5IGCA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igcA00
1SYDA 4K5XA 1ENCA 2LKVA 1SYEA 3C1FA 5CV5A 3SK6A 5CV6A 4DGZA 4NDXA 3BDLA 3T13A 1KAAA 5C5LA 4K5VA 2SNMA 2EYJA 4NMZA 1TQOA 5JAVA 5HURA 4QMGA 1NSNS 5CV4A 5IOCA 2F0LA 3OMCA 4K2KA 5KRUA 4ID6A 1SYGA 4QF4A 4B9WA 1STHA 5C3WA 5HGTA 2EYFA 1F2ZA 2QDBA 5K5PA 5J39A 2F0DA 3NQTA 3P75A 2PQEA 1JOOA 3NUCA 4IZ8A 4IALA 3MXPA 4KJOA 5NUCA 2F0SA 2F0HA 5KYLA 4RKLA 4ZUJA 2F0WA 2EY6A 2SOBA 5IIFA 1EY8A 3ITPA 4K6DA 2F0JA 5DAUA 3BDCA 3R3OA 2F0IA 3RUZA 1EY0A 2SNSA 3MVVA 1TR5A 4H7BA 4ME5A 3T16A 3HEJA 2EY1A 2HQEA 4HMJA 3SHLA 5KIXA 3S9WA 5C3XA 2F3VA 1U9RA 1EYCA 2EYMA 1KDCA 5CC4A 4N9TA 4K8JA 5CGKA 4LAAA 4F8MA 2EYPA 3NK9A 1EQVA 4DF7A 5I6YA 1SYFA 5IGGA 1TT2A 4RKBA 3SR1A 2RKSA 5EGTA 3NP8A 4S3SA 2F0VA 3D8GA 4K5WA 4N9PA 5IGEA 1A3UA 5IGDA 3QOLA 4G57A 4KTAA 3SXHA 1EYAA 1AEXA 3ERQA 1SNQA 2F0EA 1KDAA 4OL7A 2O4XA 5C6AA 5IODA 5F2DA 4HTHA 4PMBA 2PW7A 4EQOA 1SNDA 1JOKA 4QB4A 1STGA 1EYDA 4DFAA 2EYHA 1EY5A 3NHHA 5KEEA 4KD4A 4R8NA 3MZ5A 3DHQA 3TP5A 2F0GA 2F0PA 4KY6A 2PYKA 5CV8A 2F0FA 2F0QA 2ENBA 2OXPA 1F2YA 2F0KA 5JOBA 5I9PA 3MEHA 3OSOA 2PZWA 3EROA 4KD3A 2EY2A 2PW5A 1SNPA 2M00A 3MHBA 2RBMA 2EXZA 4IUNA 5ISRA 2PZUA 3OWFA 4KJNA 1ENAA 4ZUIA 4B9XA 4F7XA 4KY5A 1A3TA 3EVQA 3P1HA 3TP8A 5J22A 1A2TA 4I65A 1A2UA 1EZ8A 4K8IA 4PNYA 5IGCA 3QOJA 4ZQ3A 2EY5A 5M9OA 3DMUA 1SNMA 1EY4A 2F0UA 3TP6A 1EY6A 1JORA 2F3WA 1STYA 5E1FA 4J6HA 4EQPA 4ODGA 4EVOA 3TP7A 3SK8A 1SNCA 2EYLA 3U9OA 4HMIA 5CR3A 2RDFA 2OF1A 3QB3A 4NP5A 4E6IA 1SYCA 3D4DA 5I6WA 4DU9A 5KGUA 1SYBA 4PMCA 3PMFA 5J1ZA 1EY9A 1IHZA 1NUCA 4KY7A 3C1EA 5CV9A 3SK5A 4NKLA 2F0MA 4MIUA 5IGBA 2PZTA 1A3VA 5C5MA 3OMGA 3TMEA 5C4HA 4WORA 3VA5A 1SNOA 5I9OA 1EY7A 2KQ3A 1EZ6A 4K14A 1KDBA 3V2TA 5IGFA 5C4ZA 5EKLA 1STNA 1STBA 2OEOA 4KHVA 4YIJA 2F0OA 4KV6A 2KHSA 4K2LA 3H6MA 4EQNA 3E5SA 2NUCA 2WACA 1STAA 3LX0A 1II3A 2F0NA 3D6CA 3HZXA 4WRDA 5EKKA 1F2MA 1KABA 3NXWA 1RKNA 5CV7A 5DEHA 5KYIA 5E3FA 3D4WA 3EJIA 1JOQA 3SK4A 4TRDA 2F0TA 4J1MA 2EYOA
chains in the Genus database with same CATH superfamily
1UE1A 4LF9L 2BCOA 5AJ3L 1SN8A 4DGZA 1CT1D 1PTOB 1CM9A 5CMDA 4DV1L 1XMQQ 2JA6H 3S15B 3K0XA 2B2UA 3VR5A 2DN8A 3I4MB 1PH8A 2OWOA 1L0WA 4IFDI 3K7UC 3SDZA 4U68A 1IYVA 2UXBQ 4A3BG 4MTKA 4RMFA 2SOBA 2EY6A 2A6HD 2SNSA 4DR6Q 4CKCA 2EY1A 1QZHA 1GUNA 1ICWA 4A3GB 1BCPB 1OXVA 2F3VA 2K14A 1YEZA 3M85A 2ZXOA 4OO1H 1Q86C 2B2YA 3SR1A 4DV7L 3NP8A 5IGEA 1W6JA 1A3UA 2RSOA 1CA5A 1J5EL 4JI1Q 4DV0Q 3NELA 2O4XA 1VQ7A 3NWTA 2ID0A 1U4MA 4PMBA 4QUCA 1TS4A 1QUQA 2ZJRA 1H95A 1CHQD 1U4PA 1EIFA 4JI6L 2EE1A 3DHQA 1SE8A 2JA5H 1HUMA 1VQ6A 4GOPA 2OXPA 4FF3A 4UP8A 1HFNA 2VQEL 3A8IE 3N52A 3E9HA 2EVBA 2KECA 1E24A 2ZTDA 2E2HH 2HIVA 1A2TA 4XYQA 2OTJA 3Q6SA 1HQMC 1SNMA 4GN4B 3HG9A 1CUKA 2F3WA 2NYZD 4BBRB 3OTOL 4HMIA 4G7ZC 1N34Q 3OIQA 1Q12A 1NUCA 3EN2A 1SBBB 1EQQA 4CDDC 2AHOB 4A3DH 2N49A 2LFNA 4B3RQ 4K0KL 1N9WA 2F0OA 4R1JA 1BXTA 3I8ZA 5BN5A 2R93G 3W3AA 2XRQD 3E6ZX 3T51B 4FF4A 5C4JB 1Q7YC 2B63H 4K5XA 1SYDA 1TXYA 3CKIB 4C2MH 3GTMB 2NTTA 4RGOS 4POGA 2VL6A 2YV5A 4DKAC 2DJGC 4FXDA 1V9PA 1NSNS 4GN5A 5CV4A 2F0LA 3NTKA 5BN3A 1MSHA 1HR0Q 4R4QA 3PO2B 4IFDJ 5IYCH 4PV1C 1JE4A 1EU4A 1S40A 2I5HA 2F0HA 2NBFA 5C44H 3MA2B 2PQAA 1PZKD 2C5CA 3HEJA 1QCBD 2K28A 5M5XH 5C44B 4DR6L 4M1UB 4CKBA 1IW7D 1HCZA 3PO2H 5IGGA 3E0JA 4APVA 4IUPA 4CKEA 1Z7TA 2K04A 3RNUA 1IBKL 1GXDC 4AH6A 4XQQA 4AYBE 3GV6A 1H9SB 5C6AA 4KMUC 1I94Q 2NN6H 3OW7A 5M3FH 3CCVA 2RSNA 3GTMH 2G9HD 1XMQL 4O1NA 3ICEA 3NHHA 4CBVA 4R8NA 3TP5A 4YHHL 2B39A 5T1GA 2PYKA 2AQ3B 3EROA 1CA6A 4P71A 2PCFB 5E4WC 1XMOL 4RA8A 4B9XA 3EVQA 4Q0FA 2QEJC 3HOZG 2KOLA 4NPSA 3ZJYC 1DD2A 4IPDA 3TP6A 1EY4A 2FMCA 3I4NG 3H15A 3FVQA 3VR4A 2Q2UA 4KN7C 3TP7A 2VQFL 4X3SA 4OIKA 5JVG3 2BA0A 3HOUB 4DAYB 1SYCA 4GZYC 1L0XB 5A35A 2K52A 5LHY1 3RR5A 2UUAL 1A8VA 3HOVG 2B2WA 5ELDA 1RL2A 3HOYG 2OTLA 1VQIA 2L12A 3BVMA 4JOIC 4C3HH 4DV5L 3F2DA 2OQ0A 1VS0A 1D6EC 1I3QB 3PV0A 4UAIA 3L2PA 1S5ED 1X65A 1GUOA 1E0BA 4DUZL 5C4ZA 1D5MC 1LTBD 2Z4HA 4MNOA 3GTOH 3K59A 2JA5B 3W1BA 4GLXA 5H1SE 4HJ7A 3PUZA 4JI4Q 4F87A 4J1MA 3GDEA 4B3ML 2P5ZX 5M5WB 3GTLH 2CWPA 5C5LA 2SNMA 4H44C 1GD7A 2E76C 1GO3E 1JT8A 5GAGC 4A4IA 3FPPA 1Z9FA 3PUYA 2MUYA 2AQ1B 4HIKA 3GTPH 4LF8L 5J39A 4JI5L 4KJOA 4IZ8A 4C3JG 2F0WA 3NENA 4FO2A 3CMEA 2F0JA 4KLKA 2M9VA 2YYZA 2JN4A 4XQJA 3NWSA 2NZ1D 1U9RA 3LWUA 5HGQA 1FNWA 1WOCA 1EWIA 1P8LA 1B3QA 1TY0A 2BDNA 3HOXH 2JA6B 4O42A 1IBKQ 4DPGA 1O78A 1EFID 5C3EB 2D9UA 1RCVD 1PYSB 5EQ0A 1CZGA 1G8ZD 1PYBA 2R3ZA 1TWGB 4I7ZC 4LJZC 5CV8A 5I2YA 4X64Q 1LT6D 5M3MB 1I4XA 4KKUA 4KD3A 2PW5A 2M00A 1G6ZA 1LT3D 5JPMC 1TS3A 3MXNB 1N36L 2R7ZH 3KJPA 1F77A 1EU3A 2EY5A 1C4QA 3L9AX 1EY6A 4YCWA 1JQYD 1PA6A 2RQXA 1B8AA 5EPLA 4IN3A 4EQPA 1N36Q 1LTTD 3HRZC 1SNCA 1FNVA 1VDZA 4E6IA 3D4DA 4X65Q 2Y0SE 3I91A 1YNND 3JAML 1A3VA 4KN4C 4IFDG 3D31A 1EY7A 4YY3Q 5GAEC 3M3YB 2K5QA 5IGFA 4EX5A 5IYBG 1VQ8A 1EIGA 1IBLQ 3U9SA 1SLJA 1QWYA 2QILA 2RHQB 4QGUA 1QG7A 3CCQA 4HJ8A 5BN4A 3J7A5 4C3JH 1DJRD 3I4NB 1AZPA 1YI2A 3S2DH 1IZ6A 1F9QA 4OONA 3E9IA 3PUVA 3R8BA 4K5VA 2F03A 3TZUA 4A3DG 2TSSA 2KHIA 2IHEA 5T1IA 3CPWA 3D0FA 4DNIA 3KFUA 3AQQA 4X62L 5CBAE 5FLXL 4A3MG 1G2SA 1S72A 1F2ZA 3KK7A 4XT3B 1HFGA 4DR1L 1PRTC 4OELB 4LFAL 2N3SA 1WTQA 1MJCA 4IUVA 3ITPA 3RUZA 2JEBI 3BYYB 3T4AC 2GVBA 2JA5G 3FHWA 4A3LH 1HRJA 3STBC 1ASZA 1DOKA 1RTOA 5BR8L 3C3LA 5IGDA 1ET6A 4DA2A 5LMNL 3IFTA 1J5EQ 4XQNA 3CC7A 1KTKA 1GKHA 4J8QA 4R9WA 3CW2C 1D5XC 3DWPA 2MGSA 4C3JB 4UY8C 4HIOA 1B4OA 1KNAA 4JI3L 2F0GA 1AE2A 2KJXA 1HZ9A 3H0GG 2VW9A 1NE3A 1V1OA 3MEHA 4DR5Q 1MBYA 5ELBA 4X3KA 2EIFA 4ZUIA 2VUMG 1XPUA 4KHPL 3FEWX 5JVH3 4LFBL 4NB3A 4PQXA 4DAVA 4AIMA 3CPFA 2XSCA 3BVZA 1PH9A 4JI0L 1X6OA 1HUNA 4ME3A 4A3IG 3H3VH 4F88A 3A8JE 4WORA 2R93H 3I4NH 1S3OA 1XTCD 1I94L 4HJ5A 4A93G 5IYCG 1LTID 2DNCA 1EQTA 4GKKQ 1T5EA 1BBWA 1QJOA 1WI5A 1I50B 1Y1VG 2NUCA 1VQJA 2I5LX 1K8GA 1TWFH 1E2WA 2E74C 1T5XD 2EYOA 2HD3A 2A74C 3I90A 3EQLC 3MXGA 1Q81C 1IKMA 2F52A 1BR9A 4QMGA 3I4MG 3HOWH 3RLFA 1O7YA 1SYGA 4Y7NB 3WWVA 2IWHA 1EQRA 1SROA 1YNXA 2G5DA 3STBD 4JBKA 5M5YB 2IPKD 2DUDA 3I70A 4LFCQ 3MXUA 2VXWA 3PIP3 2JSOA 4DK6C 2K01A 3DM3A 3TDQA 1HNXL 4B08A 5AFWA 3X3NA 3JAMi 2MNAA 2JA8B 1EY0A 5IT9E 3W1GA 3J7AV 3SHLA 2HQEA 3S2HB 2EXDA 4DAPA 5EPJA 2AKWB 3MWYW 3NK9A 3BG3A 4CJ1B 1HXYD 5IP9H 1I4GA 1PH5A 4IJHA 4RKBA 1FGBD 2F0VA 3CP0A 3Q22A 1B44D 3T1YQ 1EYAA 2B2VA 3ERQA 3IFDA 5C3EH 1JCKB 1WCMB 4XDXA 1XNQL 3UDGA 5M5WH 4X3UA 4BY7G 1ILPA 2TMPA 1EY5A 5KEEA 2MHVA 2IT1A 4JG2A 5G3LD 2A8VA 4WJWA 2KCNA 2F0FA 1SR3A 3KYHC 4H02A 4OIJA 1JWUD 5IP9G 1YNNC 2BDOA 1HA6A 3S1RH 3P1HA 3TP8A 5KNDA 2K7VA 1G51A 5JJZA 4JI5Q 4Y52H 1F9PA 3GTJB 2GVAA 1M90C 2YTXA 1L2FA 4FXKC 1VCIA 2CH4W 1YHAA 4DR5L 4HIDA 1K9MC 1SYBA 4PZ8A 3VR3A 2K5NA 2Z6KA 1P16A 2LSSA 2D62A 5D3DA 5HY6A 2R7ZG 2CCZA 3S17H 4KK7A 4MIUA 1PH3A 1IBLL 3LNNA 3FPUB 3H0GB 4MTNA 3A74A 1M1KC 1HNZL 3HOZH 4A3LG 1STBA 1VQGA 4KHVA 3FKIH 3HKSA 3I3CA 4C1NI 1II3A 1LABA 2YU9B 2NVQH 2CQAA 1FJGQ 3M4PA 3SK4A 1XNRL 2F0TA 1YNJD 3PUWA 2XRSD 4NDXA 3BDLA 4C3HB 5JPNC 1KAAA 2Z6KC 3S1NB 1MSGA 3CCMA 4DV4L 4DNRB 4DAMA 4X66Q 1CK1A 4ZCKA 2K50A 1E2ZA 4QF4A 3HOUH 3T1HQ 1JJGA 1K83B 4A3IB 3D3RA 2YTYA 2KUMA 3ND8A 5KYLA 1C48A 1Y8PB 1LYLA 1FD7D 2EJFC 1EYGA 1Y69U 3PQIA 2UXCQ 2JA6G 3J81i 1TS2A 3TBIB 2RDGA 3A7LA 2L55A 1JR0D 4L5QA 5FO7B 3BU2A 1BCPC 5CGKA 4RFBA 1EQVA 2FINB 4C1NK 1DCZA 1JC7A 1ML0D 4DR4Q 5LMUL 3M4OH 2KCTA 4OO1I 2UXDL 2XNAC 3D4RA 4A3EG 4HSVA 2RHSB 2JJQA 1LACA 1S5CD 1AE3A 2CFMA 3S1NH 1HHVA 2JE6I 4ZLTF 3MFGA 1W3SA 1H9KA 4JI0Q 1V8QA 2F4VQ 3M4OB 2RVLA 2UU9L 1PFBA 2F0PA 2YU9H 4FVMA 2F0QA 4QQBX 4RWSC 5K36H 2EY2A 3HOZB 4UP7A 4BS9A 2Z0SA 4L5RC 2Z1CA 3OWFA 1QE6A 4A3CG 3JC66 3SVMA 4TVAB 3AFQA 2L4NA 4PNYA 2PMZB 2WB1E 4R4CA 3H94A 3U58A 3DMUA 3S17B 1L1OA 1STYA 1NMGA 3A55A 3CCUA 1PTOF 1E1OA 1PH4A 2D2CC 1WJJA 1N8RC 2QW7A 1DOLA 3VYRA 2ZJQA 1LTLA 5FO9B 5M3MG 1WVLA 1SNOA 4DK3C 4KI0A 4LF6Q 1I4HA 4CGYB 2K33A 3GTGH 2OEOA 5KGUA 1ZYRC 2KHSA 3K80C 3E5SA 1BF4A 1RTNA 1CSPA 3GD7A 5IT9L 3J81E 4L5SA 1K8OA 5E3FA 3CQZH 4QIWE 4UP9A 4JI7Q 1ILQA 2FFKB 2R7DA 1K0RA 1VQ9A 2K75A 4A93H 3HKZG 2K32A 1ET9A 1JWSD 1KLGD 3NBHA 5FKAC 4OWWB 4JI7L 1L1OB 5M3FG 2DJFC 2WFWA 1XNQQ 3BDOA 3CAMA 5ELFA 1BNZA 1XMOQ 4LUVA 2R92H 2QKIC 4LF6L 5FJ8H 3SE0A 5TSSA 2ES2A 4OGQC 4YWKA 3MVVA 1HR0W 3CC4A 3H09A 2B2TC 1YZ6A 1SSOA 4GKJL 2MP1A 4P75A 2LY7A 2PI2E 1F9SA 4JBJA 5M5YH 3KUPA 1QNKA 3K8AA 2B8GA 5IP7H 2A19A 2VB3X 4A3FG 2NVXB 2HCCA 4ZKBB 2A1AA 4P2CB 1NBWA 1Q1EA 3LGJA 4R8IA 1PH1A 4DV2L 4IOAA 4JOIA 1O7IA 1VF7A 