5IGCA

Crystal structure of staphylococcal nuclease variant delta+phs v23e/v66h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTEKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMHENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V23E/V66H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5igcA00
1SNDA 3SK6A 3SR1A 2F0OA 5J39A 1A3UA 1KDCA 1SNQA 2EYJA 2SNMA 1JORA 1A2UA 3BDCA 2EYFA 1NUCA 1TQOA 3BDLA 4DGZA 5C4ZA 1STAA 2F0QA 4K5VA 4KTAA 5IGDA 3MHBA 2F0GA 4ID6A 5M9OA 1EZ8A 4R8NA 1KAAA 1EY8A 1KDAA 2QDBA 4WORA 2EY6A 1STGA 3MEHA 2F0DA 2PZTA 5CV9A 3MXPA 5CR3A 3OMCA 2EY5A 4NP5A 1STNA 3DMUA 4S3SA 3T16A 1TT2A 2OF1A 4K8IA 4K5XA 1U9RA 3ITPA 4KD4A 2F0HA 2F3WA 2EXZA 3OMGA 2F0NA 2PYKA 5CV5A 5KYIA 5HGTA 2F3VA 4KJNA 5CV8A 5EKKA 3R3OA 4IUNA 4KHVA 5IGFA 2ENBA 2F0MA 4NMZA 2WACA 1EY0A 2F0LA 3MZ5A 4QB4A 3SK4A 4DU9A 1SNOA 5C5MA 3D8GA 5IGCA 5KGUA 1JOQA 3EJIA 1STHA 3U9OA 1EZ6A 1AEXA 4QMGA 3TP7A 5CC4A 2NUCA 2PZUA 4B9XA 3EVQA 4IALA 5I9OA 3D4DA 3OSOA 4ME5A 4DF7A 5K5PA 5NUCA 3RUZA 3TP8A 2F0TA 1EY5A 4YIJA 2SNSA 3NUCA 2EYMA 1STYA 2SOBA 2F0SA 4HMJA 4EQNA 2F0JA 4N9PA 1SNMA 3NK9A 4RKLA 4RKBA 5I6WA 2PZWA 2F0UA 2OEOA 5DAUA 2EYLA 2RBMA 2F0EA 5IIFA 5JOBA 3T13A 5IGEA 2F0VA 2KQ3A 2EY1A 4EQOA 1A3TA 4NKLA 3V2TA 4ZUJA 3P1HA 3TMEA 4EQPA 4F8MA 3QOJA 2F0WA 3MVVA 4PNYA 3SHLA 3TP5A 5C3WA 3HZXA 1EY9A 5IGBA 4J1MA 3P75A 5IODA 1SYBA 3VA5A 1A2TA 1EY6A 2M00A 4K14A 4NDXA 4OL7A 3S9WA 5ISRA 3QOLA 4ZUIA 3D4WA 4J6HA 3LX0A 1II3A 1ENAA 1F2ZA 5C3XA 3PMFA 1SYFA 1F2YA 5EGTA 5C6AA 1EYDA 3HEJA 5KYLA 3TP6A 4LAAA 3QB3A 3SK8A 5CV4A 3DHQA 4KY5A 1KABA 1SYGA 5KRUA 1JOKA 5JAVA 3NHHA 4KV6A 5F2DA 5C4HA 4ODGA 5HURA 5I9PA 1RKNA 5CV7A 4DFAA 4G57A 1STBA 4HTHA 2PW7A 3C1FA 2F0PA 2F0IA 1F2MA 4QF4A 4KD3A 2EYHA 1EYCA 4IZ8A 4K6DA 1EYAA 2F0FA 4PMBA 2OXPA 4H7BA 4WRDA 2EYOA 4EVOA 5CV6A 5EKLA 4F7XA 4MIUA 5E1FA 5J1ZA 1TR5A 1A3VA 5I6YA 4I65A 1ENCA 4K8JA 4HMIA 2PW5A 2HQEA 4K5WA 1EQVA 1KDBA 2F0KA 3D6CA 4N9TA 1SNPA 2EY2A 5J22A 4B9WA 1NSNS 5E3FA 1SYEA 5KIXA 4KJOA 3SXHA 5CGKA 3OWFA 1EY4A 1SYCA 2KHSA 1SYDA 2RKSA 2O4XA 1SNCA 3NXWA 4K2KA 4PMCA 4TRDA 5IGGA 4KY6A 2RDFA 2LKVA 3SK5A 5IOCA 1EY7A 1JOOA 3C1EA 2PQEA 3EROA 5C5LA 4K2LA 2EYPA 5KEEA 4KY7A 3NQTA 4ZQ3A 5DEHA 4E6IA 3H6MA 3E5SA 3ERQA 3NP8A 1IHZA
chains in the Genus database with same CATH superfamily
4JI6L 3A56A 1F9RA 2SNMA 3D31A 3Q6SA 2OTLA 3BDCA 5JEAG 1STAA 1Y1VB 3MHBA 1KDAA 2QDBA 3NSWA 1B9NA 3KFUA 2B8FA 4KKSA 1Y1WH 3M9BA 1VQDA 4C3HB 1TWAH 4L6TB 4KD4A 2Q8TA 3HOZB 1MI2A 3BYTB 5CV5A 2NTSA 2F3VA 3CW2C 2HDLA 3L0OA 2B3GA 3URYA 4HJ9A 4KHVA 5C3EH 2D62A 2AQ3B 2AUJD 4QL5A 3W1GA 3G6EA 1W3SA 4DV1Q 2UXDQ 2NUCA 1CM9A 3ZJYC 2ALYB 3EVQA 3RLFA 3ULLA 1DYQA 5CBEE 5E4WC 3NWSA 3GTPB 2ZT9C 1YHAA 2R7ZB 1HQMC 5M3FH 1Q8IA 1NNXA 4ME3A 1HNWL 2CH4W 3J7AF 2JP1A 2KCMA 3T53B 2A68D 1JWUD 2Z0SA 2VB3X 4H0LC 4LF4Q 5IODA 4NDXA 4HJ7A 4ZUIA 4QGUA 2JA9A 1II3A 3J7YW 3FKIH 4X64L 3KF6A 3QB3A 4N8X1 1B7YB 4O1NA 3GTQB 3GTLH 4RCOA 1T5EA 3DEOA 1MD2D 4ZYSA 5IYDH 4EX5A 2PW7A 3CC2A 1HZ9A 1EYCA 1XPRA 2RDHA 2CQOA 1W6KA 4OX9L 2PW5A 4I7ZC 3ND8A 5IT9c 2JA7B 3D6CA 1HRJA 1SYEA 2N88A 4FF3A 1EIFA 1NE3A 1I4RA 4R4IA 1JOOA 4RH6A 1FL0A 1TWCB 1VQ7A 1Y1VH 4C56C 1ET9A 3T1YQ 1EWCA 2Q8IB 5GADC 3PIOA 4FNFA 4BA1I 2X6LA 1AE2A 3BG3A 1M1KC 1V1PA 1X9NA 1GUTA 1CKNA 4HR7B 4C3HH 3DUZA 1NMFA 4DNTB 1CKMA 2EPBA 4ZK9B 1VQMA 3HOZH 3IRBA 3KJOA 1E1OA 1PTOB 3TP5A 1HFNA 4WORA 2KCCA 2MGSA 5FLXc 1STGA 4A3EB 5CV9A 4A3KB 2VQEQ 4DR4L 1KLUD 4R8IA 1XMOL 1KRSA 4JPBW 2F0HA 1NAPA 1RTNA 4XQJA 2PYKA 4LF5L 4CJ2C 3GTPH 2ENBA 1NY4A 1PDQA 2R7ZH 2NB0A 5COYA 4JOIA 1JR0D 1RTOA 3EJIA 3HOXG 1STHA 4UP9A 2YU9B 2TMPA 3TP8A 1IW7C 1K3BC 2F0SA 1EFID 4BS9A 3J7AV 2RBMA 2IWHA 5JOBA 2DUDA 5C4XB 3CCVA 1YNJD 3I91A 5CORA 3J80c 1OXUA 2JA8G 4TKOB 2D0PA 3UI2A 2NZ1D 1PV4A 1VQ5A 3K0YA 4X3UA 3IL8A 5BN3A 1A8VA 1TY0A 1X3FA 1VS0A 2I5MX 3HS0C 2VS1A 3IFTA 2JA6B 4HEDA 2OCEA 1R4PB 1EYGA 1AFPA 4UHVA 5M3MB 2A1AA 1UEBA 1EU4A 3TEHB 1GXDC 1N33L 2O2LD 3E3XA 2K05A 3NBIA 1ICWA 3CPWA 3TZUA 1EOVA 3S14B 2JA7H 4KD3A 4O42A 3SVMA 4NPSA 1YIJA 4CBVA 4JI5Q 3RN5A 4EGVA 1D5MC 1TWCH 2FMCA 3DWQA 5J1ZA 1TWFB 1LTSD 4HMIA 4HIDA 2K01A 4ZRZA 2JN4A 2Z6KA 1PTOC 4C3IB 4GLAC 2RKSA 4RFBA 5A2QL 1SYDA 2F3IA 3C2PA 3HOUB 2PQEA 5GAGC 4QQBX 4L5QA 1PTOH 2VY3A 4OO1I 4B3MQ 2J4XA 2PCFB 4A3GB 4C3JB 4XIGS 4A3EH 2M9VA 2RCNA 3CCEA 2IHEA 4A3KH 1SNDA 1VMPA 4OIKA 4GOPA 3BZCA 1B50A 4NXNL 1IYUA 5ELCA 2Z4HA 3CCRA 1QZGA 1DZ1A 1S72A 3E0JA 4GNXB 3LWUA 1KLGD 2QA4A 2CKZB 4GS3A 4S3SA 1HFGA 1EEID 1C8CA 1JICA 2YU9H 1QJOA 2F3WA 1YVCA 5I4DA 5AJ3L 4JI6Q 2ZJQA 1Y8OB 2A8VA 3H0GB 3HOWB 3KBGA 3D8GA 3MWYW 1EZ6A 3TP7A 1PYSB 5CC4A 5C4XH 2Y0SE 3M4QA 4LWCA 4OONA 2B2UA 1WTWA 4IUUA 5FO8B 3H15A 1U4LA 1RDPD 3TSSA 1MHWC 2RA4A 5K36H 2Z8LA 1EWHA 4JBKA 2F0VA 1Q1EA 1PVOA 5JJIA 2PNRC 1HQRD 3P1HA 3U4ZA 1G2SA 4JI3L 2JA6H 2XGTA 5M3MH 4YY3Q 2E5LL 1PLFA 1B1ZA 5C0XI 2JA5B 4K14A 3OW7A 3K5NA 3M3YB 1VQEA 3QOLA 1LTBD 2R6GA 1SYFA 5C6AA 3HP3A 3S14H 4QUFA 3U50C 5KRUA 2B8GA 3S17B 1F9SA 5HURA 1Q86C 2E2JB 2B2TC 4G57A 1TWFH 4BXXG 4IUQA 1YHQA 2P5ZX 3G6JB 4OWTB 5KNCA 1F2MA 3PIO3 4C3IH 1IZ6A 2L15A 1CT1D 1V1OA 1Q81C 3HOUH 2PPBC 1S5DD 1YHBA 4MIUA 4R4OA 2N55A 3S15B 4WFN3 4A3GH 2B2YC 5FO7B 4JW0A 4C3JH 2CHBD 4X64Q 1TIID 1AW7A 4FXDA 5AFWA 1PFMA 3PO3G 5IT9E 4P75A 1XYIA 1H9SA 1LT6D 3FPPA 3E9HA 5J3BA 4FF1A 2ES2A 1PYBA 3SR1A 1EU3A 2F0OA 4DV7L 4M8AA 1A2UA 3I7FA 3NTIA 5IGDA 1VQ8A 4OX9Q 4K6LA 1R4QB 3X3NA 3OTOQ 2UXBL 2PZTA 1VQAA 3NPPA 1ZYRD 4FP5D 3H0GH 3L2PA 3HOWH 4A3IG 5FLXE 4PQXA 5HGTA 2OWOA 3TQYA 2N49A 1E7ZA 1Z47A 4NMZA 4AYBG 3CD6A 3BU2A 2AHOB 1ML0D 3VR3A 1HHVA 3DWAA 4DV1L 4L63B 3U9OA 2UXDL 2DJGC 1A6XA 1BKBA 4RCNA 3V96A 1KC8C 4YIJA 2OTJA 3JAMi 4DR4Q 4OELB 3CXCA 1JB7A 2JA5H 1XMOQ 1QB5D 2F0EA 3M3YH 3CC7A 4JI1Q 1FJGQ 3VA7A 3H3VI 1VQOA 4A93B 3CCJA 1PZKD 3N52A 1HCZA 3C46A 1CK1A 3S17H 5C0XG 3J80E 4OL7A 2E2JH 4Q5VA 5EGTA 2HUGA 2R7DA 3S1RB 3SK8A 4BBSB 1T9HA 3S1QB 1IBLL 2K52A 2FMMA 5GAHC 2B2WA 3S15H 5IYCH 1YNXA 3HGBA 4MHEA 4IPGA 2OXPA 3FRPB 5LHY1 5T1IA 3F1ZA 5EKLA 3I55A 4OEMB 1WTVA 1DOKA 2F0KA 3P20A 2LXJA 2RVLA 2JEBI 1H9RA 4KJOA 4BWGB 1E0BA 4KN7C 1P8LA 1QNKA 2JSOA 4A3FG 2NTTA 2FFKB 3EIVA 2EYPA 3FHWA 1EEFD 3OPOA 3CHBD 3DXJC 4ZQ3A 2N3SA 2L12A 3T1YL 4ID6A 4PV1C 1BOSA 3BDOA 1IBKQ 4HSPA 4IUPA 3RN2A 3BZDB 1EZ8A 1KAAA 2EY6A 4J8QA 3MXPA 4XXEA 4HAEA 1HA6A 4LFBL 2MO1A 4EQ5A 4IFDI 2HD3A 3ITPA 2Z9HA 1O78A 5JVG3 1LTGD 5DLQE 1VQCA 3DWPA 1NCVA 4OGQC 3U9SA 3EFXD 4JI2Q 2NWGA 2WACA 4ALPA 1CZGA 2KECA 4NXNQ 4V190 1Q46A 1JJ2A 5C5MA 3HOXB 4HSVA 1FR3A 1BF4A 4IALA 1AH9A 3PO2G 3K59A 2Y0SG 1GUOA 5A35A 4YWKA 4A93H 1PRTB 4HCSA 5IP9G 3G7LA 1ENFA 5JPMC 3S1NB 5DAUA 1HA5A 1MKHA 2K5WA 1QG7A 4AIMA 1XPOA 3S1RH 1JJCB 5LMNQ 5IGBA 4BBSH 2GA4B 4BA2I 3S1QH 3AFPA 5ELNA 4CKCA 2I46A 2D5DA 3I4NB 2HIXA 1D1IA 4LNQA 1X3QA 1B4OA 1UEAB 3HKZE 3UDIA 4POGA 2GVAA 1B70B 1L0YB 4LF6Q 2K5VA 1TY2A 3SDZA 1HTLD 4DFAA 4R4TA 4HTHA 3J81c 2YTVA 3KLSA 1YNNC 2FJ2A 2IJ0A 2E5LQ 3KF6B 5H1SE 4RGMA 5IYBG 3AEVA 2A73B 4I65A 4K8JA 3CAMA 4IPCA 1AP0A 3R8BA 3MXNA 1B2TA 1CSPA 5ELBA 3SK5A 2DY8A 5G3LD 3ONAB 2B63B 3VDYA 1S5BD 1GM5A 2BDNA 5FLMG 5M5YB 1SNQA 1QUQA 1KTKA 1VQKA 1X65A 1D7QA 2R3ZA 2VUMG 2KA7A 1L2FA 1N8RC 2F0GA 3QJYA 2JQOA 1K8OA 1VQPA 3UDXA 3T16A 3CQZB 3RD4A 1PFBA 1PRTC 4GN5A 4OWXB 3PV0A 2IL8A 2XNAC 3FP9A 4YWLA 4DR7L 3FPUB 2AWOA 4G7ZC 2GN5A 2I07B 1M4VA 3S1NH 1HR0W 2CWPA 2G9DA 4ME5A 1J5EQ 3RZDB 2WKCA 1XNRL 2UXBQ 3RUZA 2RCFA 1EY5A 4XQNA 5IY0A 3DEPA 4BBRG 1S3OA 2WIIB 1CHQD 2BDOA 4X3TA 4NW2A 1CHPD 2QF7A 1CFMA 4LJZC 3T13A 4NXMQ 3I4NH 3I56A 4NKLA 2CQAA 2L1BA 2VZAA 1H9KA 2RHQB 3F8TA 1EY9A 4B08A 3KLWA 4YY3L 3VA5A 3NBHA 1SSOA 2ZM6L 1DM0B 3A54A 2J7ZA 5G3LF 5BR8L 1SROA 5C3XA 2Q2HA 1EQTA 3GTGB 4FXGC 3A8JE 4V0BA 4KV6A 1TS2A 1A15A 1DXMA 5CV7A 5A2QE 4AQYQ 2J0TD 5HY6A 1IW7D 4YCUA 1E24A 3W2DA 4A4IA 4A3BB 1B3AA 1V8QA 1HZAA 1TS3A 4ZKBB 3I73A 4XT1B 3F2UA 5GAEC 2PO4A 2B63H 2YYZA 1CKOA 2EY2A 5E3FA 3SXHA 4TSSA 5M5YH 3GO5A 1SNCA 4POFA 1IBLQ 2HCIA 2RDFA 1FD7D 1WTRA 3DLLA 1IXRA 4RWSC 3HG9A 3JAML 1CSQA 1L1OC 3E5SA 3NP8A 4RHRA 1VQFA 2UUCL 1W6JA 1JT8A 2C5CA 4LK1C 3NENA 1M8AA 3CQZH 3FDTA 2XIWA 2NBFA 3GTJB 3G4SA 3BVMA 4DK1A 3K6OA 5EKIA 2K5DA 3K8AA 5ELDA 1U0LA 2F52A 3OTOL 4NP5A 5I2XA 5C44G 1LYLA 1WFQA 1VQIA 1O7ZA 1SE3A 4A3IB 1LO5D 4GOPB 3S2HB 4CDEC 4JCVE 1K9MC 2F0NA 5L37A 3RZDH 4CKBA 4DR2Q 3I4LA 1ASYA 1PTOD 4KKTA 3M4PA 1UWVA 3JC66 1JOQA 1FNVA 1Z6HA 3A8KE 4FYDA 2ZTCA 4DA2A 3D3RA 1SXTA 1RODA 1GKHA 1XNQL 2A74C 3KDFA 1STYA 1UE5A 4LFBQ 1U4RA 2D0OA 2R61A 4RKBA 1PZID 1K0SA 4CKEA 1BCPB 