5IGCA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igcA00
4KHVA 3C1FA 5C3XA 3D4WA 3VA5A 2RBMA 3T13A 4F8MA 1SYEA 1II3A 4K14A 2F0OA 5E3FA 2F0KA 5IGGA 4KY7A 1ENAA 5IOCA 4ZQ3A 2F0GA 3C1EA 4OL7A 3MZ5A 1EZ6A 3EVQA 2F0WA 4KD3A 5C5LA 5C4HA 5EGTA 2HQEA 4K2LA 4J1MA 3MXPA 1SNMA 2RKSA 1SYGA 2KHSA 5IIFA 4NDXA 2EY2A 5F2DA 2OF1A 1STGA 1EQVA 4ME5A 4ID6A 3DMUA 5CV9A 4EQPA 1TR5A 5KEEA 4K6DA 5J39A 2F0LA 3SXHA 2SNSA 4J6HA 2PW7A 1F2YA 5EKLA 5IGFA 3DHQA 5K5PA 5HURA 2F3WA 4N9PA 4DF7A 4EVOA 2ENBA 2QDBA 4NKLA 4WRDA 2PZWA 1KDBA 2LKVA 2PQEA 1SYFA 3MHBA 5IODA 2KQ3A 1EYDA 3PMFA 4YIJA 3T16A 5KYLA 3HEJA 1TT2A 3TP6A 5IGEA 2EYPA 5CGKA 4TRDA 5CV7A 3NUCA 4K5XA 1AEXA 4KJNA 3TP7A 3V2TA 1A2TA 4NP5A 2RDFA 5C6AA 1EY8A 1A3TA 2PZTA 4QF4A 3H6MA 4K8IA 4R8NA 5J1ZA 2F0TA 3OMCA 3S9WA 2F0IA 2NUCA 3NQTA 2EYFA 2EY1A 5EKKA 1STHA 2OEOA 1SYCA 4S3SA 4F7XA 5C4ZA 3EJIA 5KGUA 1RKNA 2F0SA 4I65A 5DEHA 3D8GA 5KRUA 3ERQA 4H7BA 2EYOA 3SK4A 1U9RA 1F2MA 1A3UA 4KD4A 4B9WA 5JAVA 3R3OA 3OMGA 5C5MA 4KY5A 1A3VA 1EYCA 1SNOA 4WORA 3SK8A 4DGZA 2SNMA 2PW5A 4HTHA 4IALA 5E1FA 3QOJA 1SYBA 1JORA 5IGBA 1STBA 2EY6A 1STNA 1NSNS 2F0DA 2F0PA 2PZUA 3OWFA 5DAUA 5I9OA 4K5WA 2EY5A 5I6YA 2F0VA 5I6WA 2O4XA 3D6CA 4ZUIA 4ZUJA 4RKLA 4K8JA 1EZ8A 3BDLA 1SNQA 1EY6A 3NXWA 1EY0A 5CC4A 1SNPA 4DFAA 1EY4A 1KABA 5CV5A 4ODGA 4QMGA 1KDCA 3TMEA 1SNCA 4PMBA 1JOOA 5KIXA 3ITPA 4PNYA 3TP8A 5ISRA 4K5VA 1EY5A 2EYHA 1EY7A 2F0NA 5CV8A 3E5SA 5CV4A 3SK6A 4EQOA 3HZXA 4IZ8A 3NP8A 3SR1A 4B9XA 4E6IA 4NMZA 1KDAA 3BDCA 5J22A 1JOKA 2F0UA 2F0QA 2M00A 3MVVA 4HMIA 4KJOA 4N9TA 5I9PA 5C3WA 3QOLA 5M9OA 3NHHA 3TP5A 2F3VA 3QB3A 4HMJA 4RKBA 2EYJA 1KAAA 3D4DA 3LX0A 4KTAA 5HGTA 5IGDA 5CR3A 2WACA 1EY9A 4MIUA 5JOBA 2F0FA 2SOBA 2EYMA 4KV6A 4KY6A 1NUCA 1STAA 4PMCA 2EXZA 2F0HA 5CV6A 3EROA 5NUCA 3NK9A 2F0MA 2F0JA 1TQOA 4G57A 3MEHA 3OSOA 5IGCA 1F2ZA 3SHLA 2OXPA 4EQNA 1JOQA 4K2KA 1IHZA 2EYLA 3P1HA 4DU9A 4IUNA 4LAAA 3RUZA 1EYAA 3SK5A 1SNDA 1ENCA 4QB4A 2F0EA 2PYKA 3U9OA 5KYIA 3P75A 1A2UA 1STYA 1SYDA
chains in the Genus database with same CATH superfamily
2N3SA 1E7ZA 2MP1A 5FO7B 2F03A 5BN3A 5IOCA 5ELOA 3KLSX 2XNAC 5IWAL 4GNXB 3UDIA 3H09A 3MXPA 4BA2I 1NJIC 3T56B 1HQRD 2OF1A 1EQVA 5C44G 5DNFA 4K6DA 3RNUA 2SNSA 2G9HD 1IW7D 5BN4A 3HFZB 1JT8A 1K0SA 2K52A 4LFBL 2JA7H 3RZOH 4FXDA 1EQQA 3J81i 5ELDA 2EYPA 2HHHL 1AEXA 3NBHA 4H44C 2EZVA 2BA1A 4PMWA 1W2BA 2BOSA 4JW0A 2I5LX 1ET6A 3TN2A 4LFCL 5DM63 4JI7L 1N8RC 4DR3Q 2EYFA 4F7XA 4A3EH 2OEOA 1SJHD 1HXYD 5FLMH 1VQGA 1JJGA 3KYHC 3Q0AA 1P16A 2IX3A 4JV5L 4KY5A 4LF7L 4WORA 3I4NB 1HUNA 2VL6A 3PIOA 2R7DA 1SYBA 2L15A 3ZJYC 4A93B 1NSNS 3HOXH 4YWMA 2JA8B 4K5WA 2EY5A 3U50C 4A3CG 1EEFD 4OWWB 4A3KB 3N6RA 5JJZA 1Y8PB 2I5MX 3NXWA 5I2XA 5JEAJ 4JYAQ 1KABA 5CBEE 1KDCA 4CJ2C 5EJWA 4K5VA 4PZ8A 4Z9CB 1PTOH 2IW3A 4UPAA 3STBC 5T1GA 2WV6D 3G48A 4JI5Q 4IFDG 3K58A 3OYYA 2B39A 3OTOQ 4A3MG 2Q2TA 1UWVA 1RTNA 4JI0L 1SDFA 3DLLA 1KLGD 5NUCA 1E0BA 1MKHA 3K80C 2F0MA 3OPOA 3D4RA 4G57A 2R93B 4KN7C 1F9RA 2GA4B 1NMGA 2J0TD 2CVRA 1X9NA 5JJKA 1HZAA 1X55A 1A8VA 4IPGA 1D5ZC 3L3OC 4DR7L 1EL0A 1EWHA 5C3XA 3VA5A 1TWAB 1GUSA 3NWSA 1DZ1A 1SYEA 1N34Q 4LF5Q 1MHWC 2F0OA 2CH4W 1VQLA 4L5QA 1GM5A 2F0GA 3HOUB 1A63A 1WTQA 3T51B 2F0WA 4BBSG 4CHTB 1TWFB 3S1RB 1QUQB 1YZ6A 4C3JB 4ZLTF 4C2MB 5IIFA 2MPMA 4DNRB 2OTLA 1DOLA 2HCIA 4B08A 4JPBW 4NXMQ 1LLRD 1DGSA 2WB1B 1HZCA 2RVLA 4WJ4A 4IOAA 2UUCL 4JBKA 1TS3A 2UXDL 3DM1A 4DXGA 4GLVB 1AZQA 3M7GA 5FOBB 1A3TA 1S72A 1SE8A 4R4OA 3GTLH 4JI8L 1EOVA 1A15A 1I50H 2NVXH 2E8GA 3D8GA 4MHEA 3ERQA 1ZYRC 4A76A 2EYOA 2UXBQ 3J81j 4RHRA 3PUXA 1A3VA 4HJ5A 3X3NA 3LGJA 2UUAL 3S1QH 1E3PA 2BA0A 4A3BG 2XRSD 2F4VQ 1UUPA 2WIIB 2EVBA 1I6HB 2DN8A 5CORA 2O4XA 4A3IH 1X3QA 1VQAA 5EAYA 2PNHA 3URYA 4J8QA 1GUOA 4CDFC 1RF2D 3A54A 5IP9H 1V1PB 1E1TA 5EKIA 1IKMA 1D1KA 4JI7Q 1K8GA 1SEBD 3S2DH 4N8FA 4HAEA 1AN8A 1EY7A 2F0NA 4A3FH 3HZXA 2EDGA 2RSNA 3H0GG 1HRJA 1XNRQ 4YCWA 3NTKA 1OXVA 4K6LA 2A69C 1JB7A 4ZAIA 3HOZH 4MIUA 4AH6A 2F0FA 1RIPA 1EQRA 3GQBA 2NVTB 1NCVA 1F2ZA 3WDNA 1FJGQ 4HCEA 1LT6D 3S17H 2K03A 3K5OA 1PH8A 1DOKA 1CA5A 2A6HC 4DK6C 1YJNA 2AKWB 1GHJA 2JXMB 3K5MA 3J7A5 2PQAA 5M3MH 4L5TA 4FO2A 3D3RA 3FVQA 2ZXOA 1S5BD 3I4MB 2VUMB 3GP7A 4ID6A 4DAYA 4EQPA 1Q81C 2NYZD 1OTCA 2F0LA 5K5PA 1WCMG 1F2YA 4O1NA 2OTJA 1PXUA 2ZM6Q 2NVQB 3ZYYX 4JCVE 2HDMA 2DJGC 4Q0FA 4GKJQ 2L0CA 3NE5B 1XYIA 3TP6A 2X69A 5IT9E 4IOCA 4KJNA 2XTIA 4QF4A 3PIO3 2MO1A 3RZDH 1TWGB 2K5NA 3J80L 2WFWA 3E3XA 3MXUA 3OMCA 3K7AH 3S9WA 2KEEA 1H9JA 3A8KE 3I2ZA 5G3LD 4ZYSA 3CD6A 1PZKD 3HKZB 2JA6H 1A3UA 1CK1A 1PYWD 1EYCA 1L0YB 3FKIG 1BCPC 3T1HQ 2BDOA 3NSWA 1WD0A 3PCOB 5DAUA 2NVYH 3VYSA 1AE2A 1HR0Q 4XXEA 1L1OB 3FDTA 1VQHA 1LV9A 1EY4A 2ZTEA 3CCRA 5M5WB 4C3IG 5LL6X 4UDUC 1VQPA 3TP8A 1XJVA 1O80A 4C3HG 4IJLA 4ZK9B 1WOCA 2NN6G 4O0AA 3CQZH 3KJOA 3ULJA 3A8JE 2IT1A 1Q12A 3IKJA 4HMJA 2EYJA 2FXQA 1PMRA 3PGZA 2FINB 1QB5D 2QILA 1Q82C 4L5RC 4HR7B 3HG9A 4YWKA 4JI4Q 4DR1L 4XYOA 3RZOB 2IHFA 5IYCH 5JEAH 4I7ZC 3SK5A 3F2DA 1FR3A 3P75A 2JA6G 1BBUA 1H9SB 4A3MB 2KCMA 3C1FA 1WTHA 4DNIA 4H13C 4JI1L 4PG3A 3A7AB 4YHHQ 3I4NH 3J7YW 2PI2A 4DXFA 2B8GA 1S3OA 4K2LA 1G2SA 3AFQA 4GZYC 4X3TA 2RKSA 5F2DA 3AU7A 3CPFA 5CV9A 4A93H 1IW7C 2B2WA 2NTTA 4DV3L 4LF8Q 3PUWA 4HIDA 2F3WA 1PDQA 4YWLA 3AB9A 3U4ZA 4BBSB 3E9IA 1KDBA 3NPPA 3MXGA 4KKTA 4NW2A 1SRUA 4IFDJ 4DK3C 3CCVA 3Q23A 4PV1C 2H1EA 3ULLA 1UEBA 1BNZA 1X32A 1RJTA 1JWUD 4CJ1B 1D8LA 1VQDA 5E7NA 2JQOA 1EIFA 1V1OA 2LFNA 1LTBD 2V1CC 2F0SA 2LXJA 3FHWA 1PTOB 2K5WA 3I90A 1YNND 5FK9C 1SLJA 3QO2A 2AQ2B 1GUGA 2K5HA 1RCVD 1IL2A 1X3FA 2Z6BA 1G51A 2K5QA 2RA4A 3HGBA 1M8AA 4L6TB 4A3JG 1N36L 1TWAH 3TREA 4ZUJA 2UXCQ 1VS0A 5E4WC 2MNAA 4DFAA 1E2ZA 1TY0A 3F2UA 3PF4A 1SXTA 1SE3A 2CFMA 1SN8A 3WOEA 3F2BA 3C46A 3NP8A 1FNVA 2MUYA 3BDCA 2XSCA 2Z6KA 1JMCA 2KENA 3I72A 2D0OA 4X65Q 2AWOA 2XRQD 3LWUA 3IL8A 3L2PA 4DR5L 5K36H 2CQAA 3D31A 3H0GB 3KF8B 1HA5A 3PO2G 4H02A 1YNJD 4DPGA 1I4XA 1VF5C 4KKUA 1KRTA 3KLWA 1B2TA 3U9OA 4BWGB 4AIMA 1CM9A 4P72A 4KHVA 3KF8A 1S5CD 3D4WA 3T1YQ 2RBMA 4F8MA 1B1ZA 3HKSA 4K14A 3A74A 3PIP3 4IPDA 4U68A 3HOVH 2KVMA 1VQNA 3GTLB 2EIFA 5C4HA 4OO1G 3M4YA 1LT3D 1I50B 2NVXB 2I0QA 4B3MQ 2OQ0A 2IY5B 5AJ3Q 4J6HA 1WI5A 2ENBA 2QDBA 2I46A 2PZWA 1QVGA 1GVPA 1ILPA 4HJ8A 4DR1Q 5ELEA 4A3IB 3PV0A 5M3FG 3UDGA 2E74C 2B2UA 4NP5A 2B63H 3H6MA 1CUKA 2NZOA 2CQOA 3IFDA 4M8AA 5D3DA 3H94A 5C4JH 1PTOF 2WKDA 1N33Q 4A3FB 5I4DA 1UAPA 4NB3A 4DUZQ 4H7BA 2D62A 4IO9A 4X64Q 3QWNA 2NN6I 5JAVA 3GTKH 3PSIA 5IYBH 2O2LD 1CQVA 5E1FA 4U673 2VY3A 3J80c 3FP9A 1CSQA 3DUZA 2CW0D 4JYAL 2E5LL 5I6YA 4KN4C 3S17B 2Q8RE 3HOWH 1TS4A 3FKIB 2K1BA 4XTCS 4JC0A 1JJ2A 2C5CA 1ILQA 4PMBA 3I4MH 4JI5L 5KIXA 5M3MB 1BBXC 3H15A 1C4QA 3FMCA 3OTOL 1EEID 5EBDA 2QA4A 3MVVA 1CHPD 4N9TA 1FNWA 3QOLA 4UP7A 1SMYD 3DM3A 1C48A 1ICFB 5C44H 5LMNQ 2F0HA 4F88A 3NK9A 4QIWE 1HFGA 1A6XA 1PYSB 1N36Q 2PPBC 1EYAA 3JC66 1N34L 1UE6A 1LTTD 4LF5L 1STEA 5BR8Q 3DXJC 1ONLA 1SYGA 2WP8J 4ZKBB 3WOFA 1KTKA 1BO0A 1VQFA 1NY4A 4DV4Q 1ENAA 1VQEA 1MSHA 2Q8IB 3K7AB 4EQ5A 1OXSC 1K8OA 4X66Q 4DR6Q 1YVCA 4JOIC 3NTIA 4NXML 1C8CA 1SAPA 4FDBA 3UDFA 4KI0A 2KHSA 2JA6B 2EY2A 3M4OH 1STGA 5KNCA 4DV0Q 3DMUA 2A68D 4DR4Q 3J80E 1E2VA 3AFPA 1K28A 1VCIA 4TQUS 2B29A 3KF6B 2NVYB 4LUOA 4CDCC 5M5WH 1EIHA 5CGKA 1Q1EA 4DAVA 1QVFA 5D14A 3PO3G 1ESFA 3CRKC 4A3CH 4Y7NB 1EY8A 3S15H 3VDYA 3KJPA 3GTOH 2UXBL 4CKEA 2L11A 5JJIA 1B9NA 3BG3A 5C4ZA 3NELA 2P5ZX 4I65A 1GHKA 3RN2A 4XDXA 5KRUA 4GNXA 1JWMD 3NWTA 3BZCA 3CQZB 3SK4A 2DNCA 2F4VL 2EE1A 4LF9Q 4DV2Q 1ASZA 5HY6A 3BVZA 2SNMA 1OO9B 4HSPA 1S5DD 4IFDH 1K3BC 2OQKA 3KDFB 4V0BA 2N8NA 2RQXA 4MTKA 2BDNA 4A3MH 3EFXD 1BKBA 1EZ8A 1I6VC 2A74C 4AYBB 2ICIA 1LO5D 2Z9HA 1XNRL 1K3RA 1PFNA 2R92G 3TDQA 1VQOA 2V4DA 4QIWB 1HR0W 1VQ6A 2HDLA 2QEJC 1VQ9A 4BBSH 1QNKA 3UI2A 4B9XA 2L1BA 3D4DA 1AH9A 1HQMC 1FJGL 5HGTA 3AMUA 1NR2A 2FFKB 2EYMA 3I8ZA 4FVMA 5GQOA 4QUFA 4FXGC 1U4LA 1TQOA 3OSOA 3I91A 4XT1B 2XWJB 3ULPA 3VYRA 4K2KA 2E5LQ 2JEBI 2WAQE 2M2LA 1QWYA 3J7ZC 4X6AH 2F1MA 1PZID 2F0EA 1VQCA 1EFWA 1U4MA 3M85A 3KK7A 4JBJA 4CDEC 2HD3A 1Z6HA 4GOPC 4CJ0B 2EOTA 2PMZE 2NTSA 5D65A 3HOYG 4KD3A 3VA7A 3Q6SA 3GTPH 4P71A 2ZM6L 3CHBD 2XVSA 2G5DA 3NBIA 4GKJL 3SDZA 5KEEA 1FGUA 5EKLA 5C4XG 2YTXA 4DF7A 4EVOA 4NKLA 2JP1A 4RHSA 3S1NH 2PQEA 4A3BH 4A75A 3CAMA 3S1MH 4BY1G 1A2TA 1S40A 4POGA 1Q8KA 2DJFC 1XMOQ 1KRSA 2NUCA 4IUQA 2EY1A 2RHSB 5E4XA 1YNNC 1X56A 3T1HL 4KHPQ 2ES2A 4JBMA 2LY7A 1QUQA 1B9MA 3H0GH 4LUVA 1HR0L 3TBIB 5C0XJ 2LMCB 5EBCA 4OIJA 2K6AA 4B3TQ 1BVSA 1AW7A 1J6QA 2BH2A 1Y14B 4NXNQ 2AHOB 1HNZQ 2PO4A 1EWIA 