEA 1B46A 1NNPA 2V3UA 1B05A 1A8FA 3W9WA 5ICTA 4GD5A 5IKBA 2DWHA 1JEVA 1POY1 1IMFA 1NV7A 4P56A 1ZJLA 4NG7A 4KCCA 4EUOA 2F7AA 3TTNA 1NFTA 2OLBA 1XVYA 1QKAA 3TDJA 5ISUA 2Z22A 4P9KA 1LFGA 4FEBA 1NV2A 3V8XB 4QFOA 4GX3A 2CZLA 4R6HA 1Y1ZA 3D4GA 4P11A 4OWDA 2PCRA 3MP6A 1QW0A 4H1XA 3QUFA 1LBWA 4H67A 5I59A 2IA4A 1FPKA 1SQYA 2XX9A 3MVWA 3T22A 4I3EA 2AIXA 4G68B 1IXHA 4GWZA 4QF9A 2KR0A 3UN6A 4F1YA 3IO6A 5CBSA 3OSRA 1LGBC 1IUDA 2CEYA 4MEVA 5I56B 1S50A 1LB9A 4RPNA 4EDPA 4F3SA 5I57B 3CFLA 3KBRA 4MLQA 5L9SA 1B4HA 4YMBA 2RINA 2QMXA 4MX6A 2YPNA 1P99A 1MPDA 4R74A 3A3UA 2P2AA 3N6TA 3B6QA 4HW8A 2HQ0A 3K6WA 3BIGA 3K00A 2HAVA 3G3IA 1NNTA 1MY4A 1NV0A 3TUSA 1NKXA 2Z23A 3KC0A 5K2YA 1RYOA 1MM6A 3U72A 1B3EA 4NF8A 3G3HA 4GBVA 2Q8JA 1Q9DA 3KSJA 5I58B 2O84X 4PDDA 5A5XB 3KOTA 4GLIA 4OYVA 1FPDA 2QS2A 2PYYA 2ZXTA 4JVDA 3IB0A 4PFRA 4GWWA 1G0HA 3T9UA 2HPGA 4PETA 4BDNA 5IZ3B 2ANJA 4QSEA 1TT1A 2V3TA 1MXYA 3O66A 2V4CA 1UTBA 1LEVA 4PGNA 5TU0A 1CE2A 5B70A 4RK9A 2Y7RA 4UACA 2XXHA 3TTMA 3B6WA 2CZIA 2OCUA 1FBDA 2Z8EA 5LOMA 2P1SA 1EYIA 4WEDA 1XT8A 1UTHA 2DWJA 4LZ7A 3KJTA 3OXNA 2PFZA 2VPNA 1A54A 1YAEA 1FTOA 3K6UA 1IQ7A 4E0WA 5I84A 3TTRA 1IZ1A 4QXDA 3Q27A 1NV1A 2XXKA 2CZKA 4GOTA 4FEDA 1P1NA 1XC1A 4YAHX 4NF6A 1LAGE 3FVGA 3K4UA 4F2OA 1MPCA 3H06B 4IO6A 3C31A 3VLVA 1II5A 2O7UA 4DXBA 4Q5TA 4FJPA 3RPLA 1MM7A 1MPBA 1YCJA 4DDDA 1N84A 1M5DA 1OVTA 1LAXA 4R75A 2HXRA 3U93A 1I6AA 5ICQA 1N3WA 3K2DA 1MY2A 5CRYA 5AA2D 4RA1A 3RN8A 1SW5A 3ZS6A 1P1OA 3N94A 1MY0A 4IO7A 1A99A 2M8CA 4O94A 3PGFA 2XX7A 5TPAB 3UORA 3TKDA 3K01A 3N6UA 3TPAA 4GXAA 5IGAA 1G0IA 2ZYKA 1F9BA 4POXA 3PUXE 3UA8A 4MH5A 2FIXA 4I40A 5FTIA 1YZ0A 1Q1KA 1TFAA 4RNSA 5ET8A 2XD3A 4M4GA 2F78A 1YXIA 1TFDA 4F29A 3MZ1A 3Q28A 5CMBA 1B4ZA 1HSLA 1MRPA 4DXCA 3PU5A 4NAPA 4IO4A 1IXGA 3BBRA 2WBDA 4PTKA 1M5FA 1BKAA 1OLCA 2XA5A 5I2NA 4G8NA 1Y1MA 2L5VA 1OMPA 3IJOB 4F3PA 5ESYA 1B7UA 2RF1A 3HHGA 4GL8A 3IAZA 2XWIA 3SERA 5JTYB 2RC8A 3DP8A 1WODA 4O3AA 3PV0E 4Q0CA 4ZE8A 5I2KA 2F36A 1B7ZA 2VP1A 2REJA 4P3LA 4IR8A 3U92A 1DTZA 1LFIA 1TXFA 1B0HA 2GHAA 1FJ6A 2DE4A 4N13A 1FSAA 3ZKLA 2PBWA 3SEWA 2H25A 1A8EA 3B50A 4NGUA 4P1EA 3IK6B 4PQJA 4F3GA 2ZNUA 1FQCA 5H8QB 3UIFA 3S9EA 3EKIA 5FHNA 3U8QA 4MFIA 4PFIA 4GWOA 4F19A 2CZHA 3VXCA 4NMYA 1S9TA 3H6UA 3N5LA 5DW8A 3EF7A 4OEUA 3HSTA 4C1TA 2I0BA 3VVDA 4H5GA 2F7BA 2XXWA 2O69A 3O29A 5EYFA 4O7MA 1VE4A 2XHDA 3U65A 2THIA 4N6KA 4FIMA 3LBSA 2H5YA 3KOSA 1URDA 5A5LA 1FCKA 3RLFE 4F22A 1DTGA 1B58A 1KZ8A 3VVEA 4R6KA 1ZLQA 3VFJA 1LBYA 4H0WA 3RPWA 2VHAA 2VPOA 3LSLA 1Q35A 1PB8A 4U22A 1LFHA 3MBPA 1FBEA 2W7YA 4OANA 3EN3A 3V89B 4YICA 1RYXA 4I8CA 1KA0A 3IFAA 1GV8A 2HXWA 4KQPA 4NHBA 2H99A 4BDRA 2Z8FA 3H6TA 5JK4A 3RYDA 4PFUA 2H4IA 4C0RA 3F11A 3PPOA 4U21A 3AXFA 2Y7WA 4GBWA 4QFPA 2E0SA 3USDA 3TODA 1YTVA 4IY5A 5IZZA 2FNCA 3QSLA 4OERA 2I4BA 4XKPA 4F1UA 1Y3QA 1K9YA 4C1UA 4UABA 1O63A 1ELJA 4OA4A 2OJTA 5I58A 3IOWA 4G61A 3HPIA 4OVTA 3BIHA
chains in the Genus database with same CATH topology
