5IH2A

Structure, thermodynamics, and the role of conformational dynamics in the interactions between the n-terminal sh3 domain of crkii and proline-rich motifs in cabl
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter molecule crk
publication title Binding Mechanism of the N-Terminal SH3 Domain of CrkII and Proline-Rich Motifs in cAbl.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ih2A00
2GQIA 5I11A 4JJCA 2L3QA 1VYUA 3M0RA 4RTVA 1QWEA 4E6RA 2E5KA 1FMKA 2JS0A 1UHFA 1JEGA 3PVQA 1PWTA 3SHWA 5IXBA 2LQNA 1K76A 1AWXA 1H8KA 1X43A 1U5SA 2KT1A 2JMAA 5GJWB 4JZ3A 1E6GA 2AKLA 2ED0A 3VS4A 3A98A 3M0UA 3RBBB 4J9DA 2AK5A 3VS7A 1NYGA 1WA7A 1GCQC 1WFWA 5EC7A 2VKNA 1QKXA 2YUQA 1ZUKA 3THKA 4A63B 1K4US 2K9GA 2DE0X 2D8HA 1WDXA 1SRLA 1JXOA 1SRMA 2YSQA 3UA6A 2DRMA 3H41A 3REBB 1WI7A 1TG0A 1UJYA 2JS2A 1PKTA 1TUCA 1ZUYA 2EGAA 2KEAA 2A28A 1YP5A 1VA7A 2DX1A 2MIOA 2DBKA 1U3OA 3REAB 1AZGB 2JTEA 2DYBA 4RTYA 2DMOA 2DF6A 1AOJA 2FPDA 5FWBA 1KFZA 2GTJA 1T0HA 1BBZA 2CUDA 2CT4A 2ED1A 2CREA 2F2XA 1UG1A 1AEYA 4J9GA 3VS2A 2FEIA 3O5ZA 3NGPA 1HD3A 1KSWA 1WXBA 5FW9A 2O88A 1MV3A 3ZL7C 3EHRA 3FJ5A 3UA7A 1X6BA 2O31A 4J9EA 2ESWA 1W70A 1QKWA 3I5SA 2K7AA 2B86A 1WXTA 3VS1A 2L2PA 2W0ZA 3IQLA 4AFZC 1G83A 3EHQA 2EYYA 5ECAA 2EGCA 1XOVA 1GCPA 2DLPA 2AZVA 1OPLA 2J6FA 4JZ4A 2G6FX 1M8MA 3VRYA 1PNJA 1E7OA 4OMLA 5IHIA 2A36A 1Z9ZA 4OMPA 2V1RA 1Y57A 1BU1A 5IHNA 1I0CA 4AFUC 1UECA 2A37A 1ZLMA 2L3SA 2O2OA 2YDLA 2BTTA 2L3PA 1K0SA 4FSSA 2J6KA 4HVVA 2HEQA 2O9SA 2EKHA 2DL7A 4JPBW 2L0AA 4RTUA 1RUWA 2LNHB 2HCKA 5IXFA 4OMMA 4J9FA 4CC7A 1YCSB 2DL5A 2PTKA 2KR3A 2KXCA 2CSQA 1NYFA 2ECZA 1A0NB 1UHCA 2EVRA 4IIMA 3NHNA 2HBWA 4AFSC 2VVKA 1TUDA 5IH2A 3UF4A 4AG2C 1OPKA 2D0NA 4RTZA 3TSWA 1T3LA 3VS6A 1OV3A 2X3WD 1M3BA 4J9BA 4EIKA 2AKKA 4R0KA 2H8HA 4HXJA 2X3XD 3U23A 1NM7A 3R6NA 4ZNXA 2GBQA 1YNZA 4GBQA 2BZ8A 4J9HA 2KGTA 4F16A 4K11A 2DRKA 4DEXA 1GRIA 2C0TA 2DNUA 2KYMA 2SRCA 1SHFA 4OMOA 4ESRA 1X2KA 1X6GA 3VS3A 1UUEA 2FRWA 3EGUA 2EGEA 2J05A 2NWMA 1EFNA 1VYVA 1U06A 4RTWA 3EG0A 3TSZA 1I1JA 4J9CA 1ZBJA 2F2VA 3I5RA 2LX7A 3JV3A 2KRNA 2GGRA 2OJ2A 2DILA 1KIKA 