1V9PA 4HCSA 1EY6A 1X54A 1F2LA 5J3BA 1IZ6A 1I4RA 3JAML 2DY8A 1NBWA 2FHTA 4X3SA 1Y69U 1LM0A 1E24A 1GO3E 2IPKD 3ND8A 4ILWA 4G7OC 1YEZA 4BBRG 3HOVB 4KHZA 4XT3B 1PH6A 2R7ZG 1L2FA 1YITA 1I4QA 5AFWA 1CA6A 4NMZA 5ELBA 2K01A 1RHPA 2UUBQ 5M5YB 2JSOA 1OXUA 3NHHA 3TP5A 3SVMA 4JI4L 2C9OA 1X3PA 4KTAA 3K7UC 2EJMA 2N78A 5FO9B 1GUNA 3CCMA 5IGCA 1WCMH 1ZEQX 5IT9c 4JI2Q 2MQHA 1YNJC 4IUNA 3PF5A 1NR4A 5GAEC 4DK1A 3CF5A 1A2UA 1M4VA 4YHHL 3S24A 2B63B 3BS1A 1V1PA 3K0XA 1II3A 1JR0D 1VMPA 2RF4A 1PTOD 1IL8A 2MJ8A 4RMFA 1BDOA 4Q5VA 5C4JB 1DM0B 1Y1WG 4LF8L 5EPJA 1FVIA 1LTLA 4R1JA 2NZHA 3DEPA 3GTKB 3RMHA 5IGFA 4N9PA 2X6GA 5ELFA 3FKIH 1KQSA 2LKVA 5IODA 1O7YA 1KXLA 1PH1A 1PH3A 5C3EG 1CTMA 4DK0A 1C9OA 3HOWB 2RDFA 4R4CA 5FJ8G 4DV6Q 1Q7YC 3AQQA 1PFMA 4LJZC 2L4NA 2XIWA 1SE4A 1G6ZA 2A6ED 2BH8A 1K83H 4C3IH 1G6PA 3LWEA 2DY7A 1JC7A 1Y8NB 4X3UA 4KD4A 3M7NA 4C3HH 3DWAA 2NN6H 4ULLA 2A5HA 5LMUQ 1WTPA 1PYBA 4DGZA 3CCJA 2VQEQ 2UXCL 4X3KA 1Z47A 1F9QA 5C44B 2CW0C 2QF7A 3DWQA 2UU9Q 1VQMA 2ZJPA 2L5TA 4RCNA 4QGUA 4GN4B 2KA7A 1XMQL 4POFA 3KLSA 3KFUA 1BQQT 2PI2E 5CC4A 1SNPA 4HIOA 3MWYW 2Z1CA 2DNEA 4IUVA 1YHAA 3CU7A 1HNXQ 1K9MC 4X65L 1VMCA 3SK6A 4IFDI 4BY7G 3RR5A 1T5EA 2O5IC 1A62A 2B2VA 5C3WA 3UE1A 1SMYC 1K8MA 2B3GA 2F3VA 3M4OB 1I5FA 1EY9A 3HRZC 2B8FA 2R92B 1Q86C 4OGQC 2EJFC 3PUVA 3E0JA 4NPSA 4Y7NH 1WD1A 2OXPA 3T1YL 4LW1A 1L1OA 3EQLC 4P73A 3S15B 1S5ED 2F0KA 5CMDA 4B3ML 3GTOB 1B3AA 5AJ3L 5EGTA 4UHVA 1GJXA 3MXNB 4NDXA 2A68C 2TMPA 2VNUD 1CHQD 1TR5A 1BBWA 3V05A 1TS5A 2DUDA 2L55A 4WRDA 1X3EA 3MHBA 1XXGA 1EYDA 1D6EC 1PA6A 1TT2A 1OXTA 3TQYA 2AQ3B 4YCUA 2M9VA 2ZT9C 2JA5G 4A3LG 5CYUA 4L5SA 4A3JH 1RD9D 3NUCA 3H91A 4GKKQ 5C4XB 2IWHA 1JE4A 1H9SA 1B8AA 1N33L 1MBYA 4IPHA 1PRTB 2HIVA 2K28A 4DUZL 3QG1A 2B2TA 4X64L 4F87A 1JB3A 2E2IH 5FKAC 2K32A 3GO5A 3P20A 4BY1B 1F2MA 3J81L 2JA9A 1FGBD 3OOCA 1IBKQ 3KOJA 4HTHA 1HZBA 1BOSA 2PZUA 3O13A 3K59A 1WVLA 1UEAB 2VQFQ 4YCVA 4ZUIA 4MTNA 2XGTA 3E9HA 4DA2A 1SNQA 4WFN3 2GN5A 3H3VC 1VF7A 3BZKA 3PO2H 4ODGA 4DV5Q 1SNCA 3EBEA 2EYHA 3ERSX 3E5SA 2F4IA 5CV4A 2BCOA 3EIVA 3GTMH 2L12A 1BUVT 3GTPB 1N32Q 5LMNL 1IYJB 4EX5A 4OO1H 4C56C 4FF1A 2OCEA 3I73A 3I4LA 3VR2A 1U0LA 5BR8L 2ZXPA 3S1NB 2VS1A 3SHLA 4ZCKA 1B50A 4A3BB 2EYLA 3VYUA 1EYGA 1XMQQ 4UP8A 1ENCA 1OXXK 4DV4L 4ZKCB 2F3IA 3S1MB 5KYIA 3UDXA 3ER0A 1UE1A 3DEOA 4CKCA 2IX1A 4X66L 4DR6L 5M3FH 3VR4A 3GTGH 1UE5A 3K8AA 1Z7TA 1KIXA 1AE3A 5EPLA 1PVOA 1CKOA 4DV0L 5HGQA 3CCSA 3TS2A 3BU2A 1WTXA 4DR4L 2B2YA 1EFID 1VQ7A 1HJPA 3Q24A 4H0LC 4RAUC 2JA8G 1JWSD 2IX0A 1SJED 5FLXL 1L1OC 4A3KG 3GV6A 4MZ9A 2IL8A 1SYFA 2Y0SG 2VXWA 3OWEB 5LL6S 3PUZA 5KYLA 1B53A 2E2JH 3B6YA 4LF4Q 4XYQA 1GXDC 4OEMB 4R8IA 2D0PA 1C0AA 4CGYB 1FNUA 2PZTA 2K50A 1PRTF 4GLAC 4IJHA 1JJCB 5C0XG 5JPMC 5M5YH 4R8NA 4LF9L 2KCCA 4DV2L 1PH2A 3FRPB 3VR5A 2XWBB 2OWOA 5C3EB 4I7AA 2AMCB 1G2TA 3MA2B 5C5MA 1F77A 3BYYB 1CKNB 2KUMA 3JAME 3Q8DA 4LFAQ 2R93G 4QUCA 3QOJA 4HN7A 3K57A 1YI2A 4A3DG 1DYQA 3GV3A 1KAWA 2I5HA 4RCOA 3GTJH 3MAQA 2YU9B 1WCMB 1QZGA 1WJJA 2A69D 3U9SA 3D6CA 5I6WA 1NNXA 1Z9FA 2H5XA 5KNDA 1NTGA 5M5XB 1LUZA 4OHJA 3HOUG 2B2WC 3RLOA 2AUKA 3UE0A 1HH2P 3X3MA 1J5EQ 2JJQA 4C3JG 2A6HD 5CV8A 4A3GG 1QNUA 3CMAA 1XNQQ 2Q2UA 3MC0B 2I07B 2F0UA 2ZXRA 5I9PA 3TEHB 3D0FA 2R7FA 2WB1G 3KBGA 3RD4A 4PMCA 1FYCA 5GROA 3FPPA 3EROA 5GADC 1HNWQ 1IKLA 2WAQG 3E6ZX 3RUZA 1Y1VH 2HUGA 2LSSA 2YTVA 3V96A 1WTVA 4OWXB 3BDOA 1QILA 3CC4A 1PTOC 3I56A 2ATWA 3S2HB 2MFIA 3PO3H 5IGGA 1XWEA 3G6JB 4C1NK 3C1EA 3IFTA 1EZ6A 3EN2A 3MZ5A 1VDZA 1G8ZD 4QCLA 2HQEA 1K83B 4C3IB 1XTDA 2MHVA 1Q46A 1LABA 4XQJA 4LMQD 1TWHH 2FMMA 3CP0A 4R4QA 3J80i 1K0RA 4C3HB 1HCZA 1EUJA 3A55A 1IBMQ 1LTRD 1Q1BA 2KQ3A 4PZ6A 4YIJA 1WTWA 1XMOL 4RGTA 1SR3A 2Z6KC 5C6AA 1X65A 5H1SE 3M4PA 1JE5A 2MO0A 2K04A 4KHPL 1YHBA 1MJCA 1QJOA 2A6EC 2R6GA 5JPNC 5KGUA 3OW2A 3GD7A 2SEBD 5IP7G 2R92H 4DR2Q 4B9WA 3R3OA 1ZKOA 4B3TL 1SNOA 1Y1VG 3I70A 4LNQA 4NXNL 2Y0SE 1GUWA 1HNZL 5IGBA 2EY6A 3BJUA 2A8VA 1STNA 4G4KA 1I4PA 3KF6A 4K8JA 2A1AA 1VQ5A 4ALPA 3ND9A 5CV5A 4B3SQ 1MI2A 2O5JC 1YBYA 1KHIA 2UUBL 1JOOA 3J7AF 2VUMG 1D2BA 1I94Q 3CXCA 2N88A 4YY3Q 1ML0D 4IZ8A 4KLKA 4HJAA 1TS2A 1GUTA 2Q2HA 4JG2A 3HOYH 3CC7A 1DXMA 1MIUA 2B2UC 4ABNA 2CH4A 2A19A 5IYDG 4JI2L 1VQBA 4HIMA 2XN9C 1HPCA 1GD7A 1B3QA 2R3ZA 1H9MA 3KDFA 5A2QE 5C4XH 2N55A 4DV7L 4DU9A 5LHY1 4Y52H 2QEXA 4QB4A 3NBHB 4GS3A 4J15A 1EU4A 3A8IE 4A3JB 2E2HB 4A4IA 3CCQA 4K0KQ 3NQIA 1IXRA 4BY1H 1XX8A 3HKZG 3A56A 5C0XI 4OO1I 1SE2A 5KNBA 3MEFA 2E2IB 1CSPA 1HUMA 4LF6Q 1LTAD 1SNMA 2WB1E 1W3SA 2ZJRA 3PQIA 4HJ7A 4ME5A 1EWCA 1IYUA 4L8JA 4ZRZA 1SFOH 1YHQA 4V190 3ICEA 1E22A 4BXXG 3FEWX 4DV6L 1SBBB 1PZJD 1VQJA 3PMFA 3TSSA 3K81C 3J81E 3A5UA 3U58A 2D5DA 3PO2B 2NWGA 1WTOA 1TU2B 2Y0SB 2F0TA 5FLXc 2F0IA 1PLFA 3CKIB 1G91A 1STHA 4S3SA 3S16H 5LMUL 2VQEL 4BBRH 3GTMB 2JYOA 1LTSD 1U9RA 3M4QA 2R7ZH 2UU9L 3IRBA 1U4PA 2EQSA 1SSOA 3PUYA 4JI3Q 4DV1L 2JA7G 1AP0A 4AQYL 4QQBX 1UNSA 3NENA 3S14H 2WINB 4JK1C 2F0VA 2JEAI 1HTLD 1RTOA 3BDLA 1HNXL 4OWTB 1K8AC 3NTHA 4IQZA 4A3EG 3BVGA 1CZGA 3I7FA 5FLMG 5M3FB 4A3DB 3GTGB 3ITPA 1KL9A 1MSGA 1L0WA 3C3LA 3W1BA 1VQ4A 2J4XA 2YV5A 4XIGS 4O2DA 1TIID 3GDEA 1Y1WH 2ICEC 3HOXG 2J7ZA 2QCPX 5CV6A 4A3GB 2F0JA 3CRLC 3W3AA 1BCPB 2QDLA 4KK7A 1ZXTA 1IHZA 1JCKB 3P1HA 3EA6A 1I3QH 5D3IB 1H95A 4GNXC 2CKZB 4X62Q 3N52A 1A0IA 2E2JB 2VB3X 1PRTD 2YTYA 2HIXA 1ASYA 3K5NA 2H4OA 3K0YA 1XPUA 3E0EA 2HT1A 5C3EH 5FLXE 3R93A 1VQ8A 4LWCA 2WAQB 4RA8A 5FJ8H 4R9WA 4OL7A 2ID0A 3EVQA 4EGVA 2D9UA 4XQNA 4OONA 3J7AV 4IUUA 2K05A 4ME3A 2VW9A 1K73C 2YU9H 1QOHA 2PMZB 5IWAQ 4DNTB 1W6JA 4MN3A 3DHQA 3HS0C 3CC2A 3T4AC 4IPCA 5M5XH 5IY0A 4GKKL 3G7LA 2Z4HA 4PZ7A 3GTJB 3G4SA 5IGEA 4DV7Q 1TWCH 4IURA 4OIKA 5CV7A 3V2TA 3CW2C 4LFBQ 3BVMA 3HKZE 1LT4D 3H3VI 1W6KA 3T53B 2HHHQ 3NQTA 3VR6A 3W5OA 4RH6A 1KNEA 1V8QA 1IBKL 1RKNA 4GLXA 2Z0SA 1ESRA 3OW7A 4LFCQ 4HSVA 4BS9A 1GKHA 3KBXA 3VR3A 3L7ZC 4IUPA 1WYDA 5EQ0A 1UE7A 4BY7H 2K4KA 2VQFL 4KKSA 1JORA 4OX9L 4JV5Q 1B4OA 3M3YH 1Q90A 4LF7Q 2K33A 4DV5L 2RSOA 2SDFA 1PFBA 3S2HH 3R2IA 1LT5D 4APVA 1Y1VB 3A5ZB 4DN4M 4R4TA 2PQAB 3F2CA 3RLNA 1SROA 2Q2IA 1N32L 2X6LA 4PNYA 3PO3B 4IUTA 4WJWA 5TSSA 1RODA 1S4ZA 5J22A 1KDAA 1KLUD 2M00A 4KJOA 4OELB 1TWHB 3RLFA 1R9TB 1EU3A 2D2CC 4DAYB 3QB3A 1LTGD 1O78A 2BE5D 2ZJQA 1N9WA 4DV1Q 4AQYQ 1STAA 1VQIA 5L37A 4A3IG 2CCZA 1BCPF 1E1OA 5GAHC 4LAAA 4R4IA 1B70B 5IP9G 4JI0Q 3PIPA 2QW7A 1PH4A 3DWPA 1IYVA 2Z4IA 1LYLA 1C7YA 1R4QB 1NAPA 2JA5H 4A3LH 1J8IA 3TS0A 3R2TA 4A3FG 1NE3A 4KMUC 1B44D 2K7VA 4QY7A 1HTPA 3C2PA 4DR7Q 1MD2D 2KCNA 1SMXA 3SEBA 3HOZG 2Q8TA 4CDDC 1FD7D 1WTRA 4FF4A 2ZTCA 5ELCA 3R8BA 2PW7A 2GVBA 4LK1C 4DUYL 5HURA 4LF4L 1JICA 1T5XD 3AYHB 1J9OA 2L9HA 1YJWA 3GTQH 2DGYA 3OIQA 2K5DA 2KOLA 5DLQE 1M1KC 5LMNW 2EXDA 3TP7A 1CZWA 5M3MG 3KUPA 5A2QL 3K6OA 1CT1D 2UUCQ 2RDGA 2UXDQ 5J1ZA 2G9DA 4FNFA 2KECA 1D1IA 1SYCA 3MFGA 1AZPA 4LFAL 5T1IA 2RCFA 4JBWA 5DEHA 1RL2A 3MXNA 2TSSA 4JI8Q 3HOYB 1KNAA 1YNXA 2Z8LA 5CBAE 5JVH3 5GAGC 1P8LA 1QZHA 1QCBD 2IHEA 2F0PA 2E2HH 2UUAQ 1IBLL 3AEVA 3M9BA 1NMFA 2E76C 4RKLA 1DJRD 2KBNA 1EQTA 1J5EL 4JI6L 5I2YA 2JA7B 2VZAA 4N8X1 3TMEA 1XNQL 2FJ2A 2N49A 2ZTDA 4P74A 5COYA 3W2DA 2JN4A 3TRZA 2AUJD 3G71A 2AQ1B 1TY2A 1JOKA 3D6WA 1CI3M 3STBD 1PHJA 4BA1I 4CBVA 1DOMA 1T9HA 4A3EB 1HNWL 1KAAA 4UP9A 4MNOA 2LS01 3CMEA 4KV6A 1HHVA 4B3RL 3CCLA 1R4PB 1SFOB 3OIPA 1YJ9A 2JA8H 4OX9Q 1WFQA 1E2WA 4EQNA 1JOQA 4A3KH 3QIAA 2R61A 1Q8IA 3TZUA 3HOXB 1EOTA 1STYA 2JK8A 4RFBA 4HEDA 1TKWB 5E3FA 4KY7A 4G7HC 4ZQ3A 1CQFA 5C0XH 1PH9A 5JJLA 5C5LA 2KHIA 3S16B 2IJ0A 4J1MA 3JAMc 1IBML 3HP3A 4BBRB 1KC8C 3CCUA 1EIYB 4RGNA 2R7ZB 1S5FD 2NBFA 2YYZA 5IYCG 5JEAG 3I4OA 1CKMA 2R93H 3S14B 1PH7A 4AYBG 5IE8A 1X6OA 1TXYA 3QR8A 3U4VA 4A3DH 1G291 1QE6A 2NZ1D 4TRDA 4K5XA 2B2VC 2RDHA 4PQXA 3I4NG 3I3CA 4DR2L 1D5MC 1O7IA 3HOUH 2KJXA 1QVCA 3LNNA 3RN5A 2OT2A 3A7LA 1F9SA 4A93G 1MGSA 2QKIC 2KEDA 1TWFH 3S1RH 4C1NI 1I4GA 3JAMi 4C3JH 1ZYRD 4C2MH 4A3GH 3BYTB 2WKCA 1Y1WB 1DCZA 3SK8A 2KHJA 2F52A 4DAPA 4GN3B 5FO8B 4DUYQ 4HIKA 4RGMA 1QG7A 3I55A 2F0DA 2PCFB 1XTCD 4JOIA 3KLRA 4B3SL 4RWSC 2QGQA 1I3QB 2JE6I 3F1ZA 4FF2A 4P2CB 2C35B 1I94L 4YY3L 1TVXA 4QMGA 3W1GA 4TSSA 3VYTA 1EY5A 1H9RA 2ASBA 4WJ3M 4EQOA 3F8TA 2NB0A 2K14A 3SR1A 4E6IA 1HFNA 4HMIA 5M9OA 3SE0A 3G6EA 3TZDA 2PNRC 4RKBA 1CKNA 2E2DC 3LX0A 5IGDA 1XPRA 5CR3A 1BR9A 5JOBA 2SOBA 4TKOB 4KY6A 3SGIA 1B7YB 1NUCA 3L0OA 4DAMA 2B2TC 2CWAA 1I4HA 1I6HH 3S1QB 1PV4A 4P75A 2CWPA 4K0KL 3CCEA 1IBLQ 3NEMA 4M1UB 1SNDA 1PRTC 3ONAB 1TWCB 2PYKA 2VB2X 1U5KA 1L0XB 4JI6Q 1BXTA 1SYDA 4LF6L 3T13A 4DR3L 3P7JA 1KD1C 1MJEA 2AWNA 2RCNA 3WWVA 5ELNA 1XPOA 1O7ZA 3OHXC 2LXKA 3K5LA 1AFPA 3S2DB 4JI1Q 4HJ9A 5IP7H 5J39A 4BY7B 2GVAA 3SXHA 3MTSA 5K36G 2NVTH 5JVG3 1LACA 2ALYB 4B3RQ 4FP5D 2K5VA 2HCCA 1X3GA 3M3YB 3T16A 4DV3Q 1M90C 3HOZB 3BZDB 3HEJA 1DD2A 3IAYA 4RGOS 1F9PA 2FMCA 4XQQA 3HOVG 2K75A 1HZ9A 5A35A 1Q3LA 2HQLA 3L9AX 2KCTA 4K8IA 4L63B 1R9TH 3H3VH 2MGSA 5EKKA 1HA6A 2A73B 3EJIA 3Q22A 4GOPB 1RDPD 4JI3L 2VUMH 3CPWA 5IT9L 4DKAC 4OXPA 1O7LA 1BF4A 3OMGA 4FYDA 2E75C 4GOPA 1U4RA 4IALA 2PW5A 1BCPD 2NVQH 4AYBE 4GN5A 1STBA 1ET9A 5IYDH 1PFSA 1FL0A 3OWFA 3A0JA 4FF3A 1CFMA 2B63G 2B2YC 4RG1A 1EY0A 1JQYD 1DONA 4O42A 2RHQB 1TWGH 2JA5B 2CHBD 5DM73 5EPKA 5ISRA 4JVZA 4LUZA 5BN5A 3RZDB 5IYBG 2F0QA 5G3LF 4TVAB 1Y8OB 1VQKA 1ENFA 2EJGC 1EIGA 5I9OA 1LTID 1YIJA 2BE5C 4QL5A 3MFYA 4IN3A 2WACA 3QJYA 4FXKC 2EPBA 4X62L 2EXZA 4G7ZC 1PH5A 3MEHA 3J81c 3HOWG 4UAIA 1GOZA 1V1QA 4UY8C 3GTQB 4QJFA 1ICWA 4BXXH 3FPUB 4CKBA 1D7QA 3I4MG 1D5XC 4DR5Q 1H9KA 1V43A