2QVRA 4OVSA 4PAFA 5IZ1A 1SPIA 4FBPA 1QGXA 4PFIA 1LBWA 1NV5A 1LEVA 1NUYA 2Q74A 3LUZA 4N91A 4PGNA 2CZHA 4F19A 2ZZXA 1EYKA 4KXPA 4OVPA 4HE1A 2BJIA 1FPKA 2ZZWA 3T1BA 4O94A 4HCWA 4P47A 1VDWA 4JVIA 3HFUA 2V3QA 1IMDA 2F5XA 3PTYA 4XF5A 3SZPA 3T0JA 1KA1A 2DDKA 4MNPA 4PF6A 5DW8A 2XWVA 4I3EA 4PDHA 2OX3A 3NOHA 1FPJA 1RDXA 4GWZA 2KR0A 2FBPA 5IGAA 3KC1A 1DBZA 1G0IA 4N8GA 3CHGA 5IM2A 2CZIA 1FBDA 2CEYA 4MEVA 1CNQA 4PFBA 2QPQA 3GYYA 5F24A 4MHFA 4NX1A 4AS5A 5LDZA 1FBHA 1FPEA 1FPLA 4QBAA 2FIXA 4I40A 1YZ0A 1NV4A 2WX9A 4GWXA 4DI3D 1EYIA 1NI9A 4O7MA 2QVUA 4MNCA 4MX6A 4AS4A 1DK4A 2OWZA 4O8MA 4JVCA 4PAKA 5ET8A 2F3DA 3ROJA 3B8BA 4I3YA 4OVRA 3U65A 4N6KA 3FXBA 4N6DA 4F18A 1JP4A 3W9VA 1YXIA 2GQ1A 1RDZA 4PF8A 5A5LA 1NUWA 1XI6A 4LN5A 3IFCA 1LBZA 1FPIA 2MKZA 1NV6A 2PFZA 2VPNA 1DCUA 2FHYA 2HZLA 2WYPA 3E79A 4F1VA 5ET6A 2ZZVA 5EQAA 4MJOA 1KZ8A 4NAPA 4X04A 5ET7A 1AWBA 3BIGA 2R8TA 2P3VA 4NQ8A 5FBPA 2FIEA 2XWKA 3LV0A 1LBYA 4MAGA 2QFLA 4HE0A 2WBBA 2XWOA 2VPOA 1RDYA 1LBVA 2DVZA 2WBDA 3ISPA 4H45A 4PAIA 4PTKA 2Y5LA 2Q9TA 2B4LA 4QXDA 1NV0A 3RPLB 4PBHA 2XA5A 4PGPA 1FBEA 4X8RA 1IMEA 2L5VA 3KC0A 4OANA 4PCDA 5LTCA 1NV1A 2XXKA 4N8YA 4YICA 4N4UA 1K9ZA 1EYJA 2CZKA 3E78A 2FVZA 2P3NA 1LBXA 3QMFA 1KA0A 4N15A 2WEFA 3IFAA 5ESYA 3W9WA 2CEXA 1NUZA 3FBPA 1IMFA 1FPGA 4GWSA 4GBVA 4O7IA 5IZ3A 1NV7A 1YYZA 2QVVA 2XWIA 4HE2A 1FPBA 3D1RA 5I3SA 3MSTA 4MCOA 4NHBA 1Q9DA 4P56A 4XEQA 5ET5A 4NG7A 4PDDA 4H46A 1FBFA 5JK4A 4MNIA 1FPFA 3RYDA 4YZZA 5J16A 2PFYA 1FBGA 2VT5A 4HXVA 1FPDA 2B4MA 1D9QA 4P8BA 2F3BA 4JVDA 2JJKA 4GBWA 5EQ9A 5T3JA 4P9KA 4P3LA 3RPLA 2Q8MA 2HZKA 4IR8A 3KBZA 1FBCA 3MYUA 4PE3A 5IZZA 4PFRA 2Y5KA 4GWWA 1FRPA 1NV2A 2HHMA 3A29A 1G0HA 2DE2A 4GWUA 2HPGA 4MMPA 5CM6A 5EQ8A 4DI4B 5I7IA 1FJ6A 2DE4A 2HXRA 2PCRA 4PETA 1FSAA 4N81A 2WYKA 5EQ7A 4X9TA 1IMBA 4M1VA 1IMCA 4F1UA 4PBQA 1K9YA 4GX3A 3B50A 4UABA 4GX6A 1FBPA 5IZ3B 4NGUA 4NN3A 4OA4A 1IMAA 4GX4A 4GWYA 1INPA 1NV3A 5EYGA 5I5PA 4PC9A 4P1EA 4HCYA 4NF0A 1FJ9A 5J1DA 4P1LA 4XFEA 2KQZA 4G61A 1FTAA 4N17A 5EYHA 1NUXA 4MIJA 4OVTA 4OVQA 3EKIA 2V4CA 1BK4A 3BIHA 2DE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  4PAF A;  4PFI A;  4N91 A;  4PGN A;  2ZZX A;  4OVP A;  5I5P A;  2ZZW A;  4O94 A;  4P47 A;  4XF5 A;  4MNP A;  4PF6 A;  2XWV A;  4PDH A;  5IGA A;  4N8G A;  5IM2 A;  2CEY A;  4MEV A;  4PFB A;  3GYY A;  4MHF A;  4NX1 A;  2WX9 A;  4DI3 D;  4O7M A;  4MNC A;  4MX6 A;  4O8M A;  4PAK A;  4OVR A;  3U65 A;  4N6K A;  3FXB A;  4N6D A;  4PF8 A;  4LN5 A;  2PFZ A;  2VPN A;  2WYP A;  4X04 A;  2HZL A;  2ZZV A;  4NAP A;  4NQ8 A;  2XWK A;  4MAG A;  2XWO A;  2VPO A;  4PAI A;  4PBH A;  2XA5 A;  4PGP A;  4X8R A;  4OAN A;  5LTC A;  4PCD A;  4N8Y A;  2XXK A;  4YIC A;  4N15 A;  2CEX A;  2XWI A;  4NHB A;  4MCO A;  4P56 A;  4XEQ A;  4NG7 A;  4PDD A;  4MNI A;  4YZZ A;  2PFY A;  4P8B A;  4P9K A;  4P3L A;  2HZK A;  4PE3 A;  5IZZ A;  4PFR A;  2HPG A;  4MMP A;  5CM6 A;  4DI4 B;  5I7I A;  4PET A;  2WYK A;  4PBQ A;  3B50 A;  4UAB A;  4NGU A;  4NN3 A;  4OA4 A;  4PC9 A;  4P1E A;  4NF0 A;  4P1L A;  4XFE A;  4N17 A;  4MIJ A;  4OVQ A;  2V4C A;  4OVT A;  4N4U A; 