1X2QA 2YUOA 2EW3A 2RN8A 1NG2A 2J7IA 3EG1A 2CT3A 3EG2A 2D1XA 2QDLA 1JXMA 3C0CA 4CC3A 2CH4A 1X69A 1GBQA 1E6HA 4F14A 3M0PA 1T3SA 3M0QA 3NPFA 2EYWA 1VYTA 1WYXA 2HSPA 2YT6A 1GFCA 1GFDA 2JMCA 2FPEA 5IHKA 3UATA 2KRSA 1GBRA 4JJDA 2W10A 1UJ0A 2DL3A 2PZ1A 5GJVB 1AWOA 2FRYA 2ABLA 2K6DA 1BK2A 1AZEA 1ABOA 4AG1C 2K2MA 2RNAA 4M4ZA 4RTTA 1X27A 2DA9A 2KNBB 2DBMA 4IIOA 2FO0A 2BZYA 2KYBA 2KT8A 2P4RA 1NLOC 4HCKA 2EQIA 2DM1A 1CKBA 2K79A 2LCSA 2AZSA 1WX6A 1NLPC 3RNJA 2OAWA 2RMOA 4RUGA 2KROA 2NUZA 2V1QA 5HCKA 1AWJA 2JW4A 4Z8AA 2RQVA 4ORZA 1M27C 2F2WA 1UE9A 2M51A 1MV0B 4D8DA 1Y0MA 2KRMA 2DVJA 4RTXA 2DJQA 4LUDA 1YWOA 1RLPC 4OMNA 2LP5A 1ABQA 2LJ3A 2RPNA 1M30A 2RQUA 2C0IA 2RQWA 3I9QA 5I22A 4LE9A 1NEGA 1SSHA 3H0IA 5L23A 1AWWA 4F17A 1KJWA 1I07A 2FPFA 3M0TA 2RF0A 2YUNA 1WIEA 2EBPA 1HSQA 1AD5A 2ROTA 4DEYA 1B3QA 1WXUA 2ENMA 2YUPA 2LMJA 4J9IA 1QWFA 2JXBA 2CUBA 1CSKA 1SPKA 3H0HA 2LJ0A 1S1NA 3I35A 4D8KA 2DL4A 2GTOA 2MCNA 1WLPB 3H0FA 2GNCA 1K1ZA 1UFFA 1PHTA 2EYZA 2SEMA 1QCFA 1FYNA 1UTIA 3KFVA 1OEBA 4OMQA 1NEBA 2JT4A 4JJBA 4X1VA 1GL5A 1K9AA 2EYXA 3SEMA 2KXDA 2A08A 3QWXX 1ZSGA 2LJ1A 2ROLA 3CQTA 2EPDA 4CC4B 3PE0A 1BB9A 4HVUA 1LCKA 2K3BA 4QT7A 1QLYA 2XMFA 3NMZC 1B07A 1MUZA 1M3AA 2M0YA 2LQWA 1AVZC 1YN8A 2KE9A 2DL8A 1Z9QA 3QWYA 2FG0A 1W1FA 3EG3A 1GCQA 1ARKA 1PKSA 1SEMA 3VS5A 1IO6A 2J6OA 3ULRB 1T0JA 2CH4W 1H3HA 1ZUUA 4Z89A 1ZX6A 2D8JA 4LN2A 2I0NA 4AFQC 2IIMA 2J06A 2KBTA 1PRMC 1UDLA 2O9VA 1V1CA 1PRLC 1N5ZA 2HDAA 3M0SA 1JQQA 4GLMA 1JU5C 1SHGA 1W6XA 2RQTA 4Z88A 3LH5A 2PNIA 4LNPA 2VWFA 3GBQA 3TVTA 1HJDA 2JM9A 4CC2A 4LUEA 3PVLA 2BZXA 2JM8A 1CKAA 1G2BA 4HVWA 1YWPA 1J3TA 5FWCA 1RI9A 1K0XA 4KRTA 2MOXA 2OI3A 4WCIA 1JO8A 2RQRA 3VS0A 4Y92A 2C0OA 1M3CA 1H92A 1RLQC 2CDTA 1OOTA 1UGVA 3VRZA 2LZ6B 2CSIA
chains in the Genus database with same CATH superfamily