chains in the Genus database with same CATH topology
2MP1A 5FO7B 2F03A 5BN3A 5IOCA 3KLSX 2XNAC 3H09A 3MXPA 4BA2I 3T56B 1HQRD 2OF1A 1EQVA 5DNFA 4K6DA 2SNSA 2G9HD 1IW7D 5BN4A 4FXDA 5ELDA 2EYPA 1AEXA 3NBHA 4H44C 2EZVA 2BA1A 4PMWA 2BOSA 3TN2A 1ET6A 5DM63 2EYFA 4F7XA 2OEOA 1SJHD 1HXYD 3Q0AA 2IX3A 4KY5A 4WORA 3I4NB 1HUNA 1SYBA 4A93B 1NSNS 2JA8B 4K5WA 2EY5A 1EEFD 4A3KB 3N6RA 5JJZA 1Y8PB 3NXWA 5I2XA 5JEAJ 1KABA 5CBEE 1KDCA 4CJ2C 5EJWA 4K5VA 4Z9CB 1PTOH 2IW3A 5T1GA 2WV6D 4IFDG 3K58A 2B39A 1RTNA 1SDFA 1KLGD 5NUCA 1E0BA 2F0MA 3OPOA 3D4RA 4G57A 2R93B 4KN7C 1F9RA 2GA4B 2J0TD 2CVRA 1D5ZC 3L3OC 1EL0A 1EWHA 5C3XA 3VA5A 1TWAB 1GUSA 3NWSA 1DZ1A 1SYEA 2F0OA 2F0GA 3HOUB 1WTQA 3T51B 2F0WA 4CHTB 1TWFB 3S1RB 4C3JB 4ZLTF 5IIFA 4C2MB 2MPMA 4DNRB 1DOLA 2HCIA 4B08A 1LLRD 2WB1B 2RVLA 1TS3A 3DM1A 4DXGA 1AZQA 3M7GA 5FOBB 1A3TA 1A15A 3D8GA 4MHEA 3ERQA 1ZYRC 2EYOA 4RHRA 3PUXA 1A3VA 3X3NA 2BA0A 2XRSD 1UUPA 2WIIB 2EVBA 1I6HB 2DN8A 5CORA 2O4XA 1X3QA 3URYA 4J8QA 1GUOA 1RF2D 3A54A 1V1PB 5EKIA 1IKMA 1D1KA 1SEBD 4HAEA 1AN8A 1EY7A 2F0NA 3HZXA 2EDGA 2RSNA 1HRJA 3NTKA 1OXVA 4K6LA 2A69C 4ZAIA 4MIUA 2F0FA 3GQBA 2NVTB 1NCVA 1F2ZA 3WDNA 4HCEA 1LT6D 2K03A 3K5OA 1DOKA 1CA5A 2A6HC 1GHJA 2JXMB 3K5MA 4FO2A 3D3RA 3FVQA 2ZXOA 1S5BD 3I4MB 2VUMB 3GP7A 4ID6A 4DAYA 4EQPA 2NYZD 2F0LA 5K5PA 1F2YA 4O1NA 1PXUA 2NVQB 3ZYYX 2HDMA 4Q0FA 2L0CA 3NE5B 1XYIA 3TP6A 2X69A 5IT9E 4KJNA 4QF4A 3PIO3 1TWGB 3J80L 3MXUA 3OMCA 3S9WA 2KEEA 1H9JA 3A8KE 5G3LD 4ZYSA 1PZKD 3HKZB 1A3UA 1CK1A 1PYWD 1EYCA 1L0YB 1BCPC 2BDOA 3NSWA 1WD0A 5DAUA 3VYSA 4XXEA 3FDTA 1LV9A 1EY4A 5M5WB 4C3IG 5LL6X 4UDUC 3TP8A 1O80A 4C3HG 4ZK9B 2NN6G 3A8JE 2IT1A 1Q12A 3IKJA 4HMJA 2EYJA 1PMRA 2FINB 1QB5D 2QILA 4HR7B 3HG9A 4XYOA 3RZOB 5JEAH 4I7ZC 3SK5A 1FR3A 3P75A 4A3MB 1H9SB 3C1FA 4H13C 3A7AB 3J7YW 4DXFA 2B8GA 4K2LA 1G2SA 4GZYC 4X3TA 2RKSA 5F2DA 3AU7A 5CV9A 1IW7C 2B2WA 2NTTA 3PUWA 2F3WA 1PDQA 3AB9A 4BBSB 1KDBA 3NPPA 3MXGA 4KKTA 4NW2A 4IFDJ 3Q23A 4PV1C 2H1EA 1BNZA 1X32A 1RJTA 1JWUD 4CJ1B 1V1OA 2LFNA 1LTBD 2F0SA 1PTOB 2K5WA 3I90A 1YNND 5FK9C 3QO2A 2AQ2B 1GUGA 1RCVD 2K5QA 2RA4A 3HGBA 1M8AA 4L6TB 4ZUJA 5E4WC 4DFAA 1E2ZA 1TY0A 3F2UA 1SXTA 1SE3A 3WOEA 3C46A 3NP8A 1FNVA 2MUYA 3BDCA 2XSCA 3I72A 2AWOA 2XRQD 3LWUA 3IL8A 5K36H 2CQAA 3D31A 3H0GB 1HA5A 1YNJD 1I4XA 1VF5C 4KKUA 1B2TA 3U9OA 4BWGB 1CM9A 4KHVA 3KF8A 1S5CD 3D4WA 2RBMA 4F8MA 1B1ZA 4K14A 3PIP3 4U68A 2KVMA 3GTLB 5C4HA 4OO1G 3M4YA 1LT3D 1I50B 2NVXB 4J6HA 2ENBA 2QDBA 2I46A 2PZWA 1ILPA 5ELEA 4A3IB 3PV0A 2E74C 2B2UA 4NP5A 3H6MA 4M8AA 3IFDA 5D3DA 3H94A 1PTOF 2WKDA 4A3FB 5I4DA 1UAPA 4H7BA 2D62A 3QWNA 2NN6I 5JAVA 2O2LD 1CQVA 5E1FA 4U673 3DUZA 2CW0D 5I6YA 4KN4C 3S17B 2Q8RE 1TS4A 3FKIB 2K1BA 4XTCS 2C5CA 1ILQA 4PMBA 5KIXA 5M3MB 1BBXC 1C4QA 3FMCA 1EEID 5EBDA 3MVVA 1CHPD 4N9TA 1FNWA 3QOLA 1SMYD 1C48A 2F0HA 4F88A 3NK9A 1HFGA 1A6XA 2PPBC 1EYAA 1LTTD 1STEA 3DXJC 1ONLA 1SYGA 2WP8J 4ZKBB 3WOFA 1KTKA 1BO0A 1ENAA 1MSHA 2Q8IB 3K7AB 1OXSC 1K8OA 3NTIA 1C8CA 1SAPA 4KI0A 2KHSA 2JA6B 2EY2A 1STGA 5KNCA 3DMUA 2A68D 3J80E 1E2VA 1VCIA 4TQUS 2NVYB 1EIHA 5CGKA 1Q1EA 4DAVA 5D14A 1ESFA 3CRKC 4Y7NB 1EY8A 4CKEA 2L11A 1B9NA 3BG3A 5C4ZA 4I65A 1GHKA 4XDXA 5KRUA 1JWMD 3NWTA 3CQZB 3SK4A 2DNCA 2EE1A 3BVZA 2SNMA 1OO9B 4HSPA 1S5DD 4IFDH 4V0BA 2RQXA 2BDNA 3EFXD 1EZ8A 1I6VC 2A74C 4AYBB 2ICIA 1LO5D 1PFNA 3TDQA 2V4DA 4QIWB 2HDLA 2QEJC 1QNKA 3UI2A 4B9XA 2L1BA 3D4DA 1HQMC 5HGTA 3AMUA 1NR2A 2FFKB 2EYMA 3I8ZA 4FVMA 4QUFA 4FXGC 1U4LA 1TQOA 3OSOA 3I91A 4XT1B 2XWJB 3VYRA 4K2KA 2JEBI 2M2LA 1QWYA 2F1MA 1PZID 2F0EA 1U4MA 3M85A 3KK7A 1Z6HA 4CJ0B 2EOTA 2NTSA 5D65A 4KD3A 3VA7A 3Q6SA 3CHBD 2XVSA 3NBIA 5KEEA 3SDZA 5EKLA 4DF7A 4EVOA 4NKLA 2JP1A 4RHSA 2PQEA 1A2TA 2NUCA 4IUQA 2EY1A 5E4XA 1YNNC 2LY7A 1B9MA 3TBIB 5C0XJ 2LMCB 5EBCA 4OIJA 2K6AA 1AW7A 2PO4A 4HCSA 1EY6A 1F2LA 1I4RA 3JAML 2DY8A 2FHTA 4X3SA 1Y69U 2IPKD 3ND8A 4ILWA 4G7OC 3HOVB 4KHZA 4XT3B 1I4QA 5AFWA 1CA6A 4NMZA 5ELBA 2K01A 1RHPA 5M5YB 2JSOA 1OXUA 3TP5A 3NHHA 3SVMA 2C9OA 1X3PA 4KTAA 2EJMA 5FO9B 1GUNA 5IGCA 1ZEQX 1YNJC 4IUNA 1NR4A 4DK1A 1A2UA 1M4VA 2B63B 3BS1A 1V1PA 1II3A 1JR0D 1VMPA 1PTOD 1IL8A 2MJ8A 1BDOA 4Q5VA 5C4JB 1DM0B 5EPJA 3DEPA 3GTKB 3RMHA 5IGFA 4N9PA 2X6GA 5ELFA 2LKVA 5IODA 1O7YA 1CTMA 4DK0A 3HOWB 2RDFA 1PFMA 4LJZC 2L4NA 2XIWA 1SE4A 1G6ZA 2A6ED 3LWEA 2DY7A 1JC7A 1Y8NB 4X3UA 4KD4A 3M7NA 3DWAA 2NN6H 4ULLA 2A5HA 1WTPA 4DGZA 4X3KA 1Z47A 1F9QA 5C44B 2CW0C 2QF7A 3DWQA 2L5TA 4RCNA 2KA7A 3KLSA 1BQQT 5CC4A 1SNPA 3MWYW 2Z1CA 2DNEA 4IUVA 3CU7A 1VMCA 3SK6A 4IFDI 1T5EA 2O5IC 2B2VA 5C3WA 1SMYC 1K8MA 2F3VA 3M4OB 1EY9A 3HRZC 2B8FA 2R92B 4OGQC 2EJFC 3PUVA 3E0JA 1WD1A 2OXPA 3EQLC 3S15B 1S5ED 2F0KA 5CMDA 3GTOB 1B3AA 5EGTA 1GJXA 4NDXA 2A68C 2TMPA 2VNUD 1CHQD 1TR5A 3V05A 1TS5A 2L55A 4WRDA 3MHBA 1XXGA 1EYDA 1D6EC 1TT2A 1OXTA 2AQ3B 2M9VA 2ZT9C 5CYUA 1RD9D 3NUCA 3H91A 5C4XB 2IWHA 1JE4A 1H9SA 1MBYA 1PRTB 2K28A 3QG1A 2B2TA 4F87A 1JB3A 5FKAC 2K32A 3GO5A 3P20A 4BY1B 1F2MA 3J81L 1FGBD 3OOCA 4HTHA 1BOSA 2PZUA 3O13A 3K59A 1WVLA 1UEAB 4ZUIA 4DA2A 1SNQA 4WFN3 3H3VC 1VF7A 4ODGA 1SNCA 2EYHA 3E5SA 2F4IA 5CV4A 2BCOA 2L12A 1BUVT 3GTPB 4OO1H 4C56C 4FF1A 3I73A 3I4LA 3VR2A 2ZXPA 3S1NB 3SHLA 1B50A 4A3BB 2EYLA 3VYUA 1ENCA 1OXXK 4ZKCB 3S1MB 5KYIA 3DEOA 4CKCA 2IX1A 3VR4A 1Z7TA 5EPLA 1WTXA 2B2YA 1EFID 3Q24A 4H0LC 4RAUC 1JWSD 2IX0A 1SJED 5FLXL 3GV6A 2IL8A 1SYFA 2VXWA 3OWEB 5LL6S 3PUZA 5KYLA 1B53A 4XYQA 1GXDC 4R8IA 4CGYB 1FNUA 2PZTA 1PRTF 5C0XG 5JPMC 4R8NA 2KCCA 3FRPB 3VR5A 2XWBB 5C3EB 1G2TA 3MA2B 5C5MA 1F77A 3BYYB 3JAME 2KUMA 4QUCA 3QOJA 4HN7A 3K57A 1DYQA 3GV3A 4RCOA 3MAQA 2YU9B 1WCMB 2A69D 3U9SA 5I6WA 3D6CA 5KNDA 5M5XB 4OHJA 2B2WC 2AUKA 3X3MA 4C3JG 2A6HD 5CV8A 1QNUA 3MC0B 2I07B 2F0UA 2ZXRA 5I9PA 3KBGA 3RD4A 4PMCA 1FYCA 3FPPA 3EROA 1IKLA 3E6ZX 3RUZA 2HUGA 3V96A 1WTVA 3BDOA 1QILA 1PTOC 3S2HB 5IGGA 1XWEA 3G6JB 4C1NK 3C1EA 3IFTA 1EZ6A 3MZ5A 1VDZA 1G8ZD 4QCLA 2HQEA 1K83B 4C3IB 4XQJA 2MHVA 1LABA 4LMQD 2FMMA 4C3HB 1HCZA 3A55A 1LTRD 1Q1BA 2KQ3A 4YIJA 1WTWA 4RGTA 5C6AA 2K04A 1QJOA 2A6EC 2R6GA 5JPNC 5KGUA 3GD7A 2SEBD 4B9WA 3R3OA 1ZKOA 1SNOA 3I70A 1GUWA 5IGBA 2EY6A 1STNA 4G4KA 1I4PA 4K8JA 3ND9A 5CV5A 1MI2A 2O5JC 1JOOA 3J7AF 1D2BA 2N88A 1ML0D 4IZ8A 1TS2A 1GUTA 1DXMA 4ABNA 2B2UC 2XN9C 1HPCA 2R3ZA 1H9MA 5A2QE 2N55A 4DU9A 5LHY1 4QB4A 1EU4A 3A8IE 4A3JB 2E2HB 3NQIA 1XX8A 3A56A 5C0XI 4OO1I 1SE2A 5KNBA 2E2IB 1HUMA 1LTAD 1SNMA 4ME5A 1EWCA 1IYUA 4L8JA 4ZRZA 4V190 3FEWX 1SBBB 1PZJD 3PMFA 3TSSA 3J81E 2D5DA 3PO2B 2NWGA 1WTOA 1TU2B 2Y0SB 2F0TA 2F0IA 1PLFA 3CKIB 1G91A 1STHA 4S3SA 3GTMB 2JYOA 1LTSD 1U9RA 1U4PA 1SSOA 3PUYA 1AP0A 1UNSA 2WINB 4JK1C 2F0VA 2JEAI 1HTLD 1RTOA 3BDLA 3NTHA 4IQZA 3BVGA 1CZGA 5M3FB 4A3DB 3GTGB 3ITPA 1MSGA 3C3LA 2J4XA 4XIGS 1TIID 2ICEC 2J7ZA 2QCPX 5CV6A 4A3GB 2F0JA 3CRLC 3W3AA 1BCPB 4KK7A 1ZXTA 1IHZA 1JCKB 3P1HA 3EA6A 5D3IB 2E2JB 3N52A 2VB3X 1PRTD 3K5NA 2H4OA 3K0YA 5FLXE 3R93A 2WAQB 4RA8A 4R9WA 4OL7A 2ID0A 3EVQA 4EGVA 2D9UA 4XQNA 3J7AV 4IUUA 2K05A 1QOHA 2PMZB 4DNTB 1W6JA 4MN3A 3DHQA 3HS0C 3T4AC 3G7LA 2Z4HA 3GTJB 5IGEA 4IURA 4OIKA 5CV7A 3V2TA 3BVMA 1LT4D 1W6KA 3T53B 3NQTA 3VR6A 4RH6A 1KNEA 1V8QA 1RKNA 1ESRA 3OW7A 4HSVA 4BS9A 3KBXA 3VR3A 3L7ZC 4IUPA 5EQ0A 4KKSA 1JORA 1B4OA 1Q90A 2K33A 2RSOA 2SDFA 1PFBA 3R2IA 1LT5D 1Y1VB 4DN4M 2X6LA 4PNYA 3PO3B 4IUTA 4WJWA 5TSSA 1RODA 1S4ZA 5J22A 1KDAA 1KLUD 2M00A 4KJOA 1R9TB 1TWHB 3RLFA 1EU3A 2D2CC 3QB3A 1LTGD 1O78A 2BE5D 1STAA 1BCPF 4LAAA 3DWPA 1IYVA 2Z4IA 1R4QB 1NAPA 1J8IA 3R2TA 4KMUC 1B44D 2K7VA 1HTPA 3C2PA 1MD2D 2KCNA 3SEBA 2Q8TA 1FD7D 1WTRA 4FF4A 