#chains in the Genus database with same CATH topology
 1PB7 A;  4F3B A;  1DSN A;  1SPI A;  1BLF A;  2A5T B;  3PD8 A;  1IEJ A;  1Y20 A;  3HV1 A;  1EH3 A;  4HE1 A;  4FAJ A;  1R6Z A;  3HFU A;  4G77 A;  2OZZ A;  4O3C A;  3GZG A;  3T0J A;  2XWV A;  2Q2A A;  1HSJ A;  4OEN A;  3CI8 A;  4G8H A;  5CC2 A;  3ECR A;  1UIU A;  5IM2 A;  5CMM A;  1FPE A;  2Z8D A;  3S2V A;  4ZEC A;  3FVK A;  3O97 A;  2GRV A;  2D3I A;  4Z7E A;  3OO9 A;  4PAK A;  1H45 A;  2XXY A;  3PUY E;  1QUL A;  4I1D A;  4PF8 A;  2NWJ A;  3UK4 A;  2MKZ A;  4X04 A;  3E79 A;  1UQW A;  5HM4 B;  2WKY A;  5ET7 A;  5FHO A;  3CIJ A;  2Y84 A;  2PT1 A;  4PBH A;  4JBZ A;  4DLD A;  2QS1 A;  4N8Y A;  1K9Z A;  1LAH E;  1POT A;  2XXT A;  3FAT A;  3O6G A;  4OES A;  2ZNS A;  2X7Q A;  1XVX A;  4RXL A;  4XXU A;  1R9L A;  5ITP A;  4Q8R A;  1US4 A;  4HXV A;  2B4M A;  1D9Q A;  3SKP A;  4P8B A;  4H65 A;  4LQ2 A;  4OHN A;  4AQ4 A;  1B52 A;  5H8N B;  3ODB A;  4MMP A;  4XKQ A;  3U94 A;  1GR2 A;  3CVG A;  1NV3 A;  4MF3 A;  4HCY A;  1FQD A;  4RYA A;  2GH9 A;  2ALU A;  4G68 C;  1FTA A;  1H44 A;  4YB5 A;  1NUX A;  1Y3N A;  1LCT A;  3OSQ A;  3EHT A;  4N4U A;  3DP4 A;  1SYH A;  2P0S A;  4U1O A;  3G3G A;  1QJM A;  4KXP A;  3FUZ A;  2BJI A;  3LUY A;  4O3B A;  1M5B A;  3E3K A;  3MQ9 A;  3PTY A;  1FTL A;  4BDL A;  3NOH A;  3KC1 A;  3MWB A;  3GBA A;  5CMK A;  5CBR A;  1MDP 1;  4QBA A;  1N0T A;  4H6D A;  1MY3 A;  3OEL A;  5TP9 B;  4ELP A;  1N3X A;  2QVU A;  4YKK A;  3S9L C;  4TOZ A;  3TEP A;  4O8M A;  4RK2 A;  1JEU A;  3B8B A;  1N76 A;  2GQ1 A;  1NUW A;  1H76 A;  2HAU A;  2HZL A;  4LAT A;  2ZZV A;  4MAG A;  1IXI A;  2DVZ A;  4BLA A;  3FJG A;  1MXW A;  4WKM A;  1ZU0 A;  3K6X A;  3GBB A;  4OEV A;  1NL5 A;  2UVG A;  3KEI A;  1YPN A;  5KCJ A;  4KPT A;  3CR9 A;  3QXM A;  4O7I A;  4MLV A;  3IOR A;  3IOT A;  2Q89 A;  1NNK A;  1SVX B;  2O51 A;  2F3B A;  2JJK A;  1QUJ A;  5T3J A;  1SYI A;  2I4C A;  3D4C A;  2VGQ A;  2LAO A;  3O28 A;  1LBC A;  2DOJ A;  1JW5 A;  2O1L A;  1B0L A;  4X9T A;  4LZ5 A;  4EQB A;  3PPP A;  3PPR A;  1FJ9 A;  2DP8 A;  3PUW E;  4JWX A;  5DVI A;  3B7D A;  1JW4 A;  3W9V A;  1ZTY A;  3MZ9 A;  4IY6 A;  1VDW A;  4Q30 B;  3B6T A;  1KA1 A;  4PF6 A;  4NF4 A;  1RDX A;  4F31 B;  4YB6 A;  1A55 A;  3OO6 A;  4ZS9 A;  1HSE A;  1KWH A;  3TCH A;  1NI9 A;  3VXB A;  1SBP A;  5KDT B;  2F3D A;  3RNN A;  5I59 B;  4YKI A;  1JP4 A;  2FYI A;  1B7H A;  2I49 A;  2VOZ A;  2G29 A;  1FPI A;  4F1V A;  4YKJ A;  3C35 A;  3H6W A;  4NQ8 A;  3LV0 A;  2WBB A;  3ISP A;  2IEE A;  2B4L A;  2A5S A;  2XD2 A;  3PMV A;  3RT6 B;  2UXA A;  1PDA A;  2F97 A;  2CEX A;  2BJJ X;  4U4X A;  1GTK A;  4OFJ A;  1YYZ A;  3FJ7 A;  4U23 A;  2ZYN A;  1MH3 A;  4QRZ A;  3P7I A;  2NOO A;  2I6E A;  2F34 A;  5EHM A;  3R7X A;  1P1W A;  1MY1 A;  5CM6 A;  4GX4 A;  1DMB A;  5DEX B;  1MS7 A;  4F2Q A;  4MIJ A;  4I62 A;  3LSW A;  4K3F A;  3S4U A;  4XTC Q;  1QGX A;  1NUY A;  1B5H A;  1JQF A;  1EYK A;  1H43 A;  2ONS A;  4LVQ A;  3K0V A;  3FAS A;  3TYH A;  1PEB A;  5H8H B;  1FQE A;  1PC3 A;  3FXQ A;  