3NBHB 4X65L 1QB5D 1G2TA 2G9DA 4LK1C 3JAME 3HOXG 3KBXA 3MZ5A 1B9NA 2QGQA 1CI3M 1V43A 1I6VC 3OSOA 4A76A 4L5TA 2NVTH 4A3GH 2RF4A 2E2JB 2L5TA 3TSSA 1HPCA 2XTIA 2O2LD 5C0XG 1IKLA 1X3GA 1X3PA 1R9TB 5IY0A 2JA8H 1Y1WB 4ZQ3A 1X3EA 4BBSB 1C9OA 1NJIC 3IKJA 1LT5D 1KHIA 2NB0A 5CBEE 4XIGS 4RG1A 5CR3A 3F1ZA 1G91A 1LV9A 1Y1VB 2IJ0A 1UE6A 1PFSA 1TY2A 2IHFA 1A15A 2E5LL 4NXMQ 2WAQB 2NN6G 4N8X1 1KAWA 3A54A 3TMEA 2KEDA 3VA5A 2JA9A 5I9OA 2B8FA 5IWAL 1Y8OB 4L63B 1I6HB 2HT1A 4IPGA 2JYOA 3LX0A 1I50H 4WRDA 5IYDG 4OEMB 1LM0A 4FNFA 3I73A 4BWGB 3D4WA 1W6KA 3KF8A 4TRDA 2QA4A 2R92G 2OT2A 4BA1I 1VF5C 1VMCA 3PO2G 4LFBQ 1X54A 5FLMG 1K28A 4A3MB 1HZCA 2E8GA 1Q1BA 3UDXA 1PFMA 1CKMA 2EYFA 1I4RA 3J80E 2WINB 3MXPA 1HNZQ 5ELEA 1XWEA 3PO3G 3R3OA 3ULLA 3O13A 5KIXA 3RZDB 1XTDA 1VQAA 2NN6I 1QVGA 1IBML 2AMCB 1HA5A 2PQAB 5CC4A 1R4PB 4LNQA 1F9RA 1YJNA 3GP7A 2I0QA 3ULPA 3KBGA 4DV0L 2SEBD 4S3SA 3IRBA 4DUZQ 1U5KA 1MHWC 1ENFA 2IL8A 3CU7A 2WV6D 5BR8Q 1GHJA 2L15A 3ONAB 4C3IB 4X3TA 4JPBW 5FK9C 5L37A 3MXNA 2J7ZA 2UUAQ 4KD4A 3HOVH 1C8CA 2AQ2B 1C7YA 3CC2A 2F4VL 2CQOA 5JOBA 3OTOQ 1I6HH 2VUMB 3NTIA 4IOCA 3CCSA 1VQKA 3RZDH 2JA7G 1A3TA 1WTOA 3KJOA 2M2LA 1RHPA 3S24A 5D3IB 1VQDA 2LXJA 3NQIA 1U0LA 1K0SA 1GVPA 2Q8TA 4TKOB 3WOFA 4A3MH 1ESFA 1PH6A 4UHVA 2FMMA 3M7NA 2F0MA 5IGBA 1CFMA 1LTGD 1EZ6A 5EBDA 3V2TA 3J80i 2E2JH 2ZTCA 1V1QA 1GM5A 3J81j 1IYUA 4EQOA 4KHZA 5C4XH 5CV7A 1RKNA 3Q23A 2H5XA 2VB2X 1MGSA 2AWNA 3M3YH 3KLSA 1CKOA 1G291 1ZYRD 3PIOA 4L6TB 2E2IH 1VQNA 3FMCA 1CZWA 4AQYQ 2B63G 1K73C 4DXGA 2B2YC 1WTXA 4K2KA 1N32L 3AFPA 4BBRG 1OO9B 2DGYA 5EAYA 4ZKCB 5NUCA 4IALA 5JEAG 4GKKL 4BBSH 2UXDQ 3M4QA 2DY7A 5LMUQ 5DAUA 5I4DA 1X3QA 3GO5A 5GAHC 5D65A 3P7JA 2NVTB 2MPMA 4IUUA 2D5DA 4K8JA 1H9MA 3WOEA 2R92B 4JYAQ 1KRSA 1J6QA 1S5DD 3VYUA 3G6EA 2XN9C 2N78A 3A5UA 3GTPB 1O80A 1PTOD 4KTAA 2DY8A 5DNFA 4BY1G 2NVYB 2AWOA 1KDAA 4OX9Q 2Y0SG 1ZEQX 4LUZA 4B3SQ 1SE2A 3GTLB 3T1HL 4BBSG 2FJ2A 4AYBB 2NVXH 4K6LA 2O5JC 4JV5Q 1L0YB 1EYDA 1D1IA 1Z47A 1HZAA 3CCRA 4HSPA 4KY6A 1ESRA 2K03A 1X55A 1LTAD 2Z8LA 4IFDH 3KLWA 3PIO3 2HHHQ 3OYYA 1FR3A 4HCSA 4KJNA 1T9HA 1PYWD 4K8IA 4HR7B 3QOJA 4JBMA 4FF1A 4WFN3 2QEXA 4J15A 4CDEC 1BBUA 1K8MA 3Q24A 2EOTA 5A2QL 1N33L 4EVOA 4ODGA 4ZAIA 4JI8L 1DOMA 4DV6Q 2RDFA 4A3JB 2Q8IB 3QWNA 3PSIA 1EWCA 4H13C 4RAUC 1YITA 1HNXQ 2PPBC 2OCEA 1YIJA 5C5MA 1N33Q 1STEA 3H3VI 4JBWA 3OW2A 1Q8KA 4Z9CB 1PRTF 2OQKA 4LFAQ 1YJ9A 2J0TD 3W2DA 4XTCS 1K3RA 3GTOB 5JJIA 1B70B 2RDHA 1B50A 1SMXA 3M4YA 3R2TA 4I7AA 4X62Q 1JOQA 2IW3A 4OXPA 1CTMA 1I3QH 1DZ1A 3EFXD 3L7ZC 1EOVA 3I4LA 4JV5L 3F2CA 3BVGA 4A3BH 2B2UC 3DEOA 5HGTA 2UUCL 1MI2A 3G4SA 1NR2A 1OXXK 4DR7Q 2F0SA 4O0AA 4RKLA 1PRTB 4DV1Q 3K5NA 1PH2A 1NR4A 1A63A 4K6DA 3HOYB 2BE5D 3MTSA 3BZCA 3CCJA 2L9HA 3I2ZA 1JMCA 2UUBL 1EEID 3PUXA 3EIVA 1VMPA 4IQZA 3J7YW 5I2XA 3CCEA 3D8GA 5LL6X 4KHPQ 2K05A 2EZVA 2CVRA 3UE1A 1QILA 3I4OA 5M3FB 3HFZB 1DGSA 3DXJC 3CCLA 1PVOA 2HCIA 2NZHA 2VZAA 4GS3A 2EQSA 4LF4Q 3HOWG 1QVCA 3OPOA 4RGTA 2XIWA 4C2MB 1STGA 4DFAA 4JI2L 4IJLA 4HEDA 1AP0A 2BOSA 3I7FA 3OWEB 2KEEA 3K57A 2H1EA 4P73A 1PZJD 5C0XH 4C56C 2F0KA 1FJGL 3T56B 1MIUA 2UU9Q 1PV4A 5M5XB 3MHBA 1DM0B 2RBMA 2KBNA 4A3KH 3BZKA 3HOYH 1H9JA 4EQ5A 5J22A 1VQ4A 1HR0L 1EZ8A 2ZJPA 2EPBA 2F0UA 2CW0D 4K0KQ 4QCLA 4CHTB 1EFWA 1SJHD 4XXEA 4JCVE 1K83H 4A3IH 1R4QB 2A73B 1KLUD 1WTVA 2EJMA 4BBRH 2O5IC 1J9OA 4HJAA 5D14A 2JA7H 2ZM6Q 3IAYA 2HDMA 1VQCA 4HJ9A 1VQPA 2UXCL 3I55A 2E2HB 2B63B 2Q8RE 5GQOA 4V190 3CD6A 3W5OA 4IO9A 3G7LA 3FKIB 2I5MX 2K5WA 3D6CA 1JB3A 1F2MA 3NXWA 3DWAA 5DM73 4GLVB 2BA1A 2L11A 5CV5A 4DV4Q 4A3EH 2WAQE 1FNUA 2JEAI 4YCVA 4BXXH 3S14H 2VY3A 3FP9A 1SXTA 2IX0A 2F1MA 2NVYH 4A3JH 1KXLA 1BCPD 4TQUS 2WP8J 4WJ4A 4FYDA 2QDBA 3T1YL 3P75A 2VS1A 2VQEQ 3NUCA 5LMNQ 1Q82C 4DR2Q 2DNEA 4ZUJA 3F2UA 1Y14B 2N8NA 2K5DA 4DV7Q 3T16A 4C3IG 1UNSA 4DV5Q 3L3OC 1E22A 2D0PA 1SEBD 4R4TA 1VQ5A 1RODA 1JE5A 2A69C 4DUYQ 2B2TA 2RCNA 3RLNA 1BUVT 3QOLA 4G57A 4RH6A 3KDFA 1SRUA 3JAMc 1SNQA 1V1PB 4OL7A 5EBCA 4EGVA 1TS5A 1WCMH 1B7YB 1YNJC 4A3KG 2KHJA 4FXGC 1JOKA 1VQEA 2QCPX 2HUGA 2E2IB 2PNRC 5FLXc 4X64L 2EYHA 1NCVA 1B3AA 2QDLA 1SE4A 4FDBA 1SFOB 1D1KA 3EA6A 3SGIA 2X69A 3MFYA 3S2HH 2Q2IA 1GUGA 2PZUA 4RGNA 3BYTB 5IT9c 1SDFA 2UUCQ 1X3FA 1JICA 1NY4A 2N88A 1ZXTA 5E1FA 4ZYSA 1A6XA 4R4IA 2EYLA 1TWAH 1PRTD 4NXML 4P74A 1U4LA 4HCEA 3QIAA 3HOWB 5J1ZA 3UI2A 3S15H 3QO2A 1LUZA 3C1EA 2Q2HA 4QY7A 3V05A 3NTHA 1BBXC 1UWVA 1KC8C 4BXXG 2WKCA 3GQBA 1EWHA 2ICEC 2MFIA 3KLSX 3R93A 2WACA 1STAA 1Q90A 2LMCB 4DUYL 3S16B 4X6AH 1S4ZA 3PIPA 3KF6B 1WD1A 1YHBA 4N9TA 1ENCA 3ER0A 1SYEA 2R93B 3S1QB 4A3FH 5J3BA 3J80L 3K0YA 4C3IH 4LMQD 4DV2Q 5HURA 3OMCA 4ID6A 3FDTA 3V96A 3BJUA 1STHA 3C2PA 4V0BA 2WKDA 3K81C 3QG1A 1PH7A 1CQFA 3NQTA 2F0DA 5FO8B 2PQEA 2CWAA 2WIIB 1XYIA 2HHHL 1HZBA 4ME5A 2MO0A 2Y0SB 3DLLA 5COYA 4HMJA 3S9WA 5IYBH 3VR2A 3ND9A 2VUMH 1D7QA 3AB9A 2KVMA 2FHTA 1Q8IA 2MO1A 1KRTA 1DYQA 4CDCC 3H3VC 5CORA 1ZKOA 5A2QE 3M9BA 1H9RA 2AUKA 4DF7A 4L8JA 1TT2A 1O7LA 3BZDB 4JVZA 4ZRZA 1TIID 4N9PA 4OX9L 3SXHA 1YVCA 2F0EA 3GTQH 1WD0A 1LTSD 3G6JB 5F2DA 1JJ2A 2NWGA 1SAPA 4XT1B 3S2DB 5K36G 3AYHB 3HKZB 3T53B 1AW7A 1XJVA 1X9NA 5IP7G 1CSQA 1UEBA 2C9OA 3K58A 4B3MQ 3NE5B 2PMZE 2WB1B 1K3BC 1FVIA 3LWEA 1GUSA 1X32A 4KY5A 1HTPA 4I65A 3MC0B 4DV3L 3DEPA 4YY3L 3TZDA 1B2TA 1WTRA 1M4VA 1LT4D 3TS2A 4NP5A 3VDYA 4AYBG 2Z4IA 3PMFA 3HKZE 2K6AA 4LF7Q 3ZYYX 3MAQA 2PZTA 1Y1WH 4A3FB 3PO3H 5C4HA 2BH8A 2KENA 3J7ZC 3SEBA 1QNUA 3GTKB 4IURA 1GOZA 4YIJA 4Q5VA 3FRPB 3HZXA 2HIXA 3ERSX 4N8FA 1BCPF 4OHJA 3EJIA 1BO0A 3SK6A 5E7NA 1G6PA 1HQRD 1GJXA 1WTHA 1PFNA 2EYJA 4GN3B 1TQOA 4DK0A 5FJ8G 1Y1WG 1Y1VH 4DV3Q 1EEFD 4YCUA 3AMUA 4B3RL 1TWAB 5K5PA 3A56A 1BQQT 4CJ0B 2CHBD 3D6WA 1HTLD 1I4QA 1R9TH 3BDCA 4B3TL 2F0IA 2R7ZB 2K5VA 2CW0C 1Q46A 1H9SA 2R7FA 1N34L 1KDCA 1TU2B 3EBEA 4P72A 1C0AA 3GV3A 4A3GG 3RLOA 1LLRD 1SFOH 2ASBA 1BDOA 3OOCA 4KKTA 1YBYA 3CXCA 1UEAB 4OWXB 5C0XJ 4K5WA 3RN5A 4RGMA 3NEMA 1PMRA 1TWCH 3AEVA 1LTRD 3S14B 4HTHA 4GNXA 4GOPC 1A0IA 3HOXB 2PNHA 4A93B 2KA7A 3J7AF 4X66L 2ZM6L 3PGZA 1RIPA 1Q3LA 3KDFB 4LF7L 1U4RA 3I56A 2ZXRA 3U4VA 3KOJA 1XNRQ 2R6GA 2CH4A 4JI4L 2PZWA 4FF2A 4DV6L 1B9MA 2ALYB 2K4KA 3CRKC 2AUJD 1A2UA 5EJWA 2KCCA 1CQVA 2B2VC 3DWQA 3S1MB 3TRZA 1L1OC 4ILWA 2C35B 1PDQA 3Q8DA 5CYUA 4J6HA 2ICIA 4GNXC 1BOSA 2HDLA 4R4OA 4H0LC 3FKIG 5I6WA 3RN2A 3HS0C 3E0EA 4IPCA 2GA4B 4A3EB 1AN8A 1VQFA 1CKNB 2R61A 2FXQA 3K5LA 4DR1Q 4B3SL 3K5OA 1KDBA 1MJEA 3CQZB 2WB1G 1EIHA 2JK8A 1UE7A 4KV6A 2SDFA 2F0NA 4LF8Q 1KABA 3GTGB 5JJLA 4DK1A 1O7ZA 2LKVA 1JWMD 1TWHB 4YHHQ 5CV6A 4BY1H 3PCOB 4LW1A 2E5LQ 4B3TQ 2V1CC 1PLFA 1SJED 5LMNW 3TEHB 1OXUA 2JA7B 2A69D 3H91A 4PZ6A 3OIPA 5C4XG 4UPAA 1QVFA 1YJWA 1OXSC 4XYOA 2N55A 1D5ZC 3NSWA 4MHEA 1N32Q 1WFQA 2Q2TA 5G3LF 3J81L 4JI1L 1IXRA 1I5FA 1DXMA 4OWTB 3DUZA 1K8AC 1AFPA 1EL0A 4A3KB 3OHXC 1GUWA 5KNCA 2YTVA 2EYPA 3RD4A 1YHQA 5I6YA 3RZOB 1E7ZA 2L0CA 4LWCA 2PO4A 1XPRA 4LF4L 2RKSA 5EGTA 5JEAH 4GLAC 4A3BB 4ULLA 1RF2D 1EOTA 4IUQA 1AEXA 1HJPA 2UXBL 1E1TA 4CDFC 5ELOA 5IODA 2E2DC 3TREA 2PW7A 2B3GA 3U50C 1EUJA 1TWHH 1RD9D 4LF5Q 3QR8A 3N6RA 1RJTA 4UDUC 2NVQB 2F3IA 3UE0A 3RZOH 5JEAJ 2LXKA 1PTOC 1XX8A 2X6GA 1GUTA 3R2IA 1OTCA 3J80c 4CJ2C 1KL9A 3TS0A 4DXFA 4LF9Q 1RDPD 1SNPA 4IPHA 2EXZA 1NTGA 4A3DB 1ENAA 4IUTA 3H0GH 2RCFA 3VYSA 3BS1A 5IGCA 1PXUA 4DAYA 1IL2A 2B2WC 4M8AA 4QIWB 1B53A 1VQHA 2I46A 3SK8A 4LUOA 3CF5A 3MEFA 5E4XA 2JP1A 3QB3A 2OF1A 4A75A 4DU9A 1UAPA 2XWBB 4JC0A 1EY9A 4KY7A 3VA7A 1KNEA 3KF6A 4G7OC 4BY1B 1D8LA 2KQ3A 2NZOA 4K14A 5C4JH 4YWLA 2MQHA 5EKLA 5FLXE 3K6OA 1WTWA 3F2BA 4BA2I 5KYIA 2JQOA 5DEHA 3NBIA 1FL0A 1JB7A 1MD2D 3U4ZA 3C1FA 3VYTA 3Q0AA 4WJ3M 3T13A 4JI3Q 2XWJB 1SE3A 2V4DA 1VQBA 5LL6S 2HQLA 1AZQA 1QOHA 4GNXB 1NMFA 3PF5A 4HIMA 5IOCA 1TWCB 1IW7C 3G71A 4PZ7A 1ICFB 3NPPA 2E75C 4DR2L 4GOPB 3URYA 2Z9HA 4U673 2EDGA 2BE5C 1AH9A 3GTJH 3VR6A 2XGTA 3S1MH 4A3JG 3TQYA 2GN5A 4ZK9B 3ULJA 4QUFA 5IIFA 1VQOA 1EY8A 2CKZB 2QF7A 3WDNA 3S1RB 4PG3A 4H7BA 1KD1C 2ZT9C 5C3XA 1ASYA 2ZXPA 2EYMA 2JA8G 1E2VA 1I4PA 3A7AB 4F8MA 4DN4M 1NAPA 2K1BA 3PF4A 3I4MH 2IX3A 5KNBA 3L0OA 2IY5B 4ABNA 3HGBA 1VQLA 5IWAQ 1FGUA 3AU7A 5GADC 1SNDA 5C44G 3E3XA 5C3EG 2EJGC 2UUBQ 1WCMG 3M7GA 5AJ3Q 3A8KE 5GROA 2ENBA 5DLQE 1F2YA 3X3MA 5I9PA 4QJFA 2BH2A 1B1ZA 4NW2A 1J8IA 5ISRA 4JI6Q 4F7XA 2F4IA 4JK1C 3KF8B 3GTKH 1Z6HA 3PO3B 5M9OA 1LO5D 1SMYD 4FP5D 1JORA 1M8AA 4OO1G 3U9OA 4Y7NH 2ZTEA 2RA4A 4AQYL 4QL5A 2KCMA 2A5HA 3C46A 5FOBB 1WTPA 1BVSA 1V1PA 2L1BA 4JI2Q 3SK5A 4DNTB 1XXGA 1MKHA 1PTOH 3A0JA 1Y8NB 3P20A 1TVXA 1HNWL 1TWFB 2I07B 1S5BD 5C4XB 2XVSA 2X6LA 3UDFA 1OXTA 1UE5A 5DM63 3HP3A 3CMAA 2Z6BA 3HOVB 1FYCA 2JXMB 4POFA 4BY7B 4JI8Q 1XPOA 4NMZA 5JAVA 4TSSA 1EIYB 4C3HG 2PI2A 1PZID 5C3WA 5C0XI 2D0OA 4B9WA 4DR7L 3A5ZB 3QJYA 1UUPA 2H4OA 1JOOA 4YWMA 2A6HC 3RMHA 3I72A 1SMYC 1TR5A 4G7HC 3K7AH 1CKNA 1EYCA 2MJ8A 2LS01 1IL8A 2VNUD 4LAAA 1SYFA 4RHRA 2J4XA 1QZGA 5EKIA 3UDIA 2WAQG 1ONLA 3CRLC 1X56A 5IE8A 4DR3Q 1GHKA 5ELNA 4NXNL 1S5FD 4RCOA 1D2BA 5FLMH 3GTQB 1HH2P 2A68C 3S1QH 4QB4A 3F8TA 1JJCB 2ATWA 1CHPD 1KIXA 1IBMQ 3S16H 4MN3A 4LF5L 1VQMA 4JW0A 4MZ9A 3J81c 1F2LA 2A6ED 1QUQB 4O2DA 4G4KA 4IUNA 4KKSA 3K7AB 4RCNA 4ALPA 2K5HA 2B29A 4LFCL 1HNWQ 4NXNQ 3CHBD 4DR3L 2NTSA 3B6YA 4A3CH 3IL8A 4HAEA 3K5MA 1PHJA 1TKWB 4RHSA 4PMCA 1W2BA 1A62A 3DM1A 1IHZA 1NNXA 5CV9A 4NKLA 2VQFQ 5EPKA 3OMGA 4BY7H 2A6EC 5IYDH 1BKBA 5JJKA 1IYJB 3G48A 2IX1A 1STNA 4HN7A 1DONA 4EQNA 4K2LA 3TN2A 3H6MA 5KRUA 5M3MH 3HOUG 4DR4L 1KQSA 2A68D 1TWGH 1WYDA 5ELCA 1E3PA 3KLRA 4PMWA 4GKJQ 5EKKA 4JYAL