5ELCA 3R8BA 2PW7A 4LK1C 5HURA 1JICA 1T5XD 1J9OA 2L9HA 3OIQA 2K5DA 2KOLA 3TP7A 1CZWA 3KUPA 5A2QL 3K6OA 1CT1D 2RDGA 5J1ZA 2G9DA 4FNFA 2KECA 1D1IA 1SYCA 3MFGA 1AZPA 5T1IA 4JBWA 5DEHA 3MXNA 2TSSA 3HOYB 1KNAA 2Z8LA 5CBAE 5JVH3 1QCBD 2F0PA 2E76C 4RKLA 1DJRD 1EQTA 5I2YA 2JA7B 3TMEA 2FJ2A 3W2DA 5COYA 2AUJD 2AQ1B 1TY2A 1JOKA 3D6WA 1CI3M 4BA1I 4CBVA 1DOMA 4A3EB 1KAAA 2LS01 4KV6A 1HHVA 1R4PB 1SFOB 3OIPA 1E2WA 4EQNA 1JOQA 3QIAA 2R61A 1Q8IA 3TZUA 3HOXB 1EOTA 1STYA 4RFBA 4HEDA 1TKWB 5E3FA 4KY7A 4G7HC 4ZQ3A 1CQFA 5C0XH 5C5LA 3S16B 2IJ0A 4J1MA 3HP3A 4BBRB 4RGNA 2R7ZB 1S5FD 2NBFA 2YYZA 5JEAG 3S14B 1G291 1QE6A 2NZ1D 4TRDA 4K5XA 2B2VC 2RDHA 4PQXA 3I3CA 1D5MC 2KJXA 3LNNA 2OT2A 3A7LA 1F9SA 1MGSA 2QKIC 2KEDA 4C1NI 1I4GA 1ZYRD 3BYTB 2WKCA 1Y1WB 1DCZA 3SK8A 4DAPA 5FO8B 4RGMA 1QG7A 2F0DA 2PCFB 1XTCD 3KLRA 4RWSC 1I3QB 2JE6I 4FF2A 4P2CB 1TVXA 4QMGA 4TSSA 3VYTA 1EY5A 1H9RA 4EQOA 2NB0A 3SR1A 4E6IA 1HFNA 4HMIA 5M9OA 3SE0A 3TZDA 2PNRC 4RKBA 2E2DC 3LX0A 5IGDA 5CR3A 1BR9A 5JOBA 2SOBA 4TKOB 4KY6A 1NUCA 2B2TC 1I4HA 3S1QB 4M1UB 1SNDA 1PRTC 3ONAB 1TWCB 2PYKA 2VB2X 1L0XB 1SYDA 1BXTA 3T13A 3P7JA 2AWNA 1O7ZA 3OHXC 3K5LA 1AFPA 3S2DB 5J39A 4BY7B 3SXHA 3MTSA 5K36G 5JVG3 1LACA 4FP5D 2HCCA 3M3YB 3T16A 3HOZB 3BZDB 3HEJA 1DD2A 3IAYA 4RGOS 1F9PA 2FMCA 4XQQA 5A35A 1Q3LA 3L9AX 4K8IA 4L63B 2MGSA 5EKKA 1HA6A 2A73B 3EJIA 3Q22A 1RDPD 5IT9L 1BF4A 1O7LA 3OMGA 4FYDA 2E75C 1U4RA 4IALA 2PW5A 1BCPD 1STBA 1ET9A 3OWFA 4FF3A 1CFMA 2B2YC 1EY0A 1JQYD 1DONA 4O42A 2JA5B 2CHBD 5DM73 5EPKA 5ISRA 5BN5A 3RZDB 2F0QA 5G3LF 1Y8OB 1ENFA 2EJGC 1EIGA 5I9OA 1LTID 2BE5C 3MFYA 4IN3A 2WACA 3QJYA 4FXKC 2EPBA 2EXZA 4G7ZC 3MEHA 4UAIA 1GOZA 3GTQB 1ICWA 3FPUB 4CKBA 1D5XC 1H9KA 1V43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHV A;  3C1F A;  5C3X A;  3D4W A;  3VA5 A;  2RBM A;  3T13 A;  4F8M A;  1SYE A;  1II3 A;  4K14 A;  2F0O A;  5E3F A;  2F0K A;  5IGG A;  4KY7 A;  1ENA A;  5IOC A;  4ZQ3 A;  2F0G A;  3C1E A;  4OL7 A;  3MZ5 A;  1EZ6 A;  3EVQ A;  2F0W A;  4KD3 A;  5C5L A;  5C4H A;  5EGT A;  2HQE A;  4K2L A;  4J1M A;  3MXP A;  1SNM A;  2RKS A;  1SYG A;  2KHS A;  5IIF A;  4NDX A;  2EY2 A;  5F2D A;  2OF1 A;  1STG A;  1EQV A;  4ME5 A;  4ID6 A;  3DMU A;  5CV9 A;  4EQP A;  1TR5 A;  5KEE A;  4K6D A;  5J39 A;  2F0L A;  3SXH A;  2SNS A;  4J6H A;  2PW7 A;  1F2Y A;  5EKL A;  5IGF A;  3DHQ A;  5K5P A;  5HUR A;  2F3W A;  4N9P A;  4DF7 A;  4EVO A;  2ENB A;  2QDB A;  4NKL A;  4WRD A;  2PZW A;  1KDB A;  2LKV A;  2PQE A;  1SYF A;  3MHB A;  5IOD A;  2KQ3 A;  1EYD A;  3PMF A;  4YIJ A;  3T16 A;  5KYL A;  3HEJ A;  1TT2 A;  3TP6 A;  5IGE A;  2EYP A;  5CGK A;  4TRD A;  5CV7 A;  3NUC A;  4K5X A;  1AEX A;  4KJN A;  3TP7 A;  3V2T A;  1A2T A;  4NP5 A;  2RDF A;  5C6A A;  1EY8 A;  1A3T A;  2PZT A;  4QF4 A;  3H6M A;  4K8I A;  4R8N A;  5J1Z A;  2F0T A;  3OMC A;  3S9W A;  2F0I A;  2NUC A;  3NQT A;  2EYF A;  2EY1 A;  5EKK A;  1STH A;  2OEO A;  1SYC A;  4S3S A;  4F7X A;  5C4Z A;  3EJI A;  5KGU A;  1RKN A;  2F0S A;  4I65 A;  5DEH A;  3D8G A;  5KRU A;  3ERQ A;  4H7B A;  2EYO A;  3SK4 A;  1U9R A;  1F2M A;  1A3U A;  4KD4 A;  4B9W A;  5JAV A;  3R3O A;  3OMG A;  5C5M A;  4KY5 A;  1A3V A;  1EYC A;  1SNO A;  4WOR A;  3SK8 A;  4DGZ A;  2SNM A;  2PW5 A;  4HTH A;  4IAL A;  5E1F A;  3QOJ A;  1SYB A;  1JOR A;  5IGB A;  1STB A;  2EY6 A;  1STN A;  1NSN S;  2F0D A;  2F0P A;  2PZU A;  3OWF A;  5DAU A;  5I9O A;  4K5W A;  2EY5 A;  5I6Y A;  2F0V A;  5I6W A;  2O4X A;  3D6C A;  4ZUI A;  4ZUJ A;  4RKL A;  4K8J A;  1EZ8 A;  3BDL A;  1SNQ A;  1EY6 A;  3NXW A;  1EY0 A;  5CC4 A;  1SNP A;  4DFA A;  1EY4 A;  1KAB A;  5CV5 A;  4ODG A;  4QMG A;  1KDC A;  3TME A;  1SNC A;  4PMB A;  1JOO A;  5KIX A;  3ITP A;  4PNY A;  3TP8 A;  5ISR A;  4K5V A;  1EY5 A;  2EYH A;  1EY7 A;  2F0N A;  5CV8 A;  3E5S A;  5CV4 A;  3SK6 A;  4EQO A;  3HZX A;  4IZ8 A;  3NP8 A;  3SR1 A;  4B9X A;  4E6I A;  4NMZ A;  1KDA A;  3BDC A;  5J22 A;  1JOK A;  2F0U A;  2F0Q A;  2M00 A;  3MVV A;  4HMI A;  4KJO A;  4N9T A;  5I9P A;  5C3W A;  3QOL A;  5M9O A;  3NHH A;  3TP5 A;  2F3V A;  3QB3 A;  4HMJ A;  4RKB A;  2EYJ A;  1KAA A;  3D4D A;  3LX0 A;  4KTA A;  5HGT A;  5IGD A;  5CR3 A;  2WAC A;  1EY9 A;  4MIU A;  5JOB A;  2F0F A;  2SOB A;  2EYM A;  4KV6 A;  4KY6 A;  1NUC A;  1STA A;  4PMC A;  2EXZ A;  2F0H A;  5CV6 A;  3ERO A;  5NUC A;  3NK9 A;  2F0M A;  2F0J A;  1TQO A;  4G57 A;  3MEH A;  3OSO A;  5IGC A;  1F2Z A;  3SHL A;  2OXP A;  4EQN A;  1JOQ A;  4K2K A;  1IHZ A;  2EYL A;  3P1H A;  4DU9 A;  4IUN A;  4LAA A;  3RUZ A;  1EYA A;  3SK5 A;  1SND A;  1ENC A;  4QB4 A;  2F0E A;  2PYK A;  3U9O A;  5KYI A;  3P75 A;  1A2U A;  1STY A;  1SYD A; 
#chains in the Genus database with same CATH topology
 2N3S A;  1E7Z A;  2MP1 A;  5FO7 B;  2F03 A;  5BN3 A;  5IOC A;  5ELO A;  3KLS X;  2XNA C;  5IWA L;  4GNX B;  3UDI A;  3H09 A;  3MXP A;  4BA2 I;  1NJI C;  3T56 B;  1HQR D;  2OF1 A;  1EQV A;  5C44 G;  5DNF A;  4K6D A;  3RNU A;  2SNS A;  2G9H D;  1IW7 D;  5BN4 A;  3HFZ B;  1JT8 A;  1K0S A;  2K52 A;  4LFB L;  2JA7 H;  3RZO H;  4FXD A;  1EQQ A;  3J81 i;  5ELD A;  2EYP A;  2HHH L;  1AEX A;  3NBH A;  4H44 C;  2EZV A;  2BA1 A;  4PMW A;  1W2B A;  2BOS A;  4JW0 A;  2I5L X;  1ET6 A;  3TN2 A;  4LFC L;  5DM6 3;  4JI7 L;  1N8R C;  4DR3 Q;  2EYF A;  4F7X A;  4A3E H;  2OEO A;  1SJH D;  1HXY D;  5FLM H;  1VQG A;  1JJG A;  3KYH C;  3Q0A A;  1P16 A;  2IX3 A;  4JV5 L;  4KY5 A;  4LF7 L;  4WOR A;  3I4N B;  1HUN A;  2VL6 A;  3PIO A;  2R7D A;  1SYB A;  2L15 A;  3ZJY C;  4A93 B;  1NSN S;  3HOX H;  4YWM A;  2JA8 B;  4K5W A;  2EY5 A;  3U50 C;  4A3C G;  1EEF D;  4OWW B;  4A3K B;  3N6R A;  5JJZ A;  1Y8P B;  2I5M X;  3NXW A;  5I2X A;  5JEA J;  4JYA Q;  1KAB A;  5CBE E;  1KDC A;  4CJ2 C;  5EJW A;  4K5V A;  4PZ8 A;  4Z9C B;  1PTO H;  2IW3 A;  4UPA A;  3STB C;  5T1G A;  2WV6 D;  3G48 A;  4JI5 Q;  4IFD G;  3K58 A;  3OYY A;  2B39 A;  3OTO Q;  4A3M G;  2Q2T A;  1UWV A;  1RTN A;  4JI0 L;  1SDF A;  3DLL A;  1KLG D;  5NUC A;  1E0B A;  1MKH A;  3K80 C;  2F0M A;  3OPO A;  3D4R A;  4G57 A;  2R93 B;  4KN7 C;  1F9R A;  2GA4 B;  1NMG A;  2J0T D;  2CVR A;  1X9N A;  5JJK A;  1HZA A;  1X55 A;  1A8V A;  4IPG A;  1D5Z C;  3L3O C;  4DR7 L;  1EL0 A;  1EWH A;  5C3X A;  3VA5 A;  1TWA B;  1GUS A;  3NWS A;  1DZ1 A;  1SYE A;  1N34 Q;  4LF5 Q;  1MHW C;  2F0O A;  2CH4 W;  1VQL A;  4L5Q A;  1GM5 A;  2F0G A;  3HOU B;  1A63 A;  1WTQ A;  3T51 B;  2F0W A;  4BBS G;  4CHT B;  1TWF B;  3S1R B;  1QUQ B;  1YZ6 A;  4C3J B;  4ZLT F;  4C2M B;  5IIF A;  2MPM A;  4DNR B;  2OTL A;  1DOL A;  2HCI A;  4B08 A;  4JPB W;  4NXM Q;  1LLR D;  1DGS A;  2WB1 B;  1HZC A;  2RVL A;  4WJ4 A;  4IOA A;  2UUC L;  4JBK A;  1TS3 A;  2UXD L;  3DM1 A;  4DXG A;  4GLV B;  1AZQ A;  3M7G A;  5FOB B;  1A3T A;  1S72 A;  1SE8 A;  4R4O A;  3GTL H;  4JI8 L;  1EOV A;  1A15 A;  1I50 H;  2NVX H;  2E8G A;  3D8G A;  4MHE A;  3ERQ A;  1ZYR C;  4A76 A;  2EYO A;  2UXB Q;  3J81 j;  4RHR A;  3PUX A;  1A3V A;  4HJ5 A;  3X3N A;  3LGJ A;  2UUA L;  3S1Q H;  1E3P A;  2BA0 A;  4A3B G;  2XRS D;  2F4V Q;  1UUP A;  2WII B;  2EVB A;  1I6H B;  2DN8 A;  5COR A;  2O4X A;  4A3I H;  1X3Q A;  1VQA A;  5EAY A;  2PNH A;  3URY A;  4J8Q A;  1GUO A;  4CDF C;  1RF2 D;  3A54 A;  5IP9 H;  1V1P B;  1E1T A;  5EKI A;  1IKM A;  1D1K A;  4JI7 Q;  1K8G A;  1SEB D;  3S2D H;  4N8F A;  4HAE A;  1AN8 A;  1EY7 A;  2F0N A;  4A3F H;  3HZX A;  2EDG A;  2RSN A;  3H0G G;  1HRJ A;  1XNR Q;  4YCW A;  3NTK A;  1OXV A;  4K6L A;  2A69 C;  1JB7 A;  4ZAI A;  3HOZ H;  4MIU A;  4AH6 A;  2F0F A;  1RIP A;  1EQR A;  3GQB A;  2NVT B;  1NCV A;  1F2Z A;  3WDN A;  1FJG Q;  4HCE A;  1LT6 D;  3S17 H;  2K03 A;  3K5O A;  1PH8 A;  1DOK A;  1CA5 A;  2A6H C;  4DK6 C;  1YJN A;  2AKW B;  1GHJ A;  2JXM B;  3K5M A;  3J7A 5;  2PQA A;  5M3M H;  4L5T A;  4FO2 A;  3D3R A;  3FVQ A;  2ZXO A;  1S5B D;  3I4M B;  2VUM B;  3GP7 A;  4ID6 A;  4DAY A;  4EQP A;  1Q81 C;  2NYZ D;  1OTC A;  2F0L A;  5K5P A;  1WCM G;  1F2Y A;  4O1N A;  2OTJ A;  1PXU A;  2ZM6 Q;  2NVQ B;  3ZYY X;  4JCV E;  2HDM A;  2DJG C;  4Q0F A;  4GKJ Q;  2L0C A;  3NE5 B;  1XYI A;  3TP6 A;  2X69 A;  5IT9 E;  4IOC A;  4KJN A;  2XTI A;  4QF4 A;  3PIO 3;  2MO1 A;  3RZD H;  1TWG B;  2K5N A;  3J80 L;  2WFW A;  3E3X A;  3MXU A;  3OMC A;  3K7A H;  3S9W A;  2KEE A;  1H9J A;  3A8K E;  3I2Z A;  5G3L D;  4ZYS A;  3CD6 A;  1PZK D;  3HKZ B;  2JA6 H;  1A3U A;  1CK1 A;  1PYW D;  1EYC A;  1L0Y B;  3FKI G;  1BCP C;  