4R2F A;  4IGT A;  4MHF A;  2WX9 A;  4XKR A;  4DI3 D;  4P0I A;  3TQL A;  1SW1 A;  5CI5 A;  1DK4 A;  1ANF A;  4HTG A;  1MXU A;  2ZMB A;  4R72 A;  3BFU A;  4LN5 A;  1WDN A;  1MQI A;  1JVY A;  4OZ9 A;  1JET A;  4X48 A;  3H7M A;  3LSF B;  2P3V A;  1PBQ A;  4PAI A;  3RPL B;  4PGP A;  3TTK A;  4JXI A;  1EZP A;  1IXC A;  2NXO A;  4R6Y A;  5H8S A;  3JYR A;  2AL5 A;  2REG A;  4DCX A;  4YZZ A;  2XXI A;  5H8F B;  4ZZA A;  1B5I A;  5TPA A;  3EPE A;  4LA9 A;  4P0G A;  4H8J A;  4JB7 A;  1QUI A;  4NF8 B;  1IMC A;  3K1M A;  4ZEI A;  4NWC A;  2GHB A;  3V83 A;  2XX8 A;  1INP A;  3G3F A;  4LZ8 A;  5J1D A;  3T96 B;  2X26 A;  5AA4 A;  3EHS A;  3FV1 A;  3N26 A;  4R9F A;  5IZ1 A;  2ZZX A;  3UGW A;  5IAI A;  5I5P A;  2DQV A;  4HCW A;  4H5F A;  4OTE A;  2PMS A;  1Y4C A;  3TEL A;  2H9B A;  3SEX A;  1XS5 A;  4NF5 B;  3CSB A;  5F24 A;  2OWT A;  3H4Z A;  4NWD A;  1D4N A;  2Q88 A;  4PFY A;  3T66 A;  2V25 A;  1UTB B;  1NH7 A;  3C36 A;  4N6P A;  1LLS A;  3FXB A;  3H6V A;  2XXU A;  3FV2 A;  1RDZ A;  1XI6 A;  2I48 A;  3MVX A;  1LBZ A;  1DCU A;  1USY E;  2CMO A;  4MJO A;  5I2K B;  1R1N A;  3HCQ A;  5F1Q A;  5AA1 A;  4G2Z A;  1H3D A;  1IME A;  4XKN A;  4GVO A;  1FTK A;  3CFX A;  3IB1 A;  2QVV A;  4HS7 A;  3MST A;  1PBP A;  4XEQ A;  5ET5 A;  5J16 A;  1LAF E;  4LUB A;  1FW0 A;  2DSF A;  3KG2 A;  3MC2 A;  5AA2 B;  4ELQ A;  5EQ9 A;  1I6Q A;  3TTL A;  2HHM A;  2DS9 A;  5KCJ B;  3GLB A;  1CB6 A;  4DI4 B;  5I7I A;  1MQJ A;  4M1V A;  1USY H;  1FBP A;  4QSD A;  4ZDM A;  3MJN A;  5I56 A;  1I6B A;  2QS4 A;  1AH5 A;  2DXR A;  1I69 A;  2ABH A;  4N17 A;  4U4S A;  4OVQ A;  3RGY A;  1OLA A;  2QVR A;  4FBP A;  1NV5 A;  3JV9 A;  2ZZW A;  3ILU B;  3SZP A;  4XF5 A;  3WAE A;  1A40 A;  5L9O A;  3SES A;  1MQH A;  1NMU A;  5JEI A;  5LDZ A;  1MQD A;  4ZEF A;  1SI0 A;  1FBH A;  3CFZ A;  2F6P A;  3I6V A;  5ITO A;  1ZMG A;  3THI A;  4MNC A;  2I3W A;  1D3K A;  4I3Y A;  4AB5 A;  3M3K A;  3FXU A;  1ZKB A;  3QIM A;  3RY3 A;  3KZG A;  3RTF B;  2WYP A;  1IIT A;  5A5X A;  1AWB A;  3HN0 A;  2R8T A;  2XWK A;  1EU8 A;  4R9G A;  1B3F A;  5AA3 A;  4ONY A;  1P1U A;  4ESW A;  2QL3 A;  1B2H A;  1US5 A;  5HPQ A;  1N04 A;  1FQA A;  3KFM A;  2OBG A;  2O6A A;  3CSG A;  4H46 A;  3MAM A;  2PFY A;  1MXZ A;  2XXQ A;  1URS A;  3H3G A;  1DPE A;  3CG3 A;  3H03 A;  3MYU A;  1B9J A;  3IB2 A;  2Y5K A;  4GF8 A;  4TLL B;  4E0X A;  4NTL A;  2NUV A;  4N81 A;  4G68 A;  4QFN A;  2UYE A;  1R9Q A;  4GX6 A;  4R2B A;  1ATG A;  5I57 A;  2QRY A;  3R6U A;  2E1S A;  3MP8 A;  1VR5 A;  4YMA A;  1BK4 A;  2DE3 A;  1SDX A;  2PT2 A;  3PMX A;  3O6H A;  1VSO A;  1Z7N E;  4OVP A;  4QFK A;  4AS5 A;  4JVI A;  1IMD A;  5B7D A;  3DEL B;  1BP5 A;  4ESX A;  4ELR A;  3PPQ A;  4YU0 A;  3TFL A;  2HEU A;  3SEY A;  1FPL A;  1SW2 A;  2X7P A;  5DYH A;  3CG1 A;  1XOC A;  1B1H A;  1URG A;  3MVY A;  3QYT A;  4QSC A;  3S9N C;  2FHY A;  1MXV A;  5H8H A;  2F7C A;  4EF2 A;  4OQO A;  3O9P A;  2FIE A;  3JZJ A;  3TCG A;  4HE0 A;  2XWO A;  4H45 A;  1RDY A;  4LQ5 A;  2HCA A;  4PCD