chains in the Genus database with same CATH topology
2BCOA 4DGZA 1CT1D 1PTOB 1CM9A 5CMDA 3S15B 2B2UA 3VR5A 2DN8A 3I4MB 4IFDI 3SDZA 4U68A 1IYVA 2SOBA 2EY6A 2A6HD 2SNSA 4CKCA 2EY1A 1GUNA 1ICWA 4A3GB 1BCPB 1OXVA 2F3VA 3M85A 2ZXOA 4OO1H 2B2YA 3SR1A 3NP8A 5IGEA 1W6JA 1A3UA 2RSOA 1CA5A 2O4XA 3NWTA 2ID0A 1U4MA 4PMBA 4QUCA 1TS4A 1CHQD 1U4PA 2EE1A 3DHQA 1HUMA 2OXPA 4FF3A 1HFNA 3A8IE 3N52A 2EVBA 2KECA 1A2TA 4XYQA 3Q6SA 1HQMC 1SNMA 3HG9A 2F3WA 2NYZD 4BBRB 4HMIA 4G7ZC 3OIQA 1Q12A 1NUCA 1SBBB 2LFNA 2F0OA 1BXTA 3I8ZA 5BN5A 3W3AA 2XRQD 3E6ZX 3T51B 4FF4A 5C4JB 4K5XA 1SYDA 3CKIB 3GTMB 2NTTA 4RGOS 4FXDA 1NSNS 5CV4A 2F0LA 3NTKA 5BN3A 1MSHA 3PO2B 4IFDJ 4PV1C 1JE4A 1EU4A 2F0HA 2NBFA 3MA2B 1PZKD 2C5CA 3HEJA 1QCBD 2K28A 5C44B 4M1UB 4CKBA 1IW7D 1HCZA 5IGGA 3E0JA 4IUPA 4CKEA 1Z7TA 2K04A 1GXDC 4XQQA 3GV6A 1H9SB 5C6AA 4KMUC 2NN6H 3OW7A 2RSNA 2G9HD 4O1NA 3NHHA 4CBVA 4R8NA 3TP5A 2B39A 5T1GA 2PYKA 2AQ3B 3EROA 1CA6A 2PCFB 5E4WC 4RA8A 4B9XA 3EVQA 4Q0FA 2QEJC 2KOLA 1DD2A 3TP6A 1EY4A 2FMCA 3FVQA 3VR4A 4KN7C 3TP7A 4X3SA 4OIKA 5JVG3 2BA0A 3HOUB 1SYCA 4GZYC 1L0XB 5A35A 5LHY1 2B2WA 5ELDA 2L12A 3BVMA 1D6EC 1I3QB 3PV0A 4UAIA 1S5ED 1GUOA 1E0BA 5C4ZA 1D5MC 1LTBD 2Z4HA 3K59A 2JA5B 3PUZA 4F87A 4J1MA 5M5WB 5C5LA 2SNMA 4H44C 2E76C 3FPPA 3PUYA 2MUYA 2AQ1B 5J39A 4KJOA 4IZ8A 4C3JG 2F0WA 4FO2A 2F0JA 2M9VA 2YYZA 4XQJA 3NWSA 2NZ1D 1U9RA 3LWUA 1FNWA 1TY0A 2BDNA 2JA6B 4O42A 1O78A 1EFID 5C3EB 2D9UA 1RCVD 5EQ0A 1CZGA 1G8ZD 2R3ZA 1TWGB 4I7ZC 4LJZC 5CV8A 5I2YA 1LT6D 5M3MB 1I4XA 4KKUA 4KD3A 2PW5A 2M00A 1G6ZA 1LT3D 5JPMC 1TS3A 1F77A 1EU3A 2EY5A 1C4QA 3L9AX 1EY6A 1JQYD 2RQXA 5EPLA 4IN3A 4EQPA 1LTTD 3HRZC 1SNCA 1FNVA 1VDZA 4E6IA 3D4DA 3I91A 1YNND 3JAML 1A3VA 4KN4C 4IFDG 3D31A 1EY7A 3M3YB 2K5QA 5IGFA 1EIGA 3U9SA 1QWYA 2QILA 1QG7A 5BN4A 1DJRD 3I4NB 1AZPA 1F9QA 3PUVA 3R8BA 4K5VA 2F03A 3TZUA 2TSSA 5T1IA 5CBAE 5FLXL 1G2SA 1F2ZA 3KK7A 4XT3B 1HFGA 1PRTC 1WTQA 4IUVA 3ITPA 3RUZA 2JEBI 3BYYB 3T4AC 1HRJA 1DOKA 1RTOA 3C3LA 5IGDA 1ET6A 4DA2A 3IFTA 4XQNA 1KTKA 4J8QA 4R9WA 1D5XC 3DWPA 2MGSA 4C3JB 1B4OA 1KNAA 2F0GA 2KJXA 1V1OA 3MEHA 1MBYA 5ELBA 4X3KA 4ZUIA 3FEWX 5JVH3 4PQXA 4DAVA 2XSCA 3BVZA 1HUNA 4F88A 3A8JE 4WORA 1XTCD 1LTID 2DNCA 1EQTA 1T5EA 1QJOA 1I50B 2NUCA 1E2WA 2E74C 2EYOA 1T5XD 2A74C 3I90A 3EQLC 3MXGA 1IKMA 1BR9A 4QMGA 3RLFA 1O7YA 1SYGA 4Y7NB 2IWHA 5M5YB 2IPKD 3I70A 3MXUA 2VXWA 3PIP3 2JSOA 2K01A 3TDQA 2JA8B 4B08A 5AFWA 3X3NA 1EY0A 5IT9E 3J7AV 3SHLA 2HQEA 3S2HB 4DAPA 5EPJA 3MWYW 3NK9A 3BG3A 4CJ1B 1HXYD 1I4GA 4RKBA 1FGBD 2F0VA 3Q22A 1B44D 1EYAA 2B2VA 3ERQA 3IFDA 1JCKB 1WCMB 4XDXA 4X3UA 1ILPA 2TMPA 1EY5A 5KEEA 2MHVA 2IT1A 5G3LD 4WJWA 2KCNA 2F0FA 4OIJA 1JWUD 1YNNC 2BDOA 1HA6A 3P1HA 3TP8A 5KNDA 2K7VA 5JJZA 1F9PA 3GTJB 4FXKC 1VCIA 1SYBA 3VR3A 5D3DA 2D62A 4KK7A 4MIUA 3LNNA 3FPUB 3H0GB 1STBA 4KHVA 3I3CA 4C1NI 1II3A 1LABA 2YU9B 2CQAA 3SK4A 2F0TA 1YNJD 3PUWA 2XRSD 4NDXA 3BDLA 4C3HB 5JPNC 1KAAA 3S1NB 1MSGA 4DNRB 1CK1A 1E2ZA 4QF4A 1K83B 4A3IB 3D3RA 2KUMA 3ND8A 5KYLA 1C48A 1Y8PB 1FD7D 2EJFC 1Y69U 1TS2A 3TBIB 2RDGA 3A7LA 2L55A 1JR0D 5FO7B 5CGKA 1BCPC 4RFBA 1EQVA 2FINB 4C1NK 1DCZA 1JC7A 1ML0D 4OO1I 2XNAC 3D4RA 4HSVA 1LACA 1S5CD 1HHVA 2JE6I 4ZLTF 3MFGA 1H9KA 1V8QA 3M4OB 2RVLA 1PFBA 2F0PA 4FVMA 2F0QA 4RWSC 5K36H 3HOZB 2EY2A 4BS9A 2Z1CA 3OWFA 1QE6A 3SVMA 2L4NA 4PNYA 2PMZB 3H94A 3DMUA 3S17B 1STYA 3A55A 1PTOF 2D2CC 1DOLA 3VYRA 5FO9B 1WVLA 1SNOA 4KI0A 1I4HA 4CGYB 2K33A 2OEOA 5KGUA 1ZYRC 2KHSA 3E5SA 1BF4A 1RTNA 5IT9L 3GD7A 3J81E 1K8OA 5E3FA 1ILQA 2FFKB 2K32A 1ET9A 1JWSD 1KLGD 3NBHA 5FKAC 3BDOA 5ELFA 1BNZA 2QKIC 3SE0A 5TSSA 4OGQC 3MVVA 3H09A 2B2TC 1SSOA 2MP1A 2LY7A 1F9SA 3KUPA 1QNKA 2B8GA 2VB3X 2NVXB 2HCCA 4ZKBB 4P2CB 1Q1EA 4R8IA 1VF7A 1QB5D 1G2TA 2G9DA 4LK1C 3JAME 3KBXA 3MZ5A 1B9NA 1CI3M 1V43A 1I6VC 3OSOA 2E2JB 2L5TA 3TSSA 1HPCA 2O2LD 5C0XG 1IKLA 1X3PA 1R9TB 1Y1WB 4ZQ3A 4BBSB 3IKJA 1LT5D 2NB0A 5CBEE 4XIGS 5CR3A 1G91A 1LV9A 1Y1VB 2IJ0A 1TY2A 1A15A 2WAQB 2NN6G 3A54A 3TMEA 2KEDA 3VA5A 5I9OA 2B8FA 1Y8OB 4L63B 1I6HB 2JYOA 3LX0A 4WRDA 4FNFA 3I73A 4BWGB 3D4WA 1W6KA 3KF8A 4TRDA 2OT2A 4BA1I 1VF5C 1VMCA 4A3MB 1Q1BA 1PFMA 2EYFA 1I4RA 3J80E 2WINB 3MXPA 5ELEA 1XWEA 3R3OA 3O13A 5KIXA 3RZDB 2NN6I 5CC4A 1HA5A 1R4PB 1F9RA 3GP7A 3KBGA 2SEBD 4S3SA 1ENFA 2IL8A 3CU7A 2WV6D 1GHJA 3ONAB 4C3IB 4X3TA 5FK9C 3MXNA 2J7ZA 4KD4A 1C8CA 2AQ2B 5JOBA 2VUMB 3NTIA 1A3TA 1WTOA 2M2LA 1RHPA 5D3IB 3NQIA 2Q8TA 4TKOB 3WOFA 1ESFA 2FMMA 3M7NA 2F0MA 5IGBA 1CFMA 1LTGD 1EZ6A 5EBDA 3V2TA 1IYUA 4EQOA 4KHZA 5CV7A 1RKNA 3Q23A 2VB2X 1MGSA 2AWNA 3KLSA 1G291 1ZYRD 4L6TB 3FMCA 1CZWA 4DXGA 2B2YC 1WTXA 4K2KA 1OO9B 4ZKCB 5NUCA 4IALA 5JEAG 2DY7A 5DAUA 5I4DA 1X3QA 3GO5A 5D65A 3P7JA 2NVTB 2MPMA 4IUUA 2D5DA 4K8JA 1H9MA 3WOEA 2R92B 1S5DD 3VYUA 2XN9C 3GTPB 1O80A 1PTOD 4KTAA 2DY8A 5DNFA 2NVYB 2AWOA 1KDAA 1ZEQX 1SE2A 3GTLB 2FJ2A 4AYBB 4K6LA 2O5JC 1L0YB 1EYDA 1D1IA 1Z47A 4HSPA 4KY6A 1ESRA 2K03A 1LTAD 2Z8LA 4IFDH 3PIO3 1FR3A 4HCSA 4KJNA 1PYWD 4K8IA 4HR7B 3QOJA 4FF1A 4WFN3 3Q24A 1K8MA 2EOTA 5A2QL 4EVOA 4ODGA 4ZAIA 1DOMA 2RDFA 4A3JB 2Q8IB 3QWNA 1EWCA 4H13C 4RAUC 2PPBC 5C5MA 1STEA 4JBWA 4Z9CB 1PRTF 2J0TD 3W2DA 4XTCS 3GTOB 2RDHA 1B50A 3M4YA 3R2TA 1JOQA 2IW3A 1CTMA 1DZ1A 3EFXD 3L7ZC 3I4LA 3BVGA 2B2UC 3DEOA 5HGTA 1MI2A 1NR2A 1OXXK 2F0SA 4RKLA 1PRTB 3K5NA 1NR4A 4K6DA 3HOYB 2BE5D 3MTSA 2L9HA 1EEID 3PUXA 1VMPA 4IQZA 3J7YW 5I2XA 3D8GA 5LL6X 2K05A 2EZVA 2CVRA 1QILA 5M3FB 3DXJC 2HCIA 3OPOA 4RGTA 2XIWA 4C2MB 1STGA 4DFAA 4HEDA 1AP0A 2BOSA 3OWEB 2KEEA 3K57A 2H1EA 1PZJD 5C0XH 4C56C 2F0KA 3T56B 5M5XB 3MHBA 1DM0B 2RBMA 1H9JA 5J22A 1EZ8A 2EPBA 2F0UA 2CW0D 4QCLA 4CHTB 1SJHD 4XXEA 1R4QB 2A73B 1KLUD 1WTVA 2EJMA 2O5IC 1J9OA 5D14A 3IAYA 2HDMA 2E2HB 2B63B 2Q8RE 4V190 3G7LA 3FKIB 2K5WA 3D6CA 1JB3A 1F2MA 3NXWA 3DWAA 5DM73 2BA1A 2L11A 5CV5A 1FNUA 2JEAI 1SXTA 2IX0A 2F1MA 1BCPD 4TQUS 2WP8J 4FYDA 2QDBA 3P75A 3NUCA 2DNEA 4ZUJA 3F2UA 2K5DA 3T16A 4C3IG 1UNSA 3L3OC 1SEBD 1RODA 2A69C 2B2TA 1BUVT 3QOLA 4G57A 4RH6A 1SNQA 1V1PB 4OL7A 5EBCA 4EGVA 1TS5A 1YNJC 4FXGC 1JOKA 2QCPX 2HUGA 2E2IB 2PNRC 2EYHA 1NCVA 1B3AA 1SE4A 1SFOB 1D1KA 3EA6A 2X69A 3MFYA 1GUGA 2PZUA 4RGNA 3BYTB 1SDFA 1JICA 2N88A 1ZXTA 5E1FA 4ZYSA 1A6XA 2EYLA 1PRTD 1U4LA 4HCEA 3QIAA 3HOWB 5J1ZA 3UI2A 3QO2A 3C1EA 3V05A 3NTHA 1BBXC 2WKCA 3GQBA 1EWHA 2ICEC 3KLSX 3R93A 2WACA 1STAA 1Q90A 2LMCB 3S16B 1S4ZA 1WD1A 4N9TA 1ENCA 2R93B 1SYEA 3S1QB 3J80L 3K0YA 4LMQD 5HURA 3OMCA 4ID6A 3FDTA 3V96A 3C2PA 1STHA 4V0BA 2WKDA 3QG1A 1CQFA 2F0DA 3NQTA 5FO8B 2PQEA 2WIIB 1XYIA 4ME5A 2Y0SB 5COYA 4HMJA 3S9WA 3VR2A 3ND9A 2KVMA 2FHTA 3AB9A 1Q8IA 1DYQA 3H3VC 5CORA 1ZKOA 5A2QE 1H9RA 2AUKA 4DF7A 4L8JA 1TT2A 1O7LA 3BZDB 4ZRZA 1TIID 4N9PA 3SXHA 2F0EA 1WD0A 1LTSD 3G6JB 5F2DA 2NWGA 1SAPA 4XT1B 3S2DB 5K36G 3HKZB 3T53B 1AW7A 2C9OA 3K58A 3NE5B 2WB1B 3LWEA 1GUSA 1X32A 4KY5A 1HTPA 4I65A 3MC0B 3DEPA 1B2TA 3TZDA 1WTRA 1M4VA 1LT4D 4NP5A 2Z4IA 3PMFA 2K6AA 3ZYYX 3MAQA 2PZTA 4A3FB 5C4HA 3GTKB 3SEBA 1QNUA 4IURA 1GOZA 4YIJA 4Q5VA 3FRPB 3HZXA 1BCPF 4OHJA 3EJIA 1BO0A 3SK6A 1HQRD 1GJXA 1PFNA 2EYJA 1TQOA 4DK0A 1EEFD 3AMUA 1TWAB 5K5PA 3A56A 1BQQT 4CJ0B 2CHBD 3D6WA 1HTLD 1I4QA 3BDCA 2F0IA 2R7ZB 2CW0C 1H9SA 1KDCA 1TU2B 3GV3A 1LLRD 1BDOA 3OOCA 4KKTA 1UEAB 5C0XJ 4K5WA 4RGMA 1PMRA 1LTRD 3S14B 4HTHA 4A93B 3HOXB 2KA7A 3J7AF 1Q3LA 1U4RA 2ZXRA 2R6GA 2PZWA 4FF2A 1B9MA 3CRKC 2AUJD 1A2UA 5EJWA 2KCCA 1CQVA 2B2VC 3DWQA 3S1MB 4ILWA 1PDQA 5CYUA 4J6HA 2ICIA 1BOSA 2HDLA 4H0LC 5I6WA 3HS0C 2GA4B 4A3EB 1AN8A 2R61A 3K5LA 3K5OA 1KDBA 3CQZB 1EIHA 4KV6A 2SDFA 2F0NA 1KABA 3GTGB 4DK1A 