3T1H Q;  2BDO A;  3NSW A;  1WD0 A;  3PCO B;  5DAU A;  2NVY H;  3VYS A;  1AE2 A;  1HR0 Q;  4XXE A;  1L1O B;  3FDT A;  1VQH A;  1LV9 A;  1EY4 A;  2ZTE A;  3CCR A;  5M5W B;  4C3I G;  5LL6 X;  4UDU C;  1VQP A;  3TP8 A;  1XJV A;  1O80 A;  4C3H G;  4IJL A;  4ZK9 B;  1WOC A;  2NN6 G;  4O0A A;  3CQZ H;  3KJO A;  3ULJ A;  3A8J E;  2IT1 A;  1Q12 A;  3IKJ A;  4HMJ A;  2EYJ A;  2FXQ A;  1PMR A;  3PGZ A;  2FIN B;  1QB5 D;  2QIL A;  1Q82 C;  4L5R C;  4HR7 B;  3HG9 A;  4YWK A;  4JI4 Q;  4DR1 L;  4XYO A;  3RZO B;  2IHF A;  5IYC H;  5JEA H;  4I7Z C;  3SK5 A;  3F2D A;  1FR3 A;  3P75 A;  2JA6 G;  1BBU A;  1H9S B;  4A3M B;  2KCM A;  3C1F A;  1WTH A;  4DNI A;  4H13 C;  4JI1 L;  4PG3 A;  3A7A B;  4YHH Q;  3I4N H;  3J7Y W;  2PI2 A;  4DXF A;  2B8G A;  1S3O A;  4K2L A;  1G2S A;  3AFQ A;  4GZY C;  4X3T A;  2RKS A;  5F2D A;  3AU7 A;  3CPF A;  5CV9 A;  4A93 H;  1IW7 C;  2B2W A;  2NTT A;  4DV3 L;  4LF8 Q;  3PUW A;  4HID A;  2F3W A;  1PDQ A;  4YWL A;  3AB9 A;  3U4Z A;  4BBS B;  3E9I A;  1KDB A;  3NPP A;  3MXG A;  4KKT A;  4NW2 A;  1SRU A;  4IFD J;  4DK3 C;  3CCV A;  3Q23 A;  4PV1 C;  2H1E A;  3ULL A;  1UEB A;  1BNZ A;  1X32 A;  1RJT A;  1JWU D;  4CJ1 B;  1D8L A;  1VQD A;  5E7N A;  2JQO A;  1EIF A;  1V1O A;  2LFN A;  1LTB D;  2V1C C;  2F0S A;  2LXJ A;  3FHW A;  1PTO B;  2K5W A;  3I90 A;  1YNN D;  5FK9 C;  1SLJ A;  3QO2 A;  2AQ2 B;  1GUG A;  2K5H A;  1RCV D;  1IL2 A;  1X3F A;  2Z6B A;  1G51 A;  2K5Q A;  2RA4 A;  3HGB A;  1M8A A;  4L6T B;  4A3J G;  1N36 L;  1TWA H;  3TRE A;  4ZUJ A;  2UXC Q;  1VS0 A;  5E4W C;  2MNA A;  4DFA A;  1E2Z A;  1TY0 A;  3F2U A;  3PF4 A;  1SXT A;  1SE3 A;  2CFM A;  1SN8 A;  3WOE A;  3F2B A;  3C46 A;  3NP8 A;  1FNV A;  2MUY A;  3BDC A;  2XSC A;  2Z6K A;  1JMC A;  2KEN A;  3I72 A;  2D0O A;  4X65 Q;  2AWO A;  2XRQ D;  3LWU A;  3IL8 A;  3L2P A;  4DR5 L;  5K36 H;  2CQA A;  3D31 A;  3H0G B;  3KF8 B;  1HA5 A;  3PO2 G;  4H02 A;  1YNJ D;  4DPG A;  1I4X A;  1VF5 C;  4KKU A;  1KRT A;  3KLW A;  1B2T A;  3U9O A;  4BWG B;  4AIM A;  1CM9 A;  4P72 A;  4KHV A;  3KF8 A;  1S5C D;  3D4W A;  3T1Y Q;  2RBM A;  4F8M A;  1B1Z A;  3HKS A;  4K14 A;  3A74 A;  3PIP 3;  4IPD A;  4U68 A;  3HOV H;  2KVM A;  1VQN A;  3GTL B;  2EIF A;  5C4H A;  4OO1 G;  3M4Y A;  1LT3 D;  1I50 B;  2NVX B;  2I0Q A;  4B3M Q;  2OQ0 A;  2IY5 B;  5AJ3 Q;  4J6H A;  1WI5 A;  2ENB A;  2QDB A;  2I46 A;  2PZW A;  1QVG A;  1GVP A;  1ILP A;  4HJ8 A;  4DR1 Q;  5ELE A;  4A3I B;  3PV0 A;  5M3F G;  3UDG A;  2E74 C;  2B2U A;  4NP5 A;  2B63 H;  3H6M A;  1CUK A;  2NZO A;  2CQO A;  3IFD A;  4M8A A;  5D3D A;  3H94 A;  5C4J H;  1PTO F;  2WKD A;  1N33 Q;  4A3F B;  5I4D A;  1UAP A;  4NB3 A;  4DUZ Q;  4H7B A;  2D62 A;  4IO9 A;  4X64 Q;  3QWN A;  2NN6 I;  5JAV A;  3GTK H;  3PSI A;  5IYB H;  2O2L D;  1CQV A;  5E1F A;  4U67 3;  2VY3 A;  3J80 c;  3FP9 A;  1CSQ A;  3DUZ A;  2CW0 D;  4JYA L;  2E5L L;  5I6Y A;  4KN4 C;  3S17 B;  2Q8R E;  3HOW H;  1TS4 A;  3FKI B;  2K1B A;  4XTC S;  4JC0 A;  1JJ2 A;  2C5C A;  1ILQ A;  4PMB A;  3I4M H;  4JI5 L;  5KIX A;  5M3M B;  1BBX C;  3H15 A;  1C4Q A;  3FMC A;  3OTO L;  1EEI D;  5EBD A;  2QA4 A;  3MVV A;  1CHP D;  4N9T A;  1FNW A;  3QOL A;  4UP7 A;  1SMY D;  3DM3 A;  1C48 A;  1ICF B;  5C44 H;  5LMN Q;  2F0H A;  4F88 A;  3NK9 A;  4QIW E;  1HFG A;  1A6X A;  1PYS B;  1N36 Q;  2PPB C;  1EYA A;  3JC6 6;  1N34 L;  1UE6 A;  1LTT D;  4LF5 L;  1STE A;  5BR8 Q;  3DXJ C;  1ONL A;  1SYG A;  2WP8 J;  4ZKB B;  3WOF A;  1KTK A;  1BO0 A;  1VQF A;  1NY4 A;  4DV4 Q;  1ENA A;  1VQE A;  1MSH A;  2Q8I B;  3K7A B;  4EQ5 A;  1OXS C;  1K8O A;  4X66 Q;  4DR6 Q;  1YVC A;  4JOI C;  3NTI A;  4NXM L;  1C8C A;  1SAP A;  4FDB A;  3UDF A;  4KI0 A;  2KHS A;  2JA6 B;  2EY2 A;  3M4O H;  1STG A;  5KNC A;  4DV0 Q;  3DMU A;  2A68 D;  4DR4 Q;  3J80 E;  1E2V A;  3AFP A;  1K28 A;  1VCI A;  4TQU S;  2B29 A;  3KF6 B;  2NVY B;  4LUO A;  4CDC C;  5M5W H;  1EIH A;  5CGK A;  1Q1E A;  4DAV A;  1QVF A;  5D14 A;  3PO3 G;  1ESF A;  3CRK C;  4A3C H;  4Y7N B;  1EY8 A;  3S15 H;  3VDY A;  3KJP A;  3GTO H;  2UXB L;  4CKE A;  2L11 A;  5JJI A;  1B9N A;  3BG3 A;  5C4Z A;  3NEL A;  2P5Z X;  4I65 A;  1GHK A;  3RN2 A;  4XDX A;  5KRU A;  4GNX A;  1JWM D;  3NWT A;  3BZC A;  3CQZ B;  3SK4 A;  2DNC A;  2F4V L;  2EE1 A;  4LF9 Q;  4DV2 Q;  1ASZ A;  5HY6 A;  3BVZ A;  2SNM A;  1OO9 B;  4HSP A;  1S5D D;  4IFD H;  1K3B C;  2OQK A;  3KDF B;  4V0B A;  2N8N A;  2RQX A;  4MTK A;  2BDN A;  4A3M H;  3EFX D;  1BKB A;  1EZ8 A;  1I6V C;  2A74 C;  4AYB B;  2ICI A;  1LO5 D;  2Z9H A;  1XNR L;  1K3R A;  1PFN A;  2R92 G;  3TDQ A;  1VQO A;  2V4D A;  4QIW B;  1HR0 W;  1VQ6 A;  2HDL A;  2QEJ C;  1VQ9 A;  4BBS H;  1QNK A;  3UI2 A;  4B9X A;  2L1B A;  3D4D A;  1AH9 A;  1HQM C;  1FJG L;  5HGT A;  3AMU A;  1NR2 A;  2FFK B;  2EYM A;  3I8Z A;  4FVM A;  5GQO A;  4QUF A;  4FXG C;  1U4L A;  1TQO A;  3OSO A;  3I91 A;  4XT1 B;  2XWJ B;  3ULP A;  3VYR A;  4K2K A;  2E5L Q;  2JEB I;  2WAQ E;  2M2L A;  1QWY A;  3J7Z C;  4X6A H;  2F1M A;  1PZI D;  2F0E A;  1VQC A;  1EFW A;  1U4M A;  3M85 A;  3KK7 A;  4JBJ A;  4CDE C;  2HD3 A;  1Z6H A;  4GOP C;  4CJ0 B;  2EOT A;  2PMZ E;  2NTS A;  5D65 A;  3HOY G;  4KD3 A;  3VA7 A;  3Q6S A;  3GTP H;  4P71 A;  2ZM6 L;  3CHB D;  2XVS A;  2G5D A;  3NBI A;  4GKJ L;  3SDZ A;  5KEE A;  1FGU A;  5EKL A;  5C4X G;  2YTX A;  4DF7 A;  4EVO A;  4NKL A;  2JP1 A;  4RHS A;  3S1N H;  2PQE A;  4A3B H;  4A75 A;  3CAM A;  3S1M H;  4BY1 G;  1A2T A;  1S40 A;  4POG A;  1Q8K A;  2DJF C;  1XMO Q;  1KRS A;  2NUC A;  4IUQ A;  2EY1 A;  2RHS B;  5E4X A;  1YNN C;  1X56 A;  3T1H L;  4KHP Q;  2ES2 A;  4JBM A;  2LY7 A;  1QUQ A;  1B9M A;  3H0G H;  4LUV A;  1HR0 L;  3TBI B;  5C0X J;  2LMC B;  5EBC A;  4OIJ A;  2K6A A;  4B3T Q;  1BVS A;  1AW7 A;  1J6Q A;  2BH2 A;  1Y14 B;  4NXN Q;  2AHO B;  1HNZ Q;  2PO4 A;  1EWI A;  1V9P A;  4HCS A;  1EY6 A;  1X54 A;  1F2L A;  5J3B A;  1IZ6 A;  1I4R A;  3JAM L;  2DY8 A;  1NBW A;  2FHT A;  4X3S A;  1Y69 U;  1LM0 A;  1E24 A;  1GO3 E;  2IPK D;  3ND8 A;  4ILW A;  4G7O C;  1YEZ A;  4BBR G;  3HOV B;  4KHZ A;  4XT3 B;  1PH6 A;  2R7Z G;  1L2F A;  1YIT A;  1I4Q A;  5AFW A;  1CA6 A;  4NMZ A;  5ELB A;  2K01 A;  1RHP A;  2UUB Q;  5M5Y B;  2JSO A;  1OXU A;  3NHH A;  3TP5 A;  3SVM A;  4JI4 L;  2C9O A;  1X3P A;  4KTA A;  3K7U C;  2EJM A;  2N78 A;  5FO9 B;  1GUN A;  3CCM A;  5IGC A;  1WCM H;  1ZEQ X;  5IT9 c;  4JI2 Q;  2MQH A;  1YNJ C;  4IUN A;  3PF5 A;  1NR4 A;  5GAE C;  4DK1 A;  3CF5 A;  1A2U A;  1M4V A;  4YHH L;  3S24 A;  2B63 B;  3BS1 A;  1V1P A;  3K0X A;  1II3 A;  1JR0 D;  1VMP A;  2RF4 A;  1PTO D;  1IL8 A;  2MJ8 A;  4RMF A;  1BDO A;  4Q5V A;  5C4J B;  1DM0 B;  1Y1W G;  4LF8 L;  5EPJ A;  1FVI A;  1LTL A;  4R1J A;  2NZH A;  3DEP A;  3GTK B;  3RMH A;  5IGF A;  4N9P A;  2X6G A;  5ELF A;  3FKI H;  1KQS A;  2LKV A;  5IOD A;  1O7Y A;  1KXL A;  1PH1 A;  1PH3 A;  5C3E G;  1CTM A;  4DK0 A;  1C9O A;  3HOW B;  2RDF A;  4R4C A;  5FJ8 G;  4DV6 Q;  1Q7Y C;  3AQQ A;  1PFM A;  4LJZ C;  2L4N A;  2XIW A;  1SE4 A;  1G6Z A;  2A6E D;  2BH8 A;  1K83 H;  4C3I H;  1G6P A;  3LWE A;  2DY7 A;  1JC7 A;  1Y8N B;  4X3U A;  4KD4 A;  3M7N A;  4C3H H;  3DWA A;  2NN6 H;  4ULL A;  2A5H A;  5LMU Q;  1WTP A;  1PYB A;  4DGZ A;  3CCJ A;  2VQE Q;  2UXC L;  4X3K A;  1Z47 A;  1F9Q A;  5C44 B;  2CW0 C;  2QF7 A;  3DWQ A;  2UU9 Q;  1VQM A;  2ZJP A;  2L5T A;  4RCN A;  4QGU A;  4GN4 B;  2KA7 A;  1XMQ L;  4POF A;  3KLS A;  3KFU A;  1BQQ T;  2PI2 E;  5CC4 A;  1SNP A;  4HIO A;  3MWY W;  2Z1C A;  2DNE A;  4IUV A;  1YHA A;  3CU7 A;  1HNX Q;  1K9M C;  4X65 L;  1VMC A;  3SK6 A;  4IFD I;  4BY7 G;  3RR5 A;  1T5E A;  2O5I C;  1A62 A;  2B2V A;  5C3W A;  3UE1 A;  1SMY C;  1K8M A;  2B3G A;  2F3V A;  3M4O B;  1I5F A;  1EY9 A;  3HRZ C;  2B8F A;  2R92 B;  1Q86 C;  4OGQ C;  2EJF C;  3PUV A;  3E0J A;  4NPS A;  4Y7N H;  1WD1 A;  2OXP A;  3T1Y L;  4LW1 A;  1L1O A;  3EQL C;  4P73 A;  3S15 B;  1S5E D;  2F0K A;  5CMD A;  4B3M L;  3GTO B;  1B3A A;  5AJ3 L;  5EGT A;  4UHV A;  1GJX A;  3MXN B;  4NDX A;  2A68 C;  2TMP A;  2VNU D;  1CHQ D;  1TR5 A;  1BBW A;  3V05 A;  1TS5 A;  2DUD A;  2L55 A;  4WRD A;  1X3E A;  3MHB A;  1XXG A;  1EYD A;  1D6E C;  1PA6 A;  1TT2 A;  1OXT A;  3TQY A;  2AQ3 B;  4YCU A;  2M9V A;  2ZT9 C;  2JA5 G;  4A3L G;  5CYU A;  4L5S A;  4A3J H;  1RD9 D;  3NUC A;  3H91 A;  4GKK Q;  5C4X B;  2IWH A;  1JE4 A;  1H9S A;  1B8A A;  1N33 L;  1MBY A;  4IPH A;  1PRT B;  2HIV