3HRTA 2K5IA 3TEEA 4RTVA 1FMWA 2JS0A 1UHFA 2V8IA 2GFAA 1PWTA 2DD4A 2QASA 5IXBA 1R0CB 1D09B 1H8KA 2KT1A 1U5SA 5GJWB 4C92G 1VQ8Q 5GAN7 3CCUT 2FL7A 4C0DC 2CP2A 1LJOA 4L6V5 3JCMc 1GCQC 3UDCA 2YUQA 1ZUKA 1PCXA 4M7AA 2NUPA 3FC3A 1WGSA 1K4US 2DE0X 1IHVA 3L2RA 3RUXA 3UA6A 5A0DA 2RHYA 1B34A 1B7TA 3EFOB 2CP7A 2P0KA 4BE2A 2RJEA 5D7UA 3OMGA 3QJYA 3C95A 2HZYA 1FWZA 2DBKA 2OTJA 4ME7A 1D1AA 1WJQA 4M7DE 4RTYA 3JCMe 1W2BP 1Q86C 1AOJA 3GLXA 2GTJA 4JRQA 1QP3A 2ED1A 4FYXB 2F2XA 1VQKA 5HY6A 3DB3A 2EJGA 2VC8A 1MMAA 3NGPA 1HD3A 1KSWA 4QQ6A 2D0QB 1JRIA 4M78A 5FW9A 2O88A 1MV3A 3EHRA 3HHTB 3VYHB 3FJ5A 2RJFA 4DBHA 3SDZA 4J9EA 4OGEA 1W70A 4NL3A 2AIRB 3BW1A 2L2PA 1ZA1B 3CPWP 3IQLA 4AFZC 4M77C 4M7DD 1XOVA 3HPWA 3JAME 1RACB 2DLPA 2EQMA 4M7DB 2J6FA 4M75G 3JCMX 2CP3A 3VRYA 2X4YA 3MP6A 1E7OA 3OYCA 4XQ3A 1WHKA 4OMPA 2DZCA 5FRMA 3JCMf 2LNVA 4M78F 5IHNA 1ZBXA 1I0CA 2A37A 2L8DA 4FSSA 4HVVA 1Q82C 3GOXA 5KYYB 3LWHA 4MZMA 3A1PA 4JPBW 3M56A 2R5AA 2HCKA 4OMMA 3EAEA 2RHZA 4J9FA 1YCSB 3MEVA 1PSEA 2KR3A 2KXCA 1KQSP 3P8DA 2QAZA 4IIMA 4C8QG 2QQRA 4AFSC 3I56Q 3JB9H 5A2QE 1VQ4Q 4RCBA 3JRZA 2LQ8A 1PD0A 1YBYA 2AKKA 5LJ5e 5DM7R 3U23A 1UGSB 5D6WA 4EMKC 1NM7A 5J26A 3QG1A 3MJXA 3V8KA 4GBQA 1K73C 4J9HA 4F7UE 2X51A 4F16A 3I56A 2FYKA 2OX7A 2KQWA 1QVGS 1C0MA 4FYYB 3CEYA 3X20B 4PJOA 1KD1C 1YIJQ 3A5ZB 3M5AA 3S6WA 1X2KA 1G3SA 1WHJA 2L3RA 2EFIA 2M0OA 2QYZA 3PFSA 3EGUA 2EGEA 2J05A 3FRNA 2NWMA 1VYVA 3TSZA 1I1JA 4J9CA 1ZBJA 4XTUA 3CCRT 3MEWA 4C0DB 4HT8A 4PFZA 2YUOA 4WTOB 4KUDK 5IAYA 3HFOA 3EG2A 2HQXA 2K2VA 5GAOl 4CC3A 4F7UB 1GBQA 1SG5A 2F5TX 4CRIA 1VYTA 4FYVB 4DOVA 1W4SA 5C6SA 3HL8A 2JMCA 2FPEA 5IHKA 3UATA 3N5BB 2KRSA 4JJDA 4CI0C 2W10A 4BUGA 1AWOA 1VQ9Q 3X25B 4X9CA 2ZPGB 2YLBA 2X35A 2K2MA 1Q7YC 1VQLQ 1D0ZA 2P0QA 2DBMA 1M1FA 4IIOA 1ZSZC 2FO0A 2ATCB 2DEQA 1NLOC 1MGQA 4XU0A 1WX6A 3I55Q 1IXDA 2P0PA 4FT2A 2RO0A 3GNFB 5LJ3e 5HCKA 4DA4A 4KH0B 2P84A 3PNWC 4IUVA 1Q86U 4TVRA 2FZGB 2JW4A 4IKFA 4ORZA 1M27C 4AT1B 5KYYA 1MV0B 1G3WA 3FIFA 2KRMA 3CXCP 3M4YA 4LUDA 4OMNA 2VXFA 2JN0A 3X28B 3QKJA 4Y28E 1M90U 3OBWA 3HKSA 2AHJB 2RQUA 1K8AU 3OYMA 3H0IA 3QUIA 2JUFA 2ZPFB 3JCMd 3S3MA 2RF0A 2YUNA 3CCSQ 2EBPA 4EPCA 1AD5A 2MYSA 2ROTA 2XD0A 1VQNQ 2JNGA 5HK0A 1B3QA 1WXUA 3OYJA 5J3BA 2OTLQ 4J9IA 1H641 2JXBA 1CSKA 3CCMQ 4OB2B 4C0GA 3SWNC 2RHIA 3H0HA 3E19A 3EGXB 2CS7A 3HP9A 4MDWA 1LNXA 5LJ3f 3CCEA 1NJIU 1I5OB 3H0FA 2GNCA 1VQNA 4JRKA 4E47A 3OS2A 2CZ0B 