5IGCA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igcA00
2F0GA 2SOBA 4PMCA 5CV5A 1EYAA 3DHQA 5EGTA 3SHLA 2EY5A 2PZWA 3D8GA 5HGTA 5CR3A 4ODGA 5IIFA 4K14A 3MZ5A 2EYMA 1SNPA 2LKVA 2PW5A 2KHSA 2RBMA 3HEJA 4EQPA 1NUCA 2F0VA 3ERQA 4TRDA 1TR5A 5I6YA 3QB3A 2F0EA 1KABA 4DGZA 3LX0A 1SNOA 2OEOA 5DAUA 3PMFA 4IALA 5DEHA 1A3UA 2F0DA 3TP8A 5C4HA 1KAAA 1EY6A 1EY5A 4KD3A 2EYJA 2KQ3A 3NUCA 1RKNA 3VA5A 4KY6A 1JORA 1EY0A 4S3SA 3EROA 1F2MA 1STHA 3MEHA 1A2UA 3TMEA 4KTAA 3TP5A 2F0FA 4K6DA 5IGCA 5K5PA 4NP5A 1KDBA 1F2YA 4KY7A 4OL7A 5KYIA 5HURA 5J22A 4I65A 4NMZA 2EYPA 4R8NA 4B9XA 1NSNS 3BDLA 2OXPA 3SR1A 2F0QA 4HMIA 5JOBA 4WORA 4QMGA 3RUZA 3S9WA 1TT2A 1EYCA 1EY9A 2F0HA 1EYDA 3NP8A 2O4XA 3HZXA 5C4ZA 5IGEA 2ENBA 1SYEA 5C3WA 4LAAA 4K5WA 5CV6A 4PMBA 2F0IA 4EVOA 1IHZA 3BDCA 3P75A 3NQTA 4HTHA 3NK9A 3MVVA 4H7BA 3SK6A 1II3A 3EJIA 5IGDA 3QOJA 1AEXA 4RKLA 1EZ6A 5CC4A 3TP7A 4K2LA 2F0TA 4DU9A 4KY5A 3QOLA 2F0WA 5CGKA 1EY7A 1STYA 5JAVA 4EQNA 4PNYA 4QB4A 2PQEA 1A3TA 1STBA 3DMUA 1KDCA 1EY8A 3ITPA 2EYHA 5IGGA 1SYFA 5IOCA 5KYLA 4J6HA 5ISRA 1EQVA 5C3XA 4N9PA 3D6CA 2QDBA 3H6MA 3E5SA 3SXHA 2HQEA 5F2DA 5EKKA 3D4WA 1STAA 4K8JA 2OF1A 3NXWA 4IZ8A 5E3FA 5EKLA 5I9PA 4NDXA 2EYOA 5IODA 4ID6A 4KV6A 4F7XA 2WACA 3U9OA 1ENAA 2RKSA 4WRDA 5IGBA 1SNCA 3C1FA 4K8IA 5CV9A 4K5XA 5CV7A 1SNDA 3P1HA 5KGUA 2F0LA 2EYFA 5KIXA 2M00A 4K5VA 4KHVA 2NUCA 3T16A 4KD4A 1A2TA 2PW7A 3OSOA 4YIJA 1EZ8A 4DFAA 5J1ZA 2PZUA 2F0OA 3MHBA 4J1MA 4MIUA 2SNSA 1JOKA 4N9TA 4QF4A 4F8MA 1JOOA 5KEEA 2F0JA 4ZUJA 4NKLA 2F0NA 2PYKA 4RKBA 2F0PA 5CV8A 4B9WA 5C6AA 3EVQA 1KDAA 1EY4A 2EXZA 4ME5A 2F0KA 4ZQ3A 2F0SA 2RDFA 5E1FA 4G57A 3SK4A 3TP6A 5IGFA 2EYLA 1A3VA 3SK5A 1SNQA 1ENCA 3NHHA 3V2TA 2F0MA 2SNMA 4IUNA 5NUCA 5C5MA 4HMJA 2F3VA 4KJNA 3OMCA 3OWFA 2F3WA 3SK8A 4EQOA 3D4DA 5I6WA 1SNMA 4ZUIA 2EY1A 3T13A 2PZTA 1JOQA 2EY2A 4K2KA 1STNA 1U9RA 5C5LA 5KRUA 1SYDA 4KJOA 3R3OA 4E6IA 1SYCA 1SYBA 1TQOA 1STGA 5I9OA 1SYGA 3C1EA 3OMGA 4DF7A 5M9OA 5CV4A 5J39A 2F0UA 3MXPA 1F2ZA 2EY6A
chains in the Genus database with same CATH superfamily
1WTWA 4HSPA 3J80L 1JB7A 2A68D 4A3JH 3I72A 1LTTD 3EBEA 1K3BC 1TS3A 1Q90A 5EPKA 4QUFA 1Q82C 1EY5A 1FJGQ 4KY6A 1HNXL 2R7ZG 3AFQA 1KD1C 2OTJA 1VQAA 2J7ZA 3EA6A 2BDOA 1BVSA 2UUAL 4IFDG 3STBD 3DLLA 1Z7TA 3B6YA 1PHJA 2E2IB 5IWAL 1OTCA 2ENBA 4GOPA 4LAAA 2D0PA 3TRZA 4A93G 3VR6A 1IYJB 1U4MA 1S40A 2ATWA 1PA6A 4XQQA 5C4JH 1EL0A 3GTGB 5JVH3 3S16H 3V96A 1EIGA 1I4RA 4C3HB 1EEFD 4OGQC 3J81j 1JWUD 3BVGA 3S2DH 4IN3A 2ICEC 1HQMC 1YBYA 5ISRA 4J6HA 1HQRD 5BR8Q 3D6CA 1Q8IA 2EQSA 2MQHA 4GKKL 3PO2G 1JJCB 1HFGA 1PTOD 2K52A 3K0XA 5CBAE 3CCLA 4APVA 5LMNL 2H1EA 1S5DD 2XWJB 3G6EA 4X3TA 2XN9C 3K8AA 5M3MG 3PUYA 4LF8L 4CDDC 1YNJD 2HCIA 1WI5A 1JOOA 3HOZG 2B63G 2IHFA 4BY7G 3K7AB 2Y0SG 3TN2A 1DGSA 1VMCA 5C6AA 1HCZA 4NXML 2F0KA 4FNFA 3TP6A 1MD2D 4HJAA 5EPJA 4C3IG 1X9NA 4G7ZC 5C5MA 1PFSA 3PGZA 2B63H 1K83B 4GOPC 2ES2A 2JJQA 3E6ZX 3A8IE 3RN2A 2A5HA 1V8QA 4IQZA 2M9VA 5M5XB 3CPFA 5JEAJ 2F1MA 2EY2A 4LF5L 3AFPA 1WVLA 1QVCA 1B8AA 2LXJA 2D9UA 3I4MH 1DJRD 4LF5Q 2Q2TA 1JE5A 2E76C 4OWXB 2SOBA 4XYQA 3PUXA 4L5QA 1MKHA 4POFA 1KRSA 1SNPA 1B44D 4CKEA 2F3IA 4OXPA 3NENA 4DGZA 1O7IA 1GVPA 2XSCA 1EWHA 3NTHA 5D3DA 1RDPD 1XPOA 3BZDB 3VA5A 2DJFC 3NUCA 1RKNA 3J81E 4LUVA 2WKDA 3PUZA 1PFNA 3BVMA 4K6LA 3FKIG 3PCOB 1OXTA 4LFBQ 4HJ9A 3CU7A 3BJUA 1N9WA 4KN4C 1D7QA 2Z9HA 4KHZA 2EXDA 2KOLA 1AZQA 1CA6A 2ASBA 2AKWB 4LF9Q 3FEWX 4Q5VA 2ZJQA 1QILA 1XWEA 2RA4A 4YY3L 2GA4B 4JI5L 5D14A 2HCCA 3K5OA 4DR6L 3CCRA 4ZKCB 3CRLC 1STYA 4G7HC 4DV4L 2KCCA 4GN5A 4QB4A 4EQNA 2HDMA 2QF7A 1DOLA 5M3MB 3KDFB 2XWBB 4N9PA 3K5NA 3GP7A 4CKBA 3A5ZB 1X3EA 1X54A 1VF5C 3OPOA 4YHHQ 1HUMA 2OTLA 3LGJA 2N88A 1AH9A 3PO3G 1XNQL 2OQKA 2IWHA 3GTPH 4HEDA 3OSOA 4WFN3 1TWGB 5GAGC 1IXRA 2N49A 4J1MA 2R7DA 3PV0A 1QJOA 4MNOA 3I4LA 1O7YA 5EPLA 1VQ8A 1DYQA 3MXUA 1I94Q 1ZYRC 4FVMA 4DV6Q 1C48A 4JYAQ 3Q6SA 5H1SE 5M3MH 4JBJA 4DV6L 1UEBA 4FF2A 4BXXG 5NUCA 3JAML 3H0GB 1Q1BA 3M4PA 1HNWL 1JR0D 4QL5A 1BR9A 3I91A 2SEBD 1WCMH 1QUQA 2CKZB 2H5XA 3J7AF 1SXTA 2R7ZB 4IUTA 2D5DA 4CGYB 2ICIA 5T1IA 3K5MA 2NVXB 1OXUA 5EKKA 4XDXA 2R61A 4XYOA 3GTMB 3FDTA 1EYAA 1BBXC 3A8JE 1EUJA 5JEAH 5C44H 4X62L 3BDOA 5ELDA 1N33Q 4BA1I 4LNQA 1EIHA 3OTOL 2XVSA 3PMFA 2WP8J 1LUZA 2K50A 5EAYA 5IE8A 2RCFA 1H9MA 3NBHB 5L37A 1F2MA 1PRTD 3HG9A 5IYBG 1NY4A 3CCVA 5C4XH 5J22A 1X3GA 3HOXB 2XRSD 2LXKA 5FLXE 4A3BB 2NWGA 5CV6A 2H4OA 5G3LD 5ELEA 3QO2A 2MO1A 3CF5A 1CZGA 1QWYA 4R4CA 1PRTC 2I5LX 3W1GA 4DUZL 3S17B 2L1BA 2PO4A 2F0WA 4C3IB 3CC2A 1H9RA 1HZAA 2UUAQ 1D5ZC 2UU9Q 1HH2P 1HZCA 5C3XA 4LUOA 3W1BA 4IUVA 3RR5A 4K8JA 2OF1A 5T1GA 4LFAL 5ELFA 1HNZQ 1BNZA 3HKZG 1WTXA 1Q12A 2JA6B 3HOUH 4AYBB 1QVGA 3OW7A 1YNJC 5CV7A 1SJED 2NZHA 5IT9L 4A3DH 4A3KG 3HP3A 4FXKC 3J7YW 4DFAA 1KLUD 5J1ZA 5KEEA 3NWTA 2R92G 4A3GG 1Y1WH 2Q2UA 4B9WA 2HIXA 3F1ZA 4IPHA 1E2WA 3TS2A 5E1FA 1J8IA 3CPWA 1WTHA 3A56A 2F4VL 2ZXRA 4RFBA 1N32L 2KJXA 3GTOH 1N36Q 1UEAB 1LTAD 5BN4A 2TSSA 4HSVA 1BBUA 1ICFB 4NDXA 2EY6A 3FVQA 2NTSA 1H95A 4V0BA 3FP9A 4X62Q 1VQ9A 3DM3A 3A5UA 2KHSA 3J81c 1V1PA 3OTOQ 4EGVA 3QB3A 2HD3A 4YHHL 1Q46A 2J4XA 5C4HA 2RCNA 2K04A 2B8FA 5LL6X 2L15A 2Y0SE 3UE1A 4DXGA 1BCPF 1AP0A 1NMFA 1VQDA 2VZAA 1S3OA 2K01A 3ZJYC 1KIXA 4I65A 5ELNA 2VL6A 4QMGA 1EY9A 1G91A 3RLOA 3E9IA 1TWAB 2K5VA 1LABA 4RHRA 5GROA 1X3FA 3KBXA 4DUZQ 2AMCB 1CSPA 3H0GH 2Z6KA 4GKJL 3K6OA 1EU3A 2J0TD 4ABNA 2KVMA 4KKSA 4KY5A 3SDZA 5IYCG 1PH2A 1D1KA 4A3DB 1ASZA 4JI3L 4XIGS 1F2LA 1SE2A 4Y52H 3N52A 1R9TH 1IYVA 4K5XA 2AUKA 2EJFC 1S5ED 3EN2A 2A74C 3PIO3 3M3YB 3OW2A 2G5DA 2Q8IB 4DV4Q 1XMOL 3M4QA 3URYA 2PZUA 2F0OA 3HOWH 1A15A 4BBRG 1JOKA 2D2CC 4C3JH 1DOMA 2JK8A 4RGNA 3CHBD 2A19A 4UDUC 1K73C 1T5XD 5DM63 1TXYA 4LF9L 2RDFA 4LF6Q 2M2LA 4A3LG 1XPRA 3TZDA 3OMCA 3DWAA 3KFUA 2AQ1B 1B3AA 1STEA 3NBIA 3Q24A 1FNWA 1PFMA 4JVZA 1SYBA 1TQOA 1VQMA 5M9OA 1YHAA 4FXDA 1X3QA 2F0GA 1IKLA 1K0RA 1HPCA 5EGTA 1Q81C 2MFIA 1SE8A 1X32A 4HCSA 2F0VA 2GN5A 1PFBA 3GTMH 2BH2A 2L11A 3T53B 3OWEB 1QCBD 2KCTA 1YNND 1GUSA 4H0LC 5E4WC 4YWLA 3CC4A 3OIQA 2R7ZH 4HN7A 1U4RA 1AW7A 2CVRA 4NP5A 2JA5B 2I5MX 4OL7A 1G51A 3CD6A 1EWCA 1FNVA 2MPMA 3TZUA 2C9OA 1TWHH 4DR5Q 2OXPA 4LWCA 2FHTA 3RUZA 1XMQL 3FPPA 1TT2A 1KQSA 3L9AX 4RG1A 3HKZB 2JA6G 4IOAA 1HJPA 4PMBA 3NWSA 3BVZA 5M5XH 2NVQH 2B2TC 3NQTA 2X6GA 4DR4L 3H15A 2UUBL 2B8GA 4A3IH 4IPGA 4DUYQ 4DU9A 5CGKA 3Q23A 1P16A 4B3SL 1QB5D 1Q1EA 2EYHA 1SYFA 4A75A 1XJVA 3HOXH 2PQAA 2Q2HA 3H6MA 4IURA 3SXHA 5IYDG 4FXGC 1T9HA 1E2VA 2QW7A 1F77A 5IT9c 3UDFA 2R92B 5FOBB 4KKUA 5LMNQ 1B70B 4DR7L 4A3CH 3CMAA 2NVTH 1GM5A 4IJLA 3P1HA 2F0LA 4K5VA 1I3QH 2R93B 3VR5A 4AYBG 2QGQA 4MTNA 4JI6Q 3J7A5 2B2WC 2CWPA 3I4MG 1KL9A 3ZYYX 2R92H 3CCJA 3JAMc 4DV7L 1EY4A 1HNZL 2F0SA 4G57A 2YTXA 2QDLA 1SE3A 3V2TA 4IUNA 3X3NA 1KXLA 4ME3A 1X55A 1Y8OB 2OT2A 2WKCA 5ELCA 1JMCA 2WAQE 4X65Q 4JV5L 5FLXc 1STNA 2FMCA 4L6TB 5C5LA 3GTLB 3HFZB 4E6IA 5JJZA 2OWOA 1SYGA 3KF8B 1VQIA 3FKIH 2I5HA 3H0GG 1EQRA 1KTKA 2N55A 4XT1B 4JI8L 5BR8L 1H9JA 2AQ3B 4OIKA 4PG3A 2QEXA 1U0LA 1ONLA 5AJ3L 4TRDA 4GKKQ 5D65A 4XQNA 4J8QA 5EJWA 1KAAA 1PH1A 3S24A 1PDQA 2JEBI 4KLKA 2NBFA 4KTAA 2VUMG 1VQBA 2F0FA 3CCUA 1S5FD 1HA5A 3WOFA 4JOIA 4B9XA 2N3SA 3Q8DA 4DNTB 3U58A 3PUVA 3W2DA 1K3RA 1SBBB 4ZLTF 2K03A 4BBRH 4LF6L 5FKAC 1LO5D 3T1YL 1GKHA 3GD7A 4IFDJ 2XNAC 1AEXA 4L5SA 1TWCB 3A0JA 1LTLA 3RN5A 1YHBA 5I2XA 1A0IA 3L3OC 3VR4A 1ZKOA 1V1PB 3E5SA 4C2MB 1YITA 2UU9L 3AYHB 2E2HH 2MGSA 1PH8A 1PH9A 5EBDA 3I4NH 3X3MA 2UUCL 2I07B 4IUQA 3WWVA 4BBSH 4WRDA 3C1FA 4CDFC 1WTPA 3AB9A 3PIPA 1MSHA 3MA2B 1RL2A 1ET6A 4KD4A 1A2TA 2KA7A 2C35B 2PW7A 4DV2L 2E5LL 2VUMB 4DK1A 5JPNC 2EPBA 4P72A 4ZUJA 3S16B 2N8NA 3JAMi 5C4JB 1O78A 4POGA 3EQLC 5C0XH 1NJIC 1VMPA 2F0MA 1PTOB 5E4XA 1AN8A 1ESRA 1ZEQX 5AFWA 3D4RA 4HMJA 2F4VQ 4A4IA 3KLWA 5FO7B 1JOQA 3F2UA 3LNNA 1SYDA 2D62A 4B3RL 2O5JC 1WYDA 2VQEL 4B3TQ 4NXNQ 1SMYD 1V9PA 1WJJA 1B53A 4QY7A 4HJ5A 4FO2A 5DEHA 3HOYG 3FMCA 2Y0SB 4K0KL 3TP8A 2Q8RE 4Y7NH 4AIMA 3NEMA 1XNQQ 2KCMA 2NZ1D 5HY6A 1CTMA 4NPSA 3TMEA 4DV0Q 1D2BA 3T1HL 2IY5B 5IGCA 2E5LQ 2R93G 1Y1WG 1NAPA 5EKIA 2FMMA 1O80A 2B39A 1SMXA 2JA5G 1PTOH 5KNDA 2QILA 3MAQA 4C3HH 1VQ7A 4IFDH 4A3LH 1TWHB 3NBHA 4GLAC 1NNXA 1WD1A 1K28A 4A3IG 2NVQB 3ULPA 1TY2A 2F0TA 4HR7B 1B7YB 1GUGA 2JP1A 1DOKA 4PNYA 3DMUA 3G4SA 1K9MC 1BBWA 2KEEA 5C0XJ 1KNEA 1L1OC 3ERSX 2Z6BA 1PH7A 1UNSA 2JXMB 4JCVE 5IODA 4A3MH 3HOZB 1J9OA 2EYOA 4A93B 3C3LA 4C56C 4F7XA 2WACA 2ZM6L 4BBSB 2RKSA 1SNCA 2IT1A 4K8IA 4YY3Q 3I70A 1N32Q 1X6OA 5KGUA 4DV3L 4CJ0B 5G3LF 2JA9A 2Z6KC 1TY0A 1CHQD 