A;  2K28 A;  4DUZ L;  3QG1 A;  2B2T A;  4X64 L;  4F87 A;  1JB3 A;  2E2I H;  5FKA C;  2K32 A;  3GO5 A;  3P20 A;  4BY1 B;  1F2M A;  3J81 L;  2JA9 A;  1FGB D;  3OOC A;  1IBK Q;  3KOJ A;  4HTH A;  1HZB A;  1BOS A;  2PZU A;  3O13 A;  3K59 A;  1WVL A;  1UEA B;  2VQF Q;  4YCV A;  4ZUI A;  4MTN A;  2XGT A;  3E9H A;  4DA2 A;  1SNQ A;  4WFN 3;  2GN5 A;  3H3V C;  1VF7 A;  3BZK A;  3PO2 H;  4ODG A;  4DV5 Q;  1SNC A;  3EBE A;  2EYH A;  3ERS X;  3E5S A;  2F4I A;  5CV4 A;  2BCO A;  3EIV A;  3GTM H;  2L12 A;  1BUV T;  3GTP B;  1N32 Q;  5LMN L;  1IYJ B;  4EX5 A;  4OO1 H;  4C56 C;  4FF1 A;  2OCE A;  3I73 A;  3I4L A;  3VR2 A;  1U0L A;  5BR8 L;  2ZXP A;  3S1N B;  2VS1 A;  3SHL A;  4ZCK A;  1B50 A;  4A3B B;  2EYL A;  3VYU A;  1EYG A;  1XMQ Q;  4UP8 A;  1ENC A;  1OXX K;  4DV4 L;  4ZKC B;  2F3I A;  3S1M B;  5KYI A;  3UDX A;  3ER0 A;  1UE1 A;  3DEO A;  4CKC A;  2IX1 A;  4X66 L;  4DR6 L;  5M3F H;  3VR4 A;  3GTG H;  1UE5 A;  3K8A A;  1Z7T A;  1KIX A;  1AE3 A;  5EPL A;  1PVO A;  1CKO A;  4DV0 L;  5HGQ A;  3CCS A;  3TS2 A;  3BU2 A;  1WTX A;  4DR4 L;  2B2Y A;  1EFI D;  1VQ7 A;  1HJP A;  3Q24 A;  4H0L C;  4RAU C;  2JA8 G;  1JWS D;  2IX0 A;  1SJE D;  5FLX L;  1L1O C;  4A3K G;  3GV6 A;  4MZ9 A;  2IL8 A;  1SYF A;  2Y0S G;  2VXW A;  3OWE B;  5LL6 S;  3PUZ A;  5KYL A;  1B53 A;  2E2J H;  3B6Y A;  4LF4 Q;  4XYQ A;  1GXD C;  4OEM B;  4R8I A;  2D0P A;  1C0A A;  4CGY B;  1FNU A;  2PZT A;  2K50 A;  1PRT F;  4GLA C;  4IJH A;  1JJC B;  5C0X G;  5JPM C;  5M5Y H;  4R8N A;  4LF9 L;  2KCC A;  4DV2 L;  1PH2 A;  3FRP B;  3VR5 A;  2XWB B;  2OWO A;  5C3E B;  4I7A A;  2AMC B;  1G2T A;  3MA2 B;  5C5M A;  1F77 A;  3BYY B;  1CKN B;  2KUM A;  3JAM E;  3Q8D A;  4LFA Q;  2R93 G;  4QUC A;  3QOJ A;  4HN7 A;  3K57 A;  1YI2 A;  4A3D G;  1DYQ A;  3GV3 A;  1KAW A;  2I5H A;  4RCO A;  3GTJ H;  3MAQ A;  2YU9 B;  1WCM B;  1QZG A;  1WJJ A;  2A69 D;  3U9S A;  3D6C A;  5I6W A;  1NNX A;  1Z9F A;  2H5X A;  5KND A;  1NTG A;  5M5X B;  1LUZ A;  4OHJ A;  3HOU G;  2B2W C;  3RLO A;  2AUK A;  3UE0 A;  1HH2 P;  3X3M A;  1J5E Q;  2JJQ A;  4C3J G;  2A6H D;  5CV8 A;  4A3G G;  1QNU A;  3CMA A;  1XNQ Q;  2Q2U A;  3MC0 B;  2I07 B;  2F0U A;  2ZXR A;  5I9P A;  3TEH B;  3D0F A;  2R7F A;  2WB1 G;  3KBG A;  3RD4 A;  4PMC A;  1FYC A;  5GRO A;  3FPP A;  3ERO A;  5GAD C;  1HNW Q;  1IKL A;  2WAQ G;  3E6Z X;  3RUZ A;  1Y1V H;  2HUG A;  2LSS A;  2YTV A;  3V96 A;  1WTV A;  4OWX B;  3BDO A;  1QIL A;  3CC4 A;  1PTO C;  3I56 A;  2ATW A;  3S2H B;  2MFI A;  3PO3 H;  5IGG A;  1XWE A;  3G6J B;  4C1N K;  3C1E A;  3IFT A;  1EZ6 A;  3EN2 A;  3MZ5 A;  1VDZ A;  1G8Z D;  4QCL A;  2HQE A;  1K83 B;  4C3I B;  1XTD A;  2MHV A;  1Q46 A;  1LAB A;  4XQJ A;  4LMQ D;  1TWH H;  2FMM A;  3CP0 A;  4R4Q A;  3J80 i;  1K0R A;  4C3H B;  1HCZ A;  1EUJ A;  3A55 A;  1IBM Q;  1LTR D;  1Q1B A;  2KQ3 A;  4PZ6 A;  4YIJ A;  1WTW A;  1XMO L;  4RGT A;  1SR3 A;  2Z6K C;  5C6A A;  1X65 A;  5H1S E;  3M4P A;  1JE5 A;  2MO0 A;  2K04 A;  4KHP L;  1YHB A;  1MJC A;  1QJO A;  2A6E C;  2R6G A;  5JPN C;  5KGU A;  3OW2 A;  3GD7 A;  2SEB D;  5IP7 G;  2R92 H;  4DR2 Q;  4B9W A;  3R3O A;  1ZKO A;  4B3T L;  1SNO A;  1Y1V G;  3I70 A;  4LNQ A;  4NXN L;  2Y0S E;  1GUW A;  1HNZ L;  5IGB A;  2EY6 A;  3BJU A;  2A8V A;  1STN A;  4G4K A;  1I4P A;  3KF6 A;  4K8J A;  2A1A A;  1VQ5 A;  4ALP A;  3ND9 A;  5CV5 A;  4B3S Q;  1MI2 A;  2O5J C;  1YBY A;  1KHI A;  2UUB L;  1JOO A;  3J7A F;  2VUM G;  1D2B A;  1I94 Q;  3CXC A;  2N88 A;  4YY3 Q;  1ML0 D;  4IZ8 A;  4KLK A;  4HJA A;  1TS2 A;  1GUT A;  2Q2H A;  4JG2 A;  3HOY H;  3CC7 A;  1DXM A;  1MIU A;  2B2U C;  4ABN A;  2CH4 A;  2A19 A;  5IYD G;  4JI2 L;  1VQB A;  4HIM A;  2XN9 C;  1HPC A;  1GD7 A;  1B3Q A;  2R3Z A;  1H9M A;  3KDF A;  5A2Q E;  5C4X H;  2N55 A;  4DV7 L;  4DU9 A;  5LHY 1;  4Y52 H;  2QEX A;  4QB4 A;  3NBH B;  4GS3 A;  4J15 A;  1EU4 A;  3A8I E;  4A3J B;  2E2H B;  4A4I A;  3CCQ A;  4K0K Q;  3NQI A;  1IXR A;  4BY1 H;  1XX8 A;  3HKZ G;  3A56 A;  5C0X I;  4OO1 I;  1SE2 A;  5KNB A;  3MEF A;  2E2I B;  1CSP A;  1HUM A;  4LF6 Q;  1LTA D;  1SNM A;  2WB1 E;  1W3S A;  2ZJR A;  3PQI A;  4HJ7 A;  4ME5 A;  1EWC A;  1IYU A;  4L8J A;  4ZRZ A;  1SFO H;  1YHQ A;  4V19 0;  3ICE A;  1E22 A;  4BXX G;  3FEW X;  4DV6 L;  1SBB B;  1PZJ D;  1VQJ A;  3PMF A;  3TSS A;  3K81 C;  3J81 E;  3A5U A;  3U58 A;  2D5D A;  3PO2 B;  2NWG A;  1WTO A;  1TU2 B;  2Y0S B;  2F0T A;  5FLX c;  2F0I A;  1PLF A;  3CKI B;  1G91 A;  1STH A;  4S3S A;  3S16 H;  5LMU L;  2VQE L;  4BBR H;  3GTM B;  2JYO A;  1LTS D;  1U9R A;  3M4Q A;  2R7Z H;  2UU9 L;  3IRB A;  1U4P A;  2EQS A;  1SSO A;  3PUY A;  4JI3 Q;  4DV1 L;  2JA7 G;  1AP0 A;  4AQY L;  4QQB X;  1UNS A;  3NEN A;  3S14 H;  2WIN B;  4JK1 C;  2F0V A;  2JEA I;  1HTL D;  1RTO A;  3BDL A;  1HNX L;  4OWT B;  1K8A C;  3NTH A;  4IQZ A;  4A3E G;  3BVG A;  1CZG A;  3I7F A;  5FLM G;  5M3F B;  4A3D B;  3GTG B;  3ITP A;  1KL9 A;  1MSG A;  1L0W A;  3C3L A;  3W1B A;  1VQ4 A;  2J4X A;  2YV5 A;  4XIG S;  4O2D A;  1TII D;  3GDE A;  1Y1W H;  2ICE C;  3HOX G;  2J7Z A;  2QCP X;  5CV6 A;  4A3G B;  2F0J A;  3CRL C;  3W3A A;  1BCP B;  2QDL A;  4KK7 A;  1ZXT A;  1IHZ A;  1JCK B;  3P1H A;  3EA6 A;  1I3Q H;  5D3I B;  1H95 A;  4GNX C;  2CKZ B;  4X62 Q;  3N52 A;  1A0I A;  2E2J B;  2VB3 X;  1PRT D;  2YTY A;  2HIX A;  1ASY A;  3K5N A;  2H4O A;  3K0Y A;  1XPU A;  3E0E A;  2HT1 A;  5C3E H;  5FLX E;  3R93 A;  1VQ8 A;  4LWC A;  2WAQ B;  4RA8 A;  5FJ8 H;  4R9W A;  4OL7 A;  2ID0 A;  3EVQ A;  4EGV A;  2D9U A;  4XQN A;  4OON A;  3J7A V;  4IUU A;  2K05 A;  4ME3 A;  2VW9 A;  1K73 C;  2YU9 H;  1QOH A;  2PMZ B;  5IWA Q;  4DNT B;  1W6J A;  4MN3 A;  3DHQ A;  3HS0 C;  3CC2 A;  3T4A C;  4IPC A;  5M5X H;  5IY0 A;  4GKK L;  3G7L A;  2Z4H A;  4PZ7 A;  3GTJ B;  3G4S A;  5IGE A;  4DV7 Q;  1TWC H;  4IUR A;  4OIK A;  5CV7 A;  3V2T A;  3CW2 C;  4LFB Q;  3BVM A;  3HKZ E;  1LT4 D;  3H3V I;  1W6K A;  3T53 B;  2HHH Q;  3NQT A;  3VR6 A;  3W5O A;  4RH6 A;  1KNE A;  1V8Q A;  1IBK L;  1RKN A;  4GLX A;  2Z0S A;  1ESR A;  3OW7 A;  4LFC Q;  4HSV A;  4BS9 A;  1GKH A;  3KBX A;  3VR3 A;  3L7Z C;  4IUP A;  1WYD A;  5EQ0 A;  1UE7 A;  4BY7 H;  2K4K A;  2VQF L;  4KKS A;  1JOR A;  4OX9 L;  4JV5 Q;  1B4O A;  3M3Y H;  1Q90 A;  4LF7 Q;  2K33 A;  4DV5 L;  2RSO A;  2SDF A;  1PFB A;  3S2H H;  3R2I A;  1LT5 D;  4APV A;  1Y1V B;  3A5Z B;  4DN4 M;  4R4T A;  2PQA B;  3F2C A;  3RLN A;  1SRO A;  2Q2I A;  1N32 L;  2X6L A;  4PNY A;  3PO3 B;  4IUT A;  4WJW A;  5TSS A;  1ROD A;  1S4Z A;  5J22 A;  1KDA A;  1KLU D;  2M00 A;  4KJO A;  4OEL B;  1TWH B;  3RLF A;  1R9T B;  1EU3 A;  2D2C C;  4DAY B;  3QB3 A;  1LTG D;  1O78 A;  2BE5 D;  2ZJQ A;  1N9W A;  4DV1 Q;  4AQY Q;  1STA A;  1VQI A;  5L37 A;  4A3I G;  2CCZ A;  1BCP F;  1E1O A;  5GAH C;  4LAA A;  4R4I A;  1B70 B;  5IP9 G;  4JI0 Q;  3PIP A;  2QW7 A;  1PH4 A;  3DWP A;  1IYV A;  2Z4I A;  1LYL A;  1C7Y A;  1R4Q B;  1NAP A;  2JA5 H;  4A3L H;  1J8I A;  3TS0 A;  3R2T A;  4A3F G;  1NE3 A;  4KMU C;  1B44 D;  2K7V A;  4QY7 A;  1HTP A;  3C2P A;  4DR7 Q;  1MD2 D;  2KCN A;  1SMX A;  3SEB A;  3HOZ G;  2Q8T A;  4CDD C;  1FD7 D;  1WTR A;  4FF4 A;  2ZTC A;  5ELC A;  3R8B A;  2PW7 A;  2GVB A;  4LK1 C;  4DUY L;  5HUR A;  4LF4 L;  1JIC A;  1T5X D;  3AYH B;  1J9O A;  2L9H A;  1YJW A;  3GTQ H;  2DGY A;  3OIQ A;  2K5D A;  2KOL A;  5DLQ E;  1M1K C;  5LMN W;  2EXD A;  3TP7 A;  1CZW A;  5M3M G;  3KUP A;  5A2Q L;  3K6O A;  1CT1 D;  2UUC Q;  2RDG A;  2UXD Q;  5J1Z A;  2G9D A;  4FNF A;  2KEC A;  1D1I A;  1SYC A;  3MFG A;  1AZP A;  4LFA L;  5T1I A;  2RCF A;  4JBW A;  5DEH A;  1RL2 A;  3MXN A;  2TSS A;  4JI8 Q;  3HOY B;  1KNA A;  1YNX A;  2Z8L A;  5CBA E;  5JVH 3;  5GAG C;  1P8L A;  1QZH A;  1QCB D;  2IHE A;  2F0P A;  2E2H H;  2UUA Q;  1IBL L;  3AEV A;  3M9B A;  1NMF A;  2E76 C;  4RKL A;  1DJR D;  2KBN A;  1EQT A;  1J5E L;  4JI6 L;  5I2Y A;  2JA7 B;  2VZA A;  4N8X 1;  3TME A;  1XNQ L;  2FJ2 A;  2N49 A;  2ZTD A;  4P74 A;  5COY A;  3W2D A;  2JN4 A;  3TRZ A;  2AUJ D;  3G71 A;  2AQ1 B;  1TY2 A;  1JOK A;  3D6W A;  1CI3 M;  3STB D;  1PHJ A;  4BA1 I;  4CBV A;  1DOM A;  1T9H A;  4A3E B;  1HNW L;  1KAA A;  4UP9 A;  4MNO A;  2LS0 1;  3CME A;  4KV6 A;  1HHV A;  4B3R L;  3CCL A;  1R4P B;  1SFO B;  3OIP A;  1YJ9 A;  2JA8 H;  4OX9 Q;  1WFQ A;  1E2W A;  4EQN A;  1JOQ A;  4A3K H;  3QIA A;  2R61 A;  1Q8I A;  3TZU A;  3HOX B;  1EOT A;  1STY A;  2JK8 A;  4RFB A;  4HED A;  