1O7ZA 2LKVA 1JWMD 1TWHB 5CV6A 1PLFA 1SJED 1OXUA 2JA7B 2A69D 3H91A 3OIPA 1OXSC 4XYOA 2N55A 1D5ZC 3NSWA 4MHEA 5G3LF 3J81L 1DXMA 3DUZA 1AFPA 1EL0A 4A3KB 3OHXC 1GUWA 5KNCA 2EYPA 3RD4A 5I6YA 3RZOB 2L0CA 2PO4A 2RKSA 5EGTA 5JEAH 4A3BB 4ULLA 1RF2D 1EOTA 4IUQA 1AEXA 5IODA 2E2DC 2PW7A 1RD9D 3N6RA 1RJTA 4UDUC 2NVQB 5JEAJ 1PTOC 1XX8A 2X6GA 1GUTA 3R2IA 4CJ2C 4DXFA 1RDPD 1SNPA 2EXZA 4A3DB 1ENAA 4IUTA 3VYSA 3BS1A 5IGCA 1PXUA 4DAYA 2B2WC 4M8AA 4QIWB 1B53A 2I46A 3SK8A 5E4XA 2JP1A 2OF1A 3QB3A 4DU9A 1UAPA 2XWBB 1EY9A 4KY7A 3VA7A 1KNEA 4G7OC 4BY1B 2KQ3A 4K14A 5EKLA 5FLXE 3K6OA 1WTWA 4BA2I 5KYIA 5DEHA 3NBIA 1MD2D 3C1FA 3VYTA 3Q0AA 3T13A 2XWJB 1SE3A 2V4DA 5LL6S 1AZQA 1QOHA 5IOCA 1TWCB 1IW7C 3NPPA 2E75C 3URYA 4U673 2EDGA 2BE5C 3VR6A 4ZK9B 4QUFA 5IIFA 1EY8A 2QF7A 3WDNA 3S1RB 4H7BA 2ZT9C 5C3XA 2ZXPA 2EYMA 1E2VA 1I4PA 3A7AB 4F8MA 4DN4M 1NAPA 2K1BA 2IX3A 5KNBA 4ABNA 3HGBA 3AU7A 1SNDA 2EJGC 3M7GA 3A8KE 2ENBA 1F2YA 3X3MA 5I9PA 1B1ZA 4NW2A 1J8IA 5ISRA 4F7XA 2F4IA 4JK1C 1Z6HA 3PO3B 5M9OA 1LO5D 1SMYD 4FP5D 1JORA 1M8AA 4OO1G 3U9OA 2RA4A 2A5HA 3C46A 5FOBB 1WTPA 1V1PA 2L1BA 3SK5A 4DNTB 1XXGA 1PTOH 1Y8NB 3P20A 1TVXA 1TWFB 2I07B 1S5BD 5C4XB 2XVSA 2X6LA 1OXTA 5DM63 3HP3A 3HOVB 1FYCA 2JXMB 4BY7B 4NMZA 5JAVA 4TSSA 4C3HG 1PZID 5C0XI 5C3WA 4B9WA 3QJYA 1UUPA 2H4OA 1JOOA 2A6HC 3RMHA 3I72A 1SMYC 1TR5A 4G7HC 1EYCA 2MJ8A 2LS01 1IL8A 2VNUD 4LAAA 1SYFA 4RHRA 2J4XA 5EKIA 1ONLA 3CRLC 1GHKA 1S5FD 4RCOA 1D2BA 3GTQB 2A68C 4QB4A 1CHPD 4MN3A 1F2LA 2A6ED 4G4KA 4IUNA 4KKSA 3K7AB 4RCNA 3CHBD 2NTSA 3IL8A 4HAEA 3K5MA 1TKWB 4RHSA 4PMCA 3DM1A 1IHZA 5CV9A 4NKLA 5EPKA 3OMGA 2A6EC 2IX1A 1STNA 4HN7A 1DONA 4EQNA 4K2LA 3TN2A 3H6MA 5KRUA 2A68D 5ELCA 3KLRA 4PMWA 5EKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYD A;  4K5X A;  1ENC A;  2LKV A;  1SYE A;  3C1F A;  5CV5 A;  3SK6 A;  5CV6 A;  4DGZ A;  4NDX A;  3BDL A;  3T13 A;  1KAA A;  5C5L A;  4K5V A;  2SNM A;  2EYJ A;  4NMZ A;  1TQO A;  5JAV A;  5HUR A;  4QMG A;  1NSN S;  5CV4 A;  5IOC A;  2F0L A;  3OMC A;  4K2K A;  5KRU A;  4ID6 A;  1SYG A;  4QF4 A;  4B9W A;  1STH A;  5C3W A;  5HGT A;  2EYF A;  1F2Z A;  2QDB A;  5K5P A;  5J39 A;  2F0D A;  3NQT A;  3P75 A;  2PQE A;  1JOO A;  3NUC A;  4IZ8 A;  4IAL A;  3MXP A;  4KJO A;  5NUC A;  2F0S A;  2F0H A;  5KYL A;  4RKL A;  4ZUJ A;  2F0W A;  2EY6 A;  2SOB A;  5IIF A;  1EY8 A;  3ITP A;  4K6D A;  2F0J A;  5DAU A;  3BDC A;  3R3O A;  2F0I A;  3RUZ A;  1EY0 A;  2SNS A;  3MVV A;  1TR5 A;  4H7B A;  4ME5 A;  3T16 A;  3HEJ A;  2EY1 A;  2HQE A;  4HMJ A;  3SHL A;  5KIX A;  3S9W A;  5C3X A;  2F3V A;  1U9R A;  1EYC A;  2EYM A;  1KDC A;  5CC4 A;  4N9T A;  4K8J A;  5CGK A;  4LAA A;  4F8M A;  2EYP A;  3NK9 A;  1EQV A;  4DF7 A;  5I6Y A;  1SYF A;  5IGG A;  1TT2 A;  4RKB A;  3SR1 A;  2RKS A;  5EGT A;  3NP8 A;  4S3S A;  2F0V A;  3D8G A;  4K5W A;  4N9P A;  5IGE A;  1A3U A;  5IGD A;  3QOL A;  4G57 A;  4KTA A;  3SXH A;  1EYA A;  1AEX A;  3ERQ A;  1SNQ A;  2F0E A;  1KDA A;  4OL7 A;  2O4X A;  5C6A A;  5IOD A;  5F2D A;  4HTH A;  4PMB A;  2PW7 A;  4EQO A;  1SND A;  1JOK A;  4QB4 A;  1STG A;  1EYD A;  4DFA A;  2EYH A;  1EY5 A;  3NHH A;  5KEE A;  4KD4 A;  4R8N A;  3MZ5 A;  3DHQ A;  3TP5 A;  2F0G A;  2F0P A;  4KY6 A;  2PYK A;  5CV8 A;  2F0F A;  2F0Q A;  2ENB A;  2OXP A;  1F2Y A;  2F0K A;  5JOB A;  5I9P A;  3MEH A;  3OSO A;  2PZW A;  3ERO A;  4KD3 A;  2EY2 A;  2PW5 A;  1SNP A;  2M00 A;  3MHB A;  2RBM A;  2EXZ A;  4IUN A;  5ISR A;  2PZU A;  3OWF A;  4KJN A;  1ENA A;  4ZUI A;  4B9X A;  4F7X A;  4KY5 A;  1A3T A;  3EVQ A;  3P1H A;  3TP8 A;  5J22 A;  1A2T A;  4I65 A;  1A2U A;  1EZ8 A;  4K8I A;  4PNY A;  5IGC A;  3QOJ A;  4ZQ3 A;  2EY5 A;  5M9O A;  3DMU A;  1SNM A;  1EY4 A;  2F0U A;  3TP6 A;  1EY6 A;  1JOR A;  2F3W A;  1STY A;  5E1F A;  4J6H A;  4EQP A;  4ODG A;  4EVO A;  3TP7 A;  3SK8 A;  1SNC A;  2EYL A;  3U9O A;  4HMI A;  5CR3 A;  2RDF A;  2OF1 A;  3QB3 A;  4NP5 A;  4E6I A;  1SYC A;  3D4D A;  5I6W A;  4DU9 A;  5KGU A;  1SYB A;  4PMC A;  3PMF A;  5J1Z A;  1EY9 A;  1IHZ A;  1NUC A;  4KY7 A;  3C1E A;  5CV9 A;  3SK5 A;  4NKL A;  2F0M A;  4MIU A;  5IGB A;  2PZT A;  1A3V A;  5C5M A;  3OMG A;  3TME A;  5C4H A;  4WOR A;  3VA5 A;  1SNO A;  5I9O A;  1EY7 A;  2KQ3 A;  1EZ6 A;  4K14 A;  1KDB A;  3V2T A;  5IGF A;  5C4Z A;  5EKL A;  1STN A;  1STB A;  2OEO A;  4KHV A;  4YIJ A;  2F0O A;  4KV6 A;  2KHS A;  4K2L A;  3H6M A;  4EQN A;  3E5S A;  2NUC A;  2WAC A;  1STA A;  3LX0 A;  1II3 A;  2F0N A;  3D6C A;  3HZX A;  4WRD A;  5EKK A;  1F2M A;  1KAB A;  3NXW A;  1RKN A;  5CV7 A;  5DEH A;  5KYI A;  5E3F A;  3D4W A;  3EJI A;  1JOQ A;  3SK4 A;  4TRD A;  2F0T A;  4J1M A;  2EYO A; 
#chains in the Genus database with same CATH topology
 1UE1 A;  4LF9 L;  2BCO A;  5AJ3 L;  1SN8 A;  4DGZ A;  1CT1 D;  1PTO B;  1CM9 A;  5CMD A;  4DV1 L;  1XMQ Q;  2JA6 H;  3S15 B;  3K0X A;  2B2U A;  3VR5 A;  2DN8 A;  3I4M B;  1PH8 A;  2OWO A;  1L0W A;  4IFD I;  3K7U C;  3SDZ A;  4U68 A;  1IYV A;  2UXB Q;  4A3B G;  4MTK A;  4RMF A;  2SOB A;  2EY6 A;  2A6H D;  2SNS A;  4DR6 Q;  4CKC A;  2EY1 A;  1QZH A;  1GUN A;  1ICW A;  4A3G B;  1BCP B;  1OXV A;  2F3V A;  2K14 A;  1YEZ A;  3M85 A;  2ZXO A;  4OO1 H;  1Q86 C;  2B2Y A;  3SR1 A;  4DV7 L;  3NP8 A;  5IGE A;  1W6J A;  1A3U A;  2RSO A;  1CA5 A;  1J5E L;  4JI1 Q;  4DV0 Q;  3NEL A;  2O4X A;  1VQ7 A;  3NWT A;  2ID0 A;  1U4M A;  4PMB A;  4QUC A;  1TS4 A;  1QUQ A;  2ZJR A;  1H95 A;  1CHQ D;  1U4P A;  1EIF A;  4JI6 L;  2EE1 A;  3DHQ A;  1SE8 A;  2JA5 H;  1HUM A;  1VQ6 A;  4GOP A;  2OXP A;  4FF3 A;  4UP8 A;  1HFN A;  2VQE L;  3A8I E;  3N52 A;  3E9H A;  2EVB A;  2KEC A;  1E24 A;  2ZTD A;  2E2H H;  2HIV A;  1A2T A;  4XYQ A;  2OTJ A;  3Q6S A;  1HQM C;  1SNM A;  4GN4 B;  3HG9 A;  1CUK A;  2F3W A;  2NYZ D;  4BBR B;  3OTO L;  4HMI A;  4G7Z C;  1N34 Q;  3OIQ A;  1Q12 A;  1NUC A;  3EN2 A;  1SBB B;  1EQQ A;  4CDD C;  2AHO B;  4A3D H;  2N49 A;  2LFN A;  4B3R Q;  4K0K L;  1N9W A;  2F0O A;  4R1J A;  1BXT A;  3I8Z A;  5BN5 A;  2R93 G;  3W3A A;  2XRQ D;  3E6Z X;  3T51 B;  4FF4 A;  5C4J B;  1Q7Y C;  2B63 H;  4K5X A;  1SYD A;  1TXY A;  3CKI B;  4C2M H;  3GTM B;  2NTT A;  4RGO S;  4POG A;  2VL6 A;  2YV5 A;  4DKA C;  2DJG C;  4FXD A;  1V9P A;  1NSN S;  4GN5 A;  5CV4 A;  2F0L A;  3NTK A;  5BN3 A;  1MSH A;  1HR0 Q;  4R4Q A;  3PO2 B;  4IFD J;  5IYC H;  4PV1 C;  1JE4 A;  1EU4 A;  1S40 A;  2I5H A;  2F0H A;  2NBF A;  5C44 H;  3MA2 B;  2PQA A;  1PZK D;  2C5C A;  3HEJ A;  1QCB D;  2K28 A;  5M5X H;  5C44 B;  4DR6 L;  4M1U B;  4CKB A;  1IW7 D;  1HCZ A;  3PO2 H;  5IGG A;  3E0J A;  4APV A;  4IUP A;  4CKE A;  1Z7T A;  2K04 A;  3RNU A;  1IBK L;  1GXD C;  4AH6 A;  4XQQ A;  4AYB E;  3GV6 A;  1H9S B;  5C6A A;  4KMU C;  1I94 Q;  2NN6 H;  3OW7 A;  5M3F H;  3CCV A;  2RSN A;  3GTM H;  2G9H D;  1XMQ L;  4O1N A;  3ICE A;  3NHH A;  4CBV A;  4R8N A;  3TP5 A;  4YHH L;  2B39 A;  5T1G A;  2PYK A;  2AQ3 B;  3ERO A;  1CA6 A;  4P71 A;  2PCF B;  5E4W C;  1XMO L;  4RA8 A;  4B9X A;  3EVQ A;  4Q0F A;  2QEJ C;  3HOZ G;  2KOL A;  4NPS A;  3ZJY C;  1DD2 A;  4IPD A;  3TP6 A;  1EY4 A;  2FMC A;  3I4N G;  3H15 A;  3FVQ A;  3VR4 A;  2Q2U A;  4KN7 C;  3TP7 A;  2VQF L;  4X3S A;  4OIK A;  5JVG 3;  2BA0 A;  3HOU B;  4DAY B;  1SYC A;  4GZY C;  1L0X B;  5A35 A;  2K52 A;  5LHY 1;  3RR5 A;  2UUA L;  1A8V A;  3HOV G;  2B2W A;  5ELD A;  1RL2 A;  3HOY G;  2OTL A;  1VQI A;  2L12 A;  3BVM A;  4JOI C;  4C3H H;  4DV5 L;  3F2D A;  2OQ0 A;  1VS0 A;  1D6E C;  1I3Q B;  3PV0 A;  4UAI A;  3L2P A;  1S5E D;  1X65 A;  1GUO A;  1E0B A;  4DUZ L;  5C4Z A;  1D5M C;  1LTB D;  2Z4H A;  4MNO A;  3GTO H;  3K59 A;  2JA5 B;  3W1B A;  4GLX A;  5H1S E;  4HJ7 A;  3PUZ A;  4JI4 Q;  4F87 A;  4J1M A;  3GDE A;  4B3M L;  2P5Z X;  5M5W B;  3GTL H;  2CWP A;  5C5L A;  2SNM A;  4H44 C;  1GD7 A;  2E76 C;  1GO3 E;  1JT8 A;  5GAG C;  4A4I A;  3FPP A;  1Z9F A;  3PUY A;  2MUY A;  2AQ1 B;  4HIK A;  3GTP H;  4LF8 L;  5J39 A;  4JI5 L;  4KJO A;  4IZ8 A;  4C3J G;  2F0W A;  3NEN A;  4FO2 A;  3CME A;  2F0J A;  4KLK A;  2M9V A;  2YYZ A;  2JN4 A;  4XQJ A;  3NWS A;  2NZ1 D;  1U9R A;  3LWU A;  5HGQ A;  1FNW A;  1WOC A;  1EWI A;  1P8L A;  1B3Q A;  1TY0 A;  2BDN A;  3HOX H;  2JA6 B;  4O42 A;  1IBK Q;  4DPG A;  1O78 A;  1EFI D;  5C3E B;  2D9U A;  1RCV D;  1PYS B;  5EQ0 A;  1CZG A;  1G8Z D;  1PYB A;  2R3Z A;  1TWG B;  4I7Z C;  4LJZ C;  5CV8 A;  5I2Y A;  4X64 Q;  1LT6 D;  5M3M B;  1I4X A;  4KKU A;  4KD3 A;  2PW5 A;  