1OXTA 4BY7B 1B9MA 3EBEA 4JI1L 1FJGL 1E2VA 3TMEA 4EQPA 2F0WA 3GTGH 4AYBE 2XVSA 3PUYA 4J1MA 2C9OA 1MJCA 5FJ8G 4M1UB 3PUWA 2BE5C 1C48A 1O80A 4JVZA 2QKIC 4DK0A 4BXXH 3ER0A 4MN3A 1WTQA 4RA8A 3RR5A 3HKZG 2WB1E 3ULPA 5CV4A 4DR3L 4KY5A 4A3BH 1ILPA 1I50B 1SYGA 2WAQE 2KUMA 1LTRD 4DV5Q 4PMWA 4MNOA 3PCOB 3ULJA 2F0PA 1H95A 3CCMA 1S40A 1I5FA 1SN8A 4GLXA 2K50A 3KYHC 3F2DA 3MFYA 4KMUC 3RLNA 4EVOA 3J81E 1GUWA 3GTQH 1MBYA 3Q22A 1XXGA 2E74C 5IP7G 4OO1H 2HQEA 1DD2A 1KQSA 5D14A 4GZYC 1VF5C 1PTOF 5CGKA 2FXQA 2B29A 4O0AA 3RZOB 2KHSA 3EN2A 4TRDA 1OXSC 1T5XD 4A3FB 2HT1A 3C1EA 3GTJH 1UUPA 1ET6A 5DEHA 4JC0A 3H6MA 1TKWB 4GOPC 1Y1WG 5EPLA 4XQQA 1TWGB 2K5HA 3NTHA 1A3UA 1KDCA 1IBKL 1V1QA 4A3IH 2WP8J 2HCCA 2F0QA 2CFMA 4KN4C 5C0XJ 1HZBA 5C3EG 1Q1BA 4PZ8A 3DMUA 1SFOB 3OW2A 1F2LA 2R93B 1LLRD 3K58A 4R4QA 1BCPC 5M5WB 2I0QA 4JI2L 5IE8A 5IGCA 1YBYA 3HOVG 4BY7H 3PO2B 1ZEQX 4IJHA 4IURA 1XTCD 4XTCS 3D6WA 3AFQA 4OWWB 1SBBB 3L7ZC 1PYWD 5C0XH 2L5TA 1X3GA 2UUBL 3MEFA 1A3TA 3FKIG 1XWEA 4X3KA 3WDNA 2EXDA 4DR7Q 1FNUA 4QCLA 2EJMA 5LMNL 1GHJA 1QILA 1I50H 1O7LA 4DR5L 3T56B 1VQ6A 3MXUA 3S24A 3TS2A 1C9OA 2AQ1B 3A74A 2MJ8A 4ULLA 1XNRQ 2DJFC 2LSSA 4AH6A 3KF8B 3U4VA 5DNFA 1JOKA 3FVQA 3NHHA 5I9PA 4LF6L 3JAMc 2PMZE 1STBA 3CCLA 3BJUA 3CRKC 2Z6BA 3EA6A 2F0IA 1YJ9A 5D3DA 3RZOH 1PFSA 4A3CG 2K6AA 4DV4Q 4WRDA 1GUGA 2ZM6Q 5HGQA 4A3FH 5CV6A 4PZ6A 5JVH3 2PQAA 1QCBD 4HIKA 1E2ZA 5BR8Q 5I6YA 1RCVD 3L9AX 4N9TA 5BN4A 2KOLA 5E7NA 1TWGH 4C3HG 4LF7L 3J80i 1EY4A 4K2KA 4PMCA 1B44D 1PH6A 2CWAA 3BVZA 1Q3LA 3B6YA 3A8IE 1WOCA 3UE1A 4KY7A 1CTMA 1BBWA 4H44C 3A55A 2M2LA 3SK6A 1WJJA 3S16B 2UUAQ 1SFOH 1DGSA 3BDLA 2EYFA 2VUMB 1L0XB 2RSOA 2R93H 3C3LA 1I4QA 4A3DB 5M5WH 4DPGA 4P71A 5EBCA 1KRTA 1OO9B 1SJHD 3W3AA 4GNXC 3DM1A 3PO2H 1TS4A 2IPKD 1WCMB 4A76A 2UXCL 2UUCQ 2BOSA 2F0MA 2K4KA 1EY0A 3MZ5A 5IP9H 3WOEA 3QIAA 3H3VC 4DR6Q 3ND9A 4UAIA 1PH2A 2UU9Q 3TBIB 2KEDA 1JJGA 1J5EL 3H3VH 4MZ9A 1Z7TA 4JI0L 2MFIA 1LTID 4PG3A 3Q23A 2ZTDA 1FGBD 2ASBA 1CZWA 1PXUA 2EYLA 4KKUA 4N8FA 2KQ3A 3UDGA 2MHVA 4NXML 2QDLA 2B2TA 4F8MA 1AN8A 4IPDA 2XTIA 5C3WA 1PZJD 2F03A 5M5XB 4JBMA 3M7NA 3Q8DA 2IT1A 2HHHL 1A63A 3PMFA 2WFWA 2JA7G 5GROA 1XNQQ 2B2YA 3DM3A 1EFWA 4P73A 2NVQB 3I2ZA 2WB1G 3Q24A 3CMAA 2WAQG 3STBC 2CVRA 4A3MG 2QCPX 1SJED 4AQYL 4IFDJ 2AMCB 3L3OC 3PGZA 2R7FA 3AQQA 4QIWE 2QEJC 4IZ8A 4IJLA 4PMBA 3M85A 2EE1A 4UDUC 4DV6L 1D8LA 2O5IC 1EIHA 3GV6A 4XYQA 1KDBA 4IUVA 3ZYYX 2N8NA 5FLMH 5JEAJ 1SRUA 4A3KG 4DR3Q 3S16H 2K32A 2G5DA 3LWEA 2VQFL 1I6HB 2VUMH 2WV6D 5C5LA 3CPFA 4Y7NB 2D9UA 1DONA 4BY1G 2HDMA 1TVXA 1YJNA 4A3DH 3P7JA 4IQZA 4DV3L 2NYZD 1C4QA 5C4JB 2MO0A 2A69C 3KK7A 3GQBA 5C4ZA 4XT3B 4IFDH 2LY7A 3HRZC 1WCMH 5M9OA 4ZLTF 4R8NA 3BYYB 3GP7A 2RDGA 4ILWA 5CR3A 1KHIA 1YNND 5C44B 1GO3E 1QNUA 4OIJA 1U5KA 5JJKA 1QUQB 5JEAH 2EXZA 3R2TA 4KJNA 4X62L 1G8ZD 1WTHA 4CHTB 3K7AB 2F0LA 2KENA 1OXXK 4DR2L 1SNOA 1Y8PB 5BN5A 5K36G 1J8IA 1AEXA 4QMGA 1PHJA 1MIUA 5I9OA 3CC4A 3TS0A 2Z1CA 4FDBA 2F0TA 1FGUA 2R92G 4CDCC 5M5XH 4EQNA 1RJTA 4YCVA 3H09A 1VQ4A 2F0UA 2OEOA 1GJXA 2EY1A 4EQOA 1JQYD 4L8JA 4WJ4A 3CRLC 1NJIC 3HZXA 3TN2A 5EQ0A 2NVQH 3I4MG 4UP8A 2K28A 5EBDA 1X55A 2JEAI 1PRTD 3S1MB 1Q90A 2E75C 5KYLA 4A3LG 4YWMA 1KAWA 4CDDC 2VNUD 1GUNA 5C4HA 2UUBQ 1JCKB 3WWVA 3NBHB 3M4YA 4DV5L 2XWBB 3CKIB 2Q8RE 2NZHA 2JA8B 1U4PA 3HKSA 4WJ3M 2EYHA 4JI4Q 4JI7Q 3JAME 4DR5Q 3PIPA 1I6HH 2A19A 1EWIA 4Y7NH 1MSGA 3HOYG 4G7OC 5KIXA 1AE3A 1W2BA 5C4JH 3OWFA 3OIQA 4KY6A 4DUZL 1HNZL 4DXFA 3I8ZA 4KI0A 3ERQA 3NQIA 5EJWA 2GVBA 1D5XC 3HOWG 4JBWA 4DV2L 3ERSX 4A3JG 2K33A 1EIGA 4P72A 4JYAL 2NVTB 5FO9B 2N78A 3MEHA 3K7AH 3BVGA 1LM0A 4LF7Q 2JE6I 1STNA 2B2VC 3VR4A 4Z9CB 4IPHA 4HN7A 4IUTA 1GOZA 4LF8Q 1G6PA 1PRTF 4P74A 1NTGA 4C1NI 3T4AC 5IGFA 2IY5B 2ZTEA 2JA5G 3RLOA 4LFCQ 3HOVB 3T1HL 2HIVA 4B9XA 1X32A 3PQIA 4FO2A 1HR0Q 4R9WA 5NUCA 1HH2P 1YI2A 1TWHB 1NR4A 2SNSA 2EYMA 2V1CC 2SEBD 5KNDA 1HUMA 2VW9A 4N9PA 1SE2A 5I6WA 3LNNA 1UE7A 1V1PB 3HOXH 1CKNB 5E4XA 2NN6I 2UXCQ 1LTAD 1QOHA 3S1MH 1MGSA 1B53A 1V9PA 4H02A 3ICEA 1SYBA 4LUZA 3K57A 1XMQQ 4J6HA 1KD1C 1PH7A 2QW7A 3IFDA 3OOCA 2AWNA 3TRZA 2JA8H 1JC7A 1YJWA 1HXYD 4JI0Q 3DHQA 4C1NK 2XRSD 4DAYA 2H4OA 1RKNA 1LTLA 1K8AC 5IP7H 2DN8A 1N32Q 3C1FA 2XWJB 2RQXA 4GKJQ 4H7BA 4DV4L 2HHHQ 5E1FA 1A3VA 1ENCA 1SE4A 3LGJA 3N6RA 2MPMA 1YITA 1SNPA 4O2DA 1NSNS 1S4ZA 3Q0AA 4DN4M 1CA6A 5IWAL 2V4DA 2A6EC 1G291 5IGGA 2BE5D 2ZXRA 1DOMA 1D6EC 2KBNA 5EPJA 4K2LA 1L0WA 2NVTH 1IBML 3K80C 1GHKA 1SR3A 1RL2A 4X66Q 1IYJB 3IAYA 3NE5B 3KOJA 1DOLA 4DV6Q 2UUAL 1NUCA 3F2BA 3SGIA 1E2WA 1PMRA 2C35B 4QJFA 1YEZA 4DV0L 4X6AH 3KJPA 2F0DA 2K75A 3W1BA 1Y14B 3J81i 2OF1A 3OIPA 4QUCA 2VQFQ 3HOVH 1FYCA 1U9RA 3K7UC 3PO3B 2NVXB 4LMQD 2Q2IA 5EKKA 1EQQA 3R3OA 4A93G 4DNIA 1TWHH 4QY7A 4QB4A 4DV3Q 3SK4A 3X3MA 2JJQA 2NVYB 2Q2TA 4DXGA 1F9PA 2PZUA 4DR6L 2UU9L 2LS01 1S5ED 1SMYC 4BBSG 4HMJA 3NEMA 1SNMA 3NK9A 1JWSD 1Q8KA 4JI8L 1S5FD 1JMCA 4X62Q 2NN6G 1SE8A 3SHLA 3K81C 3MVVA 4JOIC 4AYBB 3P75A 4KK7A 4R4CA 3S9WA 4YHHL 3PIP3 2A6HC 3D4WA 1QWYA 1ENAA 1F2ZA 1I3QB 1A62A 4GKKL 3G48A 4LAAA 1BCPD 4B3TL 4KHPL 1H9MA 2WB1B 1DJRD 2BH2A 4JBJA 4A3CH 2WAQB 3KUPA 1EQRA 4Y52H 1LACA 4A3MB 5ELOA 2PNHA 1BQQT 1CUKA 1S5CD 4QF4A 1L1OA 4TQUS 2F0FA 2ZJRA 3PUVA 1FVIA 4Q0FA 1I94Q 1HZCA 2E76C 4U673 2DNCA 5I2YA 1TU2B 2KHIA 2G9HD 1IKMA 2BH8A 4ZKCB 4RMFA 3E9IA 2LKVA 3TREA 2LXKA 3GTKB 4ZAIA 3J81j 1WD1A 4LF9L 2I5LX 3NQTA 1VQ9A 2PQAB 4J15A 4BY1B 3PF5A 3S2DB 3H94A 2EIFA 3GTOB 3PO3H 4FF4A 3CF5A 2NVXH 2MP1A 4RGOS 2VL6A 2A68C 5LMUL 3FEWX 2Z6KC 4U68A 3T51B 2Q2UA 4CJ0B 1KXLA 2NVYH 1TT2A 1I4GA 2DGYA 1KNEA 1VCIA 3PUXA 3PF4A 1D1KA 1AZPA 4DUZQ 1HNZQ 1EUJA 2KHJA 5CV8A 2IW3A 3GDEA 1BCPF 2PI2E 4DV2Q 3I4NG 3U58A 1B3QA 4JYAQ 3S2HH 4DF7A 3E0EA 4LUVA 1H9SB 1PH9A 2E2HB 2R92B 2SOBA 1K73C 2QEXA 1XX8A 3I70A 2H1EA 4CJ1B 1I6VC 2JYOA 1ONLA 1IYVA 1I3QH 2X6GA 4LUOA 1F9QA 4DAPA 3I4MB 2KCNA 1X56A 3I90A 3QR8A 5M3FG 1JWMD 4X65L 1LTTD 3T1HQ 1A2TA 2FINB 2M00A 4KLKA 4C2MB 1C7YA 3BZKA 4DK3C 5EPKA 4A3MH 2B2UC 1U4MA 3KLSX 2Y0SB 2ZXPA 3CCUA 1N36Q 3AYHB 1E1TA 4IN3A 1KABA 1VMCA 2MNAA 1MJEA 2K03A 2KCTA 2YV5A 1Y69U 1EIYB 4B3RL 3K5MA 4JG2A 5D65A 4DAMA 2EOTA 1JB3A 2B63G 2ID0A 5JJZA 2PMZB 4F88A 3VR6A 4B3SQ 1JE4A 4XDXA 4K0KL 1CQVA 1F77A 2LMCB 4JI4L 4JI7L 2QILA 3GTKH 1ESFA 1UAPA 1VQGA 1BNZA 4F7XA 4R1JA 2AKWB 1HNXL 4K5WA 5IYDG 4BY1H 1LUZA 1K0RA 3HOYB 3S2DH 1LT3D 1PH5A 1SYCA 2EDGA 3K0XA 4WJWA 2L9HA 3CU7A 1G91A 3GTOH 2K5QA 3EQLC 1WYDA 1PA6A 2RF4A 2ICIA 1O7IA 3W5OA 3TZDA 1N34L 1Z9FA 1JORA 1UNSA 3A7LA 1JE5A 4A3JB 5LL6S 1X6OA 2K14A 3STBD 1YNJC 1J6QA 3NELA 4K5VA 3SE0A 1Y1VG 4DR1L 1EY8A 5LL6X 3GTMB 2PI2A 4KHZA 2H5XA 2F4IA 2CH4A 5IWAQ 4K8IA 2A5HA 1VDZA 4DUYL 2I5HA 4IO9A 3HOZG 4HJ8A 4LF8L 1IBMQ 1V43A 3MFGA 4HCEA 1CI3M 2E2HH 2R92H 4NB3A 5FOBB 4FVMA 4CDFC 4LFCL 1ICFB 4RGNA 1E3PA 3D4DA 4DV0Q 4IOCA 1HR0L 3V05A 3OYYA 3BS1A 3NUCA 2F4VL 4LW1A 4LFAL 1VQNA 2XRQD 3I4MH 2R7ZG 2F0JA 4YCWA 5T1GA 2A69D 1HNWQ 1BVSA 1RHPA 5IIFA 4C2MH 2JXMB 3MTSA 2SDFA 1XPUA 2KJXA 2OQ0A 4A3LH 4GN3B 1R9TB 3E6ZX 4A3BG 4A75A 4OHJA 2AQ2B 1EY6A 3VYRA 1WTOA 1HPCA 2VB2X 1PH8A 3MAQA 1GUSA 1Q12A 1XMQL 1ZKOA 1K8MA 4X3SA 3HEJA 2WINB 4JV5L 1J9OA 4UY8C 4BBRB 3M4OB 5JAVA 4HJAA 5ELEA 1QVCA 2OT2A 4JI8Q 2K7VA 1LT5D 1LABA 2L11A 3D4RA 1K8GA 4OO1G 2E2DC 1PH4A 3AU7A 3UE0A 3J81L 3HOYH 3A5ZB 1N32L 4RG1A 4K6DA 4QIWB 4GKJL 2EYOA 4YHHQ 1X54A 1AZQA 3WOFA 4DK6C 1N9WA 3A7AB 4GKKQ 5J22A 4B3TQ 3VR2A 4KHPQ 3HFZB 3R2IA 1RF2D 2O4XA 3QG1A 4A3JH 5IOCA 2B2WC 1KL9A 1VQJA 5IYBH 4GNXA 3AMUA 2IHFA 2TSSA 3VYTA 4H13C 3CCQA 1A0IA 1IHZA 3GTMH 2IX1A 4L5SA 2EYJA 1WTXA 4X66L 3GD7A 3M7GA 1TQOA 3RMHA 1PFNA 4KTAA 2X69A 3UDFA 2KVMA 3TDQA 3I72A 2E8GA 4A3EG 1QE6A 1IL2A 1XJVA 2BA0A 3PUZA 2D2CC 4K5XA 4LF5Q 4BY7G 4LF9Q 3KF8A 4ABNA 3OMGA 2CCZA 2CW0D 3H91A 4L5RC 4HJ5A 1Q82C 1SAPA 1B8AA 3MXGA 3G71A 4LF4L 4APVA 1K28A 4MTKA 1G6ZA 4OXPA 3CCSA 1Y8NB 1SLJA 3MXNB 3AB9A 2ICEC 5CBAE 5KGUA 3MC0B 1HJPA 1ESRA 4F87A 5K5PA 1E22A 3OSOA 1WI5A 5EAYA 5LMUQ 1OXVA 2K1BA 2YTXA 1R9TH 3PSIA 2ZXOA 4RKLA 2MUYA 1D5ZC 2PZWA 1CQFA 5JPNC 4P2CB 5IGEA 1I4PA 2DY7A 5C4XG 4ZUJA 5FK9C 5DM73 4PNYA 3A0JA 4DKAC 2L55A 1EL0A 4BBRH 3M4OH 2XN9C 2IX0A 1BBXC 3GV3A 3LX0A 4TVAB 1I4XA 1QVGA 1EYDA 5TSSA 4FXKC 3F2CA 1SDFA 3TP6A 3J7A5 2JA6G 2O5JC 4UPAA 1N33Q 5M3MG 5F2DA 4UP7A 2L4NA 1P16A 3VYUA 3VR5A 4JK1C 1WTPA 3OHXC 1RIPA 2RSNA 1ZYRC 1EYAA 2QGQA 4X65Q 3NTKA 1TXYA 3A5UA 5KNBA 4DAYB 5CMDA 2WKDA 1I94L 1NBWA 1EQVA 3MA2B 4HIMA 1VQLA 3HKZB 1PH3A 4C3IG 3OWEB 2VQEL 1DCZA 4B3RQ 2K04A 1QZHA 3HOUG 1BDOA 3EROA 5KEEA 2R93G 4A3GG 2ZJPA 1GD7A 1HUNA 1K83B 4C3JG 1OTCA 2E2IB 5J39A 4K0KQ 3K5OA 1X3PA 1WD0A 2EVBA 5FKAC 4DGZA 1ILQA 2EZVA 1HNXQ 2VXWA 1NMGA 1EOTA 2CW0C 1BUVT 3O13A 3OMCA 5IT9L 2EY5A 3I3CA 4RGTA 1MSHA 5ELFA 2MQHA 2AUKA 1KIXA 3SEBA 2JK8A 1VQHA 4DNRB 1I4HA 1BBUA 2F1MA 3QO2A 4RAUC 5KYIA 5AJ3Q 4IUNA 4DU9A 4IOAA 1Y1WB 1BXTA 1N34Q 1UE1A 2K5NA 4ZCKA 3IKJA 5C44H 4MTNA 1IKLA 2FHTA 2A6ED 3H0GG 1TWAB 1G2TA 2EQSA 1ASZA 2L0CA 1VF7A 3RNUA 1YZ6A 4DR1Q 3R93A 2B39A 1UE6A 1PH1A 2NN6H 1H9JA 1IL8A 5GQOA 5C3EB 5FLXL 3J7ZC 1ZXTA 4DUYQ 1Q7YC 1G51A 1M90C 3V2TA 5DM63 5LMNW 1BO0A 1O7YA 4JI3Q 3QOJA 1RD9D 4HIOA 2DNEA 1GVPA 1TS5A 1SMXA 2ATWA 5M3FB 5JJLA 1KNAA 1NR2A 4GN4B 4G7HC 3K5LA 2EJFC 1WVLA 4JI5L 5ISRA 4PZ7A 3D0FA 2LFNA 2OQKA 3KLRA 2Z4IA 1F2YA 2BCOA 2F4VQ 1SEBD 2IX3A 4LFAQ 3CMEA 1HTPA 1VQBA 1X3EA 1N36L 2EJGC 5FJ8H 4ODGA 1XTDA 4XYOA 2XSCA 3NWTA 4RHSA 2YTYA 4B3ML 3FKIB 1LT4D 3VYSA 1QVFA 1SMYD 3J80L 2HQLA 1CA5A 4B3SL 3FMCA 1FNWA 4GLVB 5D3IB 3KDFB 1D2BA 4I7AA 4G4KA 3GTLB 2NZOA 2BA1A 1TR5A 3QWNA 5IYCG 1K83H 4DAVA 2RHSB 4A3DG 4JV5Q 4B9WA 5CYUA 4CGYB 2E2IH 4FF2A 1L1OB 1LV9A 3NXWA 2B2VA 4IFDG 1EY7A 2KEEA 3CP0A 1STEA 2A6HD 1WCMG 3KBXA 4L5TA 1C0AA 4E6IA 1K3RA 1BR9A 3I4OA 4DV7Q