1TKW B;  5E3F A;  4KY7 A;  4G7H C;  4ZQ3 A;  1CQF A;  5C0X H;  1PH9 A;  5JJL A;  5C5L A;  2KHI A;  3S16 B;  2IJ0 A;  4J1M A;  3JAM c;  1IBM L;  3HP3 A;  4BBR B;  1KC8 C;  3CCU A;  1EIY B;  4RGN A;  2R7Z B;  1S5F D;  2NBF A;  2YYZ A;  5IYC G;  5JEA G;  3I4O A;  1CKM A;  2R93 H;  3S14 B;  1PH7 A;  4AYB G;  5IE8 A;  1X6O A;  1TXY A;  3QR8 A;  3U4V A;  4A3D H;  1G29 1;  1QE6 A;  2NZ1 D;  4TRD A;  4K5X A;  2B2V C;  2RDH A;  4PQX A;  3I4N G;  3I3C A;  4DR2 L;  1D5M C;  1O7I A;  3HOU H;  2KJX A;  1QVC A;  3LNN A;  3RN5 A;  2OT2 A;  3A7L A;  1F9S A;  4A93 G;  1MGS A;  2QKI C;  2KED A;  1TWF H;  3S1R H;  4C1N I;  1I4G A;  3JAM i;  4C3J H;  1ZYR D;  4C2M H;  4A3G H;  3BYT B;  2WKC A;  1Y1W B;  1DCZ A;  3SK8 A;  2KHJ A;  2F52 A;  4DAP A;  4GN3 B;  5FO8 B;  4DUY Q;  4HIK A;  4RGM A;  1QG7 A;  3I55 A;  2F0D A;  2PCF B;  1XTC D;  4JOI A;  3KLR A;  4B3S L;  4RWS C;  2QGQ A;  1I3Q B;  2JE6 I;  3F1Z A;  4FF2 A;  4P2C B;  2C35 B;  1I94 L;  4YY3 L;  1TVX A;  4QMG A;  3W1G A;  4TSS A;  3VYT A;  1EY5 A;  1H9R A;  2ASB A;  4WJ3 M;  4EQO A;  3F8T A;  2NB0 A;  2K14 A;  3SR1 A;  4E6I A;  1HFN A;  4HMI A;  5M9O A;  3SE0 A;  3G6E A;  3TZD A;  2PNR C;  4RKB A;  1CKN A;  2E2D C;  3LX0 A;  5IGD A;  1XPR A;  5CR3 A;  1BR9 A;  5JOB A;  2SOB A;  4TKO B;  4KY6 A;  3SGI A;  1B7Y B;  1NUC A;  3L0O A;  4DAM A;  2B2T C;  2CWA A;  1I4H A;  1I6H H;  3S1Q B;  1PV4 A;  4P75 A;  2CWP A;  4K0K L;  3CCE A;  1IBL Q;  3NEM A;  4M1U B;  1SND A;  1PRT C;  3ONA B;  1TWC B;  2PYK A;  2VB2 X;  1U5K A;  1L0X B;  4JI6 Q;  1BXT A;  1SYD A;  4LF6 L;  3T13 A;  4DR3 L;  3P7J A;  1KD1 C;  1MJE A;  2AWN A;  2RCN A;  3WWV A;  5ELN A;  1XPO A;  1O7Z A;  3OHX C;  2LXK A;  3K5L A;  1AFP A;  3S2D B;  4JI1 Q;  4HJ9 A;  5IP7 H;  5J39 A;  4BY7 B;  2GVA A;  3SXH A;  3MTS A;  5K36 G;  2NVT H;  5JVG 3;  1LAC A;  2ALY B;  4B3R Q;  4FP5 D;  2K5V A;  2HCC A;  1X3G A;  3M3Y B;  3T16 A;  4DV3 Q;  1M90 C;  3HOZ B;  3BZD B;  3HEJ A;  1DD2 A;  3IAY A;  4RGO S;  1F9P A;  2FMC A;  4XQQ A;  3HOV G;  2K75 A;  1HZ9 A;  5A35 A;  1Q3L A;  2HQL A;  3L9A X;  2KCT A;  4K8I A;  4L63 B;  1R9T H;  3H3V H;  2MGS A;  5EKK A;  1HA6 A;  2A73 B;  3EJI A;  3Q22 A;  4GOP B;  1RDP D;  4JI3 L;  2VUM H;  3CPW A;  5IT9 L;  4DKA C;  4OXP A;  1O7L A;  1BF4 A;  3OMG A;  4FYD A;  2E75 C;  4GOP A;  1U4R A;  4IAL A;  2PW5 A;  1BCP D;  2NVQ H;  4AYB E;  4GN5 A;  1STB A;  1ET9 A;  5IYD H;  1PFS A;  1FL0 A;  3OWF A;  3A0J A;  4FF3 A;  1CFM A;  2B63 G;  2B2Y C;  4RG1 A;  1EY0 A;  1JQY D;  1DON A;  4O42 A;  2RHQ B;  1TWG H;  2JA5 B;  2CHB D;  5DM7 3;  5EPK A;  5ISR A;  4JVZ A;  4LUZ A;  5BN5 A;  3RZD B;  5IYB G;  2F0Q A;  5G3L F;  4TVA B;  1Y8O B;  1VQK A;  1ENF A;  2EJG C;  1EIG A;  5I9O A;  1LTI D;  1YIJ A;  2BE5 C;  4QL5 A;  3MFY A;  4IN3 A;  2WAC A;  3QJY A;  4FXK C;  2EPB A;  4X62 L;  2EXZ A;  4G7Z C;  1PH5 A;  3MEH A;  3J81 c;  3HOW G;  4UAI A;  1GOZ A;  1V1Q A;  4UY8 C;  3GTQ B;  4QJF A;  1ICW A;  4BXX H;  3FPU B;  4CKB A;  1D7Q A;  3I4M G;  1D5X C;  4DR5 Q;  1H9K A;  1V43 A; 
#chains in the Genus database with same CATH homology
 2MP1 A;  5FO7 B;  2F03 A;  5BN3 A;  5IOC A;  3KLS X;  2XNA C;  3H09 A;  3MXP A;  4BA2 I;  3T56 B;  1HQR D;  2OF1 A;  1EQV A;  5DNF A;  4K6D A;  2SNS A;  2G9H D;  1IW7 D;  5BN4 A;  4FXD A;  5ELD A;  2EYP A;  1AEX A;  3NBH A;  4H44 C;  2EZV A;  2BA1 A;  4PMW A;  2BOS A;  3TN2 A;  1ET6 A;  5DM6 3;  2EYF A;  4F7X A;  2OEO A;  1SJH D;  1HXY D;  3Q0A A;  2IX3 A;  4KY5 A;  4WOR A;  3I4N B;  1HUN A;  1SYB A;  4A93 B;  1NSN S;  2JA8 B;  4K5W A;  2EY5 A;  1EEF D;  4A3K B;  3N6R A;  5JJZ A;  1Y8P B;  3NXW A;  5I2X A;  5JEA J;  1KAB A;  5CBE E;  1KDC A;  4CJ2 C;  5EJW A;  4K5V A;  4Z9C B;  1PTO H;  2IW3 A;  5T1G A;  2WV6 D;  4IFD G;  3K58 A;  2B39 A;  1RTN A;  1SDF A;  1KLG D;  5NUC A;  1E0B A;  2F0M A;  3OPO A;  3D4R A;  4G57 A;  2R93 B;  4KN7 C;  1F9R A;  2GA4 B;  2J0T D;  2CVR A;  1D5Z C;  3L3O C;  1EL0 A;  1EWH A;  5C3X A;  3VA5 A;  1TWA B;  1GUS A;  3NWS A;  1DZ1 A;  1SYE A;  2F0O A;  2F0G A;  3HOU B;  1WTQ A;  3T51 B;  2F0W A;  4CHT B;  1TWF B;  3S1R B;  4C3J B;  4ZLT F;  5IIF A;  4C2M B;  2MPM A;  4DNR B;  1DOL A;  2HCI A;  4B08 A;  1LLR D;  2WB1 B;  2RVL A;  1TS3 A;  3DM1 A;  4DXG A;  1AZQ A;  3M7G A;  5FOB B;  1A3T A;  1A15 A;  3D8G A;  4MHE A;  3ERQ A;  1ZYR C;  2EYO A;  4RHR A;  3PUX A;  1A3V A;  3X3N A;  2BA0 A;  2XRS D;  1UUP A;  2WII B;  2EVB A;  1I6H B;  2DN8 A;  5COR A;  2O4X A;  1X3Q A;  3URY A;  4J8Q A;  1GUO A;  1RF2 D;  3A54 A;  1V1P B;  5EKI A;  1IKM A;  1D1K A;  1SEB D;  4HAE A;  1AN8 A;  1EY7 A;  2F0N A;  3HZX A;  2EDG A;  2RSN A;  1HRJ A;  3NTK A;  1OXV A;  4K6L A;  2A69 C;  4ZAI A;  4MIU A;  2F0F A;  3GQB A;  2NVT B;  1NCV A;  1F2Z A;  3WDN A;  4HCE A;  1LT6 D;  2K03 A;  3K5O A;  1DOK A;  1CA5 A;  2A6H C;  1GHJ A;  2JXM B;  3K5M A;  4FO2 A;  3D3R A;  3FVQ A;  2ZXO A;  1S5B D;  3I4M B;  2VUM B;  3GP7 A;  4ID6 A;  4DAY A;  4EQP A;  2NYZ D;  2F0L A;  5K5P A;  1F2Y A;  4O1N A;  1PXU A;  2NVQ B;  3ZYY X;  2HDM A;  4Q0F A;  2L0C A;  3NE5 B;  1XYI A;  3TP6 A;  2X69 A;  5IT9 E;  4KJN A;  4QF4 A;  3PIO 3;  1TWG B;  3J80 L;  3MXU A;  3OMC A;  3S9W A;  2KEE A;  1H9J A;  3A8K E;  5G3L D;  4ZYS A;  1PZK D;  3HKZ B;  1A3U A;  1CK1 A;  1PYW D;  1EYC A;  1L0Y B;  1BCP C;  2BDO A;  3NSW A;  1WD0 A;  5DAU A;  3VYS A;  4XXE A;  3FDT A;  1LV9 A;  1EY4 A;  5M5W B;  4C3I G;  5LL6 X;  4UDU C;  3TP8 A;  1O80 A;  4C3H G;  4ZK9 B;  2NN6 G;  3A8J E;  2IT1 A;  1Q12 A;  3IKJ A;  4HMJ A;  2EYJ A;  1PMR A;  2FIN B;  1QB5 D;  2QIL A;  4HR7 B;  3HG9 A;  4XYO A;  3RZO B;  5JEA H;  4I7Z C;  3SK5 A;  1FR3 A;  3P75 A;  4A3M B;  1H9S B;  3C1F A;  4H13 C;  3A7A B;  3J7Y W;  4DXF A;  2B8G A;  4K2L A;  1G2S A;  4GZY C;  4X3T A;  2RKS A;  5F2D A;  3AU7 A;  5CV9 A;  1IW7 C;  2B2W A;  2NTT A;  3PUW A;  2F3W A;  1PDQ A;  3AB9 A;  4BBS B;  1KDB A;  3NPP A;  3MXG A;  4KKT A;  4NW2 A;  4IFD J;  3Q23 A;  4PV1 C;  2H1E A;  1BNZ A;  1X32 A;  1RJT A;  1JWU D;  4CJ1 B;  1V1O A;  2LFN A;  1LTB D;  2F0S A;  1PTO B;  2K5W A;  3I90 A;  1YNN D;  5FK9 C;  3QO2 A;  2AQ2 B;  1GUG A;  1RCV D;  2K5Q A;  2RA4 A;  3HGB A;  1M8A A;  4L6T B;  4ZUJ A;  5E4W C;  4DFA A;  1E2Z A;  1TY0 A;  3F2U A;  1SXT A;  1SE3 A;  3WOE A;  3C46 A;  3NP8 A;  1FNV A;  2MUY A;  3BDC A;  2XSC A;  3I72 A;  2AWO A;  2XRQ D;  3LWU A;  3IL8 A;  5K36 H;  2CQA A;  3D31 A;  3H0G B;  1HA5 A;  1YNJ D;  1I4X A;  1VF5 C;  4KKU A;  1B2T A;  3U9O A;  4BWG B;  1CM9 A;  4KHV A;  3KF8 A;  1S5C D;  3D4W A;  2RBM A;  4F8M A;  1B1Z A;  4K14 A;  3PIP 3;  4U68 A;  2KVM A;  3GTL B;  5C4H A;  4OO1 G;  3M4Y A;  1LT3 D;  1I50 B;  2NVX B;  4J6H A;  2ENB A;  2QDB A;  2I46 A;  2PZW A;  1ILP A;  5ELE A;  4A3I B;  3PV0 A;  2E74 C;  2B2U A;  4NP5 A;  3H6M A;  4M8A A;  3IFD A;  5D3D A;  3H94 A;  1PTO F;  2WKD A;  4A3F B;  5I4D A;  1UAP A;  4H7B A;  2D62 A;  3QWN A;  2NN6 I;  5JAV A;  2O2L D;  1CQV A;  5E1F A;  4U67 3;  3DUZ A;  2CW0 D;  5I6Y A;  4KN4 C;  3S17 B;  2Q8R E;  1TS4 A;  3FKI B;  2K1B A;  4XTC S;  2C5C A;  1ILQ A;  4PMB A;  5KIX A;  5M3M B;  1BBX C;  1C4Q A;  3FMC A;  1EEI D;  5EBD A;  3MVV A;  1CHP D;  4N9T A;  1FNW A;  3QOL A;  1SMY D;  1C48 A;  2F0H A;  4F88 A;  3NK9 A;  1HFG A;  1A6X A;  2PPB C;  1EYA A;  1LTT D;  1STE A;  3DXJ C;  1ONL A;  1SYG A;  2WP8 J;  4ZKB B;  3WOF A;  1KTK A;  1BO0 A;  1ENA A;  1MSH A;  2Q8I B;  3K7A B;  1OXS C;  1K8O A;  3NTI A;  1C8C A;  1SAP A;  4KI0 A;  2KHS A;  2JA6 B;  2EY2 A;  1STG A;  5KNC A;  3DMU A;  2A68 D;  3J80 E;  1E2V A;  1VCI A;  4TQU S;  2NVY B;  1EIH A;  5CGK A;  1Q1E A;  4DAV A;  5D14 A;  1ESF A;  3CRK C;  4Y7N B;  1EY8 A;  4CKE A;  2L11 A;  1B9N A;  3BG3 A;  5C4Z A;  4I65 A;  1GHK A;  4XDX A;  5KRU A;  1JWM D;  3NWT A;  3CQZ B;  3SK4 A;  2DNC A;  2EE1 A;  3BVZ A;  2SNM A;  1OO9 B;  4HSP A;  1S5D D;  4IFD H;  4V0B A;  2RQX A;  2BDN A;  3EFX D;  1EZ8 A;  1I6V C;  2A74 C;  4AYB B;  2ICI A;  1LO5 D;  1PFN A;  3TDQ A;  2V4D A;  4QIW B;  2HDL A;  2QEJ C;  1QNK A;  3UI2 A;  4B9X A;  2L1B A;  3D4D A;  1HQM C;  5HGT A;  3AMU A;  1NR2 A;  2FFK B;  2EYM A;  3I8Z A;  4FVM A;  4QUF A;  4FXG C;  1U4L A;  1TQO A;  3OSO A;  3I91 A;  4XT1 B;  2XWJ B;  3VYR A;  4K2K A;  2JEB I;  2M2L A;  1QWY A;  2F1M A;  1PZI D;  2F0E A;  1U4M A;  3M85 A;  3KK7 A;  1Z6H A;  4CJ0 B;  2EOT A;  2NTS A;  5D65 A;  4KD3 A;  3VA7 A;  3Q6S