3PO2H 2K32A 5M5YH 1YI2A 1GXDC 3BU2A 3MHBA 4JI7L 1RCVD 2F03A 1H9KA 1PXUA 1T5EA 3A8KE 4QUCA 1IL2A 5IGFA 4BBRB 3PF4A 1SNQA 1ENCA 4LF4Q 1U5KA 4A3EG 1VQ6A 5GQOA 3BYTB 5EQ0A 1JT8A 1SSOA 3KLRA 2VY3A 1LV9A 4XQJA 3DM1A 4KMUC 2C5CA 1HNXQ 1RHPA 2A73B 5A2QE 4A76A 3R3OA 1IZ6A 2KCNA 4DAPA 5I9OA 2LS01 5M3FB 4BY1H 2RSOA 3M3YH 3D31A 4OWTB 3D6WA 2ZT9C 4C3JB 1NR2A 2LKVA 3NQIA 1R9TB 1HR0W 5C3EG 1IBML 3S1MB 2JQOA 2K5NA 4ZRZA 3WOEA 4G4KA 2E8GA 3FHWA 2K5HA 1WFQA 2F52A 4IJHA 4DV0L 1A63A 5IT9E 4XT3B 2EYJA 3ICEA 3I4NG 3JC66 1PV4A 2CWAA 3MEHA 1GO3E 2EJMA 4HIOA 1EQQA 3GTQH 3T4AC 2DY7A 5KYIA 1M90C 5BN5A 3IKJA 3HOYH 4NMZA 1K8GA 3F2CA 1D5XC 3BDLA 2XRQD 3D0FA 3FPUB 4OIJA 1H9SB 4WORA 1CKNA 1YVCA 2IW3A 1W3SA 1G291 5J3BA 2A69C 1E7ZA 2NB0A 4FDBA 1IHZA 2Z0SA 5D3IB 3GTJB 1QE6A 1W2BA 2IHEA 3S1NH 3J80c 4IPCA 4KI0A 3I2ZA 3QOJA 3R2IA 3KJPA 1DONA 2JA8H 3H3VI 4IO9A 5C3EB 2PI2A 1OXSC 1I4PA 1YHQA 4YCVA 1BCPC 1I3QB 2Z4HA 1CI3M 5M3FG 1LT5D 1K0SA 4R4OA 1FYCA 3S1MH 4FF3A 2UXCQ 1A6XA 1TWFH 2R7FA 4Z9CB 3CCEA 2VB3X 2EZVA 2G9DA 3TEHB 1Y69U 4DR6Q 2B2UC 4JI2L 4TVAB 4AH6A 4YIJA 3CQZB 4AQYL 4X3SA 4N9TA 4PQXA 2FINB 4AYBE 3IRBA 1PH4A 4NKLA 4A3IB 2YU9B 1SFOH 3EVQA 3V05A 2K6AA 2DNEA 3T1YQ 1O7ZA 1Y14B 2VQFQ 3KDFA 1E1TA 2K14A 1CT1D 5JPMC 2F3VA 1BOSA 1Y1WB 4QGUA 1PZJD 5DNFA 3T13A 4JW0A 1E2ZA 3RZDH 4JV5Q 4OONA 3UDGA 4OO1H 2CH4W 1Y1VG 1XTDA 1VQEA 2WB1E 2RSNA 3HOYB 3K57A 1TVXA 4R8IA 4JBMA 1IBMQ 1CA5A 3CXCA 4I7ZC 3HEJA 4RAUC 2O5IC 1LTSD 3S14B 4DK3C 4DNRB 4JBWA 4DA2A 4L5TA 4A3GB 4A3FG 1HTLD 1EY0A 1U4PA 2DNCA 1TU2B 2MP1A 1KDBA 4KY7A 1I6VC 3M85A 1PLFA 2EYPA 1OXXK 4BWGB 1NSNS 5JOBA 1JJ2A 5JJIA 3M4OB 4MZ9A 1BCPD 2K4KA 3NP8A 1RODA 1L0XB 3HZXA 5IGEA 1PRTF 1CM9A 2LSSA 3C2PA 1AE3A 2BH8A 3PF5A 2PPBC 2VXWA 3EJIA 3AMUA 3NPPA 1HXYD 4RMFA 3PQIA 1IL8A 1JWSD 2RQXA 3KJOA 5M5WH 1B3QA 1YEZA 3F2DA 5CORA 1S4ZA 1C7YA 3K7AH 1VQ4A 2YTYA 1B9NA 5I9PA 4PZ8A 3I55A 1HHVA 2KENA 5C44B 3BYYB 4RA8A 4MTKA 1F9RA 2NUCA 4ZK9B 3H94A 3CMEA 4U68A 4X3KA 1GUNA 4DV2Q 4A93H 3IFTA 4LUZA 2A8VA 2VB2X 3DUZA 2FJ2A 5KNCA 2Z1CA 3M9BA 2V1CC 2F4IA 5AJ3Q 2EYLA 1A3VA 2OCEA 4TKOB 2UXDQ 5EBCA 2CW0C 4NW2A 4A3EH 3K59A 1CHPD 4HCEA 2BA0A 4P2CB 3D4DA 1PRTB 2EY1A 2PZTA 1QG7A 4K2KA 4X3UA 1VQKA 5KRUA 3NTIA 4FF4A 4KJOA 3R93A 2VUMH 1SRUA 2B2YC 4DF7A 1BXTA 3AQQA 4HAEA 5HGTA 2X69A 3DHQA 2K28A 3UI2A 3VYSA 3J7AV 2RBMA 4EQPA 4B3TL 5I6YA 3CQZH 1PH6A 2OEOA 4KK7A 5DAUA 3UDXA 4ZKBB 4JI5Q 1S5BD 4OEMB 1IBKQ 3BZKA 2O2LD 1WTOA 2ZJRA 1OO9B 4UHVA 1HFNA 3A7AB 3NE5B 1F2YA 4DV1Q 4LMQD 2Z4IA 1MI2A 1KNAA 1L2FA 2FFKB 2VW9A 3PSIA 5FLXL 4WJWA 2UXBQ 2CHBD 4X66L 4QJFA 1EEID 4OHJA 5C0XG 4DR1L 5C3WA 2ZXPA 4OWWB 4HTHA 1J6QA 2K33A 3EFXD 4X64L 3JAME 1VQPA 3KYHC 2ZJPA 1PVOA 1KC8C 1SR3A 1GHJA 2EOTA 2K05A 3M4YA 3I3CA 1DM0B 1STBA 2B2UA 5IGGA 5KYLA 3CCQA 1EQVA 4HJ7A 4DR5L 1I94L 1EYGA 1MJEA 2HQEA 5FO8B 1RF2D 1KHIA 1I6HB 3GTQB 1HZBA 1NR4A 2PCFB 4KV6A 3I73A 1CSQA 3J7ZC 1EOVA 4V190 5CV9A 4R4IA 2CQOA 2E75C 3E0JA 2IX1A 4OO1G 3HOVB 3HOVG 1ZXTA 3FKIB 4ULLA 1ENFA 2RHSB 3MWYW 1G6ZA 4F8MA 4JI4L 2TMPA 1I6HH 1DXMA 1E1OA 2F0PA 2EXZA 1HR0Q 2B63B 3I4MB 3K0YA 3WDNA 4QIWB 4LFCL 4G7OC 2L5TA 2RHQB 1N34Q 1FVIA 3M4OH 3VYUA 5GAHC 4KJNA 3SK8A 2F3WA 1XX8A 3GO5A 2E74C 3G6JB 1U9RA 2JA8G 3QJYA 2NVYB 1TS4A 3PO2B 1V43A 4A3FB 2HIVA 1CKOA 1VQFA 3DXJC 3SHLA 3H3VH 4B3ML 2EY5A 1VQLA 1JB3A 2F0EA 2K1BA 4EX5A 1JC7A 1CK1A 2ALYB 1QZHA 2B2VA 2A6HC 1X56A 1Y1VB 1LT4D 5DM73 4IOCA 4BY7B 2DY8A 3H3VC 4DR2L 2NYZD 4UP8A 3EROA 4DV1L 1STHA 1D8LA 2ZTEA 3P20A 1VQOA 1Z6HA 2EE1A 1TS2A 3T51B 4QIWE 1D1IA 1JICA 3TDQA 1Q7YC 4RGMA 4DV5Q 2VQFL 4RHSA 1I4HA 1FD7D 4RCOA 3STBC 4DAYB 3VDYA 1SAPA 1UE5A 3GV3A 1LYLA 2HUGA 3NK9A 4M1UB 4H13C 1QVFA 5JVG3 2E2DC 4ZYSA 1UE1A 5IIFA 1A3TA 4LF8Q 2E2IH 1LACA 1X3PA 2ZTDA 2BCOA 4GS3A 4BY7H 4KN7C 4UPAA 4PV1C 5F2DA 4LW1A 3IFDA 1HTPA 2AUJD 2EJGC 1CQVA 3HS0C 4DR3L 5E7NA 1YNXA 4GNXB 3NELA 2DUDA 3PUWA 4H02A 4KHPQ 3RZOB 2I0QA 1Y1VH 3TS0A 4Y7NB 1C0AA 1UE7A 3A54A 4JI1Q 4X6AH 3GTKH 3I90A 2UUBQ 4IPDA 1C9OA 1PMRA 3SGIA 4GN4B 3T16A 3I56A 4DK6C 1GUTA 1PH3A 1ML0D 3ER0A 4F88A 4DR2Q 2F0NA 1PYBA 4RKBA 1IBLL 3LWUA 3BZCA 1S72A 3S1NB 3RMHA 4ME5A 1R4PB 4LFAQ 3H09A 3SK5A 1DD2A 4A3CG 1FR3A 1JQYD 1YNNC 3M7NA 2K5DA 4RWSC 2HT1A 2Z8LA 3S15B 4LF7L 4O0AA 2RDGA 1VQNA 1K8MA 5IY0A 3RNUA 3OMGA 1L1OB 3MXPA 3J80i 1EYDA 1F2ZA 1BO0A 2DGYA 3K58A 1YJWA 5K36H 3DEPA 2PZWA 1VQJA 1NCVA 4ZCKA 1MSGA 1XMQQ 2WAQG 3U50C 4C3JG 5LMUL 4IALA 3RLNA 4GKJQ 1C4QA 1Y8PB 3CW2C 5K36G 3S2HB 5LMUQ 3J81L 1VF7A 3Q22A 4DV3Q 1WOCA 1B50A 1JORA 1NE3A 4S3SA 2MJ8A 1RD9D 2AQ2B 3QG1A 4CDEC 5LHY1 2IX0A 1L0WA 2NN6H 3CRKC 4CJ2C 3VYRA 4DV5L 4C2MH 3S15H 3CP0A 2B2WA 4B3RQ 1D6EC 1GOZA 2JA7B 3DEOA 2O4XA 4DR7Q 3CAMA 3U4ZA 1V1OA 2F0IA 2LFNA 3S1QB 1TWCH 1C8CA 4K0KQ 1VQ5A 3MVVA 1AE2A 1LTGD 4HJ8A 2VS1A 5GAEC 1TS5A 3O13A 4LF4L 4RKLA 1EZ6A 4L63B 5FK9C 1Z47A 3QOLA 2G9HD 1WTRA 1EY7A 3MXNB 4JPBW 5M5YB 1KDCA 1XYIA 1LT6D 3A7LA 4M8AA 4DV7Q 1BUVT 3GTKB 3J80E 3D4WA 1QUQB 1TKWB 1CKMA 2V4DA 3LWEA 1BQQT 5E3FA 1XXGA 1BCPB 2Q8TA 1ENAA 5IGBA 2L9HA 3VYTA 3S2HH 1SN8A 2B2TA 5IYDH 3HOVH 1SEBD 2M00A 1EU4A 4KHVA 3W5OA 4OX9Q 1TWFB 2L0CA 1EZ8A 4JC0A 1Y8NB 1LT3D 4QF4A 4DKAC 4I7AA 1JE4A 2L55A 3DWQA 3GTGH 2EIFA 3DWPA 5I4DA 4L8JA 1S5CD 1RTNA 4JI8Q 3KOJA 2KBNA 2CQAA 1ESFA 4X64Q 3T56B 3TQYA 4A3BG 3M7GA 1HZ9A 1MJCA 3F8TA 3U9SA 4A3KB 3HOXG 1AZPA 3GTJH 1SNMA 4ZUIA 4DAMA 1XMOQ 4IUUA 1HUNA 2JA7G 2DJGC 2A1AA 3ULJA 2KEDA 5CR3A 4LFCQ 2PW5A 3J81i 2PI2E 4N8X1 3ERQA 4UY8C 2QCPX 4C1NI 1RIPA 4R9WA 4DR4Q 1VQHA 1M4VA 2MNAA 2F0DA 1WTQA 1NBWA 3HRZC 1EY6A 4FP5D 2KQ3A 4JI1L 1IBKL 5K5PA 4K6DA 4WJ3M 1XPUA 1V1QA 3E3XA 5HURA 3ND8A 1TIID 4FYDA 2F0QA 4HMIA 5M3FH 2PMZE 4BY1B 1EYCA 2F0HA 1IBLQ 4A3JG 4DNIA 1I5FA 2UUCQ 1F9QA 3K5LA 1J5EQ 5LMNW 5IP7H 3GTOB 2QA4A 3MFGA 1II3A 4ZAIA 3H91A 4GOPB 3KK7A 4A3EB 5C4XB 1PTOF 2D0OA 1EFID 4LF7Q 3BS1A 3GDEA 1GHKA 4B3MQ 2A69D 3R2TA 3L7ZC 3N6RA 4JOIC 2JA5H 3NXWA 4IZ8A 3KF6A 3S1RB 4YWMA 4JYAL 1PZID 3U9OA 2QKIC 4U673 2I46A 2BE5C 2E2JB 2R3ZA 3QIAA 4OX9L 2BA1A 2EYFA 5KIXA 3C46A 2WIIB 3HOUB 2YYZA 2QEJC 2JA6H 2NTTA 4BBSG 1DZ1A 1WCMB 3UDIA 4MIUA 1EIYB 3RZDB 1FNUA 1N8RC 2PYKA 1BKBA 3A74A 1PH5A 4DR3Q 4ZQ3A 2KHIA 2NVYH 3OIPA 4NXNL 1A8VA 2KECA 3VR2A 4OELB 5IP9H 1SFOB 2DN8A 2BDNA 3UE0A 4UP9A 3VA7A 4F87A 2B3GA 4GN3B 4AQYQ 3PO3B 3GV6A 4H44C 4IFDI 2IX3A 1M1KC 3TBIB 5CV4A 2F0UA 3GTPB 1D5MC 1IW7D 3SEBA 4CJ1B 2BE5D 1B1ZA 1MGSA 5IP9G 1L0YB 1HA6A 2PMZB 5C0XI 4ODGA 4K14A 3MZ5A 1GUOA 2EYMA 3HGBA 3QWNA 2JEAI 3E0EA 4QQBX 1KABA 1G2SA 4PMWA 1QNUA 1FL0A 2PQAB 1SLJA 4R1JA 2K5WA 1A3UA 3GQBA 4IUPA 2WINB 4WJ4A 3RLFA 1EIFA 4KD3A 1B9MA 2WV6D 3GTLH 1A2UA 3G71A 1LTRD 3MXGA 2WB1G 1AFPA 1LM0A 1LLRD 1FGUA 1L1OA 4B08A 2UXBL 5FLMG 1CFMA 4DR1Q 3NSWA 1GJXA 3S9WA 2LMCB 2WB1B 1KRTA 1UE6A 5C3EH 2JA8B 4P74A 2JYOA 4EVOA 1P8LA 1I4GA 2ZM6Q 2AWNA 1GUWA 2A6ED 4P73A 4TQUS 1IKMA 4A3KH 5IGDA 4XXEA 1F9SA 4JI4Q 3IL8A 3U4VA 5JAVA 1UAPA 1E24A 4BS9A 3TREA 2ID0A 3P7JA 2QDBA 1CQFA 3AEVA 1STAA 2ZXOA 2YU9H 1EOTA 1UUPA 5EKLA 2CW0D 1WTVA 3PIP3 1W6JA 4UP7A 3K81C 3ND9A 4KHPL 1XNRQ 1VCIA 2HDLA 3HKSA 4B3SQ 4YCWA 1SDFA 4C3HG 3OYYA 4P75A 1PYSB 1HR0L 2MHVA 4LK1C 2Q2IA 2L4NA 5CV8A 1KDAA 4EQ5A 1I4QA 4GLVB 3TSSA 4CHTB 1VQCA 3G48A 5TSSA 2SNMA 4RGTA 1OXVA 3PO3H 3HOUG 2YTVA 3EIVA 3MXNA 3SVMA 4JI0L 1QZGA 4HIMA 3BG3A 1HNWQ 3CC7A 1I50H 3W3AA 5A2QL 2GVAA 2JA7H 3C1EA 4A3GH 2ZTCA 2R6GA 1MBYA 5CV5A 4PZ7A 3I4OA 3QR8A 4LJZC 3S14H 1ASYA 3Q0AA 2PNHA 5ELBA 1SJHD 4RH6A 3S1RH 2AWOA 1PZKD 3HOZH 3LX0A 4FF1A 4HIKA 4RCNA 2OQ0A 5GADC 2WFWA 4TSSA 2MO0A 2E2JH 5KNBA 4R4QA 3F2BA 1ET9A 1WCMG 3S2DB 1F9PA 1KAWA 1JWMD 1I50B 2IPKD 1HRJA 1IYUA 2B2YA 4P71A 4R8NA 3IAYA 4JI3Q 3SR1A 1PTOC 1MIUA 5LL6S 1YIJA 2B2VC 5M5WB 2UXCL 4C3IH 1SYEA 5JEAG 4UAIA 5C44G 1G8ZD 4A3BH 4CBVA 3S17H 1E22A 4XTCS 3BDCA 1N36L 1K8AC 1LTID 4H7BA 2XIWA 2SDFA 3MTSA 1FGBD 3NTKA 4GZYC 5BN3A 3KLSX 5FJ8H 5CC4A 4N8FA 4JI2Q 3TP7A 2CFMA 1QOHA 2HHHQ 4JI7Q 4BA2I 3HOWB 2A6EC 2EDGA 5ELOA 5COYA 3ITPA 1KLGD 3OHXC 2HHHL 5C4XG 5IOCA 1UWVA 4C1NK 2CH4A 4MN3A 3R8BA 3ULLA 4L5RC 4X66Q 3CCMA 4DAYA 1YJ9A 1BDOA 5FJ8G 4NXMQ 4A3JB 1Q3LA 4JBKA 4BY1G 1SNDA 3K80C 4A3DG 3L2PA 1H9SA 2NVTB 3RZOH 3G7LA 1RTOA 1CUKA 2RDHA 2F0JA 4A3MB 1B2TA 2NVXH 1A62A 2JE6I 3HKZE 5HGQA 1I4XA 4RGOS 4LFBL 1J5EL 1U4LA 1E0BA 1TWAH 2K5QA 3AU7A 3NHHA 2NN6I 2XGTA 3RD4A 4QCLA 2A6HD 2YV5A 5IP7G 3E9HA 4J15A 3OWFA 2HQLA 2JN4A 2JSOA 4JK1C 3ONAB 5I6WA 4DXFA 2VNUD 1M8AA 4DK0A 1QNKA 3I8ZA 4KKTA 1SYCA 2XTIA 1TWGH 2A68C 2AHOB 5J39A 2K7VA 2KUMA 2X6LA 4Q0FA 2NN6G 5A35A 4GLXA 1W6KA 2IL8A 4PMCA 1VS0A 2P5ZX 3MC0B 3D8GA 2MUYA 2GVBA 2UXDL 1N33L 1K8OA 1NUCA 1ZYRD 1XTCD 1TR5A 3I7FA 1PYWD 1G2TA 1LTBD 3D3RA 1MHWC 1SNOA 1G6PA 5I2YA 1N34L 1BF4A 4ALPA 2KHJA 4GNXC 4DN4M 3MEFA 5FO9B 1Q86C 3VR3A 4DUYL 3TP5A 4CDCC 4OO1I 1CZWA 4BXXH 3OOCA 1YZ6A 3KUPA 1EWIA 1SROA 1SMYC 1NTGA 5JJLA 5CBEE 1K83H 1X65A 4A3FH 5C4ZA 5CYUA 3S1QH 2VQEQ 4K5WA 5IWAQ 3KLSA 1YJNA 2B29A 3P75A 3MFYA 3SK6A 2LY7A 4YCUA 4A3MG 1RJTA 4K2LA 5DLQE 2RF4A 3T1HQ 4JI6L 4O1NA 1NMGA 4JI0Q 2PQEA 4O42A 1JCKB 1EY8A 3FRPB 4YWKA 1ILQA 1Z9FA 5CMDA 2FXQA 4GNXA 3PIOA 1E3PA 4ID6A 4MHEA 2BOSA 1EFWA 4R4TA 1IW7C 1DCZA 1FJGL 1VDZA 4CKCA 4ILWA 1EQTA 3A55A 2CCZA 4X65L 1SE4A 3HOWG 1ILPA 5IYBH 2SNSA 1Q8KA 3I4NB 2L12A 4O2DA 3KF8A 3CKIB 3CCSA 2E2HB 2N78A 4DPGA 5FLMH 4NB3A 2K75A 3SK4A 2WAQB 3KBGA 1GD7A 4PZ6A 1VQGA 2NZOA 4JG2A 1R4QB 1O7LA 1XNRL 4EQOA 1CKNB 2EVBA 1JJGA 1B4OA 3L0OA 5IYCH 3SE0A 4HIDA 2RVLA 1WD0A 4DAVA 2PNRC 1ICWA 1STGA 3KF6B 2IJ0A 2R93H 5JJKA 3K7UC