2K5LA 2M9UA 1RAAB 1MMNA 1QCFA 2F1LA 1FYNA 5GANe 1YJNA 4OMQA 4X1VA 4MZPA 1Q86R 2PUKB 2PVDB 5GAMe 1QVGA 1M1KC 2WSEE 3QWXX 1ZSGA 2HQHA 1X6OA 1XJWB 3OQ5A 2QI2A 4HVUA 2K3BA 2DK3A 2DETA 1M90R 1B07A 1FXXA 1M3AA 4JDSA 1K8AR 2XDPA 1IREB 3LLRA 3CCVQ 2FG0A 3VJPA 1GCQA 1PKSA 1SEMA 1IO6A 2J6OA 3ULRB 4KGZB 1YHQA 2CH4W 4QVDA 1YITQ 4Z89A 2VV5A 2D8JA 2QK0A 1I5LA 4A4EA 1N6AA 1VIEA 4AFQC 2RA2A 4PLIA 2O9VA 1TU0B 2E5QA 1N5ZA 2LVMA 1JU5C 1K73U 3CCVA 1W6XA 4Z88A 2PNIA 3CC4Q 5GANf 2KSSA 1VQOT 3GBQA 1NJIR 4E7JA 4HCZA 2JM8A 1G2BA 5KH6A 4M7AE 4FU6A 3CCJT 2KY9A 2H3JA 4HVWA 5LJ5d 1VQ6Q 1K9MC 1J3TA 1G5VA 3MPUB 2QQBA 1K0XA 4JLIA 1U8RA 5CVIA 4KRTA 1Y71A 1QVFS 2E6ZA 4M78G 4F7UF 3NTIA 3CC4A 1YI2Q 4Y92A 2C0OA 3CC7T 5KCOA 1M3CA 2XIDA 2QG9B 2E3HA 1OOTA 3G4ST 2YXYA 3VRZA 2O4XB 1XNIA 2CSIA 4C5GA 1PG5B 1QWEA 4E6RA 2E5KA 3BDUA 4QVCA 1VQ5A 3SHWA 4M77A 2QTVA 5L8RE 3CMEQ 4HCBA 2D6FA 1WPYA 4JJNK 5CKBA 1NZ9A 1TXQA 3A98A 4M7AD 4J5YA 1VQ5T 1WFWA 5EC7A 3THKA 3QXEB 1BI1A 1M8VA 2K9GA 3TQ7P 1K73R 4R56A 1JXOA 2YSQA 3JCMb 3JCMh 2EKOA 3H41A 2JS2A 1Y96B 1WQWA 3JB9I 2EGAA 2KEAA 1NBEB 4BACA 3RESA 3CC2T 1YP5A 1EIFA 1RABB 1BIAA 3OYLA 3QSUA 3A8OB 3JB9J 3ZBDA 2YRCA 1BCMA 4M77F 1AZGB 4M7DC 3JB9D 2DYBA 2V26A 2DKGA 1BBZA 2CUDA 1U1SA 3LX7A 3JCMW 4ATOA 1AEYA 1OZ3A 3VS2A 4XTVA 1ZA2B 3S3OA 1WXBA 1WNLA 5GAOm 1RAFB 3ZL7C 3UA7A 1JBMA 1UEBA 4EMKA 1QMCA 1X6BA 2ESWA 1VQMA 2K7AA 5LJ3d 2CP6A 4ZN1A 3VS1A 1S72A 3QDFA 2W0ZA 3J80E 3G71Q 1G83A 2LT4A 2NLUA 4RCCA 1V29B 2EGCA 2HL5C 3OW2S 4RKUE 1VQMT 5CQXA 5DY9A 1N8RU 2Y90A 2QEXQ 1PNJA 3ME9A 2DJZA 3QYHB 2A36A 3MEUA 5CIUA 3H8ZA 3HRUA 2DXTA 4KH1B 3CMAQ 1UECA 4O5VA 3G71A 1ZLMA 4MDXA 2L3SA 2FZKB 3L1AA 4UC4A 4FW2A 1QW1A 4RTUA 1RUWA 2LNHB 3CCQT 3C12A 2PTKA 1M1KU 3G1JA 2ECZA 2E1HA 1UHCA 3CCUQ 2EVRA 5LJ5h 3OB9A 2L5QA 1VUBA 1VQ7Q 1G3TA 3JSCA 1QVFA 2O4XA 2D0NA 4RTZA 5GANd 2HL3A 2X3WD 1FX7A 1OQKA 4J9BA 3VKIA 4EIKA 5GAMd 2WACA 3G6EQ 1C1AA 2DIGA 4ZNXA 4PK4A 1N8RR 4DBRA 1ZSZA 3AT1B 2PQWA 4J6XA 4DEXA 1VQ8A 1GRIA 4C0ZA 2LX9A 1I81A 1SHFA 1TWBA 2EJ9A 4ESRA 2PVGB 4X9DA 1ZHIA 4ZTFA 1X6GA 5KYXA 4C92E 3NTKA 1UUEA 1GXIE 2EIFA 1K9MU 