A;  4L17 A;  1B3H A;  1B32 A;  1LST A;  5DVF A;  1FPG A;  2DWA A;  2XXV A;  1JW1 A;  1DOT A;  3DLN A;  1B40 A;  4TLM B;  1XHY A;  4MNI A;  2B65 A;  2R6G E;  1B1X A;  4FE8 A;  3T93 B;  4OXV A;  3M8U A;  2HZK A;  3MW0 A;  3Q26 A;  3RTW B;  3A29 A;  4KR5 A;  1AIV A;  4KYS A;  2Y7I A;  1ZIU A;  4ZEB A;  3MPL A;  4PBQ A;  3RUM A;  4ZED A;  3EHU A;  3T9H B;  2H98 A;  3QUJ A;  3EQ1 A;  2KQZ A;  5EYH A;  3KN8 A;  5DT6 A;  1AOV A;  5CMC A;  2UVJ A;  4NX1 A;  3VLU A;  1UTH B;  3FD3 A;  3FGS A;  5ELV A;  3T1B A;  1FQF A;  4EQ9 A;  4PDH A;  1FPJ A;  2F6G A;  1QUK A;  4N8G A;  3IR1 A;  1JNF A;  4RPO A;  4N07 A;  1CNQ A;  1B51 A;  1LBB A;  3FJM A;  3PUZ E;  3IJX B;  3L6H A;  4OVJ A;  5AA4 B;  1QVS A;  4KHZ E;  4GFR A;  4IO5 A;  2OWZ A;  4JVC A;  4NF6 B;  3TQW A;  2RCB A;  4N6D A;  4XIG Q;  3PPN A;  1N7X A;  4HE2 A;  3KSX A;  4FOR A;  3E4R A;  1O7T A;  4AS4 A;  1PB9 A;  4NF5 A;  3SET A;  4GXS B;  4NE4 A;  2I58 A;  2AYS A;  4X8R A;  3ZKK A;  5L8D A;  3MPK A;  2P3N A;  2ZNT A;  2WEF A;  3KJ7 A;  4EXL A;  2RCA A;  4JWY A;  1LB8 A;  3TAJ A;  2QSX A;  4QFL A;  3D1R A;  5HBC A;  5I3S A;  4MCO A;  1ZBM A;  2HFB A;  2ZYM A;  1FBG A;  1TWY A;  3PMW A;  1GGG A;  3QAX A;  1AMF A;  3HHF A;  1B6H A;  1FBC A;  3IO4 A;  3A3C A;  3L6G A;  5DVJ A;  4ZEK A;  2WYK A;  1AL3 A;  4EQ7 A;  4AB6 A;  2DYX A;  2ONK E;  3T9V A;  3BKI B;  4JSO A;  3PUV E;  1MXX A;  1Y4T A;  2V93 A;  1FQB A;  3S9M C;  3C34 A;  4ECF A;  2Q74 A;  4YB7 A;  3OEK A;  3C33 A;  4R73 A;  4Z0I A;  2V3Q A;  4PP0 A;  2DDK A;  1BTJ A;  2OX3 A;  3DM0 A;  2UYF A;  2RKM A;  1WVJ A;  1MG1 A;  1D9Y A;  1B5J A;  3OMB A;  1D9V A;  1OVB A;  3FIR A;  1S7Y A;  4OFO A;  4GQO A;  4PE5 B;  2GFE A;  3UP9 A;  1VFE A;  3W15 C;  5L9M A;  1NV6 A;  4NF4 B;  4YKP A;  2XXX A;  3TZA A;  4IO3 A;  2QFL A;  1GVC A;  1DPP A;  3WAF A;  1LBV A;  2Q9T A;  4RJZ A;  3K02 A;  2D21 A;  1BIY A;  5K2X A;  4IB2 A;  4FAT A;  3MP1 A;  1SI1 A;  3FXR A;  1NUZ A;  2B3F A;  1VFD A;  2AL4 A;  3DP6 A;  4OET A;  1B3L A;  5DEX A;  1FBF A;  3OO7 A;  1FPF A;  1A7L A;  2DVC A;  2VT5 A;  4FEC A;  4JDF A;  2A5T A;  4KCD A;  3LR1 A;  4DIG A;  3O2A A;  3VE1 B;  5EQ8 A;  4ZE9 A;  3TMG A;  5AE4 A;  2RC9 A;  4DXU A;  3E9X A;  3K1N A;  3KGC A;  3IOU A;  3PD9 A;  2VD3 A;  4P1L A;  4XFE A;  4G4P A;  4GRK A;  3K6V A;  4KI0 E;  4OVS A;  2F35 A;  3A09 A;  3LUZ A;  2V84 A;  4GIZ A;  3C9H A;  2F5X A;  4MNP A;  2D5W A;  3CRB A;  4IGR A;  3MUQ A;  1MH4 A;  4GL0 A;  4BDO A;  4DE8 A;  5H8Q A;  1RKM A;  1NV4 A;  4GWX A;  3FVO A;  3O6I A;  4EF1 A;  3SDF A;  4EXK A;  4X1D A;  2ESN A;  2R71 A;  3ROJ A;  4F18 A;  2I0C A;  2QMW A;  3OEN A;  3IFC A;  3C4M A;  1J1N A;  3KN3 A;  5EQA A;  3G3J A;  5DTB A;  2OK2 A;  1EYJ A;  3E78 A;  2FVZ A;  4F39 A;  1LBX A;  3QK6 A;  4N15 A;  2RC7 A;  5KDT A;  3R26 A;  3FBP A;  4ND9 A;  3G3K A;  2NVU B;  2XXR A;  5IZ3 A;  3U1O A;  1FPB A;  2XXP A;  3M3F A;  4ISU A;  3MVZ A;  3MZB A;  3BFT A;  5BUU A;  3OD7 A;  2Q8M A;  1M5C A;  3KBZ A;  4PE3 A;  4U2R A;  1T0K