chains in the Genus database with same CATH topology
1WTWA 4HSPA 3J80L 2A68D 3I72A 1LTTD 1TS3A 1Q90A 5EPKA 4QUFA 1EY5A 4KY6A 2J7ZA 3EA6A 2BDOA 4IFDG 1Z7TA 2E2IB 2ENBA 4LAAA 3VR6A 1U4MA 4XQQA 1EL0A 3GTGB 5JVH3 3V96A 1EIGA 1I4RA 4C3HB 1EEFD 4OGQC 1JWUD 3BVGA 4IN3A 2ICEC 1HQMC 5ISRA 4J6HA 1HQRD 3D6CA 1Q8IA 1HFGA 1PTOD 5CBAE 2H1EA 1S5DD 2XWJB 4X3TA 2XN9C 3PUYA 1YNJD 2HCIA 1JOOA 3K7AB 3TN2A 1VMCA 5C6AA 1HCZA 2F0KA 4FNFA 3TP6A 1MD2D 5EPJA 4C3IG 4G7ZC 5C5MA 1K83B 3E6ZX 3A8IE 2A5HA 1V8QA 4IQZA 2M9VA 5M5XB 5JEAJ 2F1MA 2EY2A 1WVLA 2D9UA 1DJRD 2E76C 2SOBA 4XYQA 3PUXA 1SNPA 1B44D 4CKEA 4DGZA 2XSCA 1EWHA 3NTHA 5D3DA 1RDPD 3BZDB 3VA5A 3NUCA 1RKNA 3J81E 2WKDA 3PUZA 1PFNA 3BVMA 4K6LA 1OXTA 3CU7A 4KN4C 4KHZA 2KOLA 1AZQA 1CA6A 3FEWX 4Q5VA 1QILA 1XWEA 2RA4A 2GA4B 5D14A 2HCCA 3K5OA 4ZKCB 3CRLC 1STYA 4G7HC 2KCCA 4EQNA 4QB4A 5M3MB 2HDMA 2QF7A 1DOLA 2XWBB 4N9PA 3K5NA 3GP7A 4CKBA 1VF5C 3OPOA 1HUMA 2N88A 2IWHA 4HEDA 3OSOA 4WFN3 1TWGB 4J1MA 3PV0A 1QJOA 3I4LA 1O7YA 5EPLA 1DYQA 3MXUA 1ZYRC 4FVMA 1C48A 3Q6SA 4FF2A 5NUCA 3JAML 3H0GB 1Q1BA 1JR0D 1BR9A 3I91A 2SEBD 3J7AF 1SXTA 2R7ZB 4IUTA 2D5DA 4CGYB 2ICIA 5T1IA 3K5MA 2NVXB 1OXUA 5EKKA 4XDXA 2R61A 4XYOA 3GTMB 3FDTA 1EYAA 1BBXC 3A8JE 5JEAH 3BDOA 5ELDA 4BA1I 1EIHA 2XVSA 3PMFA 2WP8J 1H9MA 1F2MA 1PRTD 3HG9A 5J22A 3HOXB 2XRSD 5FLXE 4A3BB 2NWGA 5CV6A 2H4OA 5G3LD 5ELEA 3QO2A 1CZGA 1QWYA 1PRTC 3S17B 2L1BA 2PO4A 2F0WA 4C3IB 1H9RA 1D5ZC 5C3XA 4IUVA 4K8JA 2OF1A 5T1GA 5ELFA 1BNZA 2JA6B 1WTXA 1Q12A 4AYBB 3OW7A 1YNJC 5CV7A 1SJED 5IT9L 3HP3A 4FXKC 3J7YW 4DFAA 1KLUD 5J1ZA 5KEEA 3NWTA 4B9WA 1E2WA 5E1FA 1J8IA 3A56A 2ZXRA 4RFBA 2KJXA 1UEAB 1LTAD 5BN4A 2TSSA 4HSVA 4NDXA 2EY6A 3FVQA 2NTSA 4V0BA 2KHSA 1V1PA 4EGVA 3QB3A 2J4XA 5C4HA 2K04A 2B8FA 5LL6X 4DXGA 1BCPF 1AP0A 2K01A 4I65A 4QMGA 1EY9A 1G91A 1TWAB 1LABA 4RHRA 3KBXA 3K6OA 1EU3A 2J0TD 4ABNA 2KVMA 4KKSA 4KY5A 3SDZA 1D1KA 4A3DB 4XIGS 1F2LA 1SE2A 3N52A 1IYVA 4K5XA 2AUKA 2EJFC 1S5ED 2A74C 3PIO3 3M3YB 2Q8IB 3URYA 2PZUA 2F0OA 1A15A 1JOKA 2D2CC 1DOMA 4RGNA 3CHBD 4UDUC 1T5XD 5DM63 2RDFA 2M2LA 3TZDA 3OMCA 3DWAA 2AQ1B 1B3AA 1STEA 3NBIA 3Q24A 1FNWA 1PFMA 1SYBA 1TQOA 5M9OA 4FXDA 1X3QA 2F0GA 1IKLA 5EGTA 1HPCA 1X32A 4HCSA 2F0VA 1PFBA 2L11A 3T53B 3OWEB 1QCBD 4H0LC 1YNND 1GUSA 5E4WC 3OIQA 4HN7A 1U4RA 1AW7A 2CVRA 4NP5A 2JA5B 4OL7A 1EWCA 1FNVA 2MPMA 3TZUA 2C9OA 2OXPA 2FHTA 3RUZA 3FPPA 1TT2A 3L9AX 3HKZB 4PMBA 3NWSA 3BVZA 2B2TC 3NQTA 2X6GA 2B8GA 4DU9A 5CGKA 3Q23A 1QB5D 1Q1EA 2EYHA 1SYFA 4IURA 3H6MA 3SXHA 4FXGC 1E2VA 1F77A 2R92B 5FOBB 4KKUA 3P1HA 2F0LA 4K5VA 2R93B 3VR5A 2B2WC 3ZYYX 1EY4A 2F0SA 4G57A 1SE3A 3V2TA 4IUNA 3X3NA 1Y8OB 2OT2A 2WKCA 5ELCA 1STNA 2FMCA 4L6TB 5C5LA 3GTLB 4E6IA 5JJZA 1SYGA 2N55A 1KTKA 4XT1B 1H9JA 2AQ3B 4OIKA 1ONLA 4TRDA 5D65A 4XQNA 4J8QA 5EJWA 1KAAA 1PDQA 2JEBI 2NBFA 4KTAA 2F0FA 1S5FD 1HA5A 3WOFA 4B9XA 4DNTB 3PUVA 3W2DA 1SBBB 4ZLTF 2K03A 5FKAC 1LO5D 3GD7A 4IFDJ 2XNAC 1AEXA 1TWCB 5I2XA 3L3OC 3VR4A 1ZKOA 1V1PB 3E5SA 4C2MB 2MGSA 5EBDA 3X3MA 2I07B 4IUQA 4WRDA 3C1FA 1WTPA 3AB9A 1MSHA 3MA2B 1ET6A 4KD4A 1A2TA 2KA7A 2PW7A 2VUMB 4DK1A 5JPNC 2EPBA 4ZUJA 3S16B 5C4JB 1O78A 3EQLC 5C0XH 1VMPA 2F0MA 1PTOB 5E4XA 1AN8A 1ESRA 1ZEQX 5AFWA 3D4RA 4HMJA 5FO7B 1JOQA 3F2UA 3LNNA 1SYDA 2D62A 2O5JC 1SMYD 1B53A 4FO2A 5DEHA 3FMCA 2Y0SB 3TP8A 2Q8RE 2NZ1D 1D2BA 1CTMA 3TMEA 5IGCA 1NAPA 5EKIA 2FMMA 1O80A 2B39A 1PTOH 5KNDA 2QILA 3MAQA 4IFDH 1TWHB 3NBHA 1WD1A 2NVQB 1TY2A 2F0TA 4HR7B 1GUGA 2JP1A 1DOKA 4PNYA 3DMUA 2KEEA 5C0XJ 1KNEA 1UNSA 2JXMB 5IODA 3HOZB 1J9OA 2EYOA 4A93B 3C3LA 4C56C 4F7XA 2WACA 4BBSB 2RKSA 1SNCA 2IT1A 4K8IA 3I70A 5KGUA 4CJ0B 5G3LF 1TY0A 1CHQD 2K32A 1GXDC 3MHBA 1RCVD 2F03A 1H9KA 1PXUA 1T5EA 3A8KE 4QUCA 5IGFA 4BBRB 1SNQA 1ENCA 3BYTB 5EQ0A 1SSOA 3KLRA 1LV9A 4XQJA 3DM1A 4KMUC 2C5CA 1RHPA 2A73B 5A2QE 3R3OA 2KCNA 4DAPA 5I9OA 2LS01 5M3FB 2RSOA 3D31A 3D6WA 2ZT9C 4C3JB 1NR2A 2LKVA 3NQIA 1R9TB 3S1MB 4ZRZA 3WOEA 4G4KA 5IT9E 4XT3B 2EYJA 3MEHA 2EJMA 5KYIA 2DY7A 3T4AC 5BN5A 3IKJA 4NMZA 1D5XC 3BDLA 2XRQD 3FPUB 4OIJA 1H9SB 4WORA 2IW3A 1G291 2A69C 2NB0A 1IHZA 5D3IB 3GTJB 1QE6A 4KI0A 1DONA 3R2IA 3QOJA 5C3EB 1OXSC 1I4PA 1BCPC 1I3QB 2Z4HA 1CI3M 1LT5D 1FYCA 4FF3A 1A6XA 4Z9CB 2VB3X 2EZVA 2G9DA 1Y69U 2B2UC 4YIJA 3CQZB 4X3SA 4N9TA 4PQXA 2FINB 4NKLA 4A3IB 2YU9B 3EVQA 3V05A 2K6AA 2DNEA 1O7ZA 1CT1D 5JPMC 2F3VA 1BOSA 1Y1WB 1PZJD 5DNFA 3T13A 1E2ZA 4OO1H 2RSNA 3HOYB 3K57A 1TVXA 4R8IA 1CA5A 4I7ZC 3HEJA 4RAUC 2O5IC 1LTSD 3S14B 4DNRB 4JBWA 4DA2A 4A3GB 1HTLD 1EY0A 1U4PA 2DNCA 1TU2B 2MP1A 1KDBA 4KY7A 1I6VC 3M85A 1PLFA 2EYPA 1OXXK 4BWGB 1NSNS 5JOBA 3M4OB 1BCPD 3NP8A 1RODA 1L0XB 3HZXA 5IGEA 1PRTF 1CM9A 3C2PA 2PPBC 2VXWA 3EJIA 3AMUA 3NPPA 1HXYD 1IL8A 1JWSD 2RQXA 5CORA 1S4ZA 1B9NA 5I9PA 1HHVA 5C44B 3BYYB 4RA8A 1F9RA 2NUCA 4ZK9B 3H94A 4U68A 4X3KA 1GUNA 3IFTA 2VB2X 3DUZA 2FJ2A 5KNCA 2Z1CA 2F4IA 2EYLA 1A3VA 4TKOB 5EBCA 2CW0C 4NW2A 3K59A 1CHPD 4HCEA 2BA0A 4P2CB 3D4DA 1PRTB 2EY1A 2PZTA 1QG7A 4K2KA 4X3UA 5KRUA 3NTIA 4FF4A 4KJOA 3R93A 2B2YC 4DF7A 1BXTA 4HAEA 5HGTA 2X69A 3DHQA 2K28A 3UI2A 3VYSA 3J7AV 2RBMA 4EQPA 5I6YA 2OEOA 4KK7A 5DAUA 4ZKBB 1S5BD 2O2LD 1WTOA 1OO9B 1HFNA 3A7AB 3NE5B 1F2YA 4LMQD 2Z4IA 1MI2A 1KNAA 2FFKB 5FLXL 4WJWA 2CHBD 1EEID 4OHJA 5C0XG 5C3WA 2ZXPA 4HTHA 2K33A 3EFXD 3JAME 1GHJA 2EOTA 2K05A 3M4YA 3I3CA 1DM0B 1STBA 2B2UA 5IGGA 5KYLA 1EQVA 2HQEA 5FO8B 1RF2D 1I6HB 3GTQB 1NR4A 2PCFB 4KV6A 3I73A 4V190 5CV9A 2IX1A 2E75C 3E0JA 4OO1G 3HOVB 1ZXTA 3FKIB 4ULLA 1ENFA 3MWYW 1G6ZA 4F8MA 2TMPA 1DXMA 2F0PA 2EXZA 2B63B 3I4MB 3K0YA 3WDNA 4QIWB 4G7OC 2L5TA 3VYUA 4KJNA 3SK8A 2F3WA 1XX8A 3GO5A 2E74C 3G6JB 1U9RA 3QJYA 2NVYB 1TS4A 3PO2B 1V43A 4A3FB 3DXJC 3SHLA 2EY5A 1JB3A 2F0EA 2K1BA 1JC7A 1CK1A 2B2VA 2A6HC 4BY7B 1Y1VB 1LT4D 5DM73 2DY8A 3H3VC 2NYZD 3EROA 1STHA 3P20A 1Z6HA 2EE1A 1TS2A 3T51B 1D1IA 1JICA 3TDQA 4RGMA 4RHSA 1I4HA 1FD7D 4RCOA 1SAPA 3GV3A 2HUGA 3NK9A 4M1UB 4H13C 5JVG3 2E2DC 4ZYSA 5IIFA 1A3TA 1LACA 1X3PA 2BCOA 4KN7C 4PV1C 5F2DA 3IFDA 1HTPA 2AUJD 2EJGC 1CQVA 3HS0C 3PUWA 3RZOB 4Y7NB 3A54A 3I90A 1PMRA 3T16A 1GUTA 1ML0D 4F88A 2F0NA 4RKBA 3LWUA 3S1NB 3RMHA 4ME5A 1R4PB 3H09A 3SK5A 1DD2A 1FR3A 1JQYD 1YNNC 3M7NA 2K5DA 4RWSC 2Z8LA 3S15B 2RDGA 1K8MA 3OMGA 3MXPA 1F2ZA 1EYDA 1BO0A 3K58A 5K36H 3DEPA 2PZWA 1NCVA 1MSGA 4C3JG 4IALA 1C4QA 1Y8PB 5K36G 3S2HB 3J81L 1VF7A 3Q22A 1JORA 1B50A 4S3SA 2MJ8A 1RD9D 2AQ2B 3QG1A 5LHY1 2IX0A 2NN6H 3CRKC 4CJ2C 3VYRA 2B2WA 1D6EC 1GOZA 2JA7B 3DEOA 2O4XA 1V1OA 2F0IA 2LFNA 3S1QB 1C8CA 3MVVA 1LTGD 1TS5A 3O13A 4RKLA 1EZ6A 4L63B 5FK9C 1Z47A 3QOLA 2G9HD 1WTRA 1EY7A 5M5YB 1KDCA 1XYIA 1LT6D 3A7LA 4M8AA 1BUVT 3GTKB 3J80E 3D4WA 1TKWB 2V4DA 3LWEA 1BQQT 5E3FA 1XXGA 1BCPB 2Q8TA 1ENAA 5IGBA 2L9HA 3VYTA 2B2TA 1SEBD 2M00A 1EU4A 4KHVA 1TWFB 2L0CA 1EZ8A 1Y8NB 1LT3D 4QF4A 1JE4A 2L55A 3DWQA 3DWPA 5I4DA 4L8JA 1S5CD 1RTNA 2CQAA 1ESFA 3T56B 3M7GA 3U9SA 4A3KB 1AZPA 1SNMA 4ZUIA 4IUUA 1HUNA 2KEDA 5CR3A 2PW5A 3ERQA 2QCPX 4C1NI 4R9WA 1M4VA 2F0DA 1WTQA 3HRZC 1EY6A 4FP5D 2KQ3A 5K5PA 4K6DA 5HURA 3ND8A 1TIID 4FYDA 2F0QA 4HMIA 4BY1B 1EYCA 2F0HA 1F9QA 3K5LA 3GTOB 3MFGA 1II3A 4ZAIA 3H91A 3KK7A 4A3EB 5C4XB 1PTOF 1EFID 3BS1A 1GHKA 2A69D 3R2TA 3L7ZC 3N6RA 3NXWA 4IZ8A 3S1RB 1PZID 3U9OA 2QKIC 4U673 2I46A 2BE5C 2E2JB 2R3ZA 3QIAA 2BA1A 2EYFA 5KIXA 3C46A 2WIIB 3HOUB 2YYZA 2QEJC 2NTTA 1DZ1A 1WCMB 4MIUA 3RZDB 1FNUA 2PYKA 4ZQ3A 3OIPA 2KECA 3VR2A 1SFOB 2DN8A 2BDNA 3VA7A 4F87A 3PO3B 3GV6A 4H44C 4IFDI 2IX3A 3TBIB 5CV4A 2F0UA 3GTPB 1D5MC 1IW7D 3SEBA 4CJ1B 2BE5D 1B1ZA 1MGSA 1HA6A 1L0YB 2PMZB 5C0XI 4ODGA 4K14A 1GUOA 