2M00 A;  1G6Z A;  1LT3 D;  5JPM C;  1TS3 A;  3MXN B;  1N36 L;  2R7Z H;  3KJP A;  1F77 A;  1EU3 A;  2EY5 A;  1C4Q A;  3L9A X;  1EY6 A;  4YCW A;  1JQY D;  1PA6 A;  2RQX A;  1B8A A;  5EPL A;  4IN3 A;  4EQP A;  1N36 Q;  1LTT D;  3HRZ C;  1SNC A;  1FNV A;  1VDZ A;  4E6I A;  3D4D A;  4X65 Q;  2Y0S E;  3I91 A;  1YNN D;  3JAM L;  1A3V A;  4KN4 C;  4IFD G;  3D31 A;  1EY7 A;  4YY3 Q;  5GAE C;  3M3Y B;  2K5Q A;  5IGF A;  4EX5 A;  5IYB G;  1VQ8 A;  1EIG A;  1IBL Q;  3U9S A;  1SLJ A;  1QWY A;  2QIL A;  2RHQ B;  4QGU A;  1QG7 A;  3CCQ A;  4HJ8 A;  5BN4 A;  3J7A 5;  4C3J H;  1DJR D;  3I4N B;  1AZP A;  1YI2 A;  3S2D H;  1IZ6 A;  1F9Q A;  4OON A;  3E9I A;  3PUV A;  3R8B A;  4K5V A;  2F03 A;  3TZU A;  4A3D G;  2TSS A;  2KHI A;  2IHE A;  5T1I A;  3CPW A;  3D0F A;  4DNI A;  3KFU A;  3AQQ A;  4X62 L;  5CBA E;  5FLX L;  4A3M G;  1G2S A;  1S72 A;  1F2Z A;  3KK7 A;  4XT3 B;  1HFG A;  4DR1 L;  1PRT C;  4OEL B;  4LFA L;  2N3S A;  1WTQ A;  1MJC A;  4IUV A;  3ITP A;  3RUZ A;  2JEB I;  3BYY B;  3T4A C;  2GVB A;  2JA5 G;  3FHW A;  4A3L H;  1HRJ A;  3STB C;  1ASZ A;  1DOK A;  1RTO A;  5BR8 L;  3C3L A;  5IGD A;  1ET6 A;  4DA2 A;  5LMN L;  3IFT A;  1J5E Q;  4XQN A;  3CC7 A;  1KTK A;  1GKH A;  4J8Q A;  4R9W A;  3CW2 C;  1D5X C;  3DWP A;  2MGS A;  4C3J B;  4UY8 C;  4HIO A;  1B4O A;  1KNA A;  4JI3 L;  2F0G A;  1AE2 A;  2KJX A;  1HZ9 A;  3H0G G;  2VW9 A;  1NE3 A;  1V1O A;  3MEH A;  4DR5 Q;  1MBY A;  5ELB A;  4X3K A;  2EIF A;  4ZUI A;  2VUM G;  1XPU A;  4KHP L;  3FEW X;  5JVH 3;  4LFB L;  4NB3 A;  4PQX A;  4DAV A;  4AIM A;  3CPF A;  2XSC A;  3BVZ A;  1PH9 A;  4JI0 L;  1X6O A;  1HUN A;  4ME3 A;  4A3I G;  3H3V H;  4F88 A;  3A8J E;  4WOR A;  2R93 H;  3I4N H;  1S3O A;  1XTC D;  1I94 L;  4HJ5 A;  4A93 G;  5IYC G;  1LTI D;  2DNC A;  1EQT A;  4GKK Q;  1T5E A;  1BBW A;  1QJO A;  1WI5 A;  1I50 B;  1Y1V G;  2NUC A;  1VQJ A;  2I5L X;  1K8G A;  1TWF H;  1E2W A;  2E74 C;  1T5X D;  2EYO A;  2HD3 A;  2A74 C;  3I90 A;  3EQL C;  3MXG A;  1Q81 C;  1IKM A;  2F52 A;  1BR9 A;  4QMG A;  3I4M G;  3HOW H;  3RLF A;  1O7Y A;  1SYG A;  4Y7N B;  3WWV A;  2IWH A;  1EQR A;  1SRO A;  1YNX A;  2G5D A;  3STB D;  4JBK A;  5M5Y B;  2IPK D;  2DUD A;  3I70 A;  4LFC Q;  3MXU A;  2VXW A;  3PIP 3;  2JSO A;  4DK6 C;  2K01 A;  3DM3 A;  3TDQ A;  1HNX L;  4B08 A;  5AFW A;  3X3N A;  3JAM i;  2MNA A;  2JA8 B;  1EY0 A;  5IT9 E;  3W1G A;  3J7A V;  3SHL A;  2HQE A;  3S2H B;  2EXD A;  4DAP A;  5EPJ A;  2AKW B;  3MWY W;  3NK9 A;  3BG3 A;  4CJ1 B;  1HXY D;  5IP9 H;  1I4G A;  1PH5 A;  4IJH A;  4RKB A;  1FGB D;  2F0V A;  3CP0 A;  3Q22 A;  1B44 D;  3T1Y Q;  1EYA A;  2B2V A;  3ERQ A;  3IFD A;  5C3E H;  1JCK B;  1WCM B;  4XDX A;  1XNQ L;  3UDG A;  5M5W H;  4X3U A;  4BY7 G;  1ILP A;  2TMP A;  1EY5 A;  5KEE A;  2MHV A;  2IT1 A;  4JG2 A;  5G3L D;  2A8V A;  4WJW A;  2KCN A;  2F0F A;  1SR3 A;  3KYH C;  4H02 A;  4OIJ A;  1JWU D;  5IP9 G;  1YNN C;  2BDO A;  1HA6 A;  3S1R H;  3P1H A;  3TP8 A;  5KND A;  2K7V A;  1G51 A;  5JJZ A;  4JI5 Q;  4Y52 H;  1F9P A;  3GTJ B;  2GVA A;  1M90 C;  2YTX A;  1L2F A;  4FXK C;  1VCI A;  2CH4 W;  1YHA A;  4DR5 L;  4HID A;  1K9M C;  1SYB A;  4PZ8 A;  3VR3 A;  2K5N A;  2Z6K A;  1P16 A;  2LSS A;  2D62 A;  5D3D A;  5HY6 A;  2R7Z G;  2CCZ A;  3S17 H;  4KK7 A;  4MIU A;  1PH3 A;  1IBL L;  3LNN A;  3FPU B;  3H0G B;  4MTN A;  3A74 A;  1M1K C;  1HNZ L;  3HOZ H;  4A3L G;  1STB A;  1VQG A;  4KHV A;  3FKI H;  3HKS A;  3I3C A;  4C1N I;  1II3 A;  1LAB A;  2YU9 B;  2NVQ H;  2CQA A;  1FJG Q;  3M4P A;  3SK4 A;  1XNR L;  2F0T A;  1YNJ D;  3PUW A;  2XRS D;  4NDX A;  3BDL A;  4C3H B;  5JPN C;  1KAA A;  2Z6K C;  3S1N B;  1MSG A;  3CCM A;  4DV4 L;  4DNR B;  4DAM A;  4X66 Q;  1CK1 A;  4ZCK A;  2K50 A;  1E2Z A;  4QF4 A;  3HOU H;  3T1H Q;  1JJG A;  1K83 B;  4A3I B;  3D3R A;  2YTY A;  2KUM A;  3ND8 A;  5KYL A;  1C48 A;  1Y8P B;  1LYL A;  1FD7 D;  2EJF C;  1EYG A;  1Y69 U;  3PQI A;  2UXC Q;  2JA6 G;  3J81 i;  1TS2 A;  3TBI B;  2RDG A;  3A7L A;  2L55 A;  1JR0 D;  4L5Q A;  5FO7 B;  3BU2 A;  1BCP C;  5CGK A;  4RFB A;  1EQV A;  2FIN B;  4C1N K;  1DCZ A;  1JC7 A;  1ML0 D;  4DR4 Q;  5LMU L;  3M4O H;  2KCT A;  4OO1 I;  2UXD L;  2XNA C;  3D4R A;  4A3E G;  4HSV A;  2RHS B;  2JJQ A;  1LAC A;  1S5C D;  1AE3 A;  2CFM A;  3S1N H;  1HHV A;  2JE6 I;  4ZLT F;  3MFG A;  1W3S A;  1H9K A;  4JI0 Q;  1V8Q A;  2F4V Q;  3M4O B;  2RVL A;  2UU9 L;  1PFB A;  2F0P A;  2YU9 H;  4FVM A;  2F0Q A;  4QQB X;  4RWS C;  5K36 H;  2EY2 A;  3HOZ B;  4UP7 A;  4BS9 A;  2Z0S A;  4L5R C;  2Z1C A;  3OWF A;  1QE6 A;  4A3C G;  3JC6 6;  3SVM A;  4TVA B;  3AFQ A;  2L4N A;  4PNY A;  2PMZ B;  2WB1 E;  4R4C A;  3H94 A;  3U58 A;  3DMU A;  3S17 B;  1L1O A;  1STY A;  1NMG A;  3A55 A;  3CCU A;  1PTO F;  1E1O A;  1PH4 A;  2D2C C;  1WJJ A;  1N8R C;  2QW7 A;  1DOL A;  3VYR A;  2ZJQ A;  1LTL A;  5FO9 B;  5M3M G;  1WVL A;  1SNO A;  4DK3 C;  4KI0 A;  4LF6 Q;  1I4H A;  4CGY B;  2K33 A;  3GTG H;  2OEO A;  5KGU A;  1ZYR C;  2KHS A;  3K80 C;  3E5S A;  1BF4 A;  1RTN A;  1CSP A;  3GD7 A;  5IT9 L;  3J81 E;  4L5S A;  1K8O A;  5E3F A;  3CQZ H;  4QIW E;  4UP9 A;  4JI7 Q;  1ILQ A;  2FFK B;  2R7D A;  1K0R A;  1VQ9 A;  2K75 A;  4A93 H;  3HKZ G;  2K32 A;  1ET9 A;  1JWS D;  1KLG D;  3NBH A;  5FKA C;  4OWW B;  4JI7 L;  1L1O B;  5M3F G;  2DJF C;  2WFW A;  1XNQ Q;  3BDO A;  3CAM A;  5ELF A;  1BNZ A;  1XMO Q;  4LUV A;  2R92 H;  2QKI C;  4LF6 L;  5FJ8 H;  3SE0 A;  5TSS A;  2ES2 A;  4OGQ C;  4YWK A;  3MVV A;  1HR0 W;  3CC4 A;  3H09 A;  2B2T C;  1YZ6 A;  1SSO A;  4GKJ L;  2MP1 A;  4P75 A;  2LY7 A;  2PI2 E;  1F9S A;  4JBJ A;  5M5Y H;  3KUP A;  1QNK A;  3K8A A;  2B8G A;  5IP7 H;  2A19 A;  2VB3 X;  4A3F G;  2NVX B;  2HCC A;  4ZKB B;  2A1A A;  4P2C B;  1NBW A;  1Q1E A;  3LGJ A;  4R8I A;  1PH1 A;  4DV2 L;  4IOA A;  4JOI A;  1O7I A;  1VF7 A;  3NBH B;  4X65 L;  1QB5 D;  1G2T A;  2G9D A;  4LK1 C;  3JAM E;  3HOX G;  3KBX A;  3MZ5 A;  1B9N A;  2QGQ A;  1CI3 M;  1V43 A;  1I6V C;  3OSO A;  4A76 A;  4L5T A;  2NVT H;  4A3G H;  2RF4 A;  2E2J B;  2L5T A;  3TSS A;  1HPC A;  2XTI A;  2O2L D;  5C0X G;  1IKL A;  1X3G A;  1X3P A;  1R9T B;  5IY0 A;  2JA8 H;  1Y1W B;  4ZQ3 A;  1X3E A;  4BBS B;  1C9O A;  1NJI C;  3IKJ A;  1LT5 D;  1KHI A;  2NB0 A;  5CBE E;  4XIG S;  4RG1 A;  5CR3 A;  3F1Z A;  1G91 A;  1LV9 A;  1Y1V B;  2IJ0 A;  1UE6 A;  1PFS A;  1TY2 A;  2IHF A;  1A15 A;  2E5L L;  4NXM Q;  2WAQ B;  2NN6 G;  4N8X 1;  1KAW A;  3A54 A;  3TME A;  2KED A;  3VA5 A;  2JA9 A;  5I9O A;  2B8F A;  5IWA L;  1Y8O B;  4L63 B;  1I6H B;  2HT1 A;  4IPG A;  2JYO A;  3LX0 A;  1I50 H;  4WRD A;  5IYD G;  4OEM B;  1LM0 A;  4FNF A;  3I73 A;  4BWG B;  3D4W A;  1W6K A;  3KF8 A;  4TRD A;  2QA4 A;  2R92 G;  2OT2 A;  4BA1 I;  1VF5 C;  1VMC A;  3PO2 G;  4LFB Q;  1X54 A;  5FLM G;  1K28 A;  4A3M B;  1HZC A;  2E8G A;  1Q1B A;  3UDX A;  1PFM A;  1CKM A;  2EYF A;  1I4R A;  3J80 E;  2WIN B;  3MXP A;  1HNZ Q;  5ELE A;  1XWE A;  3PO3 G;  3R3O A;  3ULL A;  3O13 A;  5KIX A;  3RZD B;  1XTD A;  1VQA A;  2NN6 I;  1QVG A;  1IBM L;  2AMC B;  1HA5 A;  2PQA B;  5CC4 A;  1R4P B;  4LNQ A;  1F9R A;  1YJN A;  3GP7 A;  2I0Q A;  3ULP A;  3KBG A;  4DV0 L;  2SEB D;  4S3S A;  3IRB A;  4DUZ Q;  1U5K A;  1MHW C;  1ENF A;  2IL8 A;  3CU7 A;  2WV6 D;  5BR8 Q;  1GHJ A;  2L15 A;  3ONA B;  4C3I B;  4X3T A;  4JPB W;  5FK9 C;  5L37 A;  3MXN A;  2J7Z A;  2UUA Q;  4KD4 A;  3HOV H;  1C8C A;  2AQ2 B;  1C7Y A;  3CC2 A;  2F4V L;  2CQO A;  5JOB A;  3OTO Q;  1I6H H;  2VUM B;  3NTI A;  4IOC A;  3CCS A;  1VQK A;  3RZD H;  2JA7 G;  1A3T A;  1WTO A;  3KJO A;  2M2L A;  1RHP A;  3S24 A;  5D3I B;  1VQD A;  2LXJ A;  3NQI A;  1U0L A;  1K0S A;  1GVP A;  2Q8T A;  4TKO B;  3WOF A;  4A3M H;  1ESF A;  1PH6 A;  4UHV A;  2FMM A;  3M7N A;  2F0M A;  5IGB A;  1CFM A;  1LTG D;  1EZ6 A;  5EBD A;  3V2T A;  3J80 i;  2E2J H;  2ZTC A;  1V1Q A;  1GM5 A;  3J81 j;  1IYU A;  4EQO A;  4KHZ A;  5C4X H;  5CV7 A;  1RKN A;  3Q23 A;  2H5X A;  2VB2 X;  1MGS A;  2AWN A;  3M3Y H;  3KLS A;  1CKO A;  1G29 1;  1ZYR D;  3PIO A;  4L6T B;  2E2I H;  1VQN A;  3FMC A;  1CZW A;  4AQY Q;  2B63 G;  1K73 C;  4DXG A;  2B2Y C;  1WTX A;  4K2K A;  1N32 L;  3AFP A;  4BBR G;  1OO9 B;  2DGY A;  5EAY A;  4ZKC B;  5NUC A;  4IAL A;  5JEA G;  4GKK L;  4BBS H;  2UXD Q;  3M4Q A;  2DY7 A;  5LMU Q;  5DAU A;  5I4D A;  1X3Q A;  3GO5 A;  5GAH C;  5D65 A;  3P7J A;  2NVT B;  2MPM A;  4IUU A;  2D5D A;  4K8J A;  1H9M