chains in the Genus database with same CATH topology
3A56A 1F9RA 2SNMA 3D31A 3Q6SA 3BDCA 5JEAG 1STAA 1Y1VB 3MHBA 1KDAA 2QDBA 3NSWA 1B9NA 2B8FA 4KKSA 4C3HB 4L6TB 4KD4A 2Q8TA 3HOZB 1MI2A 3BYTB 5CV5A 2NTSA 2F3VA 2HDLA 3URYA 4KHVA 2D62A 2AQ3B 2AUJD 2NUCA 1CM9A 3EVQA 3RLFA 1DYQA 5CBEE 5E4WC 3NWSA 3GTPB 2ZT9C 2R7ZB 1HQMC 1Q8IA 3J7AF 2JP1A 3T53B 2A68D 1JWUD 2VB3X 4H0LC 5IODA 4NDXA 4ZUIA 1II3A 3J7YW 3QB3A 4O1NA 3GTQB 4RCOA 1T5EA 3DEOA 1MD2D 4ZYSA 2PW7A 1EYCA 2RDHA 1W6KA 2PW5A 4I7ZC 3ND8A 2JA7B 3D6CA 1HRJA 1SYEA 2N88A 4FF3A 1I4RA 1JOOA 4RH6A 1TWCB 4C56C 1ET9A 1EWCA 2Q8IB 4FNFA 4BA1I 2X6LA 3BG3A 1V1PA 1GUTA 4HR7B 3DUZA 4DNTB 2EPBA 4ZK9B 1PTOB 3TP5A 1HFNA 4WORA 2KCCA 2MGSA 1STGA 4A3EB 5CV9A 4A3KB 1KLUD 4R8IA 2F0HA 1NAPA 1RTNA 4XQJA 2PYKA 4CJ2C 2ENBA 1PDQA 2NB0A 5COYA 1JR0D 1RTOA 3EJIA 1STHA 2YU9B 2TMPA 3TP8A 1IW7C 2F0SA 1EFID 4BS9A 3J7AV 2RBMA 2IWHA 5JOBA 5C4XB 1YNJD 3I91A 5CORA 1OXUA 4TKOB 3UI2A 2NZ1D 3K0YA 4X3UA 3IL8A 5BN3A 1TY0A 3HS0C 3IFTA 2JA6B 4HEDA 1R4PB 1AFPA 5M3MB 1EU4A 1GXDC 2O2LD 2K05A 3NBIA 1ICWA 3TZUA 3S14B 4KD3A 4O42A 3SVMA 4CBVA 4EGVA 1D5MC 2FMCA 3DWQA 5J1ZA 1TWFB 1LTSD 4HMIA 2K01A 4ZRZA 4C3IB 1PTOC 2RKSA 4RFBA 5A2QL 1SYDA 3C2PA 3HOUB 2PQEA 1PTOH 4OO1I 2J4XA 2PCFB 4A3GB 4C3JB 4XIGS 2M9VA 1SNDA 1VMPA 4OIKA 1B50A 1IYUA 5ELCA 2Z4HA 1DZ1A 3E0JA 3LWUA 1KLGD 4S3SA 1HFGA 1EEID 1C8CA 1JICA 1QJOA 2F3WA 5I4DA 1Y8OB 3H0GB 3HOWB 3KBGA 3D8GA 3MWYW 1EZ6A 3TP7A 5CC4A 2B2UA 1WTWA 4IUUA 5FO8B 1U4LA 3TSSA 1RDPD 2RA4A 5K36H 2Z8LA 1EWHA 2F0VA 1Q1EA 2PNRC 1HQRD 3P1HA 1G2SA 1PLFA 1B1ZA 5C0XI 2JA5B 4K14A 3OW7A 3K5NA 3M3YB 3QOLA 1LTBD 2R6GA 1SYFA 5C6AA 3HP3A 4QUFA 5KRUA 2B8GA 3S17B 1F9SA 5HURA 2E2JB 2B2TC 4G57A 4IUQA 3G6JB 5KNCA 1F2MA 3PIO3 1CT1D 1V1OA 2PPBC 1S5DD 4MIUA 2N55A 3S15B 4WFN3 2B2YC 5FO7B 2CHBD 1TIID 1AW7A 4FXDA 5AFWA 1PFMA 5IT9E 1XYIA 1H9SA 1LT6D 3FPPA 4FF1A 3SR1A 1EU3A 2F0OA 4M8AA 1A2UA 3NTIA 5IGDA 4K6LA 1R4QB 3X3NA 2PZTA 3NPPA 1ZYRD 4FP5D 5FLXE 4PQXA 5HGTA 1Z47A 4NMZA 1ML0D 3VR3A 1HHVA 3DWAA 4L63B 3U9OA 1A6XA 4RCNA 3V96A 4YIJA 1QB5D 2F0EA 3VA7A 4A93B 1PZKD 3N52A 1HCZA 3C46A 1CK1A 5C0XG 3J80E 4OL7A 4Q5VA 5EGTA 2HUGA 3S1RB 3SK8A 4BBSB 3S1QB 2FMMA 2B2WA 3HGBA 4MHEA 2OXPA 3FRPB 5LHY1 5T1IA 5EKLA 1WTVA 1DOKA 2F0KA 3P20A 2RVLA 2JEBI 1H9RA 4KJOA 4BWGB 1E0BA 4KN7C 1QNKA 2JSOA 2NTTA 2FFKB 2EYPA 1EEFD 3CHBD 3DXJC 3OPOA 4ZQ3A 2L12A 4ID6A 4PV1C 1BOSA 3BDOA 4HSPA 4IUPA 3BZDB 1EZ8A 1KAAA 2EY6A 4J8QA 3MXPA 4XXEA 4HAEA 1HA6A 4IFDI 3ITPA 1O78A 5JVG3 1LTGD 3DWPA 1NCVA 4OGQC 3U9SA 3EFXD 2NWGA 2WACA 1CZGA 2KECA 4V190 5C5MA 3HOXB 4HSVA 1FR3A 1BF4A 4IALA 3K59A 1GUOA 5A35A 1PRTB 4HCSA 3G7LA 1ENFA 5JPMC 3S1NB 5DAUA 1HA5A 2K5WA 1QG7A 5IGBA 2GA4B 4BA2I 4CKCA 2I46A 2D5DA 3I4NB 1D1IA 1X3QA 1B4OA 1UEAB 1L0YB 1TY2A 3SDZA 1HTLD 4DFAA 4HTHA 3KLSA 1YNNC 2FJ2A 2IJ0A 4RGMA 2A73B 4I65A 4K8JA 1AP0A 3R8BA 3MXNA 1B2TA 5ELBA 3SK5A 2DY8A 5G3LD 3ONAB 2B63B 1S5BD 2BDNA 5M5YB 1SNQA 1KTKA 2R3ZA 2KA7A 2F0GA 3QJYA 1K8OA 3T16A 3CQZB 3RD4A 1PFBA 1PRTC 3PV0A 2IL8A 2XNAC 3FPUB 2AWOA 4G7ZC 2I07B 1M4VA 2G9DA 4ME5A 3RZDB 2WKCA 3RUZA 1EY5A 4XQNA 3DEPA 2WIIB 1CHQD 2BDOA 4X3TA 4NW2A 1CHPD 2QF7A 1CFMA 4LJZC 3T13A 4NKLA 2CQAA 2L1BA 1H9KA 1EY9A 4B08A 3VA5A 3NBHA 1SSOA 1DM0B 3A54A 2J7ZA 5G3LF 5C3XA 1EQTA 3GTGB 4FXGC 3A8JE 4V0BA 4KV6A 1TS2A 1A15A 1DXMA 5CV7A 5A2QE 2J0TD 1IW7D 3W2DA 4A3BB 1B3AA 1V8QA 1TS3A 4ZKBB 3I73A 4XT1B 3F2UA 2PO4A 2YYZA 2EY2A 5E3FA 3SXHA 4TSSA 3GO5A 1SNCA 2HCIA 2RDFA 1FD7D 1WTRA 4RWSC 3HG9A 3JAML 3E5SA 4RHRA 3NP8A 1W6JA 2C5CA 4LK1C 1M8AA 3FDTA 2XIWA 2NBFA 3GTJB 3BVMA 4DK1A 3K6OA 5EKIA 2K5DA 5ELDA 4NP5A 5I2XA 1O7ZA 1SE3A 4A3IB 1LO5D 3S2HB 2F0NA 4CKBA 3I4LA 1PTOD 4KKTA 1JOQA 1FNVA 1Z6HA 3A8KE 4FYDA 4DA2A 3D3RA 1SXTA 1RODA 2A74C 1STYA 1U4RA 2R61A 4RKBA 1PZID 4CKEA 1BCPB 1OXTA 4BY7B 1B9MA 1E2VA 3TMEA 4EQPA 2F0WA 2XVSA 3PUYA 4J1MA 2C9OA 4M1UB 3PUWA 2BE5C 1C48A 1O80A 2QKIC 4DK0A 4MN3A 1WTQA 4RA8A 5CV4A 4KY5A 1ILPA 1I50B 1SYGA 2KUMA 1LTRD 4PMWA 2F0PA 3MFYA 4KMUC 4EVOA 3J81E 1GUWA 1MBYA 3Q22A 1XXGA 2E74C 4OO1H 2HQEA 1DD2A 5D14A 4GZYC 1VF5C 1PTOF 5CGKA 3RZOB 2KHSA 4TRDA 1OXSC 1T5XD 4A3FB 3C1EA 1UUPA 1ET6A 5DEHA 3H6MA 1TKWB 5EPLA 4XQQA 1TWGB 3NTHA 1A3UA 1KDCA 2WP8J 2HCCA 2F0QA 4KN4C 5C0XJ 1Q1BA 3DMUA 1SFOB 1F2LA 2R93B 1LLRD 3K58A 1BCPC 5M5WB 5IGCA 3PO2B 1ZEQX 4IURA 1XTCD 4XTCS 3D6WA 1SBBB 3L7ZC 1PYWD 5C0XH 2L5TA 1A3TA 1XWEA 4X3KA 3WDNA 1FNUA 4QCLA 2EJMA 1GHJA 1QILA 1O7LA 3T56B 3MXUA 2AQ1B 2MJ8A 4ULLA 5DNFA 1JOKA 3FVQA 3NHHA 5I9PA 1STBA 3CRKC 3EA6A 2F0IA 5D3DA 2K6AA 4WRDA 1GUGA 5CV6A 5JVH3 1QCBD 1E2ZA 5I6YA 1RCVD 3L9AX 4N9TA 5BN4A 2KOLA 4C3HG 1EY4A 4K2KA 4PMCA 1B44D 3BVZA 1Q3LA 3A8IE 4KY7A 1CTMA 4H44C 3A55A 2M2LA 3SK6A 3S16B 3BDLA 2EYFA 2VUMB 1L0XB 2RSOA 3C3LA 1I4QA 4A3DB 5EBCA 1OO9B 1SJHD 3W3AA 3DM1A 1TS4A 2IPKD 1WCMB 2BOSA 2F0MA 1EY0A 3MZ5A 3WOEA 3QIAA 3H3VC 3ND9A 4UAIA 3TBIB 2KEDA 1Z7TA 1LTID 3Q23A 1FGBD 1CZWA 1PXUA 2EYLA 4KKUA 2KQ3A 2MHVA 2B2TA 4F8MA 1AN8A 5C3WA 1PZJD 2F03A 5M5XB 3M7NA 2IT1A 3PMFA 2B2YA 2NVQB 3Q24A 2CVRA 2QCPX 1SJED 4IFDJ 3L3OC 2QEJC 4IZ8A 4PMBA 3M85A 2EE1A 4UDUC 2O5IC 1EIHA 3GV6A 4XYQA 1KDBA 4IUVA 3ZYYX 5JEAJ 2K32A 3LWEA 1I6HB 2WV6D 5C5LA 4Y7NB 2D9UA 1DONA 2HDMA 1TVXA 3P7JA 4IQZA 2NYZD 1C4QA 5C4JB 2A69C 3KK7A 3GQBA 5C4ZA 4XT3B 4IFDH 2LY7A 3HRZC 5M9OA 4ZLTF 4R8NA 3BYYB 3GP7A 2RDGA 4ILWA 5CR3A 1YNND 5C44B 1QNUA 4OIJA 5JEAH 2EXZA 3R2TA 4KJNA 1G8ZD 4CHTB 3K7AB 2F0LA 1OXXK 1SNOA 1Y8PB 5BN5A 5K36G 1J8IA 1AEXA 4QMGA 5I9OA 2Z1CA 2F0TA 4EQNA 1RJTA 3H09A 2F0UA 2OEOA 1GJXA 2EY1A 4EQOA 1JQYD 4L8JA 3CRLC 3HZXA 3TN2A 5EQ0A 2K28A 5EBDA 2JEAI 1PRTD 3S1MB 1Q90A 2E75C 5KYLA 2VNUD 1GUNA 5C4HA 1JCKB 3M4YA 2XWBB 3CKIB 2Q8RE 2JA8B 1U4PA 2EYHA 3JAME 1MSGA 4G7OC 5KIXA 3OWFA 3OIQA 4KY6A 4DXFA 3I8ZA 4KI0A 3ERQA 3NQIA 5EJWA 1D5XC 4JBWA 2K33A 1EIGA 2NVTB 5FO9B 3MEHA 3BVGA 2JE6I 1STNA 2B2VC 3VR4A 4Z9CB 4HN7A 4IUTA 1GOZA 1PRTF 4C1NI 3T4AC 5IGFA 3HOVB 4B9XA 1X32A 4FO2A 4R9WA 5NUCA 1TWHB 1NR4A 2SNSA 2EYMA 2SEBD 5KNDA 1HUMA 4N9PA 1SE2A 5I6WA 3LNNA 1V1PB 5E4XA 2NN6I 1LTAD 1QOHA 1MGSA 1B53A 1SYBA 3K57A 4J6HA 3IFDA 3OOCA 2AWNA 1JC7A 1HXYD 3DHQA 4C1NK 2XRSD 4DAYA 2H4OA 1RKNA 2DN8A 3C1FA 2XWJB 2RQXA 4H7BA 5E1FA 1A3VA 1ENCA 1SE4A 3N6RA 2MPMA 1SNPA 1NSNS 1S4ZA 3Q0AA 4DN4M 1CA6A 2V4DA 2A6EC 5IGGA 1G291 2BE5D 2ZXRA 1DOMA 1D6EC 5EPJA 4K2LA 1GHKA 3IAYA 3NE5B 1DOLA 1NUCA 1E2WA 1PMRA 2F0DA 2OF1A 3OIPA 4QUCA 1FYCA 1U9RA 3PO3B 2NVXB 4LMQD 5EKKA 3R3OA 4QB4A 3SK4A 3X3MA 2NVYB 4DXGA 1F9PA 2PZUA 2LS01 1S5ED 1SMYC 4HMJA 1SNMA 3NK9A 1JWSD 1S5FD 2NN6G 3SHLA 3MVVA 4AYBB 3P75A 4KK7A 3S9WA 3PIP3 2A6HC 3D4WA 1QWYA 1ENAA 1F2ZA 1I3QB 4LAAA 1BCPD 1H9MA 2WB1B 1DJRD 2WAQB 3KUPA 1LACA 4A3MB 1BQQT 1S5CD 4QF4A 4TQUS 2F0FA 3PUVA 4Q0FA 2E76C 4U673 2DNCA 5I2YA 1TU2B 2G9HD 1IKMA 4ZKCB 2LKVA 3GTKB 4ZAIA 1WD1A 3NQTA 4BY1B 3S2DB 3H94A 3GTOB 4FF4A 2MP1A 4RGOS 2A68C 3FEWX 4U68A 3T51B 4CJ0B 1TT2A 1I4GA 3PUXA 1KNEA 1VCIA 1D1KA 1AZPA 5CV8A 2IW3A 1BCPF 4DF7A 1H9SB 2E2HB 2R92B 2SOBA 1XX8A 3I70A 2H1EA 4CJ1B 1I6VC 2JYOA 1ONLA 1IYVA 2X6GA 1F9QA 4DAPA 3I4MB 2KCNA 3I90A 1JWMD 1LTTD 1A2TA 2FINB 2M00A 4C2MB 5EPKA 2B2UC 1U4MA 3KLSX 2Y0SB 2ZXPA 4IN3A 1KABA 1VMCA 2K03A 1Y69U 3K5MA 5D65A 2EOTA 1JB3A 2ID0A 5JJZA 2PMZB 4F88A 3VR6A 1JE4A 4XDXA 1CQVA 1F77A 2LMCB 2QILA 1ESFA 1UAPA 1BNZA 4F7XA 4K5WA 3HOYB 1LT3D 1SYCA 2EDGA 4WJWA 2L9HA 3CU7A 1G91A 