2EYMA 3HGBA 3MZ5A 3QWNA 2JEAI 1KABA 1G2SA 4PMWA 1QNUA 2K5WA 1A3UA 3GQBA 4IUPA 2WINB 3RLFA 4KD3A 1B9MA 2WV6D 1A2UA 1LTRD 3MXGA 1AFPA 1LLRD 4B08A 1CFMA 1GJXA 3NSWA 3S9WA 2LMCB 2WB1B 2JA8B 2JYOA 4EVOA 1I4GA 2AWNA 1GUWA 2A6ED 4TQUS 1IKMA 5IGDA 4XXEA 1F9SA 3IL8A 5JAVA 1UAPA 4BS9A 2ID0A 3P7JA 2QDBA 1CQFA 1STAA 2ZXOA 1EOTA 1UUPA 5EKLA 2CW0D 1WTVA 3PIP3 1W6JA 3ND9A 1VCIA 2HDLA 1SDFA 4C3HG 2MHVA 4LK1C 2L4NA 5CV8A 1KDAA 1I4QA 3TSSA 4CHTB 5TSSA 2SNMA 4RGTA 1OXVA 3MXNA 3SVMA 3BG3A 3W3AA 5A2QL 3C1EA 2R6GA 1MBYA 5CV5A 4LJZC 3Q0AA 5ELBA 1SJHD 4RH6A 2AWOA 1PZKD 3LX0A 4FF1A 4RCNA 4TSSA 5KNBA 1ET9A 3S2DB 1F9PA 1I50B 1JWMD 2IPKD 1HRJA 1IYUA 2B2YA 4R8NA 3IAYA 3SR1A 1PTOC 5LL6S 2B2VC 5M5WB 1SYEA 5JEAG 4UAIA 1G8ZD 4CBVA 4XTCS 3BDCA 1LTID 4H7BA 2XIWA 2SDFA 3MTSA 1FGBD 3NTKA 4GZYC 5BN3A 3KLSX 5CC4A 3TP7A 1QOHA 4BA2I 3HOWB 2A6EC 2EDGA 5COYA 3ITPA 1KLGD 3OHXC 5IOCA 4C1NK 4MN3A 3R8BA 4DAYA 1BDOA 4A3JB 1Q3LA 1SNDA 1H9SA 2NVTB 3G7LA 1RTOA 2RDHA 2F0JA 4A3MB 1B2TA 2JE6I 1I4XA 4RGOS 1U4LA 1E0BA 2K5QA 3AU7A 3NHHA 2NN6I 3RD4A 4QCLA 2A6HD 3OWFA 2JSOA 4JK1C 3ONAB 5I6WA 4DXFA 2VNUD 1M8AA 4DK0A 1QNKA 3I8ZA 4KKTA 1SYCA 2A68C 5J39A 2K7VA 2KUMA 2X6LA 4Q0FA 2NN6G 5A35A 1W6KA 2IL8A 4PMCA 3D8GA 3MC0B 2MUYA 1K8OA 1NUCA 1ZYRD 1XTCD 1TR5A 1PYWD 1G2TA 1LTBD 3D3RA 1SNOA 5I2YA 1BF4A 4DN4M 5FO9B 3VR3A 3TP5A 4OO1I 1CZWA 3OOCA 3KUPA 1SMYC 5CBEE 5C4ZA 5CYUA 4K5WA 3KLSA 3P75A 3MFYA 3SK6A 2LY7A 1RJTA 4K2LA 4O1NA 2PQEA 4O42A 1JCKB 1EY8A 3FRPB 1ILQA 5CMDA 4ID6A 4MHEA 2BOSA 1IW7C 1DCZA 1VDZA 4CKCA 4ILWA 1EQTA 3A55A 1SE4A 1ILPA 2SNSA 3I4NB 2L12A 3KF8A 3CKIB 2E2HB 3SK4A 2WAQB 3KBGA 1R4QB 1O7LA 4EQOA 2EVBA 1B4OA 3SE0A 2RVLA 1WD0A 4DAVA 2PNRC 1ICWA 1STGA 2IJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0G A;  2SOB A;  4PMC A;  5CV5 A;  1EYA A;  3DHQ A;  5EGT A;  3SHL A;  2EY5 A;  2PZW A;  3D8G A;  5HGT A;  5CR3 A;  4ODG A;  5IIF A;  4K14 A;  3MZ5 A;  2EYM A;  1SNP A;  2LKV A;  2PW5 A;  2KHS A;  2RBM A;  3HEJ A;  4EQP A;  1NUC A;  2F0V A;  3ERQ A;  4TRD A;  1TR5 A;  5I6Y A;  3QB3 A;  2F0E A;  1KAB A;  4DGZ A;  3LX0 A;  1SNO A;  2OEO A;  5DAU A;  3PMF A;  4IAL A;  5DEH A;  1A3U A;  2F0D A;  3TP8 A;  5C4H A;  1KAA A;  1EY6 A;  1EY5 A;  4KD3 A;  2EYJ A;  2KQ3 A;  3NUC A;  1RKN A;  3VA5 A;  4KY6 A;  1JOR A;  1EY0 A;  4S3S A;  3ERO A;  1F2M A;  1STH A;  3MEH A;  1A2U A;  3TME A;  4KTA A;  3TP5 A;  2F0F A;  4K6D A;  5IGC A;  5K5P A;  4NP5 A;  1KDB A;  1F2Y A;  4KY7 A;  4OL7 A;  5KYI A;  5HUR A;  5J22 A;  4I65 A;  4NMZ A;  2EYP A;  4R8N A;  4B9X A;  1NSN S;  3BDL A;  2OXP A;  3SR1 A;  2F0Q A;  4HMI A;  5JOB A;  4WOR A;  4QMG A;  3RUZ A;  3S9W A;  1TT2 A;  1EYC A;  1EY9 A;  2F0H A;  1EYD A;  3NP8 A;  2O4X A;  3HZX A;  5C4Z A;  5IGE A;  2ENB A;  1SYE A;  5C3W A;  4LAA A;  4K5W A;  5CV6 A;  4PMB A;  2F0I A;  4EVO A;  1IHZ A;  3BDC A;  3P75 A;  3NQT A;  4HTH A;  3NK9 A;  3MVV A;  4H7B A;  3SK6 A;  1II3 A;  3EJI A;  5IGD A;  3QOJ A;  1AEX A;  4RKL A;  1EZ6 A;  5CC4 A;  3TP7 A;  4K2L A;  2F0T A;  4DU9 A;  4KY5 A;  3QOL A;  2F0W A;  5CGK A;  1EY7 A;  1STY A;  5JAV A;  4EQN A;  4PNY A;  4QB4 A;  2PQE A;  1A3T A;  1STB A;  3DMU A;  1KDC A;  1EY8 A;  3ITP A;  2EYH A;  5IGG A;  1SYF A;  5IOC A;  5KYL A;  4J6H A;  5ISR A;  1EQV A;  5C3X A;  4N9P A;  3D6C A;  2QDB A;  3H6M A;  3E5S A;  3SXH A;  2HQE A;  5F2D A;  5EKK A;  3D4W A;  1STA A;  4K8J A;  2OF1 A;  3NXW A;  4IZ8 A;  5E3F A;  5EKL A;  5I9P A;  4NDX A;  2EYO A;  5IOD A;  4ID6 A;  4KV6 A;  4F7X A;  2WAC A;  3U9O A;  1ENA A;  2RKS A;  4WRD A;  5IGB A;  1SNC A;  3C1F A;  4K8I A;  5CV9 A;  4K5X A;  5CV7 A;  1SND A;  3P1H A;  5KGU A;  2F0L A;  2EYF A;  5KIX A;  2M00 A;  4K5V A;  4KHV A;  2NUC A;  3T16 A;  4KD4 A;  1A2T A;  2PW7 A;  3OSO A;  4YIJ A;  1EZ8 A;  4DFA A;  5J1Z A;  2PZU A;  2F0O A;  3MHB A;  4J1M A;  4MIU A;  2SNS A;  1JOK A;  4N9T A;  4QF4 A;  4F8M A;  1JOO A;  5KEE A;  2F0J A;  4ZUJ A;  4NKL A;  2F0N A;  2PYK A;  4RKB A;  2F0P A;  5CV8 A;  4B9W A;  5C6A A;  3EVQ A;  1KDA A;  1EY4 A;  2EXZ A;  4ME5 A;  2F0K A;  4ZQ3 A;  2F0S A;  2RDF A;  5E1F A;  4G57 A;  3SK4 A;  3TP6 A;  5IGF A;  2EYL A;  1A3V A;  3SK5 A;  1SNQ A;  1ENC A;  3NHH A;  3V2T A;  2F0M A;  2SNM A;  4IUN A;  5NUC A;  5C5M A;  4HMJ A;  2F3V A;  4KJN A;  3OMC A;  3OWF A;  2F3W A;  3SK8 A;  4EQO A;  3D4D A;  5I6W A;  1SNM A;  4ZUI A;  2EY1 A;  3T13 A;  2PZT A;  1JOQ A;  2EY2 A;  4K2K A;  1STN A;  1U9R A;  5C5L A;  5KRU A;  1SYD A;  4KJO A;  3R3O A;  4E6I A;  1SYC A;  1SYB A;  1TQO A;  1STG A;  5I9O A;  1SYG A;  3C1E A;  3OMG A;  4DF7 A;  5M9O A;  5CV4 A;  5J39 A;  2F0U A;  3MXP A;  1F2Z A;  2EY6 A; 
#chains in the Genus database with same CATH topology
 1WTW A;  4HSP A;  3J80 L;  1JB7 A;  2A68 D;  4A3J H;  3I72 A;  1LTT D;  3EBE A;  1K3B C;  1TS3 A;  1Q90 A;  5EPK A;  4QUF A;  1Q82 C;  1EY5 A;  1FJG Q;  4KY6 A;  1HNX L;  2R7Z G;  3AFQ A;  1KD1 C;  2OTJ A;  1VQA A;  2J7Z A;  3EA6 A;  2BDO A;  1BVS A;  2UUA L;  4IFD G;  3STB D;  3DLL A;  1Z7T A;  3B6Y A;  1PHJ A;  2E2I B;  5IWA L;  1OTC A;  2ENB A;  4GOP A;  4LAA A;  2D0P A;  3TRZ A;  4A93 G;  3VR6 A;  1IYJ B;  1U4M A;  1S40 A;  2ATW A;  1PA6 A;  4XQQ A;  5C4J H;  1EL0 A;  3GTG B;  5JVH 3;  3S16 H;  3V96 A;  1EIG A;  1I4R A;  4C3H B;  1EEF D;  4OGQ C;  3J81 j;  1JWU D;  3BVG A;  3S2D H;  4IN3 A;  2ICE C;  1HQM C;  1YBY A;  5ISR A;  4J6H A;  1HQR D;  5BR8 Q;  3D6C A;  1Q8I A;  2EQS A;  2MQH A;  4GKK L;  3PO2 G;  1JJC B;  1HFG A;  1PTO D;  2K52 A;  3K0X A;  5CBA E;  3CCL A;  4APV A;  5LMN L;  2H1E A;  1S5D D;  2XWJ B;  3G6E A;  4X3T A;  2XN9 C;  3K8A A;  5M3M G;  3PUY A;  4LF8 L;  4CDD C;  1YNJ D;  2HCI A;  1WI5 A;  1JOO A;  3HOZ G;  2B63 G;  2IHF A;  4BY7 G;  3K7A B;  2Y0S G;  3TN2 A;  1DGS A;  1VMC A;  5C6A A;  1HCZ A;  4NXM L;  2F0K A;  4FNF A;  3TP6 A;  1MD2 D;  4HJA A;  5EPJ A;  4C3I G;  1X9N A;  4G7Z C;  5C5M A;  1PFS A;  3PGZ A;  2B63 H;  1K83 B;  4GOP C;  2ES2 A;  2JJQ A;  3E6Z X;  3A8I E;  3RN2 A;  2A5H A;  1V8Q A;  4IQZ A;  2M9V A;  5M5X B;  3CPF A;  5JEA J;  2F1M A;  2EY2 A;  4LF5 L;  3AFP A;  1WVL A;  1QVC A;  1B8A A;  2LXJ A;  2D9U A;  3I4M H;  1DJR D;  4LF5 Q;  2Q2T A;  1JE5 A;  2E76 C;  4OWX B;  2SOB A;  4XYQ A;  3PUX A;  4L5Q A;  1MKH A;  4POF A;  1KRS A;  1SNP A;  1B44 D;  4CKE A;  2F3I A;  4OXP A;  3NEN A;  4DGZ A;  1O7I A;  1GVP A;  2XSC A;  1EWH A;  3NTH A;  5D3D A;  1RDP D;  1XPO A;  3BZD B;  3VA5 A;  2DJF C;  3NUC A;  1RKN A;  3J81 E;  4LUV A;  2WKD A;  3PUZ A;  1PFN A;  3BVM A;  4K6L A;  3FKI G;  3PCO B;  1OXT A;  4LFB Q;  4HJ9 A;  3CU7 A;  3BJU A;  1N9W A;  4KN4 C;  1D7Q A;  2Z9H A;  4KHZ A;  2EXD A;  2KOL A;  1AZQ A;  1CA6 A;  2ASB A;  2AKW B;  4LF9 Q;  3FEW X;  4Q5V A;  2ZJQ A;  1QIL A;  1XWE A;  2RA4 A;  4YY3 L;  2GA4 B;  4JI5 L;  5D14 A;  2HCC A;  3K5O A;  4DR6 L;  3CCR A;  4ZKC B;  3CRL C;  1STY A;  4G7H C;  4DV4 L;  2KCC A;  4GN5 A;  4QB4 A;  4EQN A;  2HDM A;  2QF7 A;  1DOL A;  5M3M B;  3KDF B;  2XWB B;  4N9P A;  3K5N A;  3GP7 A;  4CKB A;  3A5Z B;  1X3E A;  1X54 A;  1VF5 C;  3OPO A;  4YHH Q;  1HUM A;  2OTL A;  3LGJ A;  2N88 A;  1AH9 A;  3PO3 G;  1XNQ L;  2OQK A;  2IWH A;  3GTP H;  4HED A;  3OSO A;  4WFN 3;  1TWG B;  5GAG C;  1IXR A;  2N49 A;  4J1M A;  2R7D A;  3PV0 A;  1QJO A;  4MNO A;  3I4L A;  1O7Y A;  5EPL A;  1VQ8 A;  1DYQ A;  3MXU A;  1I94 Q;  1ZYR C;  4FVM A;  4DV6 Q;  1C48 A;  4JYA Q;  3Q6S A;  5H1S E;  5M3M H;  4JBJ A;  4DV6 L;  1UEB A;  4FF2 A;  4BXX G;  5NUC A;  3JAM L;  3H0G B;  1Q1B A;  3M4P A;  1HNW L;  1JR0 D;  4QL5 A;  1BR9 A;  3I91 A;  2SEB D;  1WCM H;  1QUQ A;  2CKZ B;  2H5X A;  3J7A F;  1SXT A;  2R7Z B;  4IUT A;  2D5D A;  4CGY B;  2ICI A;  5T1I A;  3K5M A;  2NVX B;  1OXU A;  5EKK A;  4XDX A;  2R61 A;  4XYO A;  3GTM B;  3FDT A;  1EYA A;  1BBX C;  3A8J E;  1EUJ A;  5JEA H;  5C44 H;  4X62 L;  3BDO A;  5ELD A;  1N33 Q;  4BA1 I;  4LNQ A;  1EIH A;  3OTO L;  2XVS A;  3PMF A;  2WP8 J;  1LUZ A;  2K50 A;  5EAY A;  5IE8 A;  2RCF A;  1H9M A;  3NBH B;  5L37 A;  1F2M A;  1PRT D;  3HG9 A;  5IYB G;  1NY4 A;  3CCV A;  5C4X H;  5J22 A;  1X3G A;  3HOX B;  2XRS D;  2LXK A;  5FLX E;  4A3B B;  2NWG A;  5CV6 A;  2H4O A;  5G3L D;  5ELE A;  3QO2 A;  2MO1 A;  3CF5 A;  1CZG A;  1QWY A;  4R4C A;  1PRT C;  2I5L X;  3W1G A;  4DUZ L;  3S17 B;  2L1B A;  2PO4 A;  2F0W A;  4C3I B;  3CC2 A;  1H9R A;  1HZA A;  2UUA Q;  1D5Z C;  2UU9 Q;  1HH2 P;  1HZC A;  5C3X A;  