1EFNA 2IVWA 4RTWA 1Q81U 2OTJT 1RADB 2PVOB 4E7HA 2DILA 1U1TA 1M1KR 4KUIA 4LDWA 1M90C 2EW3A 1QQJA 2RN8A 1K8AC 1NG2A 1VQKT 2G3RA 1TUGB 1P92A 4L59A 1TS9A 2P4TA 1X69A 4EDUA 1IHWA 4F14A 3M0PA 3M0QA 2EYWA 1WJSA 1WYXA 4FIBA 1KQ2A 1GFCA 4C92D 5KCHA 1GFDA 3SWNA 4IUTA 4C92B 4V2SA 4HKEA 2PZ1A 2QDYB 5GJVB 3MP1A 2K6DA 1BK2A 4J7FA 5AYFA 1QP2A 1NJIC 1AZEA 5LJ3h 4ZGJB 2LCLA 4C5EA 3EH2A 1Y7XA 2E41A 1PC0A 3GPLA 1G8XA 2P4RA 2KT8A 2DTOA 3M59A 2EQIA 3RERA 1NLPC 3OW2A 1K9MR 3R6OA 1KQ1A 1Q81R 2YRVA 2NUZA 3OA6A 4M75E 1AWJA 2QA4Q 3E9GA 4D6WA 1YJWQ 1WQ7A 3BFMA 2E6NA 2RQVA 2F2WA 1UE9A 2M51A 9ATCB 1JJ2P 4JLGA 3PIPA 2YHTA 3OYAA 3EG9A 1M30A 3I9QA 2ZCFB 3E1SA 4LE9A 1NEGA 4F7UG 1SSHA 3VYGA 1I07A 5DLOA 1BI2A 1YJWA 4B9WA 1RL2A 4RMOA 4XTWA 1WIEA 3L2ZA 1N9RA 3CD6Q 4LDVA 4C8QE 4NOYA 1YJ9Q 1QWFA 1VQ4A 3CPFA 4M75D 5GANh 4KT0E 1I4K1 3V7SA 3CCRQ 1W2BS 5GAMh 3I56T 2LJ0A 4C5HA 5GMKe 4D8KA 2KDSA 3CD6A 3EFOA 1VQ4T 4FL6A 3QPHA 4OGCA 3PTAA 1PHTA 3JCMP 2MK5A 1YJ9A 1UGQB 2K57A 3KFVA 4J6WA 1YIJA 4JJBA 1GL5A 2KXDA 1M5Q1 1NE8A 5GAN6 2HKNA 3NFCA 3PE0A 4M77G 1BB9A 1WJRA 5LJ5f 1LCKA 1QLYA 3CBOA 4C8QD 5GAN2 3NMZC 3CPWS 3SFMA 1MNEA 4DOWA 4FYWB 2KE9A 1Z9QA 3ZFJA 8ATCB 1W1FA 3EG3A 1ARKA 3RMQA 1TSFA 4Q5WA 3J81E 1ZUUA 2I0NA 5LJ3j 3EGDB 2IIMA 2J06A 4BI3A 2A0FB 1PRLC 2HDAA 2X4JA 3FEOA 1JQQA 4GLMA 2MWOA 4J8OA 2JVVA 2MMPA 2RQTA 3VUBA 4M7DA 3LGFA 2VWFA 2ZGWA 4CC2A 4LUEA 1D3BB 5DLQE 1VQ9A 3PVLA 2BZXA 3RMSA 1KHCA 4JRIA 4M7AC 1KQSS 1UGPB 4PKCC 5GAOn 1RI9A 1VQLA 3MEAA 5A0GA 2OI3A 4OB1B 1AHJB 1RAGB 2XI9A 4BD3A 5CO7A 3ASKA 2BE7D 1RLQC 2CDTA 2CGHA 3OYIA 3I55A 1WZOA 2EYXA 4LDUA 2HQEA 2ZPIB 2RH2A 3QJ6A 4XU3A 4M7DF 3OYYA 2XK0A 3PVQA 2XU8A 4VUBA 4LD9K 4YTLA 2FHDA 1AWXA 5I21A 1QVFP 4II1A 2JMAA 4KBMB 4JZ3A 5GANj 2ZPEB 1N8RC 4J9DA 2AK5A 3RDVA 3VS7A 5GAMj 1WA7A 3P8HA 1JB0E 1QKXA 1H3ZA 3CCLQ 2RK1A 1WDXA 1SRLA 4FSXA 3CCSA 2DEUA 2E65A 3JCMJ 1TG0A 2HNIA 3PIOA 1ZUYA 4E7KA 1ACMB 2OTLA 3T9NA 1VA7A 2DX1A 4A4GA 3GIBA 3CCET 3CCMA 1EZZB 2MIOA 3CCLA 3REAB 4OB3B 2DPPB 4O6JA 2JTEA 1VQNT 2DMOA 2BIVA 4B9XA 1KFZA 2M1HA 2COWA 2OAUA 2HBPA 1YJNT 5GAN4 1SSFA 2CT4A 1W2BA 2CREA 1NPPA 