2K5QA 3EQLC 2ICIA 3TZDA 1JORA 1UNSA 3A7LA 4A3JB 5LL6S 1YNJC 4K5VA 3SE0A 1EY8A 5LL6X 3GTMB 4KHZA 2F4IA 4K8IA 2A5HA 1VDZA 1V43A 3MFGA 4HCEA 1CI3M 5FOBB 4FVMA 4RGNA 3D4DA 3V05A 3BS1A 3NUCA 2XRQD 2F0JA 5T1GA 2A69D 1RHPA 5IIFA 2JXMB 3MTSA 2SDFA 2KJXA 1R9TB 3E6ZX 4OHJA 2AQ2B 1EY6A 3VYRA 1WTOA 1HPCA 2VB2X 3MAQA 1GUSA 1Q12A 1ZKOA 1K8MA 4X3SA 3HEJA 2WINB 1J9OA 4BBRB 3M4OB 5JAVA 5ELEA 2OT2A 2K7VA 1LT5D 1LABA 2L11A 3D4RA 4OO1G 2E2DC 3AU7A 3J81L 4K6DA 4QIWB 2EYOA 1AZQA 3WOFA 3A7AB 5J22A 3VR2A 3R2IA 1RF2D 2O4XA 3QG1A 5IOCA 2B2WC 3AMUA 2TSSA 3VYTA 4H13C 1IHZA 2IX1A 2EYJA 1WTXA 3GD7A 3M7GA 1TQOA 3RMHA 1PFNA 4KTAA 2X69A 2KVMA 3TDQA 3I72A 1QE6A 2BA0A 3PUZA 2D2CC 4K5XA 3KF8A 4ABNA 3OMGA 2CW0D 3H91A 1SAPA 3MXGA 1G6ZA 1Y8NB 3AB9A 2ICEC 5CBAE 5KGUA 3MC0B 1ESRA 4F87A 5K5PA 3OSOA 1OXVA 2K1BA 2ZXOA 4RKLA 2MUYA 1D5ZC 2PZWA 1CQFA 5JPNC 4P2CB 5IGEA 1I4PA 2DY7A 4ZUJA 5FK9C 5DM73 4PNYA 2L55A 1EL0A 2XN9C 2IX0A 1BBXC 3GV3A 3LX0A 1I4XA 1EYDA 5TSSA 4FXKC 1SDFA 3TP6A 2O5JC 5F2DA 2L4NA 3VYUA 3VR5A 4JK1C 1WTPA 3OHXC 2RSNA 1ZYRC 1EYAA 3NTKA 5KNBA 5CMDA 2WKDA 1EQVA 3MA2B 3HKZB 4C3IG 3OWEB 1DCZA 2K04A 1BDOA 3EROA 5KEEA 1HUNA 1K83B 4C3JG 2E2IB 5J39A 3K5OA 1X3PA 1WD0A 2EVBA 5FKAC 4DGZA 1ILQA 2EZVA 2VXWA 1EOTA 2CW0C 1BUVT 3O13A 3OMCA 5IT9L 2EY5A 3I3CA 4RGTA 1MSHA 5ELFA 2AUKA 3SEBA 4DNRB 1I4HA 2F1MA 3QO2A 4RAUC 5KYIA 4IUNA 4DU9A 1Y1WB 1BXTA 3IKJA 1IKLA 2FHTA 2A6ED 1TWAB 1G2TA 2L0CA 1VF7A 3R93A 2B39A 2NN6H 1H9JA 1IL8A 5C3EB 5FLXL 1ZXTA 3V2TA 5DM63 1BO0A 1O7YA 3QOJA 1RD9D 2DNEA 1TS5A 5M3FB 1KNAA 1NR2A 1WVLA 4G7HC 3K5LA 2EJFC 5ISRA 2LFNA 3KLRA 2Z4IA 1F2YA 2BCOA 1SEBD 2IX3A 1HTPA 2EJGC 4ODGA 4XYOA 2XSCA 3NWTA 4RHSA 3FKIB 1LT4D 3VYSA 1SMYD 3J80L 1CA5A 3FMCA 1FNWA 5D3IB 1D2BA 4G4KA 3GTLB 2BA1A 1TR5A 3QWNA 4DAVA 4B9WA 5CYUA 4CGYB 4FF2A 1LV9A 3NXWA 2B2VA 4IFDG 1EY7A 2KEEA 1STEA 2A6HD 3KBXA 4E6IA 1BR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SND A;  3SK6 A;  3SR1 A;  2F0O A;  5J39 A;  1A3U A;  1KDC A;  1SNQ A;  2EYJ A;  2SNM A;  1JOR A;  1A2U A;  3BDC A;  2EYF A;  1NUC A;  1TQO A;  3BDL A;  4DGZ A;  5C4Z A;  1STA A;  2F0Q A;  4K5V A;  4KTA A;  5IGD A;  3MHB A;  2F0G A;  4ID6 A;  5M9O A;  1EZ8 A;  4R8N A;  1KAA A;  1EY8 A;  1KDA A;  2QDB A;  4WOR A;  2EY6 A;  1STG A;  3MEH A;  2F0D A;  2PZT A;  5CV9 A;  3MXP A;  5CR3 A;  3OMC A;  2EY5 A;  4NP5 A;  1STN A;  3DMU A;  4S3S A;  3T16 A;  1TT2 A;  2OF1 A;  4K8I A;  4K5X A;  1U9R A;  3ITP A;  4KD4 A;  2F0H A;  2F3W A;  2EXZ A;  3OMG A;  2F0N A;  2PYK A;  5CV5 A;  5KYI A;  5HGT A;  2F3V A;  4KJN A;  5CV8 A;  5EKK A;  3R3O A;  4IUN A;  4KHV A;  5IGF A;  2ENB A;  2F0M A;  4NMZ A;  2WAC A;  1EY0 A;  2F0L A;  3MZ5 A;  4QB4 A;  3SK4 A;  4DU9 A;  1SNO A;  5C5M A;  3D8G A;  5IGC A;  5KGU A;  1JOQ A;  3EJI A;  1STH A;  3U9O A;  1EZ6 A;  1AEX A;  4QMG A;  3TP7 A;  5CC4 A;  2NUC A;  2PZU A;  4B9X A;  3EVQ A;  4IAL A;  5I9O A;  3D4D A;  3OSO A;  4ME5 A;  4DF7 A;  5K5P A;  5NUC A;  3RUZ A;  3TP8 A;  2F0T A;  1EY5 A;  4YIJ A;  2SNS A;  3NUC A;  2EYM A;  1STY A;  2SOB A;  2F0S A;  4HMJ A;  4EQN A;  2F0J A;  4N9P A;  1SNM A;  3NK9 A;  4RKL A;  4RKB A;  5I6W A;  2PZW A;  2F0U A;  2OEO A;  5DAU A;  2EYL A;  2RBM A;  2F0E A;  5IIF A;  5JOB A;  3T13 A;  5IGE A;  2F0V A;  2KQ3 A;  2EY1 A;  4EQO A;  1A3T A;  4NKL A;  3V2T A;  4ZUJ A;  3P1H A;  3TME A;  4EQP A;  4F8M A;  3QOJ A;  2F0W A;  3MVV A;  4PNY A;  3SHL A;  3TP5 A;  5C3W A;  3HZX A;  1EY9 A;  5IGB A;  4J1M A;  3P75 A;  5IOD A;  1SYB A;  3VA5 A;  1A2T A;  1EY6 A;  2M00 A;  4K14 A;  4NDX A;  4OL7 A;  3S9W A;  5ISR A;  3QOL A;  4ZUI A;  3D4W A;  4J6H A;  3LX0 A;  1II3 A;  1ENA A;  1F2Z A;  5C3X A;  3PMF A;  1SYF A;  1F2Y A;  5EGT A;  5C6A A;  1EYD A;  3HEJ A;  5KYL A;  3TP6 A;  4LAA A;  3QB3 A;  3SK8 A;  5CV4 A;  3DHQ A;  4KY5 A;  1KAB A;  1SYG A;  5KRU A;  1JOK A;  5JAV A;  3NHH A;  4KV6 A;  5F2D A;  5C4H A;  4ODG A;  5HUR A;  5I9P A;  1RKN A;  5CV7 A;  4DFA A;  4G57 A;  1STB A;  4HTH A;  2PW7 A;  3C1F A;  2F0P A;  2F0I A;  1F2M A;  4QF4 A;  4KD3 A;  2EYH A;  1EYC A;  4IZ8 A;  4K6D A;  1EYA A;  2F0F A;  4PMB A;  2OXP A;  4H7B A;  4WRD A;  2EYO A;  4EVO A;  5CV6 A;  5EKL A;  4F7X A;  4MIU A;  5E1F A;  5J1Z A;  1TR5 A;  1A3V A;  5I6Y A;  4I65 A;  1ENC A;  4K8J A;  4HMI A;  2PW5 A;  2HQE A;  4K5W A;  1EQV A;  1KDB A;  2F0K A;  3D6C A;  4N9T A;  1SNP A;  2EY2 A;  5J22 A;  4B9W A;  1NSN S;  5E3F A;  1SYE A;  5KIX A;  4KJO A;  3SXH A;  5CGK A;  3OWF A;  1EY4 A;  1SYC A;  2KHS A;  1SYD A;  2RKS A;  2O4X A;  1SNC A;  3NXW A;  4K2K A;  4PMC A;  4TRD A;  5IGG A;  4KY6 A;  2RDF A;  2LKV A;  3SK5 A;  5IOC A;  1EY7 A;  1JOO A;  3C1E A;  2PQE A;  3ERO A;  5C5L A;  4K2L A;  2EYP A;  5KEE A;  4KY7 A;  3NQT A;  4ZQ3 A;  5DEH A;  4E6I A;  3H6M A;  3E5S A;  3ERQ A;  3NP8 A;  1IHZ A; 
#chains in the Genus database with same CATH topology
 4JI6 L;  3A56 A;  1F9R A;  2SNM A;  3D31 A;  3Q6S A;  2OTL A;  3BDC A;  5JEA G;  1STA A;  1Y1V B;  3MHB A;  1KDA A;  2QDB A;  3NSW A;  1B9N A;  3KFU A;  2B8F A;  4KKS A;  1Y1W H;  3M9B A;  1VQD A;  4C3H B;  1TWA H;  4L6T B;  4KD4 A;  2Q8T A;  3HOZ B;  1MI2 A;  3BYT B;  5CV5 A;  2NTS A;  2F3V A;  3CW2 C;  2HDL A;  3L0O A;  2B3G A;  3URY A;  4HJ9 A;  4KHV A;  5C3E H;  2D62 A;  2AQ3 B;  2AUJ D;  4QL5 A;  3W1G A;  3G6E A;  1W3S A;  4DV1 Q;  2UXD Q;  2NUC A;  1CM9 A;  3ZJY C;  2ALY B;  3EVQ A;  3RLF A;  3ULL A;  1DYQ A;  5CBE E;  5E4W C;  3NWS A;  3GTP B;  2ZT9 C;  1YHA A;  2R7Z B;  1HQM C;  5M3F H;  1Q8I A;  1NNX A;  4ME3 A;  1HNW L;  2CH4 W;  3J7A F;  2JP1 A;  2KCM A;  3T53 B;  2A68 D;  1JWU D;  2Z0S A;  2VB3 X;  4H0L C;  4LF4 Q;  5IOD A;  4NDX A;  4HJ7 A;  4ZUI A;  4QGU A;  2JA9 A;  1II3 A;  3J7Y W;  3FKI H;  4X64 L;  3KF6 A;  3QB3 A;  4N8X 1;  1B7Y B;  4O1N A;  3GTQ B;  3GTL H;  4RCO A;  1T5E A;  3DEO A;  1MD2 D;  4ZYS A;  5IYD H;  4EX5 A;  2PW7 A;  3CC2 A;  1HZ9 A;  1EYC A;  1XPR A;  2RDH A;  2CQO A;  1W6K A;  4OX9 L;  2PW5 A;  4I7Z C;  3ND8 A;  5IT9 c;  2JA7 B;  3D6C A;  1HRJ A;  1SYE A;  2N88 A;  4FF3 A;  1EIF A;  1NE3 A;  1I4R A;  4R4I A;  1JOO A;  4RH6 A;  1FL0 A;  1TWC B;  1VQ7 A;  1Y1V H;  4C56 C;  1ET9 A;  3T1Y Q;  1EWC A;  2Q8I B;  5GAD C;  3PIO A;  4FNF A;  4BA1 I;  2X6L A;  1AE2 A;  3BG3 A;  1M1K C;  1V1P A;  1X9N A;  1GUT A;  1CKN A;  4HR7 B;  4C3H H;  3DUZ A;  1NMF A;  4DNT B;  1CKM A;  2EPB A;  4ZK9 B;  1VQM A;  3HOZ H;  3IRB A;  3KJO A;  1E1O A;  1PTO B;  3TP5 A;  1HFN A;  4WOR A;  2KCC A;  2MGS A;  5FLX c;  1STG A;  4A3E B;  5CV9 A;  4A3K B;  2VQE Q;  4DR4 L;  1KLU D;  4R8I A;  1XMO L;  1KRS A;  4JPB W;  2F0H A;  1NAP A;  1RTN A;  4XQJ A;  2PYK A;  4LF5 L;  4CJ2 C;  3GTP H;  2ENB A;  1NY4 A;  1PDQ A;  2R7Z H;  2NB0 A;  5COY A;  4JOI A;  1JR0 D;  1RTO A;  3EJI A;  3HOX G;  1STH A;  4UP9 A;  2YU9 B;  2TMP A;  3TP8 A;  1IW7 C;  1K3B C;  2F0S A;  1EFI D;  4BS9 A;  3J7A V;  2RBM A;  2IWH A;  5JOB A;  2DUD A;  5C4X B;  3CCV A;  1YNJ D;  3I91 A;  5COR A;  3J80 c;  1OXU A;  2JA8 G;  4TKO B;  2D0P A;  3UI2 A;  2NZ1 D;  1PV4 A;  1VQ5 A;  3K0Y A;  4X3U A;  3IL8 A;  5BN3 A;  1A8V A;  1TY0 A;  1X3F A;  1VS0 A;  2I5M X;  3HS0 C;  2VS1 A;  3IFT A;  2JA6 B;  4HED A;  2OCE A;  1R4P B;  1EYG A;  1AFP A;  4UHV A;  5M3M B;  2A1A A;  1UEB A;  1EU4 A;  3TEH B;  1GXD C;  1N33 L;  2O2L D;  3E3X A;  2K05 A;  3NBI A;  1ICW A;  3CPW A;  3TZU A;  1EOV A;  3S14 B;  2JA7 H;  4KD3 A;  4O42 A;  3SVM A;  4NPS A;  1YIJ A;  4CBV A;  4JI5 Q;  3RN5 A;  4EGV A;  1D5M C;  1TWC H;  2FMC A;  3DWQ A;  5J1Z A;  1TWF B;  1LTS D;  4HMI A;  4HID A;  2K01 A;  4ZRZ A;  2JN4 A;  2Z6K A;  1PTO C;  4C3I B;  4GLA C;  2RKS A;  4RFB A;  5A2Q L;  1SYD A;  2F3I A;  3C2P A;  3HOU B;  2PQE A;  5GAG C;  4QQB X;  4L5Q A;  1PTO H;  2VY3 A;  4OO1 I;  4B3M Q;  2J4X A;  2PCF B;  4A3G B;  4C3J B;  4XIG S;  4A3E H;  2M9V A;  2RCN A;  3CCE A;  2IHE A;  4A3K H;  1SND A;  1VMP A;  4OIK A;  4GOP A;  3BZC A;  1B50 A;  4NXN L;  1IYU A;  5ELC A;  2Z4H A;  3CCR A;  1QZG A;  1DZ1 A;  1S72 A;  3E0J A;  4GNX B;  3LWU A;  1KLG D;  2QA4 A;  2CKZ B;  4GS3 A;  4S3S A;  1HFG A;  1EEI D;  1C8C A;  1JIC A;  2YU9 H;  1QJO A;  2F3W A;  1YVC A;  5I4D A;  5AJ3 L;  4JI6 Q;  2ZJQ A;  1Y8O B;  2A8V A;  3H0G B;  3HOW B;  3KBG A;  3D8G A;  3MWY W;  1EZ6 A;  3TP7 A;  1PYS B;  5CC4 A;  5C4X H;  2Y0S E;  3M4Q A;  4LWC A;  4OON A;  2B2U A;  1WTW A;  4IUU A;  5FO8 B;  3H15 A;  1U4L A;  1RDP D;  3TSS A;  1MHW C;  2RA4 A;  5K36 H;  2Z8L