4LUO A;  3W1B A;  4IUV A;  3RR5 A;  4K8J A;  2OF1 A;  5T1G A;  4LFA L;  5ELF A;  1HNZ Q;  1BNZ A;  3HKZ G;  1WTX A;  1Q12 A;  2JA6 B;  3HOU H;  4AYB B;  1QVG A;  3OW7 A;  1YNJ C;  5CV7 A;  1SJE D;  2NZH A;  5IT9 L;  4A3D H;  4A3K G;  3HP3 A;  4FXK C;  3J7Y W;  4DFA A;  1KLU D;  5J1Z A;  5KEE A;  3NWT A;  2R92 G;  4A3G G;  1Y1W H;  2Q2U A;  4B9W A;  2HIX A;  3F1Z A;  4IPH A;  1E2W A;  3TS2 A;  5E1F A;  1J8I A;  3CPW A;  1WTH A;  3A56 A;  2F4V L;  2ZXR A;  4RFB A;  1N32 L;  2KJX A;  3GTO H;  1N36 Q;  1UEA B;  1LTA D;  5BN4 A;  2TSS A;  4HSV A;  1BBU A;  1ICF B;  4NDX A;  2EY6 A;  3FVQ A;  2NTS A;  1H95 A;  4V0B A;  3FP9 A;  4X62 Q;  1VQ9 A;  3DM3 A;  3A5U A;  2KHS A;  3J81 c;  1V1P A;  3OTO Q;  4EGV A;  3QB3 A;  2HD3 A;  4YHH L;  1Q46 A;  2J4X A;  5C4H A;  2RCN A;  2K04 A;  2B8F A;  5LL6 X;  2L15 A;  2Y0S E;  3UE1 A;  4DXG A;  1BCP F;  1AP0 A;  1NMF A;  1VQD A;  2VZA A;  1S3O A;  2K01 A;  3ZJY C;  1KIX A;  4I65 A;  5ELN A;  2VL6 A;  4QMG A;  1EY9 A;  1G91 A;  3RLO A;  3E9I A;  1TWA B;  2K5V A;  1LAB A;  4RHR A;  5GRO A;  1X3F A;  3KBX A;  4DUZ Q;  2AMC B;  1CSP A;  3H0G H;  2Z6K A;  4GKJ L;  3K6O A;  1EU3 A;  2J0T D;  4ABN A;  2KVM A;  4KKS A;  4KY5 A;  3SDZ A;  5IYC G;  1PH2 A;  1D1K A;  4A3D B;  1ASZ A;  4JI3 L;  4XIG S;  1F2L A;  1SE2 A;  4Y52 H;  3N52 A;  1R9T H;  1IYV A;  4K5X A;  2AUK A;  2EJF C;  1S5E D;  3EN2 A;  2A74 C;  3PIO 3;  3M3Y B;  3OW2 A;  2G5D A;  2Q8I B;  4DV4 Q;  1XMO L;  3M4Q A;  3URY A;  2PZU A;  2F0O A;  3HOW H;  1A15 A;  4BBR G;  1JOK A;  2D2C C;  4C3J H;  1DOM A;  2JK8 A;  4RGN A;  3CHB D;  2A19 A;  4UDU C;  1K73 C;  1T5X D;  5DM6 3;  1TXY A;  4LF9 L;  2RDF A;  4LF6 Q;  2M2L A;  4A3L G;  1XPR A;  3TZD A;  3OMC A;  3DWA A;  3KFU A;  2AQ1 B;  1B3A A;  1STE A;  3NBI A;  3Q24 A;  1FNW A;  1PFM A;  4JVZ A;  1SYB A;  1TQO A;  1VQM A;  5M9O A;  1YHA A;  4FXD A;  1X3Q A;  2F0G A;  1IKL A;  1K0R A;  1HPC A;  5EGT A;  1Q81 C;  2MFI A;  1SE8 A;  1X32 A;  4HCS A;  2F0V A;  2GN5 A;  1PFB A;  3GTM H;  2BH2 A;  2L11 A;  3T53 B;  3OWE B;  1QCB D;  2KCT A;  1YNN D;  1GUS A;  4H0L C;  5E4W C;  4YWL A;  3CC4 A;  3OIQ A;  2R7Z H;  4HN7 A;  1U4R A;  1AW7 A;  2CVR A;  4NP5 A;  2JA5 B;  2I5M X;  4OL7 A;  1G51 A;  3CD6 A;  1EWC A;  1FNV A;  2MPM A;  3TZU A;  2C9O A;  1TWH H;  4DR5 Q;  2OXP A;  4LWC A;  2FHT A;  3RUZ A;  1XMQ L;  3FPP A;  1TT2 A;  1KQS A;  3L9A X;  4RG1 A;  3HKZ B;  2JA6 G;  4IOA A;  1HJP A;  4PMB A;  3NWS A;  3BVZ A;  5M5X H;  2NVQ H;  2B2T C;  3NQT A;  2X6G A;  4DR4 L;  3H15 A;  2UUB L;  2B8G A;  4A3I H;  4IPG A;  4DUY Q;  4DU9 A;  5CGK A;  3Q23 A;  1P16 A;  4B3S L;  1QB5 D;  1Q1E A;  2EYH A;  1SYF A;  4A75 A;  1XJV A;  3HOX H;  2PQA A;  2Q2H A;  3H6M A;  4IUR A;  3SXH A;  5IYD G;  4FXG C;  1T9H A;  1E2V A;  2QW7 A;  1F77 A;  5IT9 c;  3UDF A;  2R92 B;  5FOB B;  4KKU A;  5LMN Q;  1B70 B;  4DR7 L;  4A3C H;  3CMA A;  2NVT H;  1GM5 A;  4IJL A;  3P1H A;  2F0L A;  4K5V A;  1I3Q H;  2R93 B;  3VR5 A;  4AYB G;  2QGQ A;  4MTN A;  4JI6 Q;  3J7A 5;  2B2W C;  2CWP A;  3I4M G;  1KL9 A;  3ZYY X;  2R92 H;  3CCJ A;  3JAM c;  4DV7 L;  1EY4 A;  1HNZ L;  2F0S A;  4G57 A;  2YTX A;  2QDL A;  1SE3 A;  3V2T A;  4IUN A;  3X3N A;  1KXL A;  4ME3 A;  1X55 A;  1Y8O B;  2OT2 A;  2WKC A;  5ELC A;  1JMC A;  2WAQ E;  4X65 Q;  4JV5 L;  5FLX c;  1STN A;  2FMC A;  4L6T B;  5C5L A;  3GTL B;  3HFZ B;  4E6I A;  5JJZ A;  2OWO A;  1SYG A;  3KF8 B;  1VQI A;  3FKI H;  2I5H A;  3H0G G;  1EQR A;  1KTK A;  2N55 A;  4XT1 B;  4JI8 L;  5BR8 L;  1H9J A;  2AQ3 B;  4OIK A;  4PG3 A;  2QEX A;  1U0L A;  1ONL A;  5AJ3 L;  4TRD A;  4GKK Q;  5D65 A;  4XQN A;  4J8Q A;  5EJW A;  1KAA A;  1PH1 A;  3S24 A;  1PDQ A;  2JEB I;  4KLK A;  2NBF A;  4KTA A;  2VUM G;  1VQB A;  2F0F A;  3CCU A;  1S5F D;  1HA5 A;  3WOF A;  4JOI A;  4B9X A;  2N3S A;  3Q8D A;  4DNT B;  3U58 A;  3PUV A;  3W2D A;  1K3R A;  1SBB B;  4ZLT F;  2K03 A;  4BBR H;  4LF6 L;  5FKA C;  1LO5 D;  3T1Y L;  1GKH A;  3GD7 A;  4IFD J;  2XNA C;  1AEX A;  4L5S A;  1TWC B;  3A0J A;  1LTL A;  3RN5 A;  1YHB A;  5I2X A;  1A0I A;  3L3O C;  3VR4 A;  1ZKO A;  1V1P B;  3E5S A;  4C2M B;  1YIT A;  2UU9 L;  3AYH B;  2E2H H;  2MGS A;  1PH8 A;  1PH9 A;  5EBD A;  3I4N H;  3X3M A;  2UUC L;  2I07 B;  4IUQ A;  3WWV A;  4BBS H;  4WRD A;  3C1F A;  4CDF C;  1WTP A;  3AB9 A;  3PIP A;  1MSH A;  3MA2 B;  1RL2 A;  1ET6 A;  4KD4 A;  1A2T A;  2KA7 A;  2C35 B;  2PW7 A;  4DV2 L;  2E5L L;  2VUM B;  4DK1 A;  5JPN C;  2EPB A;  4P72 A;  4ZUJ A;  3S16 B;  2N8N A;  3JAM i;  5C4J B;  1O78 A;  4POG A;  3EQL C;  5C0X H;  1NJI C;  1VMP A;  2F0M A;  1PTO B;  5E4X A;  1AN8 A;  1ESR A;  1ZEQ X;  5AFW A;  3D4R A;  4HMJ A;  2F4V Q;  4A4I A;  3KLW A;  5FO7 B;  1JOQ A;  3F2U A;  3LNN A;  1SYD A;  2D62 A;  4B3R L;  2O5J C;  1WYD A;  2VQE L;  4B3T Q;  4NXN Q;  1SMY D;  1V9P A;  1WJJ A;  1B53 A;  4QY7 A;  4HJ5 A;  4FO2 A;  5DEH A;  3HOY G;  3FMC A;  2Y0S B;  4K0K L;  3TP8 A;  2Q8R E;  4Y7N H;  4AIM A;  3NEM A;  1XNQ Q;  2KCM A;  2NZ1 D;  5HY6 A;  1CTM A;  4NPS A;  3TME A;  4DV0 Q;  1D2B A;  3T1H L;  2IY5 B;  5IGC A;  2E5L Q;  2R93 G;  1Y1W G;  1NAP A;  5EKI A;  2FMM A;  1O80 A;  2B39 A;  1SMX A;  2JA5 G;  1PTO H;  5KND A;  2QIL A;  3MAQ A;  4C3H H;  1VQ7 A;  4IFD H;  4A3L H;  1TWH B;  3NBH A;  4GLA C;  1NNX A;  1WD1 A;  1K28 A;  4A3I G;  2NVQ B;  3ULP A;  1TY2 A;  2F0T A;  4HR7 B;  1B7Y B;  1GUG A;  2JP1 A;  1DOK A;  4PNY A;  3DMU A;  3G4S A;  1K9M C;  1BBW A;  2KEE A;  5C0X J;  1KNE A;  1L1O C;  3ERS X;  2Z6B A;  1PH7 A;  1UNS A;  2JXM B;  4JCV E;  5IOD A;  4A3M H;  3HOZ B;  1J9O A;  2EYO A;  4A93 B;  3C3L A;  4C56 C;  4F7X A;  2WAC A;  2ZM6 L;  4BBS B;  2RKS A;  1SNC A;  2IT1 A;  4K8I A;  4YY3 Q;  3I70 A;  1N32 Q;  1X6O A;  5KGU A;  4DV3 L;  4CJ0 B;  5G3L F;  2JA9 A;  2Z6K C;  1TY0 A;  1CHQ D;  3PO2 H;  2K32 A;  5M5Y H;  1YI2 A;  1GXD C;  3BU2 A;  3MHB A;  4JI7 L;  1RCV D;  2F03 A;  1H9K A;  1PXU A;  1T5E A;  3A8K E;  4QUC A;  1IL2 A;  5IGF A;  4BBR B;  3PF4 A;  1SNQ A;  1ENC A;  4LF4 Q;  1U5K A;  4A3E G;  1VQ6 A;  5GQO A;  3BYT B;  5EQ0 A;  1JT8 A;  1SSO A;  3KLR A;  2VY3 A;  1LV9 A;  4XQJ A;  3DM1 A;  4KMU C;  2C5C A;  1HNX Q;  1RHP A;  2A73 B;  5A2Q E;  4A76 A;  3R3O A;  1IZ6 A;  2KCN A;  4DAP A;  5I9O A;  2LS0 1;  5M3F B;  4BY1 H;  2RSO A;  3M3Y H;  3D31 A;  4OWT B;  3D6W A;  2ZT9 C;  4C3J B;  1NR2 A;  2LKV A;  3NQI A;  1R9T B;  1HR0 W;  5C3E G;  1IBM L;  3S1M B;  2JQO A;  2K5N A;  4ZRZ A;  3WOE A;  4G4K A;  2E8G A;  3FHW A;  2K5H A;  1WFQ A;  2F52 A;  4IJH A;  4DV0 L;  1A63 A;  5IT9 E;  4XT3 B;  2EYJ A;  3ICE A;  3I4N G;  3JC6 6;  1PV4 A;  2CWA A;  3MEH A;  1GO3 E;  2EJM A;  4HIO A;  1EQQ A;  3GTQ H;  3T4A C;  2DY7 A;  5KYI A;  1M90 C;  5BN5 A;  3IKJ A;  3HOY H;  4NMZ A;  1K8G A;  3F2C A;  1D5X C;  3BDL A;  2XRQ D;  3D0F A;  3FPU B;  4OIJ A;  1H9S B;  4WOR A;  1CKN A;  1YVC A;  2IW3 A;  1W3S A;  1G29 1;  5J3B A;  2A69 C;  1E7Z A;  2NB0 A;  4FDB A;  1IHZ A;  2Z0S A;  5D3I B;  3GTJ B;  1QE6 A;  1W2B A;  2IHE A;  3S1N H;  3J80 c;  4IPC A;  4KI0 A;  3I2Z A;  3QOJ A;  3R2I A;  3KJP A;  1DON A;  2JA8 H;  3H3V I;  4IO9 A;  5C3E B;  2PI2 A;  1OXS C;  1I4P A;  1YHQ A;  4YCV A;  1BCP C;  1I3Q B;  2Z4H A;  1CI3 M;  5M3F G;  1LT5 D;  1K0S A;  4R4O A;  1FYC A;  3S1M H;  4FF3 A;  2UXC Q;  1A6X A;  1TWF H;  2R7F A;  4Z9C B;  3CCE A;  2VB3 X;  2EZV A;  2G9D A;  3TEH B;  1Y69 U;  4DR6 Q;  2B2U C;  4JI2 L;  4TVA B;  4AH6 A;  4YIJ A;  3CQZ B;  4AQY L;  4X3S A;  4N9T A;  4PQX A;  2FIN B;  4AYB E;  3IRB A;  1PH4 A;  4NKL A;  4A3I B;  2YU9 B;  1SFO H;  3EVQ A;  3V05 A;  2K6A A;  2DNE A;  3T1Y Q;  1O7Z A;  1Y14 B;  2VQF Q;  3KDF A;  1E1T A;  2K14 A;  1CT1 D;  5JPM C;  2F3V A;  1BOS A;  1Y1W B;  4QGU A;  1PZJ D;  5DNF A;  3T13 A;  4JW0 A;  1E2Z A;  3RZD H;  4JV5 Q;  4OON A;  3UDG A;  4OO1 H;  2CH4 W;  1Y1V G;  1XTD A;  1VQE A;  2WB1 E;  2RSN A;  3HOY B;  3K57 A;  1TVX A;  4R8I A;  4JBM A;  1IBM Q;  1CA5 A;  3CXC A;  4I7Z C;  3HEJ A;  4RAU C;  2O5I C;  1LTS D;  3S14 B;  4DK3 C;  4DNR B;  4JBW A;  4DA2 A;  4L5T A;  4A3G B;  4A3F G;  1HTL D;  1EY0 A;  1U4P A;  2DNC A;  1TU2 B;  2MP1 A;  1KDB A;  4KY7 A;  1I6V C;  3M85 A;  1PLF A;  2EYP A;  1OXX K;  4BWG B;  1NSN S;  5JOB A;  1JJ2 A;  5JJI A;  3M4O B;  4MZ9 A;  1BCP D;  2K4K A;  3NP8 A;  1ROD A;  1L0X B;  3HZX A;  5IGE A;  1PRT F;  1CM9 A;  2LSS A;  3C2P A;  1AE3 A;  2BH8 A;  3PF5 