1UG1A 2E3IA 2DYIA 3MKDA 2E12A 4MMLA 3O5ZA 1OZ2A 1VIFA 3EFRA 3RIRA 4N0AC 3OYBA 2EAYA 2X9HA 3TU4K 4F7UA 3I5SA 4Z02A 1WXTA 4J6YA 5FU6C 3PGGA 1VQOQ 1YHQT 4BY6C 3BDLA 5LL6S 2HAXA 3EHQA 2EQKA 5ECAA 3CPWA 1GCPA 3RKYA 2AZVA 1OPLA 2NUTB 2I2LA 1M8MA 2RK2A 3HRSA 1YITA 4OMLA 3UT1A 3EGDA 5GAMf 5GAOr 1Z9ZA 3CCVT 1Y57A 3CC7Q 2R57A 3ZEHA 2QTXA 3OYKA 4AFUC 3G4SQ 3MO8A 3KUFA 4OMFB 2KI7A 3FJPA 2O2OA 2YDLA 1Q81C 2BTTA 2L3PA 1K0SA 3D7SB 2J6KA 3CXCS 4PNOA 2EKHA 2DL7A 2K5FA 2M02A 3V7RA 4RG2A 3OYEA 1MNDA 4A4KA 2DL5A 3LYIA 4A54A 2XKOC 2EQUA 4JRPA 3OYDA 2CSQA 1NYFA 1HK9A 1VQ6A 3CC4T 4GLKA 3A8LB 1KQSA 2DXUA 3NHNA 3V8LA 2HBWA 3HTRA 2XICA 2F5KA 2VVKA 1OX8A 3OYHA 2CZ6B 1TUDA 5I2SA 1YI2A 5IH2A 4N4GA 3QO3A 1OPKA 1BCOA 3TSWA 1WHHA 2IPOB 3VS6A 3ER0A 1LOJA 4EMHA 4M78E 4M7AB 2NUPB 4R0KA 3CC2Q 4HXJA 2X3XD 1XTDA 1M1GA 2GBQA 3M53A 3CMEA 1B34B 2BZ8A 2KGTA 3SD4A 4K11A 2C0TA 2DNUA 2CZ7B 5KYWB 2RD1A 2ZPHB 2SRCA 1QCOA 4BDZA 1MMDA 2PUOB 4C92C 2RHUA 2VB6A 3EGXA 5CAIA 4LXCA 2FRWA 4PJMA 1IZ6A 1U06A 2WSFE 3I5RA 3DLLA 5KYNA 2LX7A 4M78D 2GGRA 1VQPQ 4ELZC 4IUQA 2DVEA 1X2QA 3UWNA 4M78B 2X4WA 2ZAEA 2J7IA 2IG0A 4BE1A 4FT4A 1JXMA 1KHIA 2LQKA 3C0CA 4QQDA 3RKWA 4XU2A 1E6HA 1T3SA 3O8VA 3QHSA 4R55A 1VQPA 2YT6A 3M4GA 2AT1B 3GF5A 3E2UA 1LVKA 2BE9B 2QQAA 1PM3A 1M9SA 4KULA 1UJ0A 1TOVA 2DL3A 4A4HA 1S72T 4LDYA 4HA8A 2ABLA 4DQ2A 3P8BB 5GAN3 2YRDA 1KC8U 2GCXA 3QBYA 3CCQQ 4AG1C 4IUPA 4M4ZA 4RTTA 4ZGDB 1X27A 2DA9A 2KNBB 4XK8E 2DXCA 1R0BG 2QEXA 2AZSA 3WVDB 3G71T 2Y4XA 3L2UA 1R77A 4PJOE 4RUGA 3OS0A 3CMAA 4M75C 3OSVA 5FU6B 2QEXT 4BY6B 2YWWA 4JUVA 2JTMA 3NTHA 4D8DA 1Y0MA 2DJQA 2LP5A 2EWNA 2LJ3A 2RPNA 3CXCA 2C0IA 3EH1A 2CP5A 3E9FA 1KJWA 3CCUA 2FPFA 3KBGA 1VQ7A 3QZ9B 5GMKh 4DEYA 4M7DG 4FW1A 4PJOD 4C8QC 3QIIA 2YUPA 2LMJA 4C0FA 2FZCB 3VU3C 4PJOB 2CUBA 1KC8R 1VQ7T 4PFOA 4C5IA 4ANJA 2OTJQ 4GY5A 3G6EA 1VQ8T 5CKFA 1S1NA 3I35A 3VV0A 2BUDA 2VGMA 4ZTJA 1Y96A 2GTOA 1WLPB 1K1ZA 1OU8A 1UFFA 1VQKQ 5KYWA 3G6ET 2JOYA 1QVGP 3OYNA 5IT9E 4L5GA 1K9AA 4OVAA 3INZA 3SEMA 2A08A 1SF9A 2GFUA 3OYFA 2LJ1A 2LT1A 3CQTA 2EPDA 1O75A 2DIQA 5CKEA 4CC4B 2QQ9A 1YFNA 4QT7A 4M7AF 1Q95G 