A;  4MBP A;  3LSX A;  1OQG A;  2DE2 A;  2Y7P A;  3TCF A;  1IMB A;  4POW A;  1O64 A;  4JSD A;  1IMA A;  4GWY A;  5EYG A;  4KYE A;  4PC9 A;  1OIB A;  1Y3P A;  3SEU A;  1MQG A;  2UVH A;  5TP9 A;  5H8F A;  3GXA A;  4PFW A;  1NNF A;  2O68 A;  4PAF A;  3KN7 A;  4P47 A;  3ILT B;  4KFQ A;  5FTH A;  3C32 A;  1SW4 A;  1UIV A;  3OO8 A;  1DBZ A;  3IL1 B;  3VVF A;  5EHS A;  4BDQ A;  2QPQ A;  2I3V A;  2ZYO A;  4WXJ A;  4KD5 A;  1LCF A;  3I3V A;  4BDM A;  4DZ1 A;  2DXY A;  2KLF A;  1P1Q A;  4H8I A;  4OVR A;  2PVU A;  2VD2 A;  4NED A;  1MDQ A;  3I5O A;  5ET6 A;  2F8D A;  3T9X B;  5FBP A;  3VDF A;  3K1P A;  4U1Z A;  2Y5L A;  1FTJ A;  4QHQ A;  4UA8 A;  2YJP A;  1Z7M E;  5LTC A;  4G8M A;  1L5T A;  3QMF A;  5H8N A;  4PFT A;  3LC8 A;  4DCY A;  1B3G A;  3FZV A;  4GWS A;  4OFL A;  5F7V A;  3VLW A;  1M5E A;  3RQT A;  2YLN A;  3OEM A;  3ONM A;  4IO2 A;  4LP2 B;  3V5A A;  5BWJ A;  2O7I A;  1IIW A;  2UVI A;  5FHM A;  1FRP A;  1Y9U A;  3M3L A;  4GWU A;  4LON B;  1OQH A;  5EQ7 A;  2B3B A;  1EZ9 A;  3E13 X;  3OOA A;  4NN3 A;  2OWS A;  1SD3 A;  1NH8 A;  4NF0 A;  2DWI A;  4RY1 A;  2PX1 A;  4TQU Q;  2ONR A;  5AA2 A;  2R9J A;  4JWO A;  3SEV A;  4KYD A;  4N91 A;  3FVN A;  2FA7 A;  5M2V A;  4I9D A;  3Q29 A;  2FBP A;  2Y7K A;  3CHG A;  3ZSF A;  4PFB A;  3GYY A;  3HO7 A;  2O1M A;  3Q25 A;  5I2N B;  1FTM A;  4ELO A;  2QS3 A;  1JVX A;  1EZO A;  4X1B A;  5JTY A;  4WEP A;  4ZZE A;  5KZT A;  3G7W A;  3IOV A;  3IX1 A;  1QKB A;  1N7W A;  3VV5 A;  4OMB A;  2Q2C A;  2G93 A;  3RT8 A;  4THI A;  2QJE A;  1B46 A;  1NNP A;  2V3U A;  1B05 A;  1A8F A;  3W9W A;  5ICT A;  4GD5 A;  5IKB A;  2DWH A;  1JEV A;  1POY 1;  1IMF A;  1NV7 A;  4P56 A;  1ZJL A;  4NG7 A;  4KCC A;  4EUO A;  2F7A A;  3TTN A;  1NFT A;  2OLB A;  1XVY A;  1QKA A;  3TDJ A;  5ISU A;  2Z22 A;  4P9K A;  1LFG A;  4FEB A;  1NV2 A;  3V8X B;  4QFO A;  4GX3 A;  2CZL A;  4R6H A;  1Y1Z A;  3D4G A;  4P11 A;  4OWD A;  2PCR A;  3MP6 A;  1QW0 A;  4H1X A;  3QUF A;  1LBW A;  4H67 A;  5I59 A;  2IA4 A;  1FPK A;  1SQY A;  2XX9 A;  3MVW A;  3T22 A;  4I3E A;  2AIX A;  4G68 B;  1IXH A;  4GWZ A;  4QF9 A;  2KR0 A;  3UN6 A;  4F1Y A;  3IO6 A;  5CBS A;  3OSR A;  1LGB C;  1IUD A;  2CEY A;  4MEV A;  5I56 B;  1S50 A;  1LB9 A;  4RPN A;  4EDP A;  4F3S A;  5I57 B;  3CFL A;  3KBR A;  4MLQ A;  5L9S A;  1B4H A;  4YMB A;  2RIN A;  2QMX A;  4MX6 A;  2YPN A;  1P99 A;  1MPD A;  4R74 A;  3A3U A;  2P2A A;  3N6T A;  3B6Q A;  4HW8 A;  2HQ0 A;  3K6W A;  3BIG A;  3K00 A;  2HAV A;  3G3I A;  1NNT A;  1MY4 A;  1NV0 A;  3TUS A;  1NKX A;  2Z23 A;  3KC0 A;  5K2Y A;  1RYO A;  1MM6 A;  3U72 A;  1B3E A;  4NF8 A;  3G3H A;  4GBV A;  2Q8J A;  1Q9D A;  3KSJ A;  5I58 B;  2O84 X;  4PDD A;  5A5X B;  3KOT A;  4GLI A;  4OYV A;  1FPD A;  2QS2 A;  2PYY A;  2ZXT A;  4JVD A;  3IB0 A;  4PFR A;  4GWW A;  1G0H A;  3T9U A;  2HPG A;  4PET A;  4BDN A;  5IZ3 B;  2ANJ A;  4QSE A;  1TT1 A;  2V3T A;  1MXY A;  3O66 A;  2V4C A;  1UTB A;  1LEV A;  4PGN A;  5TU0 A;  1CE2 A;  5B70 A;  4RK9 A;  2Y7R A;  4UAC A;  