A;  2PPB C;  2VXW A;  3EJI A;  3AMU A;  3NPP A;  1HXY D;  4RMF A;  3PQI A;  1IL8 A;  1JWS D;  2RQX A;  3KJO A;  5M5W H;  1B3Q A;  1YEZ A;  3F2D A;  5COR A;  1S4Z A;  1C7Y A;  3K7A H;  1VQ4 A;  2YTY A;  1B9N A;  5I9P A;  4PZ8 A;  3I55 A;  1HHV A;  2KEN A;  5C44 B;  3BYY B;  4RA8 A;  4MTK A;  1F9R A;  2NUC A;  4ZK9 B;  3H94 A;  3CME A;  4U68 A;  4X3K A;  1GUN A;  4DV2 Q;  4A93 H;  3IFT A;  4LUZ A;  2A8V A;  2VB2 X;  3DUZ A;  2FJ2 A;  5KNC A;  2Z1C A;  3M9B A;  2V1C C;  2F4I A;  5AJ3 Q;  2EYL A;  1A3V A;  2OCE A;  4TKO B;  2UXD Q;  5EBC A;  2CW0 C;  4NW2 A;  4A3E H;  3K59 A;  1CHP D;  4HCE A;  2BA0 A;  4P2C B;  3D4D A;  1PRT B;  2EY1 A;  2PZT A;  1QG7 A;  4K2K A;  4X3U A;  1VQK A;  5KRU A;  3NTI A;  4FF4 A;  4KJO A;  3R93 A;  2VUM H;  1SRU A;  2B2Y C;  4DF7 A;  1BXT A;  3AQQ A;  4HAE A;  5HGT A;  2X69 A;  3DHQ A;  2K28 A;  3UI2 A;  3VYS A;  3J7A V;  2RBM A;  4EQP A;  4B3T L;  5I6Y A;  3CQZ H;  1PH6 A;  2OEO A;  4KK7 A;  5DAU A;  3UDX A;  4ZKB B;  4JI5 Q;  1S5B D;  4OEM B;  1IBK Q;  3BZK A;  2O2L D;  1WTO A;  2ZJR A;  1OO9 B;  4UHV A;  1HFN A;  3A7A B;  3NE5 B;  1F2Y A;  4DV1 Q;  4LMQ D;  2Z4I A;  1MI2 A;  1KNA A;  1L2F A;  2FFK B;  2VW9 A;  3PSI A;  5FLX L;  4WJW A;  2UXB Q;  2CHB D;  4X66 L;  4QJF A;  1EEI D;  4OHJ A;  5C0X G;  4DR1 L;  5C3W A;  2ZXP A;  4OWW B;  4HTH A;  1J6Q A;  2K33 A;  3EFX D;  4X64 L;  3JAM E;  1VQP A;  3KYH C;  2ZJP A;  1PVO A;  1KC8 C;  1SR3 A;  1GHJ A;  2EOT A;  2K05 A;  3M4Y A;  3I3C A;  1DM0 B;  1STB A;  2B2U A;  5IGG A;  5KYL A;  3CCQ A;  1EQV A;  4HJ7 A;  4DR5 L;  1I94 L;  1EYG A;  1MJE A;  2HQE A;  5FO8 B;  1RF2 D;  1KHI A;  1I6H B;  3GTQ B;  1HZB A;  1NR4 A;  2PCF B;  4KV6 A;  3I73 A;  1CSQ A;  3J7Z C;  1EOV A;  4V19 0;  5CV9 A;  4R4I A;  2CQO A;  2E75 C;  3E0J A;  2IX1 A;  4OO1 G;  3HOV B;  3HOV G;  1ZXT A;  3FKI B;  4ULL A;  1ENF A;  2RHS B;  3MWY W;  1G6Z A;  4F8M A;  4JI4 L;  2TMP A;  1I6H H;  1DXM A;  1E1O A;  2F0P A;  2EXZ A;  1HR0 Q;  2B63 B;  3I4M B;  3K0Y A;  3WDN A;  4QIW B;  4LFC L;  4G7O C;  2L5T A;  2RHQ B;  1N34 Q;  1FVI A;  3M4O H;  3VYU A;  5GAH C;  4KJN A;  3SK8 A;  2F3W A;  1XX8 A;  3GO5 A;  2E74 C;  3G6J B;  1U9R A;  2JA8 G;  3QJY A;  2NVY B;  1TS4 A;  3PO2 B;  1V43 A;  4A3F B;  2HIV A;  1CKO A;  1VQF A;  3DXJ C;  3SHL A;  3H3V H;  4B3M L;  2EY5 A;  1VQL A;  1JB3 A;  2F0E A;  2K1B A;  4EX5 A;  1JC7 A;  1CK1 A;  2ALY B;  1QZH A;  2B2V A;  2A6H C;  1X56 A;  1Y1V B;  1LT4 D;  5DM7 3;  4IOC A;  4BY7 B;  2DY8 A;  3H3V C;  4DR2 L;  2NYZ D;  4UP8 A;  3ERO A;  4DV1 L;  1STH A;  1D8L A;  2ZTE A;  3P20 A;  1VQO A;  1Z6H A;  2EE1 A;  1TS2 A;  3T51 B;  4QIW E;  1D1I A;  1JIC A;  3TDQ A;  1Q7Y C;  4RGM A;  4DV5 Q;  2VQF L;  4RHS A;  1I4H A;  1FD7 D;  4RCO A;  3STB C;  4DAY B;  3VDY A;  1SAP A;  1UE5 A;  3GV3 A;  1LYL A;  2HUG A;  3NK9 A;  4M1U B;  4H13 C;  1QVF A;  5JVG 3;  2E2D C;  4ZYS A;  1UE1 A;  5IIF A;  1A3T A;  4LF8 Q;  2E2I H;  1LAC A;  1X3P A;  2ZTD A;  2BCO A;  4GS3 A;  4BY7 H;  4KN7 C;  4UPA A;  4PV1 C;  5F2D A;  4LW1 A;  3IFD A;  1HTP A;  2AUJ D;  2EJG C;  1CQV A;  3HS0 C;  4DR3 L;  5E7N A;  1YNX A;  4GNX B;  3NEL A;  2DUD A;  3PUW A;  4H02 A;  4KHP Q;  3RZO B;  2I0Q A;  1Y1V H;  3TS0 A;  4Y7N B;  1C0A A;  1UE7 A;  3A54 A;  4JI1 Q;  4X6A H;  3GTK H;  3I90 A;  2UUB Q;  4IPD A;  1C9O A;  1PMR A;  3SGI A;  4GN4 B;  3T16 A;  3I56 A;  4DK6 C;  1GUT A;  1PH3 A;  1ML0 D;  3ER0 A;  4F88 A;  4DR2 Q;  2F0N A;  1PYB A;  4RKB A;  1IBL L;  3LWU A;  3BZC A;  1S72 A;  3S1N B;  3RMH A;  4ME5 A;  1R4P B;  4LFA Q;  3H09 A;  3SK5 A;  1DD2 A;  4A3C G;  1FR3 A;  1JQY D;  1YNN C;  3M7N A;  2K5D A;  4RWS C;  2HT1 A;  2Z8L A;  3S15 B;  4LF7 L;  4O0A A;  2RDG A;  1VQN A;  1K8M A;  5IY0 A;  3RNU A;  3OMG A;  1L1O B;  3MXP A;  3J80 i;  1EYD A;  1F2Z A;  1BO0 A;  2DGY A;  3K58 A;  1YJW A;  5K36 H;  3DEP A;  2PZW A;  1VQJ A;  1NCV A;  4ZCK A;  1MSG A;  1XMQ Q;  2WAQ G;  3U50 C;  4C3J G;  5LMU L;  4IAL A;  3RLN A;  4GKJ Q;  1C4Q A;  1Y8P B;  3CW2 C;  5K36 G;  3S2H B;  5LMU Q;  3J81 L;  1VF7 A;  3Q22 A;  4DV3 Q;  1WOC A;  1B50 A;  1JOR A;  1NE3 A;  4S3S A;  2MJ8 A;  1RD9 D;  2AQ2 B;  3QG1 A;  4CDE C;  5LHY 1;  2IX0 A;  1L0W A;  2NN6 H;  3CRK C;  4CJ2 C;  3VYR A;  4DV5 L;  4C2M H;  3S15 H;  3CP0 A;  2B2W A;  4B3R Q;  1D6E C;  1GOZ A;  2JA7 B;  3DEO A;  2O4X A;  4DR7 Q;  3CAM A;  3U4Z A;  1V1O A;  2F0I A;  2LFN A;  3S1Q B;  1TWC H;  1C8C A;  4K0K Q;  1VQ5 A;  3MVV A;  1AE2 A;  1LTG D;  4HJ8 A;  2VS1 A;  5GAE C;  1TS5 A;  3O13 A;  4LF4 L;  4RKL A;  1EZ6 A;  4L63 B;  5FK9 C;  1Z47 A;  3QOL A;  2G9H D;  1WTR A;  1EY7 A;  3MXN B;  4JPB W;  5M5Y B;  1KDC A;  1XYI A;  1LT6 D;  3A7L A;  4M8A A;  4DV7 Q;  1BUV T;  3GTK B;  3J80 E;  3D4W A;  1QUQ B;  1TKW B;  1CKM A;  2V4D A;  3LWE A;  1BQQ T;  5E3F A;  1XXG A;  1BCP B;  2Q8T A;  1ENA A;  5IGB A;  2L9H A;  3VYT A;  3S2H H;  1SN8 A;  2B2T A;  5IYD H;  3HOV H;  1SEB D;  2M00 A;  1EU4 A;  4KHV A;  3W5O A;  4OX9 Q;  1TWF B;  2L0C A;  1EZ8 A;  4JC0 A;  1Y8N B;  1LT3 D;  4QF4 A;  4DKA C;  4I7A A;  1JE4 A;  2L55 A;  3DWQ A;  3GTG H;  2EIF A;  3DWP A;  5I4D A;  4L8J A;  1S5C D;  1RTN A;  4JI8 Q;  3KOJ A;  2KBN A;  2CQA A;  1ESF A;  4X64 Q;  3T56 B;  3TQY A;  4A3B G;  3M7G A;  1HZ9 A;  1MJC A;  3F8T A;  3U9S A;  4A3K B;  3HOX G;  1AZP A;  3GTJ H;  1SNM A;  4ZUI A;  4DAM A;  1XMO Q;  4IUU A;  1HUN A;  2JA7 G;  2DJG C;  2A1A A;  3ULJ A;  2KED A;  5CR3 A;  4LFC Q;  2PW5 A;  3J81 i;  2PI2 E;  4N8X 1;  3ERQ A;  4UY8 C;  2QCP X;  4C1N I;  1RIP A;  4R9W A;  4DR4 Q;  1VQH A;  1M4V A;  2MNA A;  2F0D A;  1WTQ A;  1NBW A;  3HRZ C;  1EY6 A;  4FP5 D;  2KQ3 A;  4JI1 L;  1IBK L;  5K5P A;  4K6D A;  4WJ3 M;  1XPU A;  1V1Q A;  3E3X A;  5HUR A;  3ND8 A;  1TII D;  4FYD A;  2F0Q A;  4HMI A;  5M3F H;  2PMZ E;  4BY1 B;  1EYC A;  2F0H A;  1IBL Q;  4A3J G;  4DNI A;  1I5F A;  2UUC Q;  1F9Q A;  3K5L A;  1J5E Q;  5LMN W;  5IP7 H;  3GTO B;  2QA4 A;  3MFG A;  1II3 A;  4ZAI A;  3H91 A;  4GOP B;  3KK7 A;  4A3E B;  5C4X B;  1PTO F;  2D0O A;  1EFI D;  4LF7 Q;  3BS1 A;  3GDE A;  1GHK A;  4B3M Q;  2A69 D;  3R2T A;  3L7Z C;  3N6R A;  4JOI C;  2JA5 H;  3NXW A;  4IZ8 A;  3KF6 A;  3S1R B;  4YWM A;  4JYA L;  1PZI D;  3U9O A;  2QKI C;  4U67 3;  2I46 A;  2BE5 C;  2E2J B;  2R3Z A;  3QIA A;  4OX9 L;  2BA1 A;  2EYF A;  5KIX A;  3C46 A;  2WII B;  3HOU B;  2YYZ A;  2QEJ C;  2JA6 H;  2NTT A;  4BBS G;  1DZ1 A;  1WCM B;  3UDI A;  4MIU A;  1EIY B;  3RZD B;  1FNU A;  1N8R C;  2PYK A;  1BKB A;  3A74 A;  1PH5 A;  4DR3 Q;  4ZQ3 A;  2KHI A;  2NVY H;  3OIP A;  4NXN L;  1A8V A;  2KEC A;  3VR2 A;  4OEL B;  5IP9 H;  1SFO B;  2DN8 A;  2BDN A;  3UE0 A;  4UP9 A;  3VA7 A;  4F87 A;  2B3G A;  4GN3 B;  4AQY Q;  3PO3 B;  3GV6 A;  4H44 C;  4IFD I;  2IX3 A;  1M1K C;  3TBI B;  5CV4 A;  2F0U A;  3GTP B;  1D5M C;  1IW7 D;  3SEB A;  4CJ1 B;  2BE5 D;  1B1Z A;  1MGS A;  5IP9 G;  1L0Y B;  1HA6 A;  2PMZ B;  5C0X I;  4ODG A;  4K14 A;  3MZ5 A;  1GUO A;  2EYM A;  3HGB A;  3QWN A;  2JEA I;  3E0E A;  4QQB X;  1KAB A;  1G2S A;  4PMW A;  1QNU A;  1FL0 A;  2PQA B;  1SLJ A;  4R1J A;  2K5W A;  1A3U A;  3GQB A;  4IUP A;  2WIN B;  4WJ4 A;  3RLF A;  1EIF A;  4KD3 A;  1B9M A;  2WV6 D;  3GTL H;  1A2U A;  3G71 A;  1LTR D;  3MXG A;  2WB1 G;  1AFP A;  1LM0 A;  1LLR D;  1FGU A;  1L1O A;  4B08 A;  2UXB L;  5FLM G;  1CFM A;  4DR1 Q;  3NSW A;  1GJX A;  3S9W A;  2LMC B;  2WB1 B;  1KRT A;  1UE6 A;  5C3E H;  2JA8 B;  4P74 A;  2JYO A;  4EVO A;  1P8L A;  1I4G A;  2ZM6 Q;  2AWN A;  1GUW A;  2A6E D;  4P73 A;  4TQU S;  1IKM A;  4A3K H;  5IGD A;  4XXE A;  1F9S A;  4JI4 Q;  3IL8 A;  3U4V A;  5JAV A;  1UAP A;  1E24 A;  4BS9 A;  3TRE A;  2ID0 A;  3P7J A;  2QDB A;  1CQF A;  3AEV A;  1STA A;  2ZXO A;  2YU9 H;  1EOT A;  1UUP A;  5EKL A;  2CW0 D;  1WTV A;  3PIP 3;  1W6J A;  4UP7 A;  3K81 C;  3ND9 A;  4KHP L;  1XNR Q;  1VCI A;  2HDL A;  3HKS A;  4B3S Q;  4YCW A;  1SDF A;  4C3H G;  3OYY A;  4P75 A;  1PYS B;  1HR0 L;  2MHV A;  4LK1 C;  2Q2I A;  2L4N A;  5CV8 A;  1KDA A;  4EQ5 A;  1I4Q A;  4GLV B;  3TSS A;  4CHT B;  1VQC A;  3G48 A;  5TSS A;  2SNM A;  4RGT A;  1OXV A;  3PO3 H;  3HOU G;  2YTV A;  3EIV A;  3MXN A;  3SVM A;  4JI0 L;  1QZG A;  4HIM A;  3BG3 A;  1HNW Q;  3CC7 A;  1I50 H;  3W3A A;  5A2Q L;  2GVA A;  2JA7 H;  3C1E A;  4A3G H;  2ZTC A;  2R6G A;  1MBY A;  5CV5 A;  4PZ7 A;  3I4O A;  3QR8 A;  4LJZ C;  3S14 H;  1ASY A;  3Q0A A;  2PNH A;  