2DAQA 1MUZA 1DJ7B 5GAN5 1D0YA 2LQWA 2O01E 1AVZC 4E7LA 1HXDA 3QWYA 3V8JA 3VS5A 3WXMB 1T0JA 1LPLA 2KK4A 1ZX6A 2HD0A 4KGXB 4LN2A 2JZ2A 1PD1A 3LWIA 2EQJA 1PRMC 2KMTA 1UDLA 5M9OA 2VASA 1MHNA 1Y07A 1SHGA 3GNGA 3A8MB 3JB9F 3LH5A 5KE3A 1D0XA 1IGQA 4PJJA 3TVTA 1X75C 2E64A 2JM9A 5KYUB 4PJLA 1CKAA 1BI0A 1RI0A 2QQSA 4QKUA 5LJ5j 1YWPA 5EG2A 2ZPBB 3H6ZA 1NPRA 4N0AA 1R8OB 1JO8A 2RQRA 6AT1B 3SB2A 2CKKA 2GQVA 2GF7A 2X4XA 2LZ6B 2GQIA 5I11A 4XU1A 2MF2A 5CR2A 4JJCA 2L3QA 1VYUA 3M0RA 3OS1A 5FROA 4A53A 4FCYA 2XG8D 1FMKA 2QA4A 2B8AA 1JEGA 5GMKj 2RI5A 1I8FA 2LQNA 1K76A 1D1CA 2HKQB 3LH0A 3VUZA 2QGFB 2DZ9A 2R5MA 1X43A 3S3NA 4J7IA 3MP8A 4EMGA 4MZTA 1E6GA 2AKLA 2QA4T 2ED0A 3VS4A 3M0UA 3RBBB 2WSCE 1YJWT 1NYGA 2JTFA 4A63B 3L2WA 2VKNA 1G3YA 4XAXB 1RAHB 2D9TA 3J7AF 2D8HA 4M75B 4P5NA 2DTIA 2K3YA 1SRMA 2XDBA 4HT9A 2DRMA 4X34A 4QQGA 3REBB 1WI7A 1UJYA 1PKTA 1TUCA 2A28A 3C94A 2H3EB 4Y91A 3H9NA 5GMKm 1XQHA 3PT9A 2RI3A 3F70A 3CD6T 1FMVA 1U3OA 5C0MA 3CCRA 2K3XA 3A8HB 3QDRB 2DF6A 2FPDA 5FWBA 1YJ9T 3HSBA 1T0HA 4KGVB 4B6MA 4XTXA 1O9SA 2E70A 1YIJT 2LTOA 3DB4A 4J9GA 2FEIA 1N9SA 4C8QB 5HKCA 3RKXA 2KVQG 1QVPA 5CK9A 2O31A 4QW2A 5D6YA 1QKWA 4PJOF 2B86A 2VGNA 1IRXA 4LDXA 3OS5A 4E7SA 2R58A 2EYYA 4M77E 1OULA 2RJCA 2MAMA 4WF2A 1QCNA 4E7ZA 3FB9A 4AMCA 4E7IA 4OP0A 4C92A 1WHLA 4JZ4A 2G6FX 2VUBA 3JCMg 3G7ZA 5IHIA 3OYGA 2V1RA 4LD6A 1BU1A 3OY9A 2M16A 5CCAA 1OU9A 5CKDA 1JJ2S 1VQ9T 2HEQA 2O9SA 5FU7C 1SKUB 2L0AA 2JJ9A 5IXFA 2LDMA 5KYUA 2MPXC 1VQLT 3CBMA 4CC7A 4ZN3A 3QYGB 3A8GB 1A0NB 1WHGA 4M77D 4C92F 5FLXE 4M77B 3I55T 5J39A 4FM4B 2HSEB 1BIBA 3CBPA 3OBYA 3L2QA 3UF4A 4AG2C 5GAOp 1UB4A 2EJFA 3WVEB 4ELYC 1T3LA 4M78C 1OV3A 1M3BA 3DLMA 2H8HA 2VYTA 2CYZB 3R6NA 1KC8C 2XHCA 2DO3A 3CCEQ 1YNZA 8AT1B 3META 3L2VA 2DRKA 5GAOq 2KYMA 4DBFA 3M55A 1YJNQ 4OMOA 1M2VB 2PU9B 3CCST 4M75A 3VS3A 3RR6A 2LCCA 4DBQA 4J83A 4PFPA 2OTLT 3CCMT 3CCLT 3FLGA 2E4HA 3EG0A 3M57A 2F2VA 3JV3A 2KRNA 1Q82U 1BKBA 2OJ2A 5AT1B 1KIKA 5LJ5g 1YHQQ 3EG1A 2CT3A 2COYA 2RJDA 4EMKB 2D1XA 2QDLA 4HCCA 2CH4A 3QZ5B 1VOMA 1WHMA 3TREA 4NS5A 3NPFA 3AHUA 4C8QA 4M75F 2HSPA 3LW5E 5GAN8 2VXEA 4ZGEB 