A;  1EWH A;  4JBK A;  2F0V A;  1Q1E A;  1PVO A;  5JJI A;  2PNR C;  1HQR D;  3P1H A;  3U4Z A;  1G2S A;  4JI3 L;  2JA6 H;  2XGT A;  5M3M H;  4YY3 Q;  2E5L L;  1PLF A;  1B1Z A;  5C0X I;  2JA5 B;  4K14 A;  3OW7 A;  3K5N A;  3M3Y B;  1VQE A;  3QOL A;  1LTB D;  2R6G A;  1SYF A;  5C6A A;  3HP3 A;  3S14 H;  4QUF A;  3U50 C;  5KRU A;  2B8G A;  3S17 B;  1F9S A;  5HUR A;  1Q86 C;  2E2J B;  2B2T C;  4G57 A;  1TWF H;  4BXX G;  4IUQ A;  1YHQ A;  2P5Z X;  3G6J B;  4OWT B;  5KNC A;  1F2M A;  3PIO 3;  4C3I H;  1IZ6 A;  2L15 A;  1CT1 D;  1V1O A;  1Q81 C;  3HOU H;  2PPB C;  1S5D D;  1YHB A;  4MIU A;  4R4O A;  2N55 A;  3S15 B;  4WFN 3;  4A3G H;  2B2Y C;  5FO7 B;  4JW0 A;  4C3J H;  2CHB D;  4X64 Q;  1TII D;  1AW7 A;  4FXD A;  5AFW A;  1PFM A;  3PO3 G;  5IT9 E;  4P75 A;  1XYI A;  1H9S A;  1LT6 D;  3FPP A;  3E9H A;  5J3B A;  4FF1 A;  2ES2 A;  1PYB A;  3SR1 A;  1EU3 A;  2F0O A;  4DV7 L;  4M8A A;  1A2U A;  3I7F A;  3NTI A;  5IGD A;  1VQ8 A;  4OX9 Q;  4K6L A;  1R4Q B;  3X3N A;  3OTO Q;  2UXB L;  2PZT A;  1VQA A;  3NPP A;  1ZYR D;  4FP5 D;  3H0G H;  3L2P A;  3HOW H;  4A3I G;  5FLX E;  4PQX A;  5HGT A;  2OWO A;  3TQY A;  2N49 A;  1E7Z A;  1Z47 A;  4NMZ A;  4AYB G;  3CD6 A;  3BU2 A;  2AHO B;  1ML0 D;  3VR3 A;  1HHV A;  3DWA A;  4DV1 L;  4L63 B;  3U9O A;  2UXD L;  2DJG C;  1A6X A;  1BKB A;  4RCN A;  3V96 A;  1KC8 C;  4YIJ A;  2OTJ A;  3JAM i;  4DR4 Q;  4OEL B;  3CXC A;  1JB7 A;  2JA5 H;  1XMO Q;  1QB5 D;  2F0E A;  3M3Y H;  3CC7 A;  4JI1 Q;  1FJG Q;  3VA7 A;  3H3V I;  1VQO A;  4A93 B;  3CCJ A;  1PZK D;  3N52 A;  1HCZ A;  3C46 A;  1CK1 A;  3S17 H;  5C0X G;  3J80 E;  4OL7 A;  2E2J H;  4Q5V A;  5EGT A;  2HUG A;  2R7D A;  3S1R B;  3SK8 A;  4BBS B;  1T9H A;  3S1Q B;  1IBL L;  2K52 A;  2FMM A;  5GAH C;  2B2W A;  3S15 H;  5IYC H;  1YNX A;  3HGB A;  4MHE A;  4IPG A;  2OXP A;  3FRP B;  5LHY 1;  5T1I A;  3F1Z A;  5EKL A;  3I55 A;  4OEM B;  1WTV A;  1DOK A;  2F0K A;  3P20 A;  2LXJ A;  2RVL A;  2JEB I;  1H9R A;  4KJO A;  4BWG B;  1E0B A;  4KN7 C;  1P8L A;  1QNK A;  2JSO A;  4A3F G;  2NTT A;  2FFK B;  3EIV A;  2EYP A;  3FHW A;  1EEF D;  3OPO A;  3CHB D;  3DXJ C;  4ZQ3 A;  2N3S A;  2L12 A;  3T1Y L;  4ID6 A;  4PV1 C;  1BOS A;  3BDO A;  1IBK Q;  4HSP A;  4IUP A;  3RN2 A;  3BZD B;  1EZ8 A;  1KAA A;  2EY6 A;  4J8Q A;  3MXP A;  4XXE A;  4HAE A;  1HA6 A;  4LFB L;  2MO1 A;  4EQ5 A;  4IFD I;  2HD3 A;  3ITP A;  2Z9H A;  1O78 A;  5JVG 3;  1LTG D;  5DLQ E;  1VQC A;  3DWP A;  1NCV A;  4OGQ C;  3U9S A;  3EFX D;  4JI2 Q;  2NWG A;  2WAC A;  4ALP A;  1CZG A;  2KEC A;  4NXN Q;  4V19 0;  1Q46 A;  1JJ2 A;  5C5M A;  3HOX B;  4HSV A;  1FR3 A;  1BF4 A;  4IAL A;  1AH9 A;  3PO2 G;  3K59 A;  2Y0S G;  1GUO A;  5A35 A;  4YWK A;  4A93 H;  1PRT B;  4HCS A;  5IP9 G;  3G7L A;  1ENF A;  5JPM C;  3S1N B;  5DAU A;  1HA5 A;  1MKH A;  2K5W A;  1QG7 A;  4AIM A;  1XPO A;  3S1R H;  1JJC B;  5LMN Q;  5IGB A;  4BBS H;  2GA4 B;  4BA2 I;  3S1Q H;  3AFP A;  5ELN A;  4CKC A;  2I46 A;  2D5D A;  3I4N B;  2HIX A;  1D1I A;  4LNQ A;  1X3Q A;  1B4O A;  1UEA B;  3HKZ E;  3UDI A;  4POG A;  2GVA A;  1B70 B;  1L0Y B;  4LF6 Q;  2K5V A;  1TY2 A;  3SDZ A;  1HTL D;  4DFA A;  4R4T A;  4HTH A;  3J81 c;  2YTV A;  3KLS A;  1YNN C;  2FJ2 A;  2IJ0 A;  2E5L Q;  3KF6 B;  5H1S E;  4RGM A;  5IYB G;  3AEV A;  2A73 B;  4I65 A;  4K8J A;  3CAM A;  4IPC A;  1AP0 A;  3R8B A;  3MXN A;  1B2T A;  1CSP A;  5ELB A;  3SK5 A;  2DY8 A;  5G3L D;  3ONA B;  2B63 B;  3VDY A;  1S5B D;  1GM5 A;  2BDN A;  5FLM G;  5M5Y B;  1SNQ A;  1QUQ A;  1KTK A;  1VQK A;  1X65 A;  1D7Q A;  2R3Z A;  2VUM G;  2KA7 A;  1L2F A;  1N8R C;  2F0G A;  3QJY A;  2JQO A;  1K8O A;  1VQP A;  3UDX A;  3T16 A;  3CQZ B;  3RD4 A;  1PFB A;  1PRT C;  4GN5 A;  4OWX B;  3PV0 A;  2IL8 A;  2XNA C;  3FP9 A;  4YWL A;  4DR7 L;  3FPU B;  2AWO A;  4G7Z C;  2GN5 A;  2I07 B;  1M4V A;  3S1N H;  1HR0 W;  2CWP A;  2G9D A;  4ME5 A;  1J5E Q;  3RZD B;  2WKC A;  1XNR L;  2UXB Q;  3RUZ A;  2RCF A;  1EY5 A;  4XQN A;  5IY0 A;  3DEP A;  4BBR G;  1S3O A;  2WII B;  1CHQ D;  2BDO A;  4X3T A;  4NW2 A;  1CHP D;  2QF7 A;  1CFM A;  4LJZ C;  3T13 A;  4NXM Q;  3I4N H;  3I56 A;  4NKL A;  2CQA A;  2L1B A;  2VZA A;  1H9K A;  2RHQ B;  3F8T A;  1EY9 A;  4B08 A;  3KLW A;  4YY3 L;  3VA5 A;  3NBH A;  1SSO A;  2ZM6 L;  1DM0 B;  3A54 A;  2J7Z A;  5G3L F;  5BR8 L;  1SRO A;  5C3X A;  2Q2H A;  1EQT A;  3GTG B;  4FXG C;  3A8J E;  4V0B A;  4KV6 A;  1TS2 A;  1A15 A;  1DXM A;  5CV7 A;  5A2Q E;  4AQY Q;  2J0T D;  5HY6 A;  1IW7 D;  4YCU A;  1E24 A;  3W2D A;  4A4I A;  4A3B B;  1B3A A;  1V8Q A;  1HZA A;  1TS3 A;  4ZKB B;  3I73 A;  4XT1 B;  3F2U A;  5GAE C;  2PO4 A;  2B63 H;  2YYZ A;  1CKO A;  2EY2 A;  5E3F A;  3SXH A;  4TSS A;  5M5Y H;  3GO5 A;  1SNC A;  4POF A;  1IBL Q;  2HCI A;  2RDF A;  1FD7 D;  1WTR A;  3DLL A;  1IXR A;  4RWS C;  3HG9 A;  3JAM L;  1CSQ A;  1L1O C;  3E5S A;  3NP8 A;  4RHR A;  1VQF A;  2UUC L;  1W6J A;  1JT8 A;  2C5C A;  4LK1 C;  3NEN A;  1M8A A;  3CQZ H;  3FDT A;  2XIW A;  2NBF A;  3GTJ B;  3G4S A;  3BVM A;  4DK1 A;  3K6O A;  5EKI A;  2K5D A;  3K8A A;  5ELD A;  1U0L A;  2F52 A;  3OTO L;  4NP5 A;  5I2X A;  5C44 G;  1LYL A;  1WFQ A;  1VQI A;  1O7Z A;  1SE3 A;  4A3I B;  1LO5 D;  4GOP B;  3S2H B;  4CDE C;  4JCV E;  1K9M C;  2F0N A;  5L37 A;  3RZD H;  4CKB A;  4DR2 Q;  3I4L A;  1ASY A;  1PTO D;  4KKT A;  3M4P A;  1UWV A;  3JC6 6;  1JOQ A;  1FNV A;  1Z6H A;  3A8K E;  4FYD A;  2ZTC A;  4DA2 A;  3D3R A;  1SXT A;  1ROD A;  1GKH A;  1XNQ L;  2A74 C;  3KDF A;  1STY A;  1UE5 A;  4LFB Q;  1U4R A;  2D0O A;  2R61 A;  4RKB A;  1PZI D;  1K0S A;  4CKE A;  1BCP B;  1OXT A;  4BY7 B;  1B9M A;  3EBE A;  4JI1 L;  1FJG L;  1E2V A;  3TME A;  4EQP A;  2F0W A;  3GTG H;  4AYB E;  2XVS A;  3PUY A;  4J1M A;  2C9O A;  1MJC A;  5FJ8 G;  4M1U B;  3PUW A;  2BE5 C;  1C48 A;  1O80 A;  4JVZ A;  2QKI C;  4DK0 A;  4BXX H;  3ER0 A;  4MN3 A;  1WTQ A;  4RA8 A;  3RR5 A;  3HKZ G;  2WB1 E;  3ULP A;  5CV4 A;  4DR3 L;  4KY5 A;  4A3B H;  1ILP A;  1I50 B;  1SYG A;  2WAQ E;  2KUM A;  1LTR D;  4DV5 Q;  4PMW A;  4MNO A;  3PCO B;  3ULJ A;  2F0P A;  1H95 A;  3CCM A;  1S40 A;  1I5F A;  1SN8 A;  4GLX A;  2K50 A;  3KYH C;  3F2D A;  3MFY A;  4KMU C;  3RLN A;  4EVO A;  3J81 E;  1GUW A;  3GTQ H;  1MBY A;  3Q22 A;  1XXG A;  2E74 C;  5IP7 G;  4OO1 H;  2HQE A;  1DD2 A;  1KQS A;  5D14 A;  4GZY C;  1VF5 C;  1PTO F;  5CGK A;  2FXQ A;  2B29 A;  4O0A A;  3RZO B;  2KHS A;  3EN2 A;  4TRD A;  1OXS C;  1T5X D;  4A3F B;  2HT1 A;  3C1E A;  3GTJ H;  1UUP A;  1ET6 A;  5DEH A;  4JC0 A;  3H6M A;  1TKW B;  4GOP C;  1Y1W G;  5EPL A;  4XQQ A;  1TWG B;  2K5H A;  3NTH A;  1A3U A;  1KDC A;  1IBK L;  1V1Q A;  4A3I H;  2WP8 J;  2HCC A;  2F0Q A;  2CFM A;  4KN4 C;  5C0X J;  1HZB A;  5C3E G;  1Q1B A;  4PZ8 A;  3DMU A;  1SFO B;  3OW2 A;  1F2L A;  2R93 B;  1LLR D;  3K58 A;  4R4Q A;  1BCP C;  5M5W B;  2I0Q A;  4JI2 L;  5IE8 A;  5IGC A;  1YBY A;  3HOV G;  4BY7 H;  3PO2 B;  1ZEQ X;  4IJH A;  4IUR A;  1XTC D;  4XTC S;  3D6W A;  3AFQ A;  4OWW B;  1SBB B;  3L7Z C;  1PYW D;  5C0X H;  2L5T A;  1X3G A;  2UUB L;  3MEF A;  1A3T A;  3FKI G;  1XWE A;  4X3K A;  3WDN A;  2EXD A;  4DR7 Q;  1FNU A;  4QCL A;  2EJM A;  5LMN L;  1GHJ A;  1QIL A;  1I50 H;  1O7L A;  4DR5 L;  3T56 B;  1VQ6 A;  3MXU A;  3S24 A;  3TS2 A;  1C9O A;  2AQ1 B;  3A74 A;  2MJ8 A;  4ULL A;  1XNR Q;  2DJF C;  2LSS A;  4AH6 A;  3KF8 B;  3U4V A;  5DNF A;  1JOK A;  3FVQ A;  3NHH A;  5I9P A;  4LF6 L;  3JAM c;  2PMZ E;  1STB A;  3CCL A;  3BJU A;  3CRK C;  2Z6B A;  3EA6 A;  2F0I A;  1YJ9 A;  5D3D A;  3RZO H;  1PFS A;  4A3C G;  2K6A A;  4DV4 Q;  4WRD A;  1GUG A;  2ZM6 Q;  5HGQ A;  4A3F H;  5CV6 A;  4PZ6 A;  5JVH 3;  2PQA A;  1QCB D;  4HIK A;  1E2Z A;  5BR8 Q;  5I6Y A;  1RCV D;  3L9A X;  4N9T A;  5BN4 A;  2KOL A;  5E7N A;  1TWG H;  4C3H G;  4LF7 L;  3J80 i;  1EY4 A;  4K2K A;  4PMC A;  1B44 D;  1PH6 A;  2CWA A;  3BVZ A;  1Q3L A;  3B6Y A;  3A8I E;  1WOC A;  3UE1 A;  4KY7 A;  1CTM A;  1BBW A;  4H44 C;  3A55 A;  2M2L A;  3SK6 A;  1WJJ A;  3S16 B;  2UUA Q;  1SFO H;  1DGS A;  3BDL A;  2EYF A;  2VUM B;  1L0X B;  2RSO A;  2R93 H;  3C3L A;  1I4Q A;  4A3D B;  5M5W H;  4DPG A;  4P71 A;  5EBC A;  1KRT A;  1OO9 B;  1SJH D;  3W3A A;  4GNX C;  3DM1 A;  3PO2 H;  1TS4 A;  2IPK D;  1WCM B;  4A76 A;  2UXC L;  2UUC Q;  2BOS A;  2F0M A;  2K4K A;  1EY0 A;  3MZ5 A;  5IP9 H;  3WOE A;  3QIA A;  3H3V C;  4DR6 Q;  3ND9 A;  4UAI A;  1PH2 A;  2UU9 Q;  3TBI B;  2KED A;  