5ELB A;  1SJH D;  4RH6 A;  3S1R H;  2AWO A;  1PZK D;  3HOZ H;  3LX0 A;  4FF1 A;  4HIK A;  4RCN A;  2OQ0 A;  5GAD C;  2WFW A;  4TSS A;  2MO0 A;  2E2J H;  5KNB A;  4R4Q A;  3F2B A;  1ET9 A;  1WCM G;  3S2D B;  1F9P A;  1KAW A;  1JWM D;  1I50 B;  2IPK D;  1HRJ A;  1IYU A;  2B2Y A;  4P71 A;  4R8N A;  3IAY A;  4JI3 Q;  3SR1 A;  1PTO C;  1MIU A;  5LL6 S;  1YIJ A;  2B2V C;  5M5W B;  2UXC L;  4C3I H;  1SYE A;  5JEA G;  4UAI A;  5C44 G;  1G8Z D;  4A3B H;  4CBV A;  3S17 H;  1E22 A;  4XTC S;  3BDC A;  1N36 L;  1K8A C;  1LTI D;  4H7B A;  2XIW A;  2SDF A;  3MTS A;  1FGB D;  3NTK A;  4GZY C;  5BN3 A;  3KLS X;  5FJ8 H;  5CC4 A;  4N8F A;  4JI2 Q;  3TP7 A;  2CFM A;  1QOH A;  2HHH Q;  4JI7 Q;  4BA2 I;  3HOW B;  2A6E C;  2EDG A;  5ELO A;  5COY A;  3ITP A;  1KLG D;  3OHX C;  2HHH L;  5C4X G;  5IOC A;  1UWV A;  4C1N K;  2CH4 A;  4MN3 A;  3R8B A;  3ULL A;  4L5R C;  4X66 Q;  3CCM A;  4DAY A;  1YJ9 A;  1BDO A;  5FJ8 G;  4NXM Q;  4A3J B;  1Q3L A;  4JBK A;  4BY1 G;  1SND A;  3K80 C;  4A3D G;  3L2P A;  1H9S A;  2NVT B;  3RZO H;  3G7L A;  1RTO A;  1CUK A;  2RDH A;  2F0J A;  4A3M B;  1B2T A;  2NVX H;  1A62 A;  2JE6 I;  3HKZ E;  5HGQ A;  1I4X A;  4RGO S;  4LFB L;  1J5E L;  1U4L A;  1E0B A;  1TWA H;  2K5Q A;  3AU7 A;  3NHH A;  2NN6 I;  2XGT A;  3RD4 A;  4QCL A;  2A6H D;  2YV5 A;  5IP7 G;  3E9H A;  4J15 A;  3OWF A;  2HQL A;  2JN4 A;  2JSO A;  4JK1 C;  3ONA B;  5I6W A;  4DXF A;  2VNU D;  1M8A A;  4DK0 A;  1QNK A;  3I8Z A;  4KKT A;  1SYC A;  2XTI A;  1TWG H;  2A68 C;  2AHO B;  5J39 A;  2K7V A;  2KUM A;  2X6L A;  4Q0F A;  2NN6 G;  5A35 A;  4GLX A;  1W6K A;  2IL8 A;  4PMC A;  1VS0 A;  2P5Z X;  3MC0 B;  3D8G A;  2MUY A;  2GVB A;  2UXD L;  1N33 L;  1K8O A;  1NUC A;  1ZYR D;  1XTC D;  1TR5 A;  3I7F A;  1PYW D;  1G2T A;  1LTB D;  3D3R A;  1MHW C;  1SNO A;  1G6P A;  5I2Y A;  1N34 L;  1BF4 A;  4ALP A;  2KHJ A;  4GNX C;  4DN4 M;  3MEF A;  5FO9 B;  1Q86 C;  3VR3 A;  4DUY L;  3TP5 A;  4CDC C;  4OO1 I;  1CZW A;  4BXX H;  3OOC A;  1YZ6 A;  3KUP A;  1EWI A;  1SRO A;  1SMY C;  1NTG A;  5JJL A;  5CBE E;  1K83 H;  1X65 A;  4A3F H;  5C4Z A;  5CYU A;  3S1Q H;  2VQE Q;  4K5W A;  5IWA Q;  3KLS A;  1YJN A;  2B29 A;  3P75 A;  3MFY A;  3SK6 A;  2LY7 A;  4YCU A;  4A3M G;  1RJT A;  4K2L A;  5DLQ E;  2RF4 A;  3T1H Q;  4JI6 L;  4O1N A;  1NMG A;  4JI0 Q;  2PQE A;  4O42 A;  1JCK B;  1EY8 A;  3FRP B;  4YWK A;  1ILQ A;  1Z9F A;  5CMD A;  2FXQ A;  4GNX A;  3PIO A;  1E3P A;  4ID6 A;  4MHE A;  2BOS A;  1EFW A;  4R4T A;  1IW7 C;  1DCZ A;  1FJG L;  1VDZ A;  4CKC A;  4ILW A;  1EQT A;  3A55 A;  2CCZ A;  4X65 L;  1SE4 A;  3HOW G;  1ILP A;  5IYB H;  2SNS A;  1Q8K A;  3I4N B;  2L12 A;  4O2D A;  3KF8 A;  3CKI B;  3CCS A;  2E2H B;  2N78 A;  4DPG A;  5FLM H;  4NB3 A;  2K75 A;  3SK4 A;  2WAQ B;  3KBG A;  1GD7 A;  4PZ6 A;  1VQG A;  2NZO A;  4JG2 A;  1R4Q B;  1O7L A;  1XNR L;  4EQO A;  1CKN B;  2EVB A;  1JJG A;  1B4O A;  3L0O A;  5IYC H;  3SE0 A;  4HID A;  2RVL A;  1WD0 A;  4DAV A;  2PNR C;  1ICW A;  1STG A;  3KF6 B;  2IJ0 A;  2R93 H;  5JJK A;  3K7U C; 
#chains in the Genus database with same CATH homology
 1WTW A;  4HSP A;  3J80 L;  2A68 D;  3I72 A;  1LTT D;  1TS3 A;  1Q90 A;  5EPK A;  4QUF A;  1EY5 A;  4KY6 A;  2J7Z A;  3EA6 A;  2BDO A;  4IFD G;  1Z7T A;  2E2I B;  2ENB A;  4LAA A;  3VR6 A;  1U4M A;  4XQQ A;  1EL0 A;  3GTG B;  5JVH 3;  3V96 A;  1EIG A;  1I4R A;  4C3H B;  1EEF D;  4OGQ C;  1JWU D;  3BVG A;  4IN3 A;  2ICE C;  1HQM C;  5ISR A;  4J6H A;  1HQR D;  3D6C A;  1Q8I A;  1HFG A;  1PTO D;  5CBA E;  2H1E A;  1S5D D;  2XWJ B;  4X3T A;  2XN9 C;  3PUY A;  1YNJ D;  2HCI A;  1JOO A;  3K7A B;  3TN2 A;  1VMC A;  5C6A A;  1HCZ A;  2F0K A;  4FNF A;  3TP6 A;  1MD2 D;  5EPJ A;  4C3I G;  4G7Z C;  5C5M A;  1K83 B;  3E6Z X;  3A8I E;  2A5H A;  1V8Q A;  4IQZ A;  2M9V A;  5M5X B;  5JEA J;  2F1M A;  2EY2 A;  1WVL A;  2D9U A;  1DJR D;  2E76 C;  2SOB A;  4XYQ A;  3PUX A;  1SNP A;  1B44 D;  4CKE A;  4DGZ A;  2XSC A;  1EWH A;  3NTH A;  5D3D A;  1RDP D;  3BZD B;  3VA5 A;  3NUC A;  1RKN A;  3J81 E;  2WKD A;  3PUZ A;  1PFN A;  3BVM A;  4K6L A;  1OXT A;  3CU7 A;  4KN4 C;  4KHZ A;  2KOL A;  1AZQ A;  1CA6 A;  3FEW X;  4Q5V A;  1QIL A;  1XWE A;  2RA4 A;  2GA4 B;  5D14 A;  2HCC A;  3K5O A;  4ZKC B;  3CRL C;  1STY A;  4G7H C;  2KCC A;  4EQN A;  4QB4 A;  5M3M B;  2HDM A;  2QF7 A;  1DOL A;  2XWB B;  4N9P A;  3K5N A;  3GP7 A;  4CKB A;  1VF5 C;  3OPO A;  1HUM A;  2N88 A;  2IWH A;  4HED A;  3OSO A;  4WFN 3;  1TWG B;  4J1M A;  3PV0 A;  1QJO A;  3I4L A;  1O7Y A;  5EPL A;  1DYQ A;  3MXU A;  1ZYR C;  4FVM A;  1C48 A;  3Q6S A;  4FF2 A;  5NUC A;  3JAM L;  3H0G B;  1Q1B A;  1JR0 D;  1BR9 A;  3I91 A;  2SEB D;  3J7A F;  1SXT A;  2R7Z B;  4IUT A;  2D5D A;  4CGY B;  2ICI A;  5T1I A;  3K5M A;  2NVX B;  1OXU A;  5EKK A;  4XDX A;  2R61 A;  4XYO A;  3GTM B;  3FDT A;  1EYA A;  1BBX C;  3A8J E;  5JEA H;  3BDO A;  5ELD A;  4BA1 I;  1EIH A;  2XVS A;  3PMF A;  2WP8 J;  1H9M A;  1F2M A;  1PRT D;  3HG9 A;  5J22 A;  3HOX B;  2XRS D;  5FLX E;  4A3B B;  2NWG A;  5CV6 A;  2H4O A;  5G3L D;  5ELE A;  3QO2 A;  1CZG A;  1QWY A;  1PRT C;  3S17 B;  2L1B A;  2PO4 A;  2F0W A;  4C3I B;  1H9R A;  1D5Z C;  5C3X A;  4IUV A;  4K8J A;  2OF1 A;  5T1G A;  5ELF A;  1BNZ A;  2JA6 B;  1WTX A;  1Q12 A;  4AYB B;  3OW7 A;  1YNJ C;  5CV7 A;  1SJE D;  5IT9 L;  3HP3 A;  4FXK C;  3J7Y W;  4DFA A;  1KLU D;  5J1Z A;  5KEE A;  3NWT A;  4B9W A;  1E2W A;  5E1F A;  1J8I A;  3A56 A;  2ZXR A;  4RFB A;  2KJX A;  1UEA B;  1LTA D;  5BN4 A;  2TSS A;  4HSV A;  4NDX A;  2EY6 A;  3FVQ A;  2NTS A;  4V0B A;  2KHS A;  1V1P A;  4EGV A;  3QB3 A;  2J4X A;  5C4H A;  2K04 A;  2B8F A;  5LL6 X;  4DXG A;  1BCP F;  1AP0 A;  2K01 A;  4I65 A;  4QMG A;  1EY9 A;  1G91 A;  1TWA B;  1LAB A;  4RHR A;  3KBX A;  3K6O A;  1EU3 A;  2J0T D;  4ABN A;  2KVM A;  4KKS A;  4KY5 A;  3SDZ A;  1D1K A;  4A3D B;  4XIG S;  1F2L A;  1SE2 A;  3N52 A;  1IYV A;  4K5X A;  2AUK A;  2EJF C;  1S5E D;  2A74 C;  3PIO 3;  3M3Y B;  2Q8I B;  3URY A;  2PZU A;  2F0O A;  1A15 A;  1JOK A;  2D2C C;  1DOM A;  4RGN A;  3CHB D;  4UDU C;  1T5X D;  5DM6 3;  2RDF A;  2M2L A;  3TZD A;  3OMC A;  3DWA A;  2AQ1 B;  1B3A A;  1STE A;  3NBI A;  3Q24 A;  1FNW A;  1PFM A;  1SYB A;  1TQO A;  5M9O A;  4FXD A;  1X3Q A;  2F0G A;  1IKL A;  5EGT A;  1HPC A;  1X32 A;  4HCS A;  2F0V A;  1PFB A;  2L11 A;  3T53 B;  3OWE B;  1QCB D;  4H0L C;  1YNN D;  1GUS A;  5E4W C;  3OIQ A;  4HN7 A;  1U4R A;  1AW7 A;  2CVR A;  4NP5 A;  2JA5 B;  4OL7 A;  1EWC A;  1FNV A;  2MPM A;  3TZU A;  2C9O A;  2OXP A;  2FHT A;  3RUZ A;  3FPP A;  1TT2 A;  3L9A X;  3HKZ B;  4PMB A;  3NWS A;  3BVZ A;  2B2T C;  3NQT A;  2X6G A;  2B8G A;  4DU9 A;  5CGK A;  3Q23 A;  1QB5 D;  1Q1E A;  2EYH A;  1SYF A;  4IUR A;  3H6M A;  3SXH A;  4FXG C;  1E2V A;  1F77 A;  2R92 B;  5FOB B;  4KKU A;  3P1H A;  2F0L A;  4K5V A;  2R93 B;  3VR5 A;  2B2W C;  3ZYY X;  1EY4 A;  2F0S A;  4G57 A;  1SE3 A;  3V2T A;  4IUN A;  3X3N A;  1Y8O B;  2OT2 A;  2WKC A;  5ELC A;  1STN A;  2FMC A;  4L6T B;  5C5L A;  3GTL B;  4E6I A;  5JJZ A;  1SYG A;  2N55 A;  1KTK A;  4XT1 B;  1H9J A;  2AQ3 B;  4OIK A;  1ONL A;  4TRD A;  5D65 A;  4XQN A;  4J8Q A;  5EJW A;  1KAA A;  1PDQ A;  2JEB I;  2NBF A;  4KTA A;  2F0F A;  1S5F D;  1HA5 A;  3WOF A;  4B9X A;  4DNT B;  3PUV A;  3W2D A;  1SBB B;  4ZLT F;  2K03 A;  5FKA C;  1LO5 D;  3GD7 A;  4IFD J;  2XNA C;  1AEX A;  1TWC B;  5I2X A;  3L3O C;  3VR4 A;  1ZKO A;  1V1P B;  3E5S A;  4C2M B;  2MGS A;  5EBD A;  3X3M A;  2I07 B;  4IUQ A;  4WRD A;  3C1F A;  1WTP A;  3AB9 A;  1MSH A;  3MA2 B;  1ET6 A;  4KD4 A;  1A2T A;  2KA7 A;  2PW7 A;  2VUM B;  4DK1 A;  5JPN C;  2EPB A;  4ZUJ A;  3S16 B;  5C4J B;  1O78 A;  3EQL C;  5C0X H;  1VMP A;  2F0M A;  1PTO B;  5E4X A;  1AN8 A;  1ESR A;  1ZEQ X;  5AFW A;  3D4R A;  4HMJ A;  5FO7 B;  1JOQ A;  3F2U A;  3LNN A;  1SYD A;  2D62 A;  2O5J C;  1SMY D;  1B53 A;  4FO2 A;  5DEH A;  3FMC A;  2Y0S B;  3TP8 A;  2Q8R E;  2NZ1 D;  1D2B A;  1CTM A;  3TME A;  5IGC A;  1NAP A;  5EKI A;  2FMM A;  1O80 A;  2B39 A;  1PTO H;  5KND A;  2QIL A;  3MAQ A;  4IFD H;  1TWH B;  3NBH A;  1WD1 A;  2NVQ B;  1TY2 A;  2F0T A;  4HR7 B;  1GUG A;  2JP1 A;  1DOK A;  4PNY A;  3DMU A;  2KEE A;  5C0X J;  1KNE A;  1UNS A;  2JXM B;  5IOD A;  3HOZ B;  1J9O A;  2EYO A;  4A93 B;  3C3L A;  4C56 C;  4F7X A;  2WAC A;  4BBS B;  2RKS A;  1SNC A;  2IT1 A;  4K8I A;  3I70 A;  5KGU A;  