2XXH A;  3TTM A;  3B6W A;  2CZI A;  2OCU A;  1FBD A;  2Z8E A;  5LOM A;  2P1S A;  1EYI A;  4WED A;  1XT8 A;  1UTH A;  2DWJ A;  4LZ7 A;  3KJT A;  3OXN A;  2PFZ A;  2VPN A;  1A54 A;  1YAE A;  1FTO A;  3K6U A;  1IQ7 A;  4E0W A;  5I84 A;  3TTR A;  1IZ1 A;  4QXD A;  3Q27 A;  1NV1 A;  2XXK A;  2CZK A;  4GOT A;  4FED A;  1P1N A;  1XC1 A;  4YAH X;  4NF6 A;  1LAG E;  3FVG A;  3K4U A;  4F2O A;  1MPC A;  3H06 B;  4IO6 A;  3C31 A;  3VLV A;  1II5 A;  2O7U A;  4DXB A;  4Q5T A;  4FJP A;  3RPL A;  1MM7 A;  1MPB A;  1YCJ A;  4DDD A;  1N84 A;  1M5D A;  1OVT A;  1LAX A;  4R75 A;  2HXR A;  3U93 A;  1I6A A;  5ICQ A;  1N3W A;  3K2D A;  1MY2 A;  5CRY A;  5AA2 D;  4RA1 A;  3RN8 A;  1SW5 A;  3ZS6 A;  1P1O A;  3N94 A;  1MY0 A;  4IO7 A;  1A99 A;  2M8C A;  4O94 A;  3PGF A;  2XX7 A;  5TPA B;  3UOR A;  3TKD A;  3K01 A;  3N6U A;  3TPA A;  4GXA A;  5IGA A;  1G0I A;  2ZYK A;  1F9B A;  4POX A;  3PUX E;  3UA8 A;  4MH5 A;  2FIX A;  4I40 A;  5FTI A;  1YZ0 A;  1Q1K A;  1TFA A;  4RNS A;  5ET8 A;  2XD3 A;  4M4G A;  2F78 A;  1YXI A;  1TFD A;  4F29 A;  3MZ1 A;  3Q28 A;  5CMB A;  1B4Z A;  1HSL A;  1MRP A;  4DXC A;  3PU5 A;  4NAP A;  4IO4 A;  1IXG A;  3BBR A;  2WBD A;  4PTK A;  1M5F A;  1BKA A;  1OLC A;  2XA5 A;  5I2N A;  4G8N A;  1Y1M A;  2L5V A;  1OMP A;  3IJO B;  4F3P A;  5ESY A;  1B7U A;  2RF1 A;  3HHG A;  4GL8 A;  3IAZ A;  2XWI A;  3SER A;  5JTY B;  2RC8 A;  3DP8 A;  1WOD A;  4O3A A;  3PV0 E;  4Q0C A;  4ZE8 A;  5I2K A;  2F36 A;  1B7Z A;  2VP1 A;  2REJ A;  4P3L A;  4IR8 A;  3U92 A;  1DTZ A;  1LFI A;  1TXF A;  1B0H A;  2GHA A;  1FJ6 A;  2DE4 A;  4N13 A;  1FSA A;  3ZKL A;  2PBW A;  3SEW A;  2H25 A;  1A8E A;  3B50 A;  4NGU A;  4P1E A;  3IK6 B;  4PQJ A;  4F3G A;  2ZNU A;  1FQC A;  5H8Q B;  3UIF A;  3S9E A;  3EKI A;  5FHN A;  3U8Q A;  4MFI A;  4PFI A;  4GWO A;  4F19 A;  2CZH A;  3VXC A;  4NMY A;  1S9T A;  3H6U A;  3N5L A;  5DW8 A;  3EF7 A;  4OEU A;  3HST A;  4C1T A;  2I0B A;  3VVD A;  4H5G A;  2F7B A;  2XXW A;  2O69 A;  3O29 A;  5EYF A;  4O7M A;  1VE4 A;  2XHD A;  3U65 A;  2THI A;  4N6K A;  4FIM A;  3LBS A;  2H5Y A;  3KOS A;  1URD A;  5A5L A;  1FCK A;  3RLF E;  4F22 A;  1DTG A;  1B58 A;  1KZ8 A;  3VVE A;  4R6K A;  1ZLQ A;  3VFJ A;  1LBY A;  4H0W A;  3RPW A;  2VHA A;  2VPO A;  3LSL A;  1Q35 A;  1PB8 A;  4U22 A;  1LFH A;  3MBP A;  1FBE A;  2W7Y A;  4OAN A;  3EN3 A;  3V89 B;  4YIC A;  1RYX A;  4I8C A;  1KA0 A;  3IFA A;  1GV8 A;  2HXW A;  4KQP A;  4NHB A;  2H99 A;  4BDR A;  2Z8F A;  3H6T A;  5JK4 A;  3RYD A;  4PFU A;  2H4I A;  4C0R A;  3F11 A;  3PPO A;  4U21 A;  3AXF A;  2Y7W A;  4GBW A;  4QFP A;  2E0S A;  3USD A;  3TOD A;  1YTV A;  4IY5 A;  5IZZ A;  2FNC A;  3QSL A;  4OER A;  2I4B A;  4XKP A;  4F1U A;  1Y3Q A;  1K9Y A;  4C1U A;  4UAB A;  1O63 A;  1ELJ A;  4OA4 A;  2OJT A;  5I58 A;  3IOW A;  4G61 A;  3HPI A;  4OVT A;  3BIH A; 
#chains in the Genus database with same CATH homology