1JJG A;  1J5E L;  3H3V H;  4MZ9 A;  1Z7T A;  4JI0 L;  2MFI A;  1LTI D;  4PG3 A;  3Q23 A;  2ZTD A;  1FGB D;  2ASB A;  1CZW A;  1PXU A;  2EYL A;  4KKU A;  4N8F A;  2KQ3 A;  3UDG A;  2MHV A;  4NXM L;  2QDL A;  2B2T A;  4F8M A;  1AN8 A;  4IPD A;  2XTI A;  5C3W A;  1PZJ D;  2F03 A;  5M5X B;  4JBM A;  3M7N A;  3Q8D A;  2IT1 A;  2HHH L;  1A63 A;  3PMF A;  2WFW A;  2JA7 G;  5GRO A;  1XNQ Q;  2B2Y A;  3DM3 A;  1EFW A;  4P73 A;  2NVQ B;  3I2Z A;  2WB1 G;  3Q24 A;  3CMA A;  2WAQ G;  3STB C;  2CVR A;  4A3M G;  2QCP X;  1SJE D;  4AQY L;  4IFD J;  2AMC B;  3L3O C;  3PGZ A;  2R7F A;  3AQQ A;  4QIW E;  2QEJ C;  4IZ8 A;  4IJL A;  4PMB A;  3M85 A;  2EE1 A;  4UDU C;  4DV6 L;  1D8L A;  2O5I C;  1EIH A;  3GV6 A;  4XYQ A;  1KDB A;  4IUV A;  3ZYY X;  2N8N A;  5FLM H;  5JEA J;  1SRU A;  4A3K G;  4DR3 Q;  3S16 H;  2K32 A;  2G5D A;  3LWE A;  2VQF L;  1I6H B;  2VUM H;  2WV6 D;  5C5L A;  3CPF A;  4Y7N B;  2D9U A;  1DON A;  4BY1 G;  2HDM A;  1TVX A;  1YJN A;  4A3D H;  3P7J A;  4IQZ A;  4DV3 L;  2NYZ D;  1C4Q A;  5C4J B;  2MO0 A;  2A69 C;  3KK7 A;  3GQB A;  5C4Z A;  4XT3 B;  4IFD H;  2LY7 A;  3HRZ C;  1WCM H;  5M9O A;  4ZLT F;  4R8N A;  3BYY B;  3GP7 A;  2RDG A;  4ILW A;  5CR3 A;  1KHI A;  1YNN D;  5C44 B;  1GO3 E;  1QNU A;  4OIJ A;  1U5K A;  5JJK A;  1QUQ B;  5JEA H;  2EXZ A;  3R2T A;  4KJN A;  4X62 L;  1G8Z D;  1WTH A;  4CHT B;  3K7A B;  2F0L A;  2KEN A;  1OXX K;  4DR2 L;  1SNO A;  1Y8P B;  5BN5 A;  5K36 G;  1J8I A;  1AEX A;  4QMG A;  1PHJ A;  1MIU A;  5I9O A;  3CC4 A;  3TS0 A;  2Z1C A;  4FDB A;  2F0T A;  1FGU A;  2R92 G;  4CDC C;  5M5X H;  4EQN A;  1RJT A;  4YCV A;  3H09 A;  1VQ4 A;  2F0U A;  2OEO A;  1GJX A;  2EY1 A;  4EQO A;  1JQY D;  4L8J A;  4WJ4 A;  3CRL C;  1NJI C;  3HZX A;  3TN2 A;  5EQ0 A;  2NVQ H;  3I4M G;  4UP8 A;  2K28 A;  5EBD A;  1X55 A;  2JEA I;  1PRT D;  3S1M B;  1Q90 A;  2E75 C;  5KYL A;  4A3L G;  4YWM A;  1KAW A;  4CDD C;  2VNU D;  1GUN A;  5C4H A;  2UUB Q;  1JCK B;  3WWV A;  3NBH B;  3M4Y A;  4DV5 L;  2XWB B;  3CKI B;  2Q8R E;  2NZH A;  2JA8 B;  1U4P A;  3HKS A;  4WJ3 M;  2EYH A;  4JI4 Q;  4JI7 Q;  3JAM E;  4DR5 Q;  3PIP A;  1I6H H;  2A19 A;  1EWI A;  4Y7N H;  1MSG A;  3HOY G;  4G7O C;  5KIX A;  1AE3 A;  1W2B A;  5C4J H;  3OWF A;  3OIQ A;  4KY6 A;  4DUZ L;  1HNZ L;  4DXF A;  3I8Z A;  4KI0 A;  3ERQ A;  3NQI A;  5EJW A;  2GVB A;  1D5X C;  3HOW G;  4JBW A;  4DV2 L;  3ERS X;  4A3J G;  2K33 A;  1EIG A;  4P72 A;  4JYA L;  2NVT B;  5FO9 B;  2N78 A;  3MEH A;  3K7A H;  3BVG A;  1LM0 A;  4LF7 Q;  2JE6 I;  1STN A;  2B2V C;  3VR4 A;  4Z9C B;  4IPH A;  4HN7 A;  4IUT A;  1GOZ A;  4LF8 Q;  1G6P A;  1PRT F;  4P74 A;  1NTG A;  4C1N I;  3T4A C;  5IGF A;  2IY5 B;  2ZTE A;  2JA5 G;  3RLO A;  4LFC Q;  3HOV B;  3T1H L;  2HIV A;  4B9X A;  1X32 A;  3PQI A;  4FO2 A;  1HR0 Q;  4R9W A;  5NUC A;  1HH2 P;  1YI2 A;  1TWH B;  1NR4 A;  2SNS A;  2EYM A;  2V1C C;  2SEB D;  5KND A;  1HUM A;  2VW9 A;  4N9P A;  1SE2 A;  5I6W A;  3LNN A;  1UE7 A;  1V1P B;  3HOX H;  1CKN B;  5E4X A;  2NN6 I;  2UXC Q;  1LTA D;  1QOH A;  3S1M H;  1MGS A;  1B53 A;  1V9P A;  4H02 A;  3ICE A;  1SYB A;  4LUZ A;  3K57 A;  1XMQ Q;  4J6H A;  1KD1 C;  1PH7 A;  2QW7 A;  3IFD A;  3OOC A;  2AWN A;  3TRZ A;  2JA8 H;  1JC7 A;  1YJW A;  1HXY D;  4JI0 Q;  3DHQ A;  4C1N K;  2XRS D;  4DAY A;  2H4O A;  1RKN A;  1LTL A;  1K8A C;  5IP7 H;  2DN8 A;  1N32 Q;  3C1F A;  2XWJ B;  2RQX A;  4GKJ Q;  4H7B A;  4DV4 L;  2HHH Q;  5E1F A;  1A3V A;  1ENC A;  1SE4 A;  3LGJ A;  3N6R A;  2MPM A;  1YIT A;  1SNP A;  4O2D A;  1NSN S;  1S4Z A;  3Q0A A;  4DN4 M;  1CA6 A;  5IWA L;  2V4D A;  2A6E C;  1G29 1;  5IGG A;  2BE5 D;  2ZXR A;  1DOM A;  1D6E C;  2KBN A;  5EPJ A;  4K2L A;  1L0W A;  2NVT H;  1IBM L;  3K80 C;  1GHK A;  1SR3 A;  1RL2 A;  4X66 Q;  1IYJ B;  3IAY A;  3NE5 B;  3KOJ A;  1DOL A;  4DV6 Q;  2UUA L;  1NUC A;  3F2B A;  3SGI A;  1E2W A;  1PMR A;  2C35 B;  4QJF A;  1YEZ A;  4DV0 L;  4X6A H;  3KJP A;  2F0D A;  2K75 A;  3W1B A;  1Y14 B;  3J81 i;  2OF1 A;  3OIP A;  4QUC A;  2VQF Q;  3HOV H;  1FYC A;  1U9R A;  3K7U C;  3PO3 B;  2NVX B;  4LMQ D;  2Q2I A;  5EKK A;  1EQQ A;  3R3O A;  4A93 G;  4DNI A;  1TWH H;  4QY7 A;  4QB4 A;  4DV3 Q;  3SK4 A;  3X3M A;  2JJQ A;  2NVY B;  2Q2T A;  4DXG A;  1F9P A;  2PZU A;  4DR6 L;  2UU9 L;  2LS0 1;  1S5E D;  1SMY C;  4BBS G;  4HMJ A;  3NEM A;  1SNM A;  3NK9 A;  1JWS D;  1Q8K A;  4JI8 L;  1S5F D;  1JMC A;  4X62 Q;  2NN6 G;  1SE8 A;  3SHL A;  3K81 C;  3MVV A;  4JOI C;  4AYB B;  3P75 A;  4KK7 A;  4R4C A;  3S9W A;  4YHH L;  3PIP 3;  2A6H C;  3D4W A;  1QWY A;  1ENA A;  1F2Z A;  1I3Q B;  1A62 A;  4GKK L;  3G48 A;  4LAA A;  1BCP D;  4B3T L;  4KHP L;  1H9M A;  2WB1 B;  1DJR D;  2BH2 A;  4JBJ A;  4A3C H;  2WAQ B;  3KUP A;  1EQR A;  4Y52 H;  1LAC A;  4A3M B;  5ELO A;  2PNH A;  1BQQ T;  1CUK A;  1S5C D;  4QF4 A;  1L1O A;  4TQU S;  2F0F A;  2ZJR A;  3PUV A;  1FVI A;  4Q0F A;  1I94 Q;  1HZC A;  2E76 C;  4U67 3;  2DNC A;  5I2Y A;  1TU2 B;  2KHI A;  2G9H D;  1IKM A;  2BH8 A;  4ZKC B;  4RMF A;  3E9I A;  2LKV A;  3TRE A;  2LXK A;  3GTK B;  4ZAI A;  3J81 j;  1WD1 A;  4LF9 L;  2I5L X;  3NQT A;  1VQ9 A;  2PQA B;  4J15 A;  4BY1 B;  3PF5 A;  3S2D B;  3H94 A;  2EIF A;  3GTO B;  3PO3 H;  4FF4 A;  3CF5 A;  2NVX H;  2MP1 A;  4RGO S;  2VL6 A;  2A68 C;  5LMU L;  3FEW X;  2Z6K C;  4U68 A;  3T51 B;  2Q2U A;  4CJ0 B;  1KXL A;  2NVY H;  1TT2 A;  1I4G A;  2DGY A;  1KNE A;  1VCI A;  3PUX A;  3PF4 A;  1D1K A;  1AZP A;  4DUZ Q;  1HNZ Q;  1EUJ A;  2KHJ A;  5CV8 A;  2IW3 A;  3GDE A;  1BCP F;  2PI2 E;  4DV2 Q;  3I4N G;  3U58 A;  1B3Q A;  4JYA Q;  3S2H H;  4DF7 A;  3E0E A;  4LUV A;  1H9S B;  1PH9 A;  2E2H B;  2R92 B;  2SOB A;  1K73 C;  2QEX A;  1XX8 A;  3I70 A;  2H1E A;  4CJ1 B;  1I6V C;  2JYO A;  1ONL A;  1IYV A;  1I3Q H;  2X6G A;  4LUO A;  1F9Q A;  4DAP A;  3I4M B;  2KCN A;  1X56 A;  3I90 A;  3QR8 A;  5M3F G;  1JWM D;  4X65 L;  1LTT D;  3T1H Q;  1A2T A;  2FIN B;  2M00 A;  4KLK A;  4C2M B;  1C7Y A;  3BZK A;  4DK3 C;  5EPK A;  4A3M H;  2B2U C;  1U4M A;  3KLS X;  2Y0S B;  2ZXP A;  3CCU A;  1N36 Q;  3AYH B;  1E1T A;  4IN3 A;  1KAB A;  1VMC A;  2MNA A;  1MJE A;  2K03 A;  2KCT A;  2YV5 A;  1Y69 U;  1EIY B;  4B3R L;  3K5M A;  4JG2 A;  5D65 A;  4DAM A;  2EOT A;  1JB3 A;  2B63 G;  2ID0 A;  5JJZ A;  2PMZ B;  4F88 A;  3VR6 A;  4B3S Q;  1JE4 A;  4XDX A;  4K0K L;  1CQV A;  1F77 A;  2LMC B;  4JI4 L;  4JI7 L;  2QIL A;  3GTK H;  1ESF A;  1UAP A;  1VQG A;  1BNZ A;  4F7X A;  4R1J A;  2AKW B;  1HNX L;  4K5W A;  5IYD G;  4BY1 H;  1LUZ A;  1K0R A;  3HOY B;  3S2D H;  1LT3 D;  1PH5 A;  1SYC A;  2EDG A;  3K0X A;  4WJW A;  2L9H A;  3CU7 A;  1G91 A;  3GTO H;  2K5Q A;  3EQL C;  1WYD A;  1PA6 A;  2RF4 A;  2ICI A;  1O7I A;  3W5O A;  3TZD A;  1N34 L;  1Z9F A;  1JOR A;  1UNS A;  3A7L A;  1JE5 A;  4A3J B;  5LL6 S;  1X6O A;  2K14 A;  3STB D;  1YNJ C;  1J6Q A;  3NEL A;  4K5V A;  3SE0 A;  1Y1V G;  4DR1 L;  1EY8 A;  5LL6 X;  3GTM B;  2PI2 A;  4KHZ A;  2H5X A;  2F4I A;  2CH4 A;  5IWA Q;  4K8I A;  2A5H A;  1VDZ A;  4DUY L;  2I5H A;  4IO9 A;  3HOZ G;  4HJ8 A;  4LF8 L;  1IBM Q;  1V43 A;  3MFG A;  4HCE A;  1CI3 M;  2E2H H;  2R92 H;  4NB3 A;  5FOB B;  4FVM A;  4CDF C;  4LFC L;  1ICF B;  4RGN A;  1E3P A;  3D4D A;  4DV0 Q;  4IOC A;  1HR0 L;  3V05 A;  3OYY A;  3BS1 A;  3NUC A;  2F4V L;  4LW1 A;  4LFA L;  1VQN A;  2XRQ D;  3I4M H;  2R7Z G;  2F0J A;  4YCW A;  5T1G A;  2A69 D;  1HNW Q;  1BVS A;  1RHP A;  5IIF A;  4C2M H;  2JXM B;  3MTS A;  2SDF A;  1XPU A;  2KJX A;  2OQ0 A;  4A3L H;  4GN3 B;  1R9T B;  3E6Z X;  4A3B G;  4A75 A;  4OHJ A;  2AQ2 B;  1EY6 A;  3VYR A;  1WTO A;  1HPC A;  2VB2 X;  1PH8 A;  3MAQ A;  1GUS A;  1Q12 A;  1XMQ L;  1ZKO A;  1K8M A;  4X3S A;  3HEJ A;  2WIN B;  4JV5 L;  1J9O A;  4UY8 C;  4BBR B;  3M4O B;  5JAV A;  4HJA A;  5ELE A;  1QVC A;  2OT2 A;  4JI8 Q;  2K7V A;  1LT5 D;  1LAB A;  2L11 A;  3D4R A;  1K8G A;  4OO1 G;  2E2D C;  1PH4 A;  3AU7 A;  3UE0 A;  3J81 L;  3HOY H;  3A5Z B;  1N32 L;  4RG1 A;  4K6D A;  4QIW B;  4GKJ L;  2EYO A;  4YHH Q;  1X54 A;  1AZQ A;  3WOF A;  4DK6 C;  1N9W A;  3A7A B;  4GKK Q;  5J22 A;  4B3T Q;  3VR2 A;  4KHP Q;  3HFZ B;  3R2I A;  1RF2 D;  2O4X A;  3QG1 A;  4A3J H;  5IOC A;  2B2W C;  1KL9 A;  1VQJ A;  5IYB H;  4GNX A;  3AMU A;  2IHF A;  2TSS A;  3VYT A;  4H13 C;  3CCQ A;  1A0I A;  1IHZ A;  3GTM H;  2IX1 A;  4L5S A;  2EYJ A;  1WTX A;  4X66 L;  3GD7 A;  3M7G A;  1TQO A;  3RMH A;  1PFN A;  4KTA A;  2X69 A;  3UDF A;  