A;  3WOE A;  2R92 B;  4JYA Q;  1KRS A;  1J6Q A;  1S5D D;  3VYU A;  3G6E A;  2XN9 C;  2N78 A;  3A5U A;  3GTP B;  1O80 A;  1PTO D;  4KTA A;  2DY8 A;  5DNF A;  4BY1 G;  2NVY B;  2AWO A;  1KDA A;  4OX9 Q;  2Y0S G;  1ZEQ X;  4LUZ A;  4B3S Q;  1SE2 A;  3GTL B;  3T1H L;  4BBS G;  2FJ2 A;  4AYB B;  2NVX H;  4K6L A;  2O5J C;  4JV5 Q;  1L0Y B;  1EYD A;  1D1I A;  1Z47 A;  1HZA A;  3CCR A;  4HSP A;  4KY6 A;  1ESR A;  2K03 A;  1X55 A;  1LTA D;  2Z8L A;  4IFD H;  3KLW A;  3PIO 3;  2HHH Q;  3OYY A;  1FR3 A;  4HCS A;  4KJN A;  1T9H A;  1PYW D;  4K8I A;  4HR7 B;  3QOJ A;  4JBM A;  4FF1 A;  4WFN 3;  2QEX A;  4J15 A;  4CDE C;  1BBU A;  1K8M A;  3Q24 A;  2EOT A;  5A2Q L;  1N33 L;  4EVO A;  4ODG A;  4ZAI A;  4JI8 L;  1DOM A;  4DV6 Q;  2RDF A;  4A3J B;  2Q8I B;  3QWN A;  3PSI A;  1EWC A;  4H13 C;  4RAU C;  1YIT A;  1HNX Q;  2PPB C;  2OCE A;  1YIJ A;  5C5M A;  1N33 Q;  1STE A;  3H3V I;  4JBW A;  3OW2 A;  1Q8K A;  4Z9C B;  1PRT F;  2OQK A;  4LFA Q;  1YJ9 A;  2J0T D;  3W2D A;  4XTC S;  1K3R A;  3GTO B;  5JJI A;  1B70 B;  2RDH A;  1B50 A;  1SMX A;  3M4Y A;  3R2T A;  4I7A A;  4X62 Q;  1JOQ A;  2IW3 A;  4OXP A;  1CTM A;  1I3Q H;  1DZ1 A;  3EFX D;  3L7Z C;  1EOV A;  3I4L A;  4JV5 L;  3F2C A;  3BVG A;  4A3B H;  2B2U C;  3DEO A;  5HGT A;  2UUC L;  1MI2 A;  3G4S A;  1NR2 A;  1OXX K;  4DR7 Q;  2F0S A;  4O0A A;  4RKL A;  1PRT B;  4DV1 Q;  3K5N A;  1PH2 A;  1NR4 A;  1A63 A;  4K6D A;  3HOY B;  2BE5 D;  3MTS A;  3BZC A;  3CCJ A;  2L9H A;  3I2Z A;  1JMC A;  2UUB L;  1EEI D;  3PUX A;  3EIV A;  1VMP A;  4IQZ A;  3J7Y W;  5I2X A;  3CCE A;  3D8G A;  5LL6 X;  4KHP Q;  2K05 A;  2EZV A;  2CVR A;  3UE1 A;  1QIL A;  3I4O A;  5M3F B;  3HFZ B;  1DGS A;  3DXJ C;  3CCL A;  1PVO A;  2HCI A;  2NZH A;  2VZA A;  4GS3 A;  2EQS A;  4LF4 Q;  3HOW G;  1QVC A;  3OPO A;  4RGT A;  2XIW A;  4C2M B;  1STG A;  4DFA A;  4JI2 L;  4IJL A;  4HED A;  1AP0 A;  2BOS A;  3I7F A;  3OWE B;  2KEE A;  3K57 A;  2H1E A;  4P73 A;  1PZJ D;  5C0X H;  4C56 C;  2F0K A;  1FJG L;  3T56 B;  1MIU A;  2UU9 Q;  1PV4 A;  5M5X B;  3MHB A;  1DM0 B;  2RBM A;  2KBN A;  4A3K H;  3BZK A;  3HOY H;  1H9J A;  4EQ5 A;  5J22 A;  1VQ4 A;  1HR0 L;  1EZ8 A;  2ZJP A;  2EPB A;  2F0U A;  2CW0 D;  4K0K Q;  4QCL A;  4CHT B;  1EFW A;  1SJH D;  4XXE A;  4JCV E;  1K83 H;  4A3I H;  1R4Q B;  2A73 B;  1KLU D;  1WTV A;  2EJM A;  4BBR H;  2O5I C;  1J9O A;  4HJA A;  5D14 A;  2JA7 H;  2ZM6 Q;  3IAY A;  2HDM A;  1VQC A;  4HJ9 A;  1VQP A;  2UXC L;  3I55 A;  2E2H B;  2B63 B;  2Q8R E;  5GQO A;  4V19 0;  3CD6 A;  3W5O A;  4IO9 A;  3G7L A;  3FKI B;  2I5M X;  2K5W A;  3D6C A;  1JB3 A;  1F2M A;  3NXW A;  3DWA A;  5DM7 3;  4GLV B;  2BA1 A;  2L11 A;  5CV5 A;  4DV4 Q;  4A3E H;  2WAQ E;  1FNU A;  2JEA I;  4YCV A;  4BXX H;  3S14 H;  2VY3 A;  3FP9 A;  1SXT A;  2IX0 A;  2F1M A;  2NVY H;  4A3J H;  1KXL A;  1BCP D;  4TQU S;  2WP8 J;  4WJ4 A;  4FYD A;  2QDB A;  3T1Y L;  3P75 A;  2VS1 A;  2VQE Q;  3NUC A;  5LMN Q;  1Q82 C;  4DR2 Q;  2DNE A;  4ZUJ A;  3F2U A;  1Y14 B;  2N8N A;  2K5D A;  4DV7 Q;  3T16 A;  4C3I G;  1UNS A;  4DV5 Q;  3L3O C;  1E22 A;  2D0P A;  1SEB D;  4R4T A;  1VQ5 A;  1ROD A;  1JE5 A;  2A69 C;  4DUY Q;  2B2T A;  2RCN A;  3RLN A;  1BUV T;  3QOL A;  4G57 A;  4RH6 A;  3KDF A;  1SRU A;  3JAM c;  1SNQ A;  1V1P B;  4OL7 A;  5EBC A;  4EGV A;  1TS5 A;  1WCM H;  1B7Y B;  1YNJ C;  4A3K G;  2KHJ A;  4FXG C;  1JOK A;  1VQE A;  2QCP X;  2HUG A;  2E2I B;  2PNR C;  5FLX c;  4X64 L;  2EYH A;  1NCV A;  1B3A A;  2QDL A;  1SE4 A;  4FDB A;  1SFO B;  1D1K A;  3EA6 A;  3SGI A;  2X69 A;  3MFY A;  3S2H H;  2Q2I A;  1GUG A;  2PZU A;  4RGN A;  3BYT B;  5IT9 c;  1SDF A;  2UUC Q;  1X3F A;  1JIC A;  1NY4 A;  2N88 A;  1ZXT A;  5E1F A;  4ZYS A;  1A6X A;  4R4I A;  2EYL A;  1TWA H;  1PRT D;  4NXM L;  4P74 A;  1U4L A;  4HCE A;  3QIA A;  3HOW B;  5J1Z A;  3UI2 A;  3S15 H;  3QO2 A;  1LUZ A;  3C1E A;  2Q2H A;  4QY7 A;  3V05 A;  3NTH A;  1BBX C;  1UWV A;  1KC8 C;  4BXX G;  2WKC A;  3GQB A;  1EWH A;  2ICE C;  2MFI A;  3KLS X;  3R93 A;  2WAC A;  1STA A;  1Q90 A;  2LMC B;  4DUY L;  3S16 B;  4X6A H;  1S4Z A;  3PIP A;  3KF6 B;  1WD1 A;  1YHB A;  4N9T A;  1ENC A;  3ER0 A;  1SYE A;  2R93 B;  3S1Q B;  4A3F H;  5J3B A;  3J80 L;  3K0Y A;  4C3I H;  4LMQ D;  4DV2 Q;  5HUR A;  3OMC A;  4ID6 A;  3FDT A;  3V96 A;  3BJU A;  1STH A;  3C2P A;  4V0B A;  2WKD A;  3K81 C;  3QG1 A;  1PH7 A;  1CQF A;  3NQT A;  2F0D A;  5FO8 B;  2PQE A;  2CWA A;  2WII B;  1XYI A;  2HHH L;  1HZB A;  4ME5 A;  2MO0 A;  2Y0S B;  3DLL A;  5COY A;  4HMJ A;  3S9W A;  5IYB H;  3VR2 A;  3ND9 A;  2VUM H;  1D7Q A;  3AB9 A;  2KVM A;  2FHT A;  1Q8I A;  2MO1 A;  1KRT A;  1DYQ A;  4CDC C;  3H3V C;  5COR A;  1ZKO A;  5A2Q E;  3M9B A;  1H9R A;  2AUK A;  4DF7 A;  4L8J A;  1TT2 A;  1O7L A;  3BZD B;  4JVZ A;  4ZRZ A;  1TII D;  4N9P A;  4OX9 L;  3SXH A;  1YVC A;  2F0E A;  3GTQ H;  1WD0 A;  1LTS D;  3G6J B;  5F2D A;  1JJ2 A;  2NWG A;  1SAP A;  4XT1 B;  3S2D B;  5K36 G;  3AYH B;  3HKZ B;  3T53 B;  1AW7 A;  1XJV A;  1X9N A;  5IP7 G;  1CSQ A;  1UEB A;  2C9O A;  3K58 A;  4B3M Q;  3NE5 B;  2PMZ E;  2WB1 B;  1K3B C;  1FVI A;  3LWE A;  1GUS A;  1X32 A;  4KY5 A;  1HTP A;  4I65 A;  3MC0 B;  4DV3 L;  3DEP A;  4YY3 L;  3TZD A;  1B2T A;  1WTR A;  1M4V A;  1LT4 D;  3TS2 A;  4NP5 A;  3VDY A;  4AYB G;  2Z4I A;  3PMF A;  3HKZ E;  2K6A A;  4LF7 Q;  3ZYY X;  3MAQ A;  2PZT A;  1Y1W H;  4A3F B;  3PO3 H;  5C4H A;  2BH8 A;  2KEN A;  3J7Z C;  3SEB A;  1QNU A;  3GTK B;  4IUR A;  1GOZ A;  4YIJ A;  4Q5V A;  3FRP B;  3HZX A;  2HIX A;  3ERS X;  4N8F A;  1BCP F;  4OHJ A;  3EJI A;  1BO0 A;  3SK6 A;  5E7N A;  1G6P A;  1HQR D;  1GJX A;  1WTH A;  1PFN A;  2EYJ A;  4GN3 B;  1TQO A;  4DK0 A;  5FJ8 G;  1Y1W G;  1Y1V H;  4DV3 Q;  1EEF D;  4YCU A;  3AMU A;  4B3R L;  1TWA B;  5K5P A;  3A56 A;  1BQQ T;  4CJ0 B;  2CHB D;  3D6W A;  1HTL D;  1I4Q A;  1R9T H;  3BDC A;  4B3T L;  2F0I A;  2R7Z B;  2K5V A;  2CW0 C;  1Q46 A;  1H9S A;  2R7F A;  1N34 L;  1KDC A;  1TU2 B;  3EBE A;  4P72 A;  1C0A A;  3GV3 A;  4A3G G;  3RLO A;  1LLR D;  1SFO H;  2ASB A;  1BDO A;  3OOC A;  4KKT A;  1YBY A;  3CXC A;  1UEA B;  4OWX B;  5C0X J;  4K5W A;  3RN5 A;  4RGM A;  3NEM A;  1PMR A;  1TWC H;  3AEV A;  1LTR D;  3S14 B;  4HTH A;  4GNX A;  4GOP C;  1A0I A;  3HOX B;  2PNH A;  4A93 B;  2KA7 A;  3J7A F;  4X66 L;  2ZM6 L;  3PGZ A;  1RIP A;  1Q3L A;  3KDF B;  4LF7 L;  1U4R A;  3I56 A;  2ZXR A;  3U4V A;  3KOJ A;  1XNR Q;  2R6G A;  2CH4 A;  4JI4 L;  2PZW A;  4FF2 A;  4DV6 L;  1B9M A;  2ALY B;  2K4K A;  3CRK C;  2AUJ D;  1A2U A;  5EJW A;  2KCC A;  1CQV A;  2B2V C;  3DWQ A;  3S1M B;  3TRZ A;  1L1O C;  4ILW A;  2C35 B;  1PDQ A;  3Q8D A;  5CYU A;  4J6H A;  2ICI A;  4GNX C;  1BOS A;  2HDL A;  4R4O A;  4H0L C;  3FKI G;  5I6W A;  3RN2 A;  3HS0 C;  3E0E A;  4IPC A;  2GA4 B;  4A3E B;  1AN8 A;  1VQF A;  1CKN B;  2R61 A;  2FXQ A;  3K5L A;  4DR1 Q;  4B3S L;  3K5O A;  1KDB A;  1MJE A;  3CQZ B;  2WB1 G;  1EIH A;  2JK8 A;  1UE7 A;  4KV6 A;  2SDF A;  2F0N A;  4LF8 Q;  1KAB A;  3GTG B;  5JJL A;  4DK1 A;  1O7Z A;  2LKV A;  1JWM D;  1TWH B;  4YHH Q;  5CV6 A;  4BY1 H;  3PCO B;  4LW1 A;  2E5L Q;  4B3T Q;  2V1C C;  1PLF A;  1SJE D;  5LMN W;  3TEH B;  1OXU A;  2JA7 B;  2A69 D;  3H91 A;  4PZ6 A;  3OIP A;  5C4X G;  4UPA A;  1QVF A;  1YJW A;  1OXS C;  4XYO A;  2N55 A;  1D5Z C;  3NSW A;  4MHE A;  1N32 Q;  1WFQ A;  2Q2T A;  5G3L F;  3J81 L;  4JI1 L;  1IXR A;  1I5F A;  1DXM A;  4OWT B;  3DUZ A;  1K8A C;  1AFP A;  1EL0 A;  4A3K B;  3OHX C;  1GUW A;  5KNC A;  2YTV A;  2EYP A;  3RD4 A;  1YHQ A;  5I6Y A;  3RZO B;  1E7Z A;  2L0C A;  4LWC A;  2PO4 A;  1XPR A;  4LF4 L;  2RKS A;  5EGT A;  5JEA H;  4GLA C;  4A3B B;  4ULL A;  1RF2 D;  1EOT A;  4IUQ A;  1AEX A;  1HJP A;  2UXB L;  1E1T A;  4CDF C;  5ELO A;  5IOD A;  2E2D C;  3TRE A;  2PW7 A;  2B3G A;  3U50 C;  1EUJ A;  1TWH H;  1RD9 D;  4LF5 Q;  3QR8 A;  3N6R A;  1RJT A;  4UDU C;  2NVQ B;  2F3I A;  3UE0 A;  3RZO H;  5JEA J;  2LXK A;  1PTO C;  1XX8 A;  2X6G A;  1GUT A;  3R2I A;  1OTC A;  3J80 c;  4CJ2 C;  1KL9 A;  3TS0 A;  4DXF A;  4LF9 Q;  1RDP D;  1SNP A;  4IPH A;  2EXZ A;  1NTG A;  4A3D B;  1ENA A;  4IUT A;  3H0G H;  2RCF A;  3VYS A;  3BS1 A;  5IGC A;  1PXU A;  4DAY A;  1IL2 A;  2B2W C;  4M8A A;  4QIW B;  1B53 A;  1VQH A;  2I46 A;  3SK8 A;  4LUO A;  3CF5 A;  3MEF A;  5E4X A;  2JP1 A;  3QB3 A;  2OF1 A;  4A75 A;  4DU9 A;  1UAP A;  2XWB B;  4JC0 A;  1EY9 A;  