4CJ0 B;  5G3L F;  1TY0 A;  1CHQ D;  2K32 A;  1GXD C;  3MHB A;  1RCV D;  2F03 A;  1H9K A;  1PXU A;  1T5E A;  3A8K E;  4QUC A;  5IGF A;  4BBR B;  1SNQ A;  1ENC A;  3BYT B;  5EQ0 A;  1SSO A;  3KLR A;  1LV9 A;  4XQJ A;  3DM1 A;  4KMU C;  2C5C A;  1RHP A;  2A73 B;  5A2Q E;  3R3O A;  2KCN A;  4DAP A;  5I9O A;  2LS0 1;  5M3F B;  2RSO A;  3D31 A;  3D6W A;  2ZT9 C;  4C3J B;  1NR2 A;  2LKV A;  3NQI A;  1R9T B;  3S1M B;  4ZRZ A;  3WOE A;  4G4K A;  5IT9 E;  4XT3 B;  2EYJ A;  3MEH A;  2EJM A;  5KYI A;  2DY7 A;  3T4A C;  5BN5 A;  3IKJ A;  4NMZ A;  1D5X C;  3BDL A;  2XRQ D;  3FPU B;  4OIJ A;  1H9S B;  4WOR A;  2IW3 A;  1G29 1;  2A69 C;  2NB0 A;  1IHZ A;  5D3I B;  3GTJ B;  1QE6 A;  4KI0 A;  1DON A;  3R2I A;  3QOJ A;  5C3E B;  1OXS C;  1I4P A;  1BCP C;  1I3Q B;  2Z4H A;  1CI3 M;  1LT5 D;  1FYC A;  4FF3 A;  1A6X A;  4Z9C B;  2VB3 X;  2EZV A;  2G9D A;  1Y69 U;  2B2U C;  4YIJ A;  3CQZ B;  4X3S A;  4N9T A;  4PQX A;  2FIN B;  4NKL A;  4A3I B;  2YU9 B;  3EVQ A;  3V05 A;  2K6A A;  2DNE A;  1O7Z A;  1CT1 D;  5JPM C;  2F3V A;  1BOS A;  1Y1W B;  1PZJ D;  5DNF A;  3T13 A;  1E2Z A;  4OO1 H;  2RSN A;  3HOY B;  3K57 A;  1TVX A;  4R8I A;  1CA5 A;  4I7Z C;  3HEJ A;  4RAU C;  2O5I C;  1LTS D;  3S14 B;  4DNR B;  4JBW A;  4DA2 A;  4A3G B;  1HTL D;  1EY0 A;  1U4P A;  2DNC A;  1TU2 B;  2MP1 A;  1KDB A;  4KY7 A;  1I6V C;  3M85 A;  1PLF A;  2EYP A;  1OXX K;  4BWG B;  1NSN S;  5JOB A;  3M4O B;  1BCP D;  3NP8 A;  1ROD A;  1L0X B;  3HZX A;  5IGE A;  1PRT F;  1CM9 A;  3C2P A;  2PPB C;  2VXW A;  3EJI A;  3AMU A;  3NPP A;  1HXY D;  1IL8 A;  1JWS D;  2RQX A;  5COR A;  1S4Z A;  1B9N A;  5I9P A;  1HHV A;  5C44 B;  3BYY B;  4RA8 A;  1F9R A;  2NUC A;  4ZK9 B;  3H94 A;  4U68 A;  4X3K A;  1GUN A;  3IFT A;  2VB2 X;  3DUZ A;  2FJ2 A;  5KNC A;  2Z1C A;  2F4I A;  2EYL A;  1A3V A;  4TKO B;  5EBC A;  2CW0 C;  4NW2 A;  3K59 A;  1CHP D;  4HCE A;  2BA0 A;  4P2C B;  3D4D A;  1PRT B;  2EY1 A;  2PZT A;  1QG7 A;  4K2K A;  4X3U A;  5KRU A;  3NTI A;  4FF4 A;  4KJO A;  3R93 A;  2B2Y C;  4DF7 A;  1BXT A;  4HAE A;  5HGT A;  2X69 A;  3DHQ A;  2K28 A;  3UI2 A;  3VYS A;  3J7A V;  2RBM A;  4EQP A;  5I6Y A;  2OEO A;  4KK7 A;  5DAU A;  4ZKB B;  1S5B D;  2O2L D;  1WTO A;  1OO9 B;  1HFN A;  3A7A B;  3NE5 B;  1F2Y A;  4LMQ D;  2Z4I A;  1MI2 A;  1KNA A;  2FFK B;  5FLX L;  4WJW A;  2CHB D;  1EEI D;  4OHJ A;  5C0X G;  5C3W A;  2ZXP A;  4HTH A;  2K33 A;  3EFX D;  3JAM E;  1GHJ A;  2EOT A;  2K05 A;  3M4Y A;  3I3C A;  1DM0 B;  1STB A;  2B2U A;  5IGG A;  5KYL A;  1EQV A;  2HQE A;  5FO8 B;  1RF2 D;  1I6H B;  3GTQ B;  1NR4 A;  2PCF B;  4KV6 A;  3I73 A;  4V19 0;  5CV9 A;  2IX1 A;  2E75 C;  3E0J A;  4OO1 G;  3HOV B;  1ZXT A;  3FKI B;  4ULL A;  1ENF A;  3MWY W;  1G6Z A;  4F8M A;  2TMP A;  1DXM A;  2F0P A;  2EXZ A;  2B63 B;  3I4M B;  3K0Y A;  3WDN A;  4QIW B;  4G7O C;  2L5T A;  3VYU A;  4KJN A;  3SK8 A;  2F3W A;  1XX8 A;  3GO5 A;  2E74 C;  3G6J B;  1U9R A;  3QJY A;  2NVY B;  1TS4 A;  3PO2 B;  1V43 A;  4A3F B;  3DXJ C;  3SHL A;  2EY5 A;  1JB3 A;  2F0E A;  2K1B A;  1JC7 A;  1CK1 A;  2B2V A;  2A6H C;  4BY7 B;  1Y1V B;  1LT4 D;  5DM7 3;  2DY8 A;  3H3V C;  2NYZ D;  3ERO A;  1STH A;  3P20 A;  1Z6H A;  2EE1 A;  1TS2 A;  3T51 B;  1D1I A;  1JIC A;  3TDQ A;  4RGM A;  4RHS A;  1I4H A;  1FD7 D;  4RCO A;  1SAP A;  3GV3 A;  2HUG A;  3NK9 A;  4M1U B;  4H13 C;  5JVG 3;  2E2D C;  4ZYS A;  5IIF A;  1A3T A;  1LAC A;  1X3P A;  2BCO A;  4KN7 C;  4PV1 C;  5F2D A;  3IFD A;  1HTP A;  2AUJ D;  2EJG C;  1CQV A;  3HS0 C;  3PUW A;  3RZO B;  4Y7N B;  3A54 A;  3I90 A;  1PMR A;  3T16 A;  1GUT A;  1ML0 D;  4F88 A;  2F0N A;  4RKB A;  3LWU A;  3S1N B;  3RMH A;  4ME5 A;  1R4P B;  3H09 A;  3SK5 A;  1DD2 A;  1FR3 A;  1JQY D;  1YNN C;  3M7N A;  2K5D A;  4RWS C;  2Z8L A;  3S15 B;  2RDG A;  1K8M A;  3OMG A;  3MXP A;  1F2Z A;  1EYD A;  1BO0 A;  3K58 A;  5K36 H;  3DEP A;  2PZW A;  1NCV A;  1MSG A;  4C3J G;  4IAL A;  1C4Q A;  1Y8P B;  5K36 G;  3S2H B;  3J81 L;  1VF7 A;  3Q22 A;  1JOR A;  1B50 A;  4S3S A;  2MJ8 A;  1RD9 D;  2AQ2 B;  3QG1 A;  5LHY 1;  2IX0 A;  2NN6 H;  3CRK C;  4CJ2 C;  3VYR A;  2B2W A;  1D6E C;  1GOZ A;  2JA7 B;  3DEO A;  2O4X A;  1V1O A;  2F0I A;  2LFN A;  3S1Q B;  1C8C A;  3MVV A;  1LTG D;  1TS5 A;  3O13 A;  4RKL A;  1EZ6 A;  4L63 B;  5FK9 C;  1Z47 A;  3QOL A;  2G9H D;  1WTR A;  1EY7 A;  5M5Y B;  1KDC A;  1XYI A;  1LT6 D;  3A7L A;  4M8A A;  1BUV T;  3GTK B;  3J80 E;  3D4W A;  1TKW B;  2V4D A;  3LWE A;  1BQQ T;  5E3F A;  1XXG A;  1BCP B;  2Q8T A;  1ENA A;  5IGB A;  2L9H A;  3VYT A;  2B2T A;  1SEB D;  2M00 A;  1EU4 A;  4KHV A;  1TWF B;  2L0C A;  1EZ8 A;  1Y8N B;  1LT3 D;  4QF4 A;  1JE4 A;  2L55 A;  3DWQ A;  3DWP A;  5I4D A;  4L8J A;  1S5C D;  1RTN A;  2CQA A;  1ESF A;  3T56 B;  3M7G A;  3U9S A;  4A3K B;  1AZP A;  1SNM A;  4ZUI A;  4IUU A;  1HUN A;  2KED A;  5CR3 A;  2PW5 A;  3ERQ A;  2QCP X;  4C1N I;  4R9W A;  1M4V A;  2F0D A;  1WTQ A;  3HRZ C;  1EY6 A;  4FP5 D;  2KQ3 A;  5K5P A;  4K6D A;  5HUR A;  3ND8 A;  1TII D;  4FYD A;  2F0Q A;  4HMI A;  4BY1 B;  1EYC A;  2F0H A;  1F9Q A;  3K5L A;  3GTO B;  3MFG A;  1II3 A;  4ZAI A;  3H91 A;  3KK7 A;  4A3E B;  5C4X B;  1PTO F;  1EFI D;  3BS1 A;  1GHK A;  2A69 D;  3R2T A;  3L7Z C;  3N6R A;  3NXW A;  4IZ8 A;  3S1R B;  1PZI D;  3U9O A;  2QKI C;  4U67 3;  2I46 A;  2BE5 C;  2E2J B;  2R3Z A;  3QIA A;  2BA1 A;  2EYF A;  5KIX A;  3C46 A;  2WII B;  3HOU B;  2YYZ A;  2QEJ C;  2NTT A;  1DZ1 A;  1WCM B;  4MIU A;  3RZD B;  1FNU A;  2PYK A;  4ZQ3 A;  3OIP A;  2KEC A;  3VR2 A;  1SFO B;  2DN8 A;  2BDN A;  3VA7 A;  4F87 A;  3PO3 B;  3GV6 A;  4H44 C;  4IFD I;  2IX3 A;  3TBI B;  5CV4 A;  2F0U A;  3GTP B;  1D5M C;  1IW7 D;  3SEB A;  4CJ1 B;  2BE5 D;  1B1Z A;  1MGS A;  1HA6 A;  1L0Y B;  2PMZ B;  5C0X I;  4ODG A;  4K14 A;  1GUO A;  2EYM A;  3HGB A;  3MZ5 A;  3QWN A;  2JEA I;  1KAB A;  1G2S A;  4PMW A;  1QNU A;  2K5W A;  1A3U A;  3GQB A;  4IUP A;  2WIN B;  3RLF A;  4KD3 A;  1B9M A;  2WV6 D;  1A2U A;  1LTR D;  3MXG A;  1AFP A;  1LLR D;  4B08 A;  1CFM A;  1GJX A;  3NSW A;  3S9W A;  2LMC B;  2WB1 B;  2JA8 B;  2JYO A;  4EVO A;  1I4G A;  2AWN A;  1GUW A;  2A6E D;  4TQU S;  1IKM A;  5IGD A;  4XXE A;  1F9S A;  3IL8 A;  5JAV A;  1UAP A;  4BS9 A;  2ID0 A;  3P7J A;  2QDB A;  1CQF A;  1STA A;  2ZXO A;  1EOT A;  1UUP A;  5EKL A;  2CW0 D;  1WTV A;  3PIP 3;  1W6J A;  3ND9 A;  1VCI A;  2HDL A;  1SDF A;  4C3H G;  2MHV A;  4LK1 C;  2L4N A;  5CV8 A;  1KDA A;  1I4Q A;  3TSS A;  4CHT B;  5TSS A;  2SNM A;  4RGT A;  1OXV A;  3MXN A;  3SVM A;  3BG3 A;  3W3A A;  5A2Q L;  3C1E A;  2R6G A;  1MBY A;  5CV5 A;  4LJZ C;  3Q0A A;  5ELB A;  1SJH D;  4RH6 A;  2AWO A;  1PZK D;  3LX0 A;  4FF1 A;  4RCN A;  4TSS A;  5KNB A;  1ET9 A;  3S2D B;  1F9P A;  1I50 B;  1JWM D;  2IPK D;  1HRJ A;  1IYU A;  2B2Y A;  4R8N A;  3IAY A;  3SR1 A;  1PTO C;  5LL6 S;  2B2V C;  5M5W B;  1SYE A;  5JEA G;  4UAI A;  1G8Z D;  4CBV A;  4XTC S;  3BDC A;  1LTI D;  4H7B A;  2XIW A;  2SDF A;  3MTS A;  1FGB D;  3NTK A;  4GZY C;  5BN3 A;  3KLS X;  5CC4 A;  3TP7 A;  1QOH A;  4BA2 I;  3HOW B;  2A6E C;  2EDG A;  5COY A;  3ITP A;  1KLG D;  3OHX C;  5IOC A;  4C1N K;  4MN3 A;  3R8B A;  4DAY A;  1BDO A;  4A3J B;  1Q3L A;  1SND A;  1H9S A;  2NVT B;  3G7L A;  1RTO A;  2RDH A;  2F0J A;  4A3M B;  1B2T A;  2JE6 I;  1I4X A;  4RGO S;  1U4L A;  1E0B A;  2K5Q A;  3AU7 A;  3NHH A;  2NN6 I;  3RD4 A;  4QCL A;  2A6H D;  3OWF A;  2JSO A;  4JK1 C;  3ONA B;  5I6W A;  4DXF A;  2VNU D;  1M8A A;  4DK0 A;  1QNK A;  3I8Z A;  4KKT A;  1SYC A;  2A68 C;  5J39 A;  2K7V A;  2KUM A;  2X6L A;  4Q0F A;  2NN6 G;  5A35 A;  1W6K A;  2IL8 A;  4PMC A;  3D8G A;  3MC0 B;  2MUY A;  1K8O A;  1NUC A;  1ZYR D;  1XTC D;  1TR5 A;  1PYW D;  1G2T A;  1LTB D;  3D3R A;  1SNO A;  5I2Y A;  1BF4 A;  4DN4 M;  5FO9 B;  3VR3 A;  3TP5 A;  4OO1 I;  1CZW A;  3OOC A;  3KUP A;  1SMY C;  5CBE E;  5C4Z A;  5CYU A;  4K5W A;  3KLS A;  3P75 A;  3MFY A;  3SK6 A;  2LY7 A;  1RJT A;  4K2L A;  4O1N A;  2PQE A;  4O42 A;  1JCK B;  1EY8 A;  3FRP B;  1ILQ A;  5CMD A;  4ID6 A;  4MHE A;  2BOS A;  1IW7 C;  1DCZ A;  1VDZ A;  4CKC A;  4ILW A;  1EQT A;  3A55 A;  1SE4 A;  1ILP A;  2SNS A;  3I4N B;  2L12 A;  3KF8 A;  3CKI B;  2E2H B;  3SK4 A;  2WAQ B;  3KBG A;  1R4Q B;  1O7L A;  4EQO A;  2EVB A;  1B4O A;  3SE0 A;  2RVL A;  1WD0 A;  4DAV A;  2PNR C;  1ICW A;  1STG A;  2IJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...