2KVM A;  3TDQ A;  3I72 A;  2E8G A;  4A3E G;  1QE6 A;  1IL2 A;  1XJV A;  2BA0 A;  3PUZ A;  2D2C C;  4K5X A;  4LF5 Q;  4BY7 G;  4LF9 Q;  3KF8 A;  4ABN A;  3OMG A;  2CCZ A;  2CW0 D;  3H91 A;  4L5R C;  4HJ5 A;  1Q82 C;  1SAP A;  1B8A A;  3MXG A;  3G71 A;  4LF4 L;  4APV A;  1K28 A;  4MTK A;  1G6Z A;  4OXP A;  3CCS A;  1Y8N B;  1SLJ A;  3MXN B;  3AB9 A;  2ICE C;  5CBA E;  5KGU A;  3MC0 B;  1HJP A;  1ESR A;  4F87 A;  5K5P A;  1E22 A;  3OSO A;  1WI5 A;  5EAY A;  5LMU Q;  1OXV A;  2K1B A;  2YTX A;  1R9T H;  3PSI A;  2ZXO A;  4RKL A;  2MUY A;  1D5Z C;  2PZW A;  1CQF A;  5JPN C;  4P2C B;  5IGE A;  1I4P A;  2DY7 A;  5C4X G;  4ZUJ A;  5FK9 C;  5DM7 3;  4PNY A;  3A0J A;  4DKA C;  2L55 A;  1EL0 A;  4BBR H;  3M4O H;  2XN9 C;  2IX0 A;  1BBX C;  3GV3 A;  3LX0 A;  4TVA B;  1I4X A;  1QVG A;  1EYD A;  5TSS A;  4FXK C;  3F2C A;  1SDF A;  3TP6 A;  3J7A 5;  2JA6 G;  2O5J C;  4UPA A;  1N33 Q;  5M3M G;  5F2D A;  4UP7 A;  2L4N A;  1P16 A;  3VYU A;  3VR5 A;  4JK1 C;  1WTP A;  3OHX C;  1RIP A;  2RSN A;  1ZYR C;  1EYA A;  2QGQ A;  4X65 Q;  3NTK A;  1TXY A;  3A5U A;  5KNB A;  4DAY B;  5CMD A;  2WKD A;  1I94 L;  1NBW A;  1EQV A;  3MA2 B;  4HIM A;  1VQL A;  3HKZ B;  1PH3 A;  4C3I G;  3OWE B;  2VQE L;  1DCZ A;  4B3R Q;  2K04 A;  1QZH A;  3HOU G;  1BDO A;  3ERO A;  5KEE A;  2R93 G;  4A3G G;  2ZJP A;  1GD7 A;  1HUN A;  1K83 B;  4C3J G;  1OTC A;  2E2I B;  5J39 A;  4K0K Q;  3K5O A;  1X3P A;  1WD0 A;  2EVB A;  5FKA C;  4DGZ A;  1ILQ A;  2EZV A;  1HNX Q;  2VXW A;  1NMG A;  1EOT A;  2CW0 C;  1BUV T;  3O13 A;  3OMC A;  5IT9 L;  2EY5 A;  3I3C A;  4RGT A;  1MSH A;  5ELF A;  2MQH A;  2AUK A;  1KIX A;  3SEB A;  2JK8 A;  1VQH A;  4DNR B;  1I4H A;  1BBU A;  2F1M A;  3QO2 A;  4RAU C;  5KYI A;  5AJ3 Q;  4IUN A;  4DU9 A;  4IOA A;  1Y1W B;  1BXT A;  1N34 Q;  1UE1 A;  2K5N A;  4ZCK A;  3IKJ A;  5C44 H;  4MTN A;  1IKL A;  2FHT A;  2A6E D;  3H0G G;  1TWA B;  1G2T A;  2EQS A;  1ASZ A;  2L0C A;  1VF7 A;  3RNU A;  1YZ6 A;  4DR1 Q;  3R93 A;  2B39 A;  1UE6 A;  1PH1 A;  2NN6 H;  1H9J A;  1IL8 A;  5GQO A;  5C3E B;  5FLX L;  3J7Z C;  1ZXT A;  4DUY Q;  1Q7Y C;  1G51 A;  1M90 C;  3V2T A;  5DM6 3;  5LMN W;  1BO0 A;  1O7Y A;  4JI3 Q;  3QOJ A;  1RD9 D;  4HIO A;  2DNE A;  1GVP A;  1TS5 A;  1SMX A;  2ATW A;  5M3F B;  5JJL A;  1KNA A;  1NR2 A;  4GN4 B;  4G7H C;  3K5L A;  2EJF C;  1WVL A;  4JI5 L;  5ISR A;  4PZ7 A;  3D0F A;  2LFN A;  2OQK A;  3KLR A;  2Z4I A;  1F2Y A;  2BCO A;  2F4V Q;  1SEB D;  2IX3 A;  4LFA Q;  3CME A;  1HTP A;  1VQB A;  1X3E A;  1N36 L;  2EJG C;  5FJ8 H;  4ODG A;  1XTD A;  4XYO A;  2XSC A;  3NWT A;  4RHS A;  2YTY A;  4B3M L;  3FKI B;  1LT4 D;  3VYS A;  1QVF A;  1SMY D;  3J80 L;  2HQL A;  1CA5 A;  4B3S L;  3FMC A;  1FNW A;  4GLV B;  5D3I B;  3KDF B;  1D2B A;  4I7A A;  4G4K A;  3GTL B;  2NZO A;  2BA1 A;  1TR5 A;  3QWN A;  5IYC G;  1K83 H;  4DAV A;  2RHS B;  4A3D G;  4JV5 Q;  4B9W A;  5CYU A;  4CGY B;  2E2I H;  4FF2 A;  1L1O B;  1LV9 A;  3NXW A;  2B2V A;  4IFD G;  1EY7 A;  2KEE A;  3CP0 A;  1STE A;  2A6H D;  1WCM G;  3KBX A;  4L5T A;  1C0A A;  4E6I A;  1K3R A;  1BR9 A;  3I4O A;  4DV7 Q; 
#chains in the Genus database with same CATH homology
 3A56 A;  1F9R A;  2SNM A;  3D31 A;  3Q6S A;  3BDC A;  5JEA G;  1STA A;  1Y1V B;  3MHB A;  1KDA A;  2QDB A;  3NSW A;  1B9N A;  2B8F A;  4KKS A;  4C3H B;  4L6T B;  4KD4 A;  2Q8T A;  3HOZ B;  1MI2 A;  3BYT B;  5CV5 A;  2NTS A;  2F3V A;  2HDL A;  3URY A;  4KHV A;  2D62 A;  2AQ3 B;  2AUJ D;  2NUC A;  1CM9 A;  3EVQ A;  3RLF A;  1DYQ A;  5CBE E;  5E4W C;  3NWS A;  3GTP B;  2ZT9 C;  2R7Z B;  1HQM C;  1Q8I A;  3J7A F;  2JP1 A;  3T53 B;  2A68 D;  1JWU D;  2VB3 X;  4H0L C;  5IOD A;  4NDX A;  4ZUI A;  1II3 A;  3J7Y W;  3QB3 A;  4O1N A;  3GTQ B;  4RCO A;  1T5E A;  3DEO A;  1MD2 D;  4ZYS A;  2PW7 A;  1EYC A;  2RDH A;  1W6K A;  2PW5 A;  4I7Z C;  3ND8 A;  2JA7 B;  3D6C A;  1HRJ A;  1SYE A;  2N88 A;  4FF3 A;  1I4R A;  1JOO A;  4RH6 A;  1TWC B;  4C56 C;  1ET9 A;  1EWC A;  2Q8I B;  4FNF A;  4BA1 I;  2X6L A;  3BG3 A;  1V1P A;  1GUT A;  4HR7 B;  3DUZ A;  4DNT B;  2EPB A;  4ZK9 B;  1PTO B;  3TP5 A;  1HFN A;  4WOR A;  2KCC A;  2MGS A;  1STG A;  4A3E B;  5CV9 A;  4A3K B;  1KLU D;  4R8I A;  2F0H A;  1NAP A;  1RTN A;  4XQJ A;  2PYK A;  4CJ2 C;  2ENB A;  1PDQ A;  2NB0 A;  5COY A;  1JR0 D;  1RTO A;  3EJI A;  1STH A;  2YU9 B;  2TMP A;  3TP8 A;  1IW7 C;  2F0S A;  1EFI D;  4BS9 A;  3J7A V;  2RBM A;  2IWH A;  5JOB A;  5C4X B;  1YNJ D;  3I91 A;  5COR A;  1OXU A;  4TKO B;  3UI2 A;  2NZ1 D;  3K0Y A;  4X3U A;  3IL8 A;  5BN3 A;  1TY0 A;  3HS0 C;  3IFT A;  2JA6 B;  4HED A;  1R4P B;  1AFP A;  5M3M B;  1EU4 A;  1GXD C;  2O2L D;  2K05 A;  3NBI A;  1ICW A;  3TZU A;  3S14 B;  4KD3 A;  4O42 A;  3SVM A;  4CBV A;  4EGV A;  1D5M C;  2FMC A;  3DWQ A;  5J1Z A;  1TWF B;  1LTS D;  4HMI A;  2K01 A;  4ZRZ A;  4C3I B;  1PTO C;  2RKS A;  4RFB A;  5A2Q L;  1SYD A;  3C2P A;  3HOU B;  2PQE A;  1PTO H;  4OO1 I;  2J4X A;  2PCF B;  4A3G B;  4C3J B;  4XIG S;  2M9V A;  1SND A;  1VMP A;  4OIK A;  1B50 A;  1IYU A;  5ELC A;  2Z4H A;  1DZ1 A;  3E0J A;  3LWU A;  1KLG D;  4S3S A;  1HFG A;  1EEI D;  1C8C A;  1JIC A;  1QJO A;  2F3W A;  5I4D A;  1Y8O B;  3H0G B;  3HOW B;  3KBG A;  3D8G A;  3MWY W;  1EZ6 A;  3TP7 A;  5CC4 A;  2B2U A;  1WTW A;  4IUU A;  5FO8 B;  1U4L A;  3TSS A;  1RDP D;  2RA4 A;  5K36 H;  2Z8L A;  1EWH A;  2F0V A;  1Q1E A;  2PNR C;  1HQR D;  3P1H A;  1G2S A;  1PLF A;  1B1Z A;  5C0X I;  2JA5 B;  4K14 A;  3OW7 A;  3K5N A;  3M3Y B;  3QOL A;  1LTB D;  2R6G A;  1SYF A;  5C6A A;  3HP3 A;  4QUF A;  5KRU A;  2B8G A;  3S17 B;  1F9S A;  5HUR A;  2E2J B;  2B2T C;  4G57 A;  4IUQ A;  3G6J B;  5KNC A;  1F2M A;  3PIO 3;  1CT1 D;  1V1O A;  2PPB C;  1S5D D;  4MIU A;  2N55 A;  3S15 B;  4WFN 3;  2B2Y C;  5FO7 B;  2CHB D;  1TII D;  1AW7 A;  4FXD A;  5AFW A;  1PFM A;  5IT9 E;  1XYI A;  1H9S A;  1LT6 D;  3FPP A;  4FF1 A;  3SR1 A;  1EU3 A;  2F0O A;  4M8A A;  1A2U A;  3NTI A;  5IGD A;  4K6L A;  1R4Q B;  3X3N A;  2PZT A;  3NPP A;  1ZYR D;  4FP5 D;  5FLX E;  4PQX A;  5HGT A;  1Z47 A;  4NMZ A;  1ML0 D;  3VR3 A;  1HHV A;  3DWA A;  4L63 B;  3U9O A;  1A6X A;  4RCN A;  3V96 A;  4YIJ A;  1QB5 D;  2F0E A;  3VA7 A;  4A93 B;  1PZK D;  3N52 A;  1HCZ A;  3C46 A;  1CK1 A;  5C0X G;  3J80 E;  4OL7 A;  4Q5V A;  5EGT A;  2HUG A;  3S1R B;  3SK8 A;  4BBS B;  3S1Q B;  2FMM A;  2B2W A;  3HGB A;  4MHE A;  2OXP A;  3FRP B;  5LHY 1;  5T1I A;  5EKL A;  1WTV A;  1DOK A;  2F0K A;  3P20 A;  2RVL A;  2JEB I;  1H9R A;  4KJO A;  4BWG B;  1E0B A;  4KN7 C;  1QNK A;  2JSO A;  2NTT A;  2FFK B;  2EYP A;  1EEF D;  3CHB D;  3DXJ C;  3OPO A;  4ZQ3 A;  2L12 A;  4ID6 A;  4PV1 C;  1BOS A;  3BDO A;  4HSP A;  4IUP A;  3BZD B;  1EZ8 A;  1KAA A;  2EY6 A;  4J8Q A;  3MXP A;  4XXE A;  4HAE A;  1HA6 A;  4IFD I;  3ITP A;  1O78 A;  5JVG 3;  1LTG D;  3DWP A;  1NCV A;  4OGQ C;  3U9S A;  3EFX D;  2NWG A;  2WAC A;  1CZG A;  2KEC A;  4V19 0;  5C5M A;  3HOX B;  4HSV A;  1FR3 A;  1BF4 A;  4IAL A;  3K59 A;  1GUO A;  5A35 A;  1PRT B;  4HCS A;  3G7L A;  1ENF A;  5JPM C;  3S1N B;  5DAU A;  1HA5 A;  2K5W A;  1QG7 A;  5IGB A;  2GA4 B;  4BA2 I;  4CKC A;  2I46 A;  2D5D A;  3I4N B;  1D1I A;  1X3Q A;  1B4O A;  1UEA B;  1L0Y B;  1TY2 A;  3SDZ A;  1HTL D;  4DFA A;  4HTH A;  3KLS A;  1YNN C;  2FJ2 A;  2IJ0 A;  4RGM A;  2A73 B;  4I65 A;  4K8J A;  1AP0 A;  3R8B A;  3MXN A;  1B2T A;  5ELB A;  3SK5 A;  2DY8 A;  5G3L D;  3ONA B;  2B63 B;  1S5B D;  2BDN A;  5M5Y B;  1SNQ A;  1KTK A;  2R3Z A;  2KA7 A;  2F0G A;  3QJY A;  1K8O A;  3T16 A;  3CQZ B;  3RD4 A;  1PFB A;  1PRT C;  3PV0 A;  2IL8 A;  2XNA C;  3FPU B;  2AWO A;  4G7Z C;  2I07 B;  1M4V A;  2G9D A;  4ME5 A;  3RZD B;  2WKC A;  3RUZ A;  1EY5 A;  4XQN A;  3DEP A;  2WII B;  1CHQ D;  2BDO A;  4X3T A;  4NW2 A;  1CHP D;  2QF7 A;  1CFM A;  4LJZ C;  3T13 A;  4NKL A;  2CQA A;  2L1B A;  1H9K A;  1EY9 A;  4B08 A;  3VA5 A;  3NBH A;  1SSO A;  1DM0 B;  3A54 A;  2J7Z A;  5G3L F;  5C3X A;  1EQT A;  3GTG B;  4FXG C;  3A8J E;  4V0B A;  4KV6 A;  1TS2 A;  1A15 A;  1DXM A;  5CV7 A;  5A2Q E;  2J0T D;  1IW7 D;  3W2D A;  4A3B B;  1B3A A;  1V8Q A;  1TS3 A;  4ZKB B;  3I73 A;  4XT1 B;  3F2U A;  2PO4 A;  2YYZ A;  2EY2 A;  5E3F A;  3SXH A;  4TSS A;  3GO5 A;  1SNC A;  2HCI A;  2RDF A;  1FD7 D;  1WTR A;  4RWS C;  3HG9 A;  3JAM L;  3E5S A;  4RHR A;  3NP8 A;  1W6J A;  2C5C A;  4LK1 C;  1M8A A;  3FDT A;  2XIW A;  2NBF A;  3GTJ B;  3BVM A;  4DK1 A;  3K6O