A;  3CHB D;  2XVS A;  3NBI A;  5KEE A;  3SDZ A;  5EKL A;  4DF7 A;  4EVO A;  4NKL A;  2JP1 A;  4RHS A;  2PQE A;  1A2T A;  2NUC A;  4IUQ A;  2EY1 A;  5E4X A;  1YNN C;  2LY7 A;  1B9M A;  3TBI B;  5C0X J;  2LMC B;  5EBC A;  4OIJ A;  2K6A A;  1AW7 A;  2PO4 A;  4HCS A;  1EY6 A;  1F2L A;  1I4R A;  3JAM L;  2DY8 A;  2FHT A;  4X3S A;  1Y69 U;  2IPK D;  3ND8 A;  4ILW A;  4G7O C;  3HOV B;  4KHZ A;  4XT3 B;  1I4Q A;  5AFW A;  1CA6 A;  4NMZ A;  5ELB A;  2K01 A;  1RHP A;  5M5Y B;  2JSO A;  1OXU A;  3TP5 A;  3NHH A;  3SVM A;  2C9O A;  1X3P A;  4KTA A;  2EJM A;  5FO9 B;  1GUN A;  5IGC A;  1ZEQ X;  1YNJ C;  4IUN A;  1NR4 A;  4DK1 A;  1A2U A;  1M4V A;  2B63 B;  3BS1 A;  1V1P A;  1II3 A;  1JR0 D;  1VMP A;  1PTO D;  1IL8 A;  2MJ8 A;  1BDO A;  4Q5V A;  5C4J B;  1DM0 B;  5EPJ A;  3DEP A;  3GTK B;  3RMH A;  5IGF A;  4N9P A;  2X6G A;  5ELF A;  2LKV A;  5IOD A;  1O7Y A;  1CTM A;  4DK0 A;  3HOW B;  2RDF A;  1PFM A;  4LJZ C;  2L4N A;  2XIW A;  1SE4 A;  1G6Z A;  2A6E D;  3LWE A;  2DY7 A;  1JC7 A;  1Y8N B;  4X3U A;  4KD4 A;  3M7N A;  3DWA A;  2NN6 H;  4ULL A;  2A5H A;  1WTP A;  4DGZ A;  4X3K A;  1Z47 A;  1F9Q A;  5C44 B;  2CW0 C;  2QF7 A;  3DWQ A;  2L5T A;  4RCN A;  2KA7 A;  3KLS A;  1BQQ T;  5CC4 A;  1SNP A;  3MWY W;  2Z1C A;  2DNE A;  4IUV A;  3CU7 A;  1VMC A;  3SK6 A;  4IFD I;  1T5E A;  2O5I C;  2B2V A;  5C3W A;  1SMY C;  1K8M A;  2F3V A;  3M4O B;  1EY9 A;  3HRZ C;  2B8F A;  2R92 B;  4OGQ C;  2EJF C;  3PUV A;  3E0J A;  1WD1 A;  2OXP A;  3EQL C;  3S15 B;  1S5E D;  2F0K A;  5CMD A;  3GTO B;  1B3A A;  5EGT A;  1GJX A;  4NDX A;  2A68 C;  2TMP A;  2VNU D;  1CHQ D;  1TR5 A;  3V05 A;  1TS5 A;  2L55 A;  4WRD A;  3MHB A;  1XXG A;  1EYD A;  1D6E C;  1TT2 A;  1OXT A;  2AQ3 B;  2M9V A;  2ZT9 C;  5CYU A;  1RD9 D;  3NUC A;  3H91 A;  5C4X B;  2IWH A;  1JE4 A;  1H9S A;  1MBY A;  1PRT B;  2K28 A;  3QG1 A;  2B2T A;  4F87 A;  1JB3 A;  5FKA C;  2K32 A;  3GO5 A;  3P20 A;  4BY1 B;  1F2M A;  3J81 L;  1FGB D;  3OOC A;  4HTH A;  1BOS A;  2PZU A;  3O13 A;  3K59 A;  1WVL A;  1UEA B;  4ZUI A;  4DA2 A;  1SNQ A;  4WFN 3;  3H3V C;  1VF7 A;  4ODG A;  1SNC A;  2EYH A;  3E5S A;  2F4I A;  5CV4 A;  2BCO A;  2L12 A;  1BUV T;  3GTP B;  4OO1 H;  4C56 C;  4FF1 A;  3I73 A;  3I4L A;  3VR2 A;  2ZXP A;  3S1N B;  3SHL A;  1B50 A;  4A3B B;  2EYL A;  3VYU A;  1ENC A;  1OXX K;  4ZKC B;  3S1M B;  5KYI A;  3DEO A;  4CKC A;  2IX1 A;  3VR4 A;  1Z7T A;  5EPL A;  1WTX A;  2B2Y A;  1EFI D;  3Q24 A;  4H0L C;  4RAU C;  1JWS D;  2IX0 A;  1SJE D;  5FLX L;  3GV6 A;  2IL8 A;  1SYF A;  2VXW A;  3OWE B;  5LL6 S;  3PUZ A;  5KYL A;  1B53 A;  4XYQ A;  1GXD C;  4R8I A;  4CGY B;  1FNU A;  2PZT A;  1PRT F;  5C0X G;  5JPM C;  4R8N A;  2KCC A;  3FRP B;  3VR5 A;  2XWB B;  5C3E B;  1G2T A;  3MA2 B;  5C5M A;  1F77 A;  3BYY B;  3JAM E;  2KUM A;  4QUC A;  3QOJ A;  4HN7 A;  3K57 A;  1DYQ A;  3GV3 A;  4RCO A;  3MAQ A;  2YU9 B;  1WCM B;  2A69 D;  3U9S A;  5I6W A;  3D6C A;  5KND A;  5M5X B;  4OHJ A;  2B2W C;  2AUK A;  3X3M A;  4C3J G;  2A6H D;  5CV8 A;  1QNU A;  3MC0 B;  2I07 B;  2F0U A;  2ZXR A;  5I9P A;  3KBG A;  3RD4 A;  4PMC A;  1FYC A;  3FPP A;  3ERO A;  1IKL A;  3E6Z X;  3RUZ A;  2HUG A;  3V96 A;  1WTV A;  3BDO A;  1QIL A;  1PTO C;  3S2H B;  5IGG A;  1XWE A;  3G6J B;  4C1N K;  3C1E A;  3IFT A;  1EZ6 A;  3MZ5 A;  1VDZ A;  1G8Z D;  4QCL A;  2HQE A;  1K83 B;  4C3I B;  4XQJ A;  2MHV A;  1LAB A;  4LMQ D;  2FMM A;  4C3H B;  1HCZ A;  3A55 A;  1LTR D;  1Q1B A;  2KQ3 A;  4YIJ A;  1WTW A;  4RGT A;  5C6A A;  2K04 A;  1QJO A;  2A6E C;  2R6G A;  5JPN C;  5KGU A;  3GD7 A;  2SEB D;  4B9W A;  3R3O A;  1ZKO A;  1SNO A;  3I70 A;  1GUW A;  5IGB A;  2EY6 A;  1STN A;  4G4K A;  1I4P A;  4K8J A;  3ND9 A;  5CV5 A;  1MI2 A;  2O5J C;  1JOO A;  3J7A F;  1D2B A;  2N88 A;  1ML0 D;  4IZ8 A;  1TS2 A;  1GUT A;  1DXM A;  4ABN A;  2B2U C;  2XN9 C;  1HPC A;  2R3Z A;  1H9M A;  5A2Q E;  2N55 A;  4DU9 A;  5LHY 1;  4QB4 A;  1EU4 A;  3A8I E;  4A3J B;  2E2H B;  3NQI A;  1XX8 A;  3A56 A;  5C0X I;  4OO1 I;  1SE2 A;  5KNB A;  2E2I B;  1HUM A;  1LTA D;  1SNM A;  4ME5 A;  1EWC A;  1IYU A;  4L8J A;  4ZRZ A;  4V19 0;  3FEW X;  1SBB B;  1PZJ D;  3PMF A;  3TSS A;  3J81 E;  2D5D A;  3PO2 B;  2NWG A;  1WTO A;  1TU2 B;  2Y0S B;  2F0T A;  2F0I A;  1PLF A;  3CKI B;  1G91 A;  1STH A;  4S3S A;  3GTM B;  2JYO A;  1LTS D;  1U9R A;  1U4P A;  1SSO A;  3PUY A;  1AP0 A;  1UNS A;  2WIN B;  4JK1 C;  2F0V A;  2JEA I;  1HTL D;  1RTO A;  3BDL A;  3NTH A;  4IQZ A;  3BVG A;  1CZG A;  5M3F B;  4A3D B;  3GTG B;  3ITP A;  1MSG A;  3C3L A;  2J4X A;  4XIG S;  1TII D;  2ICE C;  2J7Z A;  2QCP X;  5CV6 A;  4A3G B;  2F0J A;  3CRL C;  3W3A A;  1BCP B;  4KK7 A;  1ZXT A;  1IHZ A;  1JCK B;  3P1H A;  3EA6 A;  5D3I B;  2E2J B;  3N52 A;  2VB3 X;  1PRT D;  3K5N A;  2H4O A;  3K0Y A;  5FLX E;  3R93 A;  2WAQ B;  4RA8 A;  4R9W A;  4OL7 A;  2ID0 A;  3EVQ A;  4EGV A;  2D9U A;  4XQN A;  3J7A V;  4IUU A;  2K05 A;  1QOH A;  2PMZ B;  4DNT B;  1W6J A;  4MN3 A;  3DHQ A;  3HS0 C;  3T4A C;  3G7L A;  2Z4H A;  3GTJ B;  5IGE A;  4IUR A;  4OIK A;  5CV7 A;  3V2T A;  3BVM A;  1LT4 D;  1W6K A;  3T53 B;  3NQT A;  3VR6 A;  4RH6 A;  1KNE A;  1V8Q A;  1RKN A;  1ESR A;  3OW7 A;  4HSV A;  4BS9 A;  3KBX A;  3VR3 A;  3L7Z C;  4IUP A;  5EQ0 A;  4KKS A;  1JOR A;  1B4O A;  1Q90 A;  2K33 A;  2RSO A;  2SDF A;  1PFB A;  3R2I A;  1LT5 D;  1Y1V B;  4DN4 M;  2X6L A;  4PNY A;  3PO3 B;  4IUT A;  4WJW A;  5TSS A;  1ROD A;  1S4Z A;  5J22 A;  1KDA A;  1KLU D;  2M00 A;  4KJO A;  1R9T B;  1TWH B;  3RLF A;  1EU3 A;  2D2C C;  3QB3 A;  1LTG D;  1O78 A;  2BE5 D;  1STA A;  1BCP F;  4LAA A;  3DWP A;  1IYV A;  2Z4I A;  1R4Q B;  1NAP A;  1J8I A;  3R2T A;  4KMU C;  1B44 D;  2K7V A;  1HTP A;  3C2P A;  1MD2 D;  2KCN A;  3SEB A;  2Q8T A;  1FD7 D;  1WTR A;  4FF4 A;  5ELC A;  3R8B A;  2PW7 A;  4LK1 C;  5HUR A;  1JIC A;  1T5X D;  1J9O A;  2L9H A;  3OIQ A;  2K5D A;  2KOL A;  3TP7 A;  1CZW A;  3KUP A;  5A2Q L;  3K6O A;  1CT1 D;  2RDG A;  5J1Z A;  2G9D A;  4FNF A;  2KEC A;  1D1I A;  1SYC A;  3MFG A;  1AZP A;  5T1I A;  4JBW A;  5DEH A;  3MXN A;  2TSS A;  3HOY B;  1KNA A;  2Z8L A;  5CBA E;  5JVH 3;  1QCB D;  2F0P A;  2E76 C;  4RKL A;  1DJR D;  1EQT A;  5I2Y A;  2JA7 B;  3TME A;  2FJ2 A;  3W2D A;  5COY A;  2AUJ D;  2AQ1 B;  1TY2 A;  1JOK A;  3D6W A;  1CI3 M;  4BA1 I;  4CBV A;  1DOM A;  4A3E B;  1KAA A;  2LS0 1;  4KV6 A;  1HHV A;  1R4P B;  1SFO B;  3OIP A;  1E2W A;  4EQN A;  1JOQ A;  3QIA A;  2R61 A;  1Q8I A;  3TZU A;  3HOX B;  1EOT A;  1STY A;  4RFB A;  4HED A;  1TKW B;  5E3F A;  4KY7 A;  4G7H C;  4ZQ3 A;  1CQF A;  5C0X H;  5C5L A;  3S16 B;  2IJ0 A;  4J1M A;  3HP3 A;  4BBR B;  4RGN A;  2R7Z B;  1S5F D;  2NBF A;  2YYZ A;  5JEA G;  3S14 B;  1G29 1;  1QE6 A;  2NZ1 D;  4TRD A;  4K5X A;  2B2V C;  2RDH A;  4PQX A;  3I3C A;  1D5M C;  2KJX A;  3LNN A;  2OT2 A;  3A7L A;  1F9S A;  1MGS A;  2QKI C;  2KED A;  4C1N I;  1I4G A;  1ZYR D;  3BYT B;  2WKC A;  1Y1W B;  1DCZ A;  3SK8 A;  4DAP A;  5FO8 B;  4RGM A;  1QG7 A;  2F0D A;  2PCF B;  1XTC D;  3KLR A;  4RWS C;  1I3Q B;  2JE6 I;  4FF2 A;  4P2C B;  1TVX A;  4QMG A;  4TSS A;  3VYT A;  1EY5 A;  1H9R A;  4EQO A;  2NB0 A;  3SR1 A;  4E6I A;  1HFN A;  4HMI A;  5M9O A;  3SE0 A;  3TZD A;  2PNR C;  4RKB A;  2E2D C;  3LX0 A;  5IGD A;  5CR3 A;  1BR9 A;  5JOB A;  2SOB A;  4TKO B;  4KY6 A;  1NUC A;  2B2T C;  1I4H A;  3S1Q B;  4M1U B;  1SND A;  1PRT C;  3ONA B;  1TWC B;  2PYK A;  2VB2 X;  1L0X B;  1SYD A;  1BXT A;  3T13 A;  3P7J A;  2AWN A;  1O7Z A;  3OHX C;  3K5L A;  1AFP A;  3S2D B;  5J39 A;  4BY7 B;  3SXH A;  3MTS A;  5K36 G;  5JVG 3;  1LAC A;  4FP5 D;  2HCC A;  3M3Y B;  3T16 A;  3HOZ B;  3BZD B;  3HEJ A;  1DD2 A;  3IAY A;  4RGO S;  1F9P A;  2FMC A;  4XQQ A;  5A35 A;  1Q3L A;  3L9A X;  4K8I A;  4L63 B;  2MGS A;  5EKK A;  1HA6 A;  2A73 B;  3EJI A;  3Q22 A;  1RDP D;  5IT9 L;  1BF4 A;  1O7L A;  3OMG A;  4FYD A;  2E75 C;  1U4R A;  4IAL A;  2PW5 A;  1BCP D;  1STB A;  1ET9 A;  3OWF A;  4FF3 A;  1CFM A;  2B2Y C;  1EY0 A;  1JQY D;  1DON A;  4O42 A;  2JA5 B;  2CHB D;  5DM7 3;  5EPK A;  5ISR A;  5BN5 A;  3RZD B;  2F0Q A;  5G3L F;  1Y8O B;  1ENF A;  2EJG C;  1EIG A;  5I9O A;  1LTI D;  2BE5 C;  3MFY A;  4IN3 A;  2WAC A;  3QJY A;  4FXK C;  2EPB A;  2EXZ A;  4G7Z C;  3MEH A;  4UAI A;  1GOZ A;  3GTQ B;  1ICW A;  3FPU B;  4CKB A;  1D5X C;  1H9K A;  1V43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...