4KY7 A;  3VA7 A;  1KNE A;  3KF6 A;  4G7O C;  4BY1 B;  1D8L A;  2KQ3 A;  2NZO A;  4K14 A;  5C4J H;  4YWL A;  2MQH A;  5EKL A;  5FLX E;  3K6O A;  1WTW A;  3F2B A;  4BA2 I;  5KYI A;  2JQO A;  5DEH A;  3NBI A;  1FL0 A;  1JB7 A;  1MD2 D;  3U4Z A;  3C1F A;  3VYT A;  3Q0A A;  4WJ3 M;  3T13 A;  4JI3 Q;  2XWJ B;  1SE3 A;  2V4D A;  1VQB A;  5LL6 S;  2HQL A;  1AZQ A;  1QOH A;  4GNX B;  1NMF A;  3PF5 A;  4HIM A;  5IOC A;  1TWC B;  1IW7 C;  3G71 A;  4PZ7 A;  1ICF B;  3NPP A;  2E75 C;  4DR2 L;  4GOP B;  3URY A;  2Z9H A;  4U67 3;  2EDG A;  2BE5 C;  1AH9 A;  3GTJ H;  3VR6 A;  2XGT A;  3S1M H;  4A3J G;  3TQY A;  2GN5 A;  4ZK9 B;  3ULJ A;  4QUF A;  5IIF A;  1VQO A;  1EY8 A;  2CKZ B;  2QF7 A;  3WDN A;  3S1R B;  4PG3 A;  4H7B A;  1KD1 C;  2ZT9 C;  5C3X A;  1ASY A;  2ZXP A;  2EYM A;  2JA8 G;  1E2V A;  1I4P A;  3A7A B;  4F8M A;  4DN4 M;  1NAP A;  2K1B A;  3PF4 A;  3I4M H;  2IX3 A;  5KNB A;  3L0O A;  2IY5 B;  4ABN A;  3HGB A;  1VQL A;  5IWA Q;  1FGU A;  3AU7 A;  5GAD C;  1SND A;  5C44 G;  3E3X A;  5C3E G;  2EJG C;  2UUB Q;  1WCM G;  3M7G A;  5AJ3 Q;  3A8K E;  5GRO A;  2ENB A;  5DLQ E;  1F2Y A;  3X3M A;  5I9P A;  4QJF A;  2BH2 A;  1B1Z A;  4NW2 A;  1J8I A;  5ISR A;  4JI6 Q;  4F7X A;  2F4I A;  4JK1 C;  3KF8 B;  3GTK H;  1Z6H A;  3PO3 B;  5M9O A;  1LO5 D;  1SMY D;  4FP5 D;  1JOR A;  1M8A A;  4OO1 G;  3U9O A;  4Y7N H;  2ZTE A;  2RA4 A;  4AQY L;  4QL5 A;  2KCM A;  2A5H A;  3C46 A;  5FOB B;  1WTP A;  1BVS A;  1V1P A;  2L1B A;  4JI2 Q;  3SK5 A;  4DNT B;  1XXG A;  1MKH A;  1PTO H;  3A0J A;  1Y8N B;  3P20 A;  1TVX A;  1HNW L;  1TWF B;  2I07 B;  1S5B D;  5C4X B;  2XVS A;  2X6L A;  3UDF A;  1OXT A;  1UE5 A;  5DM6 3;  3HP3 A;  3CMA A;  2Z6B A;  3HOV B;  1FYC A;  2JXM B;  4POF A;  4BY7 B;  4JI8 Q;  1XPO A;  4NMZ A;  5JAV A;  4TSS A;  1EIY B;  4C3H G;  2PI2 A;  1PZI D;  5C3W A;  5C0X I;  2D0O A;  4B9W A;  4DR7 L;  3A5Z B;  3QJY A;  1UUP A;  2H4O A;  1JOO A;  4YWM A;  2A6H C;  3RMH A;  3I72 A;  1SMY C;  1TR5 A;  4G7H C;  3K7A H;  1CKN A;  1EYC A;  2MJ8 A;  2LS0 1;  1IL8 A;  2VNU D;  4LAA A;  1SYF A;  4RHR A;  2J4X A;  1QZG A;  5EKI A;  3UDI A;  2WAQ G;  1ONL A;  3CRL C;  1X56 A;  5IE8 A;  4DR3 Q;  1GHK A;  5ELN A;  4NXN L;  1S5F D;  4RCO A;  1D2B A;  5FLM H;  3GTQ B;  1HH2 P;  2A68 C;  3S1Q H;  4QB4 A;  3F8T A;  1JJC B;  2ATW A;  1CHP D;  1KIX A;  1IBM Q;  3S16 H;  4MN3 A;  4LF5 L;  1VQM A;  4JW0 A;  4MZ9 A;  3J81 c;  1F2L A;  2A6E D;  1QUQ B;  4O2D A;  4G4K A;  4IUN A;  4KKS A;  3K7A B;  4RCN A;  4ALP A;  2K5H A;  2B29 A;  4LFC L;  1HNW Q;  4NXN Q;  3CHB D;  4DR3 L;  2NTS A;  3B6Y A;  4A3C H;  3IL8 A;  4HAE A;  3K5M A;  1PHJ A;  1TKW B;  4RHS A;  4PMC A;  1W2B A;  1A62 A;  3DM1 A;  1IHZ A;  1NNX A;  5CV9 A;  4NKL A;  2VQF Q;  5EPK A;  3OMG A;  4BY7 H;  2A6E C;  5IYD H;  1BKB A;  5JJK A;  1IYJ B;  3G48 A;  2IX1 A;  1STN A;  4HN7 A;  1DON A;  4EQN A;  4K2L A;  3TN2 A;  3H6M A;  5KRU A;  5M3M H;  3HOU G;  4DR4 L;  1KQS A;  2A68 D;  1TWG H;  1WYD A;  5ELC A;  1E3P A;  3KLR A;  4PMW A;  4GKJ Q;  5EKK A;  4JYA L; 
#chains in the Genus database with same CATH homology
 2BCO A;  4DGZ A;  1CT1 D;  1PTO B;  1CM9 A;  5CMD A;  3S15 B;  2B2U A;  3VR5 A;  2DN8 A;  3I4M B;  4IFD I;  3SDZ A;  4U68 A;  1IYV A;  2SOB A;  2EY6 A;  2A6H D;  2SNS A;  4CKC A;  2EY1 A;  1GUN A;  1ICW A;  4A3G B;  1BCP B;  1OXV A;  2F3V A;  3M85 A;  2ZXO A;  4OO1 H;  2B2Y A;  3SR1 A;  3NP8 A;  5IGE A;  1W6J A;  1A3U A;  2RSO A;  1CA5 A;  2O4X A;  3NWT A;  2ID0 A;  1U4M A;  4PMB A;  4QUC A;  1TS4 A;  1CHQ D;  1U4P A;  2EE1 A;  3DHQ A;  1HUM A;  2OXP A;  4FF3 A;  1HFN A;  3A8I E;  3N52 A;  2EVB A;  2KEC A;  1A2T A;  4XYQ A;  3Q6S A;  1HQM C;  1SNM A;  3HG9 A;  2F3W A;  2NYZ D;  4BBR B;  4HMI A;  4G7Z C;  3OIQ A;  1Q12 A;  1NUC A;  1SBB B;  2LFN A;  2F0O A;  1BXT A;  3I8Z A;  5BN5 A;  3W3A A;  2XRQ D;  3E6Z X;  3T51 B;  4FF4 A;  5C4J B;  4K5X A;  1SYD A;  3CKI B;  3GTM B;  2NTT A;  4RGO S;  4FXD A;  1NSN S;  5CV4 A;  2F0L A;  3NTK A;  5BN3 A;  1MSH A;  3PO2 B;  4IFD J;  4PV1 C;  1JE4 A;  1EU4 A;  2F0H A;  2NBF A;  3MA2 B;  1PZK D;  2C5C A;  3HEJ A;  1QCB D;  2K28 A;  5C44 B;  4M1U B;  4CKB A;  1IW7 D;  1HCZ A;  5IGG A;  3E0J A;  4IUP A;  4CKE A;  1Z7T A;  2K04 A;  1GXD C;  4XQQ A;  3GV6 A;  1H9S B;  5C6A A;  4KMU C;  2NN6 H;  3OW7 A;  2RSN A;  2G9H D;  4O1N A;  3NHH A;  4CBV A;  4R8N A;  3TP5 A;  2B39 A;  5T1G A;  2PYK A;  2AQ3 B;  3ERO A;  1CA6 A;  2PCF B;  5E4W C;  4RA8 A;  4B9X A;  3EVQ A;  4Q0F A;  2QEJ C;  2KOL A;  1DD2 A;  3TP6 A;  1EY4 A;  2FMC A;  3FVQ A;  3VR4 A;  4KN7 C;  3TP7 A;  4X3S A;  4OIK A;  5JVG 3;  2BA0 A;  3HOU B;  1SYC A;  4GZY C;  1L0X B;  5A35 A;  5LHY 1;  2B2W A;  5ELD A;  2L12 A;  3BVM A;  1D6E C;  1I3Q B;  3PV0 A;  4UAI A;  1S5E D;  1GUO A;  1E0B A;  5C4Z A;  1D5M C;  1LTB D;  2Z4H A;  3K59 A;  2JA5 B;  3PUZ A;  4F87 A;  4J1M A;  5M5W B;  5C5L A;  2SNM A;  4H44 C;  2E76 C;  3FPP A;  3PUY A;  2MUY A;  2AQ1 B;  5J39 A;  4KJO A;  4IZ8 A;  4C3J G;  2F0W A;  4FO2 A;  2F0J A;  2M9V A;  2YYZ A;  4XQJ A;  3NWS A;  2NZ1 D;  1U9R A;  3LWU A;  1FNW A;  1TY0 A;  2BDN A;  2JA6 B;  4O42 A;  1O78 A;  1EFI D;  5C3E B;  2D9U A;  1RCV D;  5EQ0 A;  1CZG A;  1G8Z D;  2R3Z A;  1TWG B;  4I7Z C;  4LJZ C;  5CV8 A;  5I2Y A;  1LT6 D;  5M3M B;  1I4X A;  4KKU A;  4KD3 A;  2PW5 A;  2M00 A;  1G6Z A;  1LT3 D;  5JPM C;  1TS3 A;  1F77 A;  1EU3 A;  2EY5 A;  1C4Q A;  3L9A X;  1EY6 A;  1JQY D;  2RQX A;  5EPL A;  4IN3 A;  4EQP A;  1LTT D;  3HRZ C;  1SNC A;  1FNV A;  1VDZ A;  4E6I A;  3D4D A;  3I91 A;  1YNN D;  3JAM L;  1A3V A;  4KN4 C;  4IFD G;  3D31 A;  1EY7 A;  3M3Y B;  2K5Q A;  5IGF A;  1EIG A;  3U9S A;  1QWY A;  2QIL A;  1QG7 A;  5BN4 A;  1DJR D;  3I4N B;  1AZP A;  1F9Q A;  3PUV A;  3R8B A;  4K5V A;  2F03 A;  3TZU A;  2TSS A;  5T1I A;  5CBA E;  5FLX L;  1G2S A;  1F2Z A;  3KK7 A;  4XT3 B;  1HFG A;  1PRT C;  1WTQ A;  4IUV A;  3ITP A;  3RUZ A;  2JEB I;  3BYY B;  3T4A C;  1HRJ A;  1DOK A;  1RTO A;  3C3L A;  5IGD A;  1ET6 A;  4DA2 A;  3IFT A;  4XQN A;  1KTK A;  4J8Q A;  4R9W A;  1D5X C;  3DWP A;  2MGS A;  4C3J B;  1B4O A;  1KNA A;  2F0G A;  2KJX A;  1V1O A;  3MEH A;  1MBY A;  5ELB A;  4X3K A;  4ZUI A;  3FEW X;  5JVH 3;  4PQX A;  4DAV A;  2XSC A;  3BVZ A;  1HUN A;  4F88 A;  3A8J E;  4WOR A;  1XTC D;  1LTI D;  2DNC A;  1EQT A;  1T5E A;  1QJO A;  1I50 B;  2NUC A;  1E2W A;  2E74 C;  2EYO A;  1T5X D;  2A74 C;  3I90 A;  3EQL C;  3MXG A;  1IKM A;  1BR9 A;  4QMG A;  3RLF A;  1O7Y A;  1SYG A;  4Y7N B;  2IWH A;  5M5Y B;  2IPK D;  3I70 A;  3MXU A;  2VXW A;  3PIP 3;  2JSO A;  2K01 A;  3TDQ A;  2JA8 B;  4B08 A;  5AFW A;  3X3N A;  1EY0 A;  5IT9 E;  3J7A V;  3SHL A;  2HQE A;  3S2H B;  4DAP A;  5EPJ A;  3MWY W;  3NK9 A;  3BG3 A;  4CJ1 B;  1HXY D;  1I4G A;  4RKB A;  1FGB D;  2F0V A;  3Q22 A;  1B44 D;  1EYA A;  2B2V A;  3ERQ A;  3IFD A;  1JCK B;  1WCM B;  4XDX A;  4X3U A;  1ILP A;  2TMP A;  1EY5 A;  5KEE A;  2MHV A;  2IT1 A;  5G3L D;  4WJW A;  2KCN A;  2F0F A;  4OIJ A;  1JWU D;  1YNN C;  2BDO A;  1HA6 A;  3P1H A;  3TP8 A;  5KND A;  2K7V A;  5JJZ A;  1F9P A;  3GTJ B;  4FXK C;  1VCI A;  1SYB A;  3VR3 A;  5D3D A;  2D62 A;  4KK7 A;  4MIU A;  3LNN A;  3FPU B;  3H0G B;  1STB A;  4KHV A;  3I3C A;  4C1N I;  1II3 A;  1LAB A;  2YU9 B;  2CQA A;  3SK4 A;  2F0T A;  1YNJ D;  3PUW A;  2XRS D;  4NDX A;  3BDL A;  4C3H B;  5JPN C;  1KAA A;  3S1N B;  1MSG A;  4DNR B;  1CK1 A;  1E2Z A;  4QF4 A;  1K83 B;  4A3I B;  3D3R A;  2KUM A;  3ND8 A;  5KYL A;  1C48 A;  1Y8P B;  1FD7 D;  2EJF C;  1Y69 U;  1TS2 A;  3TBI B;  2RDG A;  3A7L A;  2L55 A;  1JR0 D;  5FO7 B;  5CGK A;  1BCP C;  4RFB A;  1EQV A;  2FIN B;  4C1N K;  1DCZ A;  1JC7 A;  1ML0 D;  4OO1 I;  2XNA C;  3D4R A;  4HSV A;  1LAC A;  1S5C D;  1HHV A;  2JE6 I;  4ZLT F;  3MFG A;  1H9K A;  1V8Q A;  3M4O B;  2RVL A;  1PFB A;  2F0P A;  4FVM A;  2F0Q A;  4RWS C;  5K36 H;  3HOZ B;  2EY2 A;  4BS9 A;  2Z1C A;  3OWF A;  1QE6 A;  3SVM A;  2L4N A;  4PNY A;  2PMZ B;  3H94 A;  3DMU A;  3S17 B;  1STY A;  3A55 A;  1PTO F;  2D2C C;  1DOL A;  3VYR A;  5FO9 B;  1WVL A;  1SNO A;  4KI0 A;  1I4H A;  4CGY B;  2K33 A;  2OEO A;  5KGU A;  1ZYR C;  2KHS A;  3E5S A;  1BF4 A;  1RTN A;  5IT9 L;  3GD7 A;  3J81 E;  1K8O A;  5E3F A;  1ILQ A;  2FFK B;  2K32 A;  1ET9 A;  1JWS D;  1KLG D;  3NBH A;  5FKA C;  3BDO A;  5ELF A;  1BNZ A;  2QKI C;  3SE0 A;  5TSS A;  4OGQ C;  3MVV A;  3H09 A;  