 2QVR A;  4OVS A;  4PAF A;  5IZ1 A;  1SPI A;  4FBP A;  1QGX A;  4PFI A;  1LBW A;  1NV5 A;  1LEV A;  1NUY A;  2Q74 A;  3LUZ A;  4N91 A;  4PGN A;  2CZH A;  4F19 A;  2ZZX A;  1EYK A;  4KXP A;  4OVP A;  4HE1 A;  2BJI A;  1FPK A;  2ZZW A;  3T1B A;  4O94 A;  4HCW A;  4P47 A;  1VDW A;  4JVI A;  3HFU A;  2V3Q A;  1IMD A;  2F5X A;  3PTY A;  4XF5 A;  3SZP A;  3T0J A;  1KA1 A;  2DDK A;  4MNP A;  4PF6 A;  5DW8 A;  2XWV A;  4I3E A;  4PDH A;  2OX3 A;  3NOH A;  1FPJ A;  1RDX A;  4GWZ A;  2KR0 A;  2FBP A;  5IGA A;  3KC1 A;  1DBZ A;  1G0I A;  4N8G A;  3CHG A;  5IM2 A;  2CZI A;  1FBD A;  2CEY A;  4MEV A;  1CNQ A;  4PFB A;  2QPQ A;  3GYY A;  5F24 A;  4MHF A;  4NX1 A;  4AS5 A;  5LDZ A;  1FBH A;  1FPE A;  1FPL A;  4QBA A;  2FIX A;  4I40 A;  1YZ0 A;  1NV4 A;  2WX9 A;  4GWX A;  4DI3 D;  1EYI A;  1NI9 A;  4O7M A;  2QVU A;  4MNC A;  4MX6 A;  4AS4 A;  1DK4 A;  2OWZ A;  4O8M A;  4JVC A;  4PAK A;  5ET8 A;  2F3D A;  3ROJ A;  3B8B A;  4I3Y A;  4OVR A;  3U65 A;  4N6K A;  3FXB A;  4N6D A;  4F18 A;  1JP4 A;  3W9V A;  1YXI A;  2GQ1 A;  1RDZ A;  4PF8 A;  5A5L A;  1NUW A;  1XI6 A;  4LN5 A;  3IFC A;  1LBZ A;  1FPI A;  2MKZ A;  1NV6 A;  2PFZ A;  2VPN A;  1DCU A;  2FHY A;  2HZL A;  2WYP A;  3E79 A;  4F1V A;  5ET6 A;  2ZZV A;  5EQA A;  4MJO A;  1KZ8 A;  4NAP A;  4X04 A;  5ET7 A;  1AWB A;  3BIG A;  2R8T A;  2P3V A;  4NQ8 A;  5FBP A;  2FIE A;  2XWK A;  3LV0 A;  1LBY A;  4MAG A;  2QFL A;  4HE0 A;  2WBB A;  2XWO A;  2VPO A;  1RDY A;  1LBV A;  2DVZ A;  2WBD A;  3ISP A;  4H45 A;  4PAI A;  4PTK A;  2Y5L A;  2Q9T A;  2B4L A;  4QXD A;  1NV0 A;  3RPL B;  4PBH A;  2XA5 A;  4PGP A;  1FBE A;  4X8R A;  1IME A;  2L5V A;  3KC0 A;  4OAN A;  4PCD A;  5LTC A;  1NV1 A;  2XXK A;  4N8Y A;  4YIC A;  4N4U A;  1K9Z A;  1EYJ A;  2CZK A;  3E78 A;  2FVZ A;  2P3N A;  1LBX A;  3QMF A;  1KA0 A;  4N15 A;  2WEF A;  3IFA A;  5ESY A;  3W9W A;  2CEX A;  1NUZ A;  3FBP A;  1IMF A;  1FPG A;  4GWS A;  4GBV A;  4O7I A;  5IZ3 A;  1NV7 A;  1YYZ A;  2QVV A;  2XWI A;  4HE2 A;  1FPB A;  3D1R A;  5I3S A;  3MST A;  4MCO A;  4NHB A;  1Q9D A;  4P56 A;  4XEQ A;  5ET5 A;  4NG7 A;  4PDD A;  4H46 A;  1FBF A;  5JK4 A;  4MNI A;  1FPF A;  3RYD A;  4YZZ A;  5J16 A;  2PFY A;  1FBG A;  2VT5 A;  4HXV A;  1FPD A;  2B4M A;  1D9Q A;  4P8B A;  2F3B A;  4JVD A;  2JJK A;  4GBW A;  5EQ9 A;  5T3J A;  4P9K A;  4P3L A;  3RPL A;  2Q8M A;  2HZK A;  4IR8 A;  3KBZ A;  1FBC A;  3MYU A;  4PE3 A;  5IZZ A;  4PFR A;  2Y5K A;  4GWW A;  1FRP A;  1NV2 A;  2HHM A;  3A29 A;  1G0H A;  2DE2 A;  4GWU A;  2HPG A;  4MMP A;  5CM6 A;  5EQ8 A;  4DI4 B;  5I7I A;  1FJ6 A;  2DE4 A;  2HXR A;  2PCR A;  4PET A;  1FSA A;  4N81 A;  2WYK A;  5EQ7 A;  4X9T A;  1IMB A;  4M1V A;  1IMC A;  4F1U A;  4PBQ A;  1K9Y A;  4GX3 A;  3B50 A;  4UAB A;  4GX6 A;  1FBP A;  5IZ3 B;  4NGU A;  4NN3 A;  4OA4 A;  1IMA A;  4GX4 A;  4GWY A;  1INP A;  1NV3 A;  5EYG A;  5I5P A;  4PC9 A;  4P1E A;  4HCY A;  4NF0 A;  1FJ9 A;  5J1D A;  4P1L A;  4XFE A;  2KQZ A;  4G61 A;  1FTA A;  4N17 A;  5EYH A;  1NUX A;  4MIJ A;  4OVT A;  4OVQ A;  3EKI A;  2V4C A;  1BK4 A;  3BIH A;  2DE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...