A;  5EKI A;  2K5D A;  5ELD A;  4NP5 A;  5I2X A;  1O7Z A;  1SE3 A;  4A3I B;  1LO5 D;  3S2H B;  2F0N A;  4CKB A;  3I4L A;  1PTO D;  4KKT A;  1JOQ A;  1FNV A;  1Z6H A;  3A8K E;  4FYD A;  4DA2 A;  3D3R A;  1SXT A;  1ROD A;  2A74 C;  1STY A;  1U4R A;  2R61 A;  4RKB A;  1PZI D;  4CKE A;  1BCP B;  1OXT A;  4BY7 B;  1B9M A;  1E2V A;  3TME A;  4EQP A;  2F0W A;  2XVS A;  3PUY A;  4J1M A;  2C9O A;  4M1U B;  3PUW A;  2BE5 C;  1C48 A;  1O80 A;  2QKI C;  4DK0 A;  4MN3 A;  1WTQ A;  4RA8 A;  5CV4 A;  4KY5 A;  1ILP A;  1I50 B;  1SYG A;  2KUM A;  1LTR D;  4PMW A;  2F0P A;  3MFY A;  4KMU C;  4EVO A;  3J81 E;  1GUW A;  1MBY A;  3Q22 A;  1XXG A;  2E74 C;  4OO1 H;  2HQE A;  1DD2 A;  5D14 A;  4GZY C;  1VF5 C;  1PTO F;  5CGK A;  3RZO B;  2KHS A;  4TRD A;  1OXS C;  1T5X D;  4A3F B;  3C1E A;  1UUP A;  1ET6 A;  5DEH A;  3H6M A;  1TKW B;  5EPL A;  4XQQ A;  1TWG B;  3NTH A;  1A3U A;  1KDC A;  2WP8 J;  2HCC A;  2F0Q A;  4KN4 C;  5C0X J;  1Q1B A;  3DMU A;  1SFO B;  1F2L A;  2R93 B;  1LLR D;  3K58 A;  1BCP C;  5M5W B;  5IGC A;  3PO2 B;  1ZEQ X;  4IUR A;  1XTC D;  4XTC S;  3D6W A;  1SBB B;  3L7Z C;  1PYW D;  5C0X H;  2L5T A;  1A3T A;  1XWE A;  4X3K A;  3WDN A;  1FNU A;  4QCL A;  2EJM A;  1GHJ A;  1QIL A;  1O7L A;  3T56 B;  3MXU A;  2AQ1 B;  2MJ8 A;  4ULL A;  5DNF A;  1JOK A;  3FVQ A;  3NHH A;  5I9P A;  1STB A;  3CRK C;  3EA6 A;  2F0I A;  5D3D A;  2K6A A;  4WRD A;  1GUG A;  5CV6 A;  5JVH 3;  1QCB D;  1E2Z A;  5I6Y A;  1RCV D;  3L9A X;  4N9T A;  5BN4 A;  2KOL A;  4C3H G;  1EY4 A;  4K2K A;  4PMC A;  1B44 D;  3BVZ A;  1Q3L A;  3A8I E;  4KY7 A;  1CTM A;  4H44 C;  3A55 A;  2M2L A;  3SK6 A;  3S16 B;  3BDL A;  2EYF A;  2VUM B;  1L0X B;  2RSO A;  3C3L A;  1I4Q A;  4A3D B;  5EBC A;  1OO9 B;  1SJH D;  3W3A A;  3DM1 A;  1TS4 A;  2IPK D;  1WCM B;  2BOS A;  2F0M A;  1EY0 A;  3MZ5 A;  3WOE A;  3QIA A;  3H3V C;  3ND9 A;  4UAI A;  3TBI B;  2KED A;  1Z7T A;  1LTI D;  3Q23 A;  1FGB D;  1CZW A;  1PXU A;  2EYL A;  4KKU A;  2KQ3 A;  2MHV A;  2B2T A;  4F8M A;  1AN8 A;  5C3W A;  1PZJ D;  2F03 A;  5M5X B;  3M7N A;  2IT1 A;  3PMF A;  2B2Y A;  2NVQ B;  3Q24 A;  2CVR A;  2QCP X;  1SJE D;  4IFD J;  3L3O C;  2QEJ C;  4IZ8 A;  4PMB A;  3M85 A;  2EE1 A;  4UDU C;  2O5I C;  1EIH A;  3GV6 A;  4XYQ A;  1KDB A;  4IUV A;  3ZYY X;  5JEA J;  2K32 A;  3LWE A;  1I6H B;  2WV6 D;  5C5L A;  4Y7N B;  2D9U A;  1DON A;  2HDM A;  1TVX A;  3P7J A;  4IQZ A;  2NYZ D;  1C4Q A;  5C4J B;  2A69 C;  3KK7 A;  3GQB A;  5C4Z A;  4XT3 B;  4IFD H;  2LY7 A;  3HRZ C;  5M9O A;  4ZLT F;  4R8N A;  3BYY B;  3GP7 A;  2RDG A;  4ILW A;  5CR3 A;  1YNN D;  5C44 B;  1QNU A;  4OIJ A;  5JEA H;  2EXZ A;  3R2T A;  4KJN A;  1G8Z D;  4CHT B;  3K7A B;  2F0L A;  1OXX K;  1SNO A;  1Y8P B;  5BN5 A;  5K36 G;  1J8I A;  1AEX A;  4QMG A;  5I9O A;  2Z1C A;  2F0T A;  4EQN A;  1RJT A;  3H09 A;  2F0U A;  2OEO A;  1GJX A;  2EY1 A;  4EQO A;  1JQY D;  4L8J A;  3CRL C;  3HZX A;  3TN2 A;  5EQ0 A;  2K28 A;  5EBD A;  2JEA I;  1PRT D;  3S1M B;  1Q90 A;  2E75 C;  5KYL A;  2VNU D;  1GUN A;  5C4H A;  1JCK B;  3M4Y A;  2XWB B;  3CKI B;  2Q8R E;  2JA8 B;  1U4P A;  2EYH A;  3JAM E;  1MSG A;  4G7O C;  5KIX A;  3OWF A;  3OIQ A;  4KY6 A;  4DXF A;  3I8Z A;  4KI0 A;  3ERQ A;  3NQI A;  5EJW A;  1D5X C;  4JBW A;  2K33 A;  1EIG A;  2NVT B;  5FO9 B;  3MEH A;  3BVG A;  2JE6 I;  1STN A;  2B2V C;  3VR4 A;  4Z9C B;  4HN7 A;  4IUT A;  1GOZ A;  1PRT F;  4C1N I;  3T4A C;  5IGF A;  3HOV B;  4B9X A;  1X32 A;  4FO2 A;  4R9W A;  5NUC A;  1TWH B;  1NR4 A;  2SNS A;  2EYM A;  2SEB D;  5KND A;  1HUM A;  4N9P A;  1SE2 A;  5I6W A;  3LNN A;  1V1P B;  5E4X A;  2NN6 I;  1LTA D;  1QOH A;  1MGS A;  1B53 A;  1SYB A;  3K57 A;  4J6H A;  3IFD A;  3OOC A;  2AWN A;  1JC7 A;  1HXY D;  3DHQ A;  4C1N K;  2XRS D;  4DAY A;  2H4O A;  1RKN A;  2DN8 A;  3C1F A;  2XWJ B;  2RQX A;  4H7B A;  5E1F A;  1A3V A;  1ENC A;  1SE4 A;  3N6R A;  2MPM A;  1SNP A;  1NSN S;  1S4Z A;  3Q0A A;  4DN4 M;  1CA6 A;  2V4D A;  2A6E C;  5IGG A;  1G29 1;  2BE5 D;  2ZXR A;  1DOM A;  1D6E C;  5EPJ A;  4K2L A;  1GHK A;  3IAY A;  3NE5 B;  1DOL A;  1NUC A;  1E2W A;  1PMR A;  2F0D A;  2OF1 A;  3OIP A;  4QUC A;  1FYC A;  1U9R A;  3PO3 B;  2NVX B;  4LMQ D;  5EKK A;  3R3O A;  4QB4 A;  3SK4 A;  3X3M A;  2NVY B;  4DXG A;  1F9P A;  2PZU A;  2LS0 1;  1S5E D;  1SMY C;  4HMJ A;  1SNM A;  3NK9 A;  1JWS D;  1S5F D;  2NN6 G;  3SHL A;  3MVV A;  4AYB B;  3P75 A;  4KK7 A;  3S9W A;  3PIP 3;  2A6H C;  3D4W A;  1QWY A;  1ENA A;  1F2Z A;  1I3Q B;  4LAA A;  1BCP D;  1H9M A;  2WB1 B;  1DJR D;  2WAQ B;  3KUP A;  1LAC A;  4A3M B;  1BQQ T;  1S5C D;  4QF4 A;  4TQU S;  2F0F A;  3PUV A;  4Q0F A;  2E76 C;  4U67 3;  2DNC A;  5I2Y A;  1TU2 B;  2G9H D;  1IKM A;  4ZKC B;  2LKV A;  3GTK B;  4ZAI A;  1WD1 A;  3NQT A;  4BY1 B;  3S2D B;  3H94 A;  3GTO B;  4FF4 A;  2MP1 A;  4RGO S;  2A68 C;  3FEW X;  4U68 A;  3T51 B;  4CJ0 B;  1TT2 A;  1I4G A;  3PUX A;  1KNE A;  1VCI A;  1D1K A;  1AZP A;  5CV8 A;  2IW3 A;  1BCP F;  4DF7 A;  1H9S B;  2E2H B;  2R92 B;  2SOB A;  1XX8 A;  3I70 A;  2H1E A;  4CJ1 B;  1I6V C;  2JYO A;  1ONL A;  1IYV A;  2X6G A;  1F9Q A;  4DAP A;  3I4M B;  2KCN A;  3I90 A;  1JWM D;  1LTT D;  1A2T A;  2FIN B;  2M00 A;  4C2M B;  5EPK A;  2B2U C;  1U4M A;  3KLS X;  2Y0S B;  2ZXP A;  4IN3 A;  1KAB A;  1VMC A;  2K03 A;  1Y69 U;  3K5M A;  5D65 A;  2EOT A;  1JB3 A;  2ID0 A;  5JJZ A;  2PMZ B;  4F88 A;  3VR6 A;  1JE4 A;  4XDX A;  1CQV A;  1F77 A;  2LMC B;  2QIL A;  1ESF A;  1UAP A;  1BNZ A;  4F7X A;  4K5W A;  3HOY B;  1LT3 D;  1SYC A;  2EDG A;  4WJW A;  2L9H A;  3CU7 A;  1G91 A;  2K5Q A;  3EQL C;  2ICI A;  3TZD A;  1JOR A;  1UNS A;  3A7L A;  4A3J B;  5LL6 S;  1YNJ C;  4K5V A;  3SE0 A;  1EY8 A;  5LL6 X;  3GTM B;  4KHZ A;  2F4I A;  4K8I A;  2A5H A;  1VDZ A;  1V43 A;  3MFG A;  4HCE A;  1CI3 M;  5FOB B;  4FVM A;  4RGN A;  3D4D A;  3V05 A;  3BS1 A;  3NUC A;  2XRQ D;  2F0J A;  5T1G A;  2A69 D;  1RHP A;  5IIF A;  2JXM B;  3MTS A;  2SDF A;  2KJX A;  1R9T B;  3E6Z X;  4OHJ A;  2AQ2 B;  1EY6 A;  3VYR A;  1WTO A;  1HPC A;  2VB2 X;  3MAQ A;  1GUS A;  1Q12 A;  1ZKO A;  1K8M A;  4X3S A;  3HEJ A;  2WIN B;  1J9O A;  4BBR B;  3M4O B;  5JAV A;  5ELE A;  2OT2 A;  2K7V A;  1LT5 D;  1LAB A;  2L11 A;  3D4R A;  4OO1 G;  2E2D C;  3AU7 A;  3J81 L;  4K6D A;  4QIW B;  2EYO A;  1AZQ A;  3WOF A;  3A7A B;  5J22 A;  3VR2 A;  3R2I A;  1RF2 D;  2O4X A;  3QG1 A;  5IOC A;  2B2W C;  3AMU A;  2TSS A;  3VYT A;  4H13 C;  1IHZ A;  2IX1 A;  2EYJ A;  1WTX A;  3GD7 A;  3M7G A;  1TQO A;  3RMH A;  1PFN A;  4KTA A;  2X69 A;  2KVM A;  3TDQ A;  3I72 A;  1QE6 A;  2BA0 A;  3PUZ A;  2D2C C;  4K5X A;  3KF8 A;  4ABN A;  3OMG A;  2CW0 D;  3H91 A;  1SAP A;  3MXG A;  1G6Z A;  1Y8N B;  3AB9 A;  2ICE C;  5CBA E;  5KGU A;  3MC0 B;  1ESR A;  4F87 A;  5K5P A;  3OSO A;  1OXV A;  2K1B A;  2ZXO A;  4RKL A;  2MUY A;  1D5Z C;  2PZW A;  1CQF A;  5JPN C;  4P2C B;  5IGE A;  1I4P A;  2DY7 A;  4ZUJ A;  5FK9 C;  5DM7 3;  4PNY A;  2L55 A;  1EL0 A;  2XN9 C;  2IX0 A;  1BBX C;  3GV3 A;  3LX0 A;  1I4X A;  1EYD A;  5TSS A;  4FXK C;  1SDF A;  3TP6 A;  2O5J C;  5F2D A;  2L4N A;  3VYU A;  3VR5 A;  4JK1 C;  1WTP A;  3OHX C;  2RSN A;  1ZYR C;  1EYA A;  3NTK A;  5KNB A;  5CMD A;  2WKD A;  1EQV A;  3MA2 B;  3HKZ B;  4C3I G;  3OWE B;  1DCZ A;  2K04 A;  1BDO A;  3ERO A;  5KEE A;  1HUN A;  1K83 B;  4C3J G;  2E2I B;  5J39 A;  3K5O A;  1X3P A;  1WD0 A;  2EVB A;  5FKA C;  4DGZ A;  1ILQ A;  2EZV A;  2VXW A;  1EOT A;  2CW0 C;  1BUV T;  3O13 A;  3OMC A;  5IT9 L;  2EY5 A;  3I3C A;  4RGT A;  1MSH A;  5ELF A;  2AUK A;  3SEB A;  4DNR B;  1I4H A;  2F1M A;  3QO2 A;  4RAU C;  5KYI A;  4IUN A;  4DU9 A;  1Y1W B;  1BXT A;  3IKJ A;  1IKL A;  2FHT A;  2A6E D;  1TWA B;  1G2T A;  2L0C A;  1VF7 A;  3R93 A;  2B39 A;  2NN6 H;  1H9J A;  1IL8 A;  5C3E B;  5FLX L;  1ZXT A;  3V2T A;  5DM6 3;  1BO0 A;  1O7Y A;  3QOJ A;  1RD9 D;  2DNE A;  1TS5 A;  5M3F B;  1KNA A;  1NR2 A;  1WVL A;  4G7H C;  3K5L A;  2EJF C;  5ISR A;  2LFN A;  3KLR A;  2Z4I A;  1F2Y A;  2BCO A;  1SEB D;  2IX3 A;  1HTP A;  2EJG C;  4ODG A;  4XYO A;  2XSC A;  3NWT A;  4RHS A;  3FKI B;  1LT4 D;  3VYS A;  1SMY D;  3J80 L;  1CA5 A;  3FMC A;  1FNW A;  5D3I B;  1D2B A;  4G4K A;  3GTL B;  2BA1 A;  1TR5 A;  3QWN A;  4DAV A;  4B9W A;  5CYU A;  4CGY B;  4FF2 A;  1LV9 A;  3NXW A;  2B2V A;  4IFD G;  1EY7 A;  2KEE A;  1STE A;  2A6H D;  3KBX A;  4E6I A;  1BR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...