2B2T C;  1SSO A;  2MP1 A;  2LY7 A;  1F9S A;  3KUP A;  1QNK A;  2B8G A;  2VB3 X;  2NVX B;  2HCC A;  4ZKB B;  4P2C B;  1Q1E A;  4R8I A;  1VF7 A;  1QB5 D;  1G2T A;  2G9D A;  4LK1 C;  3JAM E;  3KBX A;  3MZ5 A;  1B9N A;  1CI3 M;  1V43 A;  1I6V C;  3OSO A;  2E2J B;  2L5T A;  3TSS A;  1HPC A;  2O2L D;  5C0X G;  1IKL A;  1X3P A;  1R9T B;  1Y1W B;  4ZQ3 A;  4BBS B;  3IKJ A;  1LT5 D;  2NB0 A;  5CBE E;  4XIG S;  5CR3 A;  1G91 A;  1LV9 A;  1Y1V B;  2IJ0 A;  1TY2 A;  1A15 A;  2WAQ B;  2NN6 G;  3A54 A;  3TME A;  2KED A;  3VA5 A;  5I9O A;  2B8F A;  1Y8O B;  4L63 B;  1I6H B;  2JYO A;  3LX0 A;  4WRD A;  4FNF A;  3I73 A;  4BWG B;  3D4W A;  1W6K A;  3KF8 A;  4TRD A;  2OT2 A;  4BA1 I;  1VF5 C;  1VMC A;  4A3M B;  1Q1B A;  1PFM A;  2EYF A;  1I4R A;  3J80 E;  2WIN B;  3MXP A;  5ELE A;  1XWE A;  3R3O A;  3O13 A;  5KIX A;  3RZD B;  2NN6 I;  5CC4 A;  1HA5 A;  1R4P B;  1F9R A;  3GP7 A;  3KBG A;  2SEB D;  4S3S A;  1ENF A;  2IL8 A;  3CU7 A;  2WV6 D;  1GHJ A;  3ONA B;  4C3I B;  4X3T A;  5FK9 C;  3MXN A;  2J7Z A;  4KD4 A;  1C8C A;  2AQ2 B;  5JOB A;  2VUM B;  3NTI A;  1A3T A;  1WTO A;  2M2L A;  1RHP A;  5D3I B;  3NQI A;  2Q8T A;  4TKO B;  3WOF A;  1ESF A;  2FMM A;  3M7N A;  2F0M A;  5IGB A;  1CFM A;  1LTG D;  1EZ6 A;  5EBD A;  3V2T A;  1IYU A;  4EQO A;  4KHZ A;  5CV7 A;  1RKN A;  3Q23 A;  2VB2 X;  1MGS A;  2AWN A;  3KLS A;  1G29 1;  1ZYR D;  4L6T B;  3FMC A;  1CZW A;  4DXG A;  2B2Y C;  1WTX A;  4K2K A;  1OO9 B;  4ZKC B;  5NUC A;  4IAL A;  5JEA G;  2DY7 A;  5DAU A;  5I4D A;  1X3Q A;  3GO5 A;  5D65 A;  3P7J A;  2NVT B;  2MPM A;  4IUU A;  2D5D A;  4K8J A;  1H9M A;  3WOE A;  2R92 B;  1S5D D;  3VYU A;  2XN9 C;  3GTP B;  1O80 A;  1PTO D;  4KTA A;  2DY8 A;  5DNF A;  2NVY B;  2AWO A;  1KDA A;  1ZEQ X;  1SE2 A;  3GTL B;  2FJ2 A;  4AYB B;  4K6L A;  2O5J C;  1L0Y B;  1EYD A;  1D1I A;  1Z47 A;  4HSP A;  4KY6 A;  1ESR A;  2K03 A;  1LTA D;  2Z8L A;  4IFD H;  3PIO 3;  1FR3 A;  4HCS A;  4KJN A;  1PYW D;  4K8I A;  4HR7 B;  3QOJ A;  4FF1 A;  4WFN 3;  3Q24 A;  1K8M A;  2EOT A;  5A2Q L;  4EVO A;  4ODG A;  4ZAI A;  1DOM A;  2RDF A;  4A3J B;  2Q8I B;  3QWN A;  1EWC A;  4H13 C;  4RAU C;  2PPB C;  5C5M A;  1STE A;  4JBW A;  4Z9C B;  1PRT F;  2J0T D;  3W2D A;  4XTC S;  3GTO B;  2RDH A;  1B50 A;  3M4Y A;  3R2T A;  1JOQ A;  2IW3 A;  1CTM A;  1DZ1 A;  3EFX D;  3L7Z C;  3I4L A;  3BVG A;  2B2U C;  3DEO A;  5HGT A;  1MI2 A;  1NR2 A;  1OXX K;  2F0S A;  4RKL A;  1PRT B;  3K5N A;  1NR4 A;  4K6D A;  3HOY B;  2BE5 D;  3MTS A;  2L9H A;  1EEI D;  3PUX A;  1VMP A;  4IQZ A;  3J7Y W;  5I2X A;  3D8G A;  5LL6 X;  2K05 A;  2EZV A;  2CVR A;  1QIL A;  5M3F B;  3DXJ C;  2HCI A;  3OPO A;  4RGT A;  2XIW A;  4C2M B;  1STG A;  4DFA A;  4HED A;  1AP0 A;  2BOS A;  3OWE B;  2KEE A;  3K57 A;  2H1E A;  1PZJ D;  5C0X H;  4C56 C;  2F0K A;  3T56 B;  5M5X B;  3MHB A;  1DM0 B;  2RBM A;  1H9J A;  5J22 A;  1EZ8 A;  2EPB A;  2F0U A;  2CW0 D;  4QCL A;  4CHT B;  1SJH D;  4XXE A;  1R4Q B;  2A73 B;  1KLU D;  1WTV A;  2EJM A;  2O5I C;  1J9O A;  5D14 A;  3IAY A;  2HDM A;  2E2H B;  2B63 B;  2Q8R E;  4V19 0;  3G7L A;  3FKI B;  2K5W A;  3D6C A;  1JB3 A;  1F2M A;  3NXW A;  3DWA A;  5DM7 3;  2BA1 A;  2L11 A;  5CV5 A;  1FNU A;  2JEA I;  1SXT A;  2IX0 A;  2F1M A;  1BCP D;  4TQU S;  2WP8 J;  4FYD A;  2QDB A;  3P75 A;  3NUC A;  2DNE A;  4ZUJ A;  3F2U A;  2K5D A;  3T16 A;  4C3I G;  1UNS A;  3L3O C;  1SEB D;  1ROD A;  2A69 C;  2B2T A;  1BUV T;  3QOL A;  4G57 A;  4RH6 A;  1SNQ A;  1V1P B;  4OL7 A;  5EBC A;  4EGV A;  1TS5 A;  1YNJ C;  4FXG C;  1JOK A;  2QCP X;  2HUG A;  2E2I B;  2PNR C;  2EYH A;  1NCV A;  1B3A A;  1SE4 A;  1SFO B;  1D1K A;  3EA6 A;  2X69 A;  3MFY A;  1GUG A;  2PZU A;  4RGN A;  3BYT B;  1SDF A;  1JIC A;  2N88 A;  1ZXT A;  5E1F A;  4ZYS A;  1A6X A;  2EYL A;  1PRT D;  1U4L A;  4HCE A;  3QIA A;  3HOW B;  5J1Z A;  3UI2 A;  3QO2 A;  3C1E A;  3V05 A;  3NTH A;  1BBX C;  2WKC A;  3GQB A;  1EWH A;  2ICE C;  3KLS X;  3R93 A;  2WAC A;  1STA A;  1Q90 A;  2LMC B;  3S16 B;  1S4Z A;  1WD1 A;  4N9T A;  1ENC A;  2R93 B;  1SYE A;  3S1Q B;  3J80 L;  3K0Y A;  4LMQ D;  5HUR A;  3OMC A;  4ID6 A;  3FDT A;  3V96 A;  3C2P A;  1STH A;  4V0B A;  2WKD A;  3QG1 A;  1CQF A;  2F0D A;  3NQT A;  5FO8 B;  2PQE A;  2WII B;  1XYI A;  4ME5 A;  2Y0S B;  5COY A;  4HMJ A;  3S9W A;  3VR2 A;  3ND9 A;  2KVM A;  2FHT A;  3AB9 A;  1Q8I A;  1DYQ A;  3H3V C;  5COR A;  1ZKO A;  5A2Q E;  1H9R A;  2AUK A;  4DF7 A;  4L8J A;  1TT2 A;  1O7L A;  3BZD B;  4ZRZ A;  1TII D;  4N9P A;  3SXH A;  2F0E A;  1WD0 A;  1LTS D;  3G6J B;  5F2D A;  2NWG A;  1SAP A;  4XT1 B;  3S2D B;  5K36 G;  3HKZ B;  3T53 B;  1AW7 A;  2C9O A;  3K58 A;  3NE5 B;  2WB1 B;  3LWE A;  1GUS A;  1X32 A;  4KY5 A;  1HTP A;  4I65 A;  3MC0 B;  3DEP A;  1B2T A;  3TZD A;  1WTR A;  1M4V A;  1LT4 D;  4NP5 A;  2Z4I A;  3PMF A;  2K6A A;  3ZYY X;  3MAQ A;  2PZT A;  4A3F B;  5C4H A;  3GTK B;  3SEB A;  1QNU A;  4IUR A;  1GOZ A;  4YIJ A;  4Q5V A;  3FRP B;  3HZX A;  1BCP F;  4OHJ A;  3EJI A;  1BO0 A;  3SK6 A;  1HQR D;  1GJX A;  1PFN A;  2EYJ A;  1TQO A;  4DK0 A;  1EEF D;  3AMU A;  1TWA B;  5K5P A;  3A56 A;  1BQQ T;  4CJ0 B;  2CHB D;  3D6W A;  1HTL D;  1I4Q A;  3BDC A;  2F0I A;  2R7Z B;  2CW0 C;  1H9S A;  1KDC A;  1TU2 B;  3GV3 A;  1LLR D;  1BDO A;  3OOC A;  4KKT A;  1UEA B;  5C0X J;  4K5W A;  4RGM A;  1PMR A;  1LTR D;  3S14 B;  4HTH A;  4A93 B;  3HOX B;  2KA7 A;  3J7A F;  1Q3L A;  1U4R A;  2ZXR A;  2R6G A;  2PZW A;  4FF2 A;  1B9M A;  3CRK C;  2AUJ D;  1A2U A;  5EJW A;  2KCC A;  1CQV A;  2B2V C;  3DWQ A;  3S1M B;  4ILW A;  1PDQ A;  5CYU A;  4J6H A;  2ICI A;  1BOS A;  2HDL A;  4H0L C;  5I6W A;  3HS0 C;  2GA4 B;  4A3E B;  1AN8 A;  2R61 A;  3K5L A;  3K5O A;  1KDB A;  3CQZ B;  1EIH A;  4KV6 A;  2SDF A;  2F0N A;  1KAB A;  3GTG B;  4DK1 A;  1O7Z A;  2LKV A;  1JWM D;  1TWH B;  5CV6 A;  1PLF A;  1SJE D;  1OXU A;  2JA7 B;  2A69 D;  3H91 A;  3OIP A;  1OXS C;  4XYO A;  2N55 A;  1D5Z C;  3NSW A;  4MHE A;  5G3L F;  3J81 L;  1DXM A;  3DUZ A;  1AFP A;  1EL0 A;  4A3K B;  3OHX C;  1GUW A;  5KNC A;  2EYP A;  3RD4 A;  5I6Y A;  3RZO B;  2L0C A;  2PO4 A;  2RKS A;  5EGT A;  5JEA H;  4A3B B;  4ULL A;  1RF2 D;  1EOT A;  4IUQ A;  1AEX A;  5IOD A;  2E2D C;  2PW7 A;  1RD9 D;  3N6R A;  1RJT A;  4UDU C;  2NVQ B;  5JEA J;  1PTO C;  1XX8 A;  2X6G A;  1GUT A;  3R2I A;  4CJ2 C;  4DXF A;  1RDP D;  1SNP A;  2EXZ A;  4A3D B;  1ENA A;  4IUT A;  3VYS A;  3BS1 A;  5IGC A;  1PXU A;  4DAY A;  2B2W C;  4M8A A;  4QIW B;  1B53 A;  2I46 A;  3SK8 A;  5E4X A;  2JP1 A;  2OF1 A;  3QB3 A;  4DU9 A;  1UAP A;  2XWB B;  1EY9 A;  4KY7 A;  3VA7 A;  1KNE A;  4G7O C;  4BY1 B;  2KQ3 A;  4K14 A;  5EKL A;  5FLX E;  3K6O A;  1WTW A;  4BA2 I;  5KYI A;  5DEH A;  3NBI A;  1MD2 D;  3C1F A;  3VYT A;  3Q0A A;  3T13 A;  2XWJ B;  1SE3 A;  2V4D A;  5LL6 S;  1AZQ A;  1QOH A;  5IOC A;  1TWC B;  1IW7 C;  3NPP A;  2E75 C;  3URY A;  4U67 3;  2EDG A;  2BE5 C;  3VR6 A;  4ZK9 B;  4QUF A;  5IIF A;  1EY8 A;  2QF7 A;  3WDN A;  3S1R B;  4H7B A;  2ZT9 C;  5C3X A;  2ZXP A;  2EYM A;  1E2V A;  1I4P A;  3A7A B;  4F8M A;  4DN4 M;  1NAP A;  2K1B A;  2IX3 A;  5KNB A;  4ABN A;  3HGB A;  3AU7 A;  1SND A;  2EJG C;  3M7G A;  3A8K E;  2ENB A;  1F2Y A;  3X3M A;  5I9P A;  1B1Z A;  4NW2 A;  1J8I A;  5ISR A;  4F7X A;  2F4I A;  4JK1 C;  1Z6H A;  3PO3 B;  5M9O A;  1LO5 D;  1SMY D;  4FP5 D;  1JOR A;  1M8A A;  4OO1 G;  3U9O A;  2RA4 A;  2A5H A;  3C46 A;  5FOB B;  1WTP A;  1V1P A;  2L1B A;  3SK5 A;  4DNT B;  1XXG A;  1PTO H;  1Y8N B;  3P20 A;  1TVX A;  1TWF B;  2I07 B;  1S5B D;  5C4X B;  2XVS A;  2X6L A;  1OXT A;  5DM6 3;  3HP3 A;  3HOV B;  1FYC A;  2JXM B;  4BY7 B;  4NMZ A;  5JAV A;  4TSS A;  4C3H G;  1PZI D;  5C0X I;  5C3W A;  4B9W A;  3QJY A;  1UUP A;  2H4O A;  1JOO A;  2A6H C;  3RMH A;  3I72 A;  1SMY C;  1TR5 A;  4G7H C;  1EYC A;  2MJ8 A;  2LS0 1;  1IL8 A;  2VNU D;  4LAA A;  1SYF A;  4RHR A;  2J4X A;  5EKI A;  1ONL A;  3CRL C;  1GHK A;  1S5F D;  4RCO A;  1D2B A;  3GTQ B;  2A68 C;  4QB4 A;  1CHP D;  4MN3 A;  1F2L A;  2A6E D;  4G4K A;  4IUN A;  4KKS A;  3K7A B;  4RCN A;  3CHB D;  2NTS A;  3IL8 A;  4HAE A;  3K5M A;  1TKW B;  4RHS A;  4PMC A;  3DM1 A;  1IHZ A;  5CV9 A;  4NKL A;  5EPK A;  3OMG A;  2A6E C;  2IX1 A;  1STN A;  4HN7 A;  1DON A;  4EQN A;  4K2L A;  3TN2 A;  3H6M A;  5KRU A;  2A68 D;  5ELC A;  3KLR A;  4PMW A;  5EKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...