1HYOA 2MI6A 3M9QA 3CCJQ 4M7AG 4N4HA 1GBRA 5KE2A 4BI4A 1PSFA 2FRYA 3BE3A 3M54A 2NYSA 2XDDA 1EX4A 1M4ZA 2CZ1B 1VQOA 1ABOA 3EFSA 2RNAA 4PJNA 2HMAA 1YITT 1TTHB 1MMGA 4XTYA 2DXBA 3CCJA 2COZA 2BZYA 2KYBA 4HCKA 3OW2P 1OYXA 3FDRA 2LC4A 2DM1A 1KD1U 1CKBA 2K79A 2LCSA 1UGRB 1D3BA 4BDYA 2FB7A 4C8QF 4PJOC 3RNJA 3JB9G 2OAWA 2E10A 2QGGA 2RMOA 2KROA 2V1QA 3CC7A 2V8KA 1D1BA 1BYMA 1Q82R 4RG8A 3G4SA 1VQ5Q 3GP8A 5GMKi 4Z8AA 4BE0A 1OI1A 1TH7A 2F69A 4IUUA 4RTXA 2DVJA 1YWOA 1RLPC 1ABQA 2L89A 1JJ2A 1VQ6T 2RHXA 2RQWA 4PLLA 5I22A 5FRNA 3HFNA 3DKMA 1RAIB 5L23A 4JS4A 2DERA 1AWWA 4F17A 2A3LA 1YCYA 1YI2T 3M0TA 3PMIA 2YLCA 5D6XA 1HSQA 3C4SA 3TCJA 1IB8A 1ZSZB 2QXFA 5FU7B 1M2OA 4PL6A 1C6VX 2ENMA 4OF1A 5IN1A 1KK7A 3JCMQ 3CMET 1SPKA 5LJ3g 2RI2A 3CC2A 4NL2A 5GMKl 5CKHA 5KYXB 4BB7A 4F04B 2K4YA 2RB6A 3M58A 3LGLA 3V7CA 3X26B 1V76A 4XTZA 2DL4A 2MCNA 2FVUA 1Q7YU 1KD1R 3MHXA 2EYQA 3X24B 2EYZA 7AT1B 3BY7A 1KG1A 2SEMA 1M2VA 1UTIA 2A7YA 2Z0WA 1OX9A 1OEBA 1NEBA 2JT4A 4QVZA 4N4IA 4OB0B 2CP0A 2MWPA 2ROLA 5A0LA 1VQMQ 2XMFA 1S72Q 4A4FA 3KXTA 2M0YA 1X01A 1YN8A 2V8JA 2DL8A 4E2FB 3JCMV 2RM4A 5CQYA 3SWNB 3URGA 1ZQ1A 4JS5A 1H3HA 2DD5A 3PMTA 2DTHA 2Y4YA 1VQPT 3MCAB 1RAEB 2KBTA 3OSSC 4IURA 1V1CA 1N27A 3Q1JA 3M0SA 4MMKA 1IGUA 5GANg 4PJOG 5HK3A 4BI8B 5GAMg 2C06A 2DFUA 2ZZDA 2NUTA 4LNPA 1HJDA 2KAFA 1Q7YR 1BI3A 2BKDN 3CCQA 5I2MA 3UPUA 5FWCA 3L42A 1F1BB 1AT1B 2MOXA 4WCIA 2LRQA 3VS0A 3EG9B 3OMCA 3CMAT 1H92A 1UGVA
chains in the Genus database with same CATH topology
2GQIA 5I11A 4JJCA 2L3QA 1VYUA 3M0RA 4RTVA 1QWEA 4E6RA 2E5KA 1FMKA 2JS0A 1UHFA 1JEGA 3PVQA 1PWTA 3SHWA 5IXBA 2LQNA 1K76A 1AWXA 1H8KA 1X43A 1U5SA 2KT1A 2JMAA 5GJWB 4JZ3A 1E6GA 2AKLA 2ED0A 3VS4A 3A98A 3M0UA 3RBBB 4J9DA 2AK5A 3VS7A 1NYGA 1WA7A 1GCQC 1WFWA 5EC7A 2VKNA 1QKXA 2YUQA 1ZUKA 3THKA 4A63B 1K4US 2K9GA 2DE0X 2D8HA 1WDXA 1SRLA 1JXOA 1SRMA 2YSQA 3UA6A 2DRMA 3H41A 3REBB 1WI7A 1TG0A 1UJYA 2JS2A 1PKTA 1TUCA 1ZUYA 2EGAA 2KEAA 2A28A 1YP5A 1VA7A 2DX1A 2MIOA 2DBKA 1U3OA 3REAB 1AZGB 2JTEA 2DYBA 4RTYA 2DMOA 2DF6A 1AOJA 2FPDA 5FWBA 1KFZA 2GTJA 1T0HA 1BBZA 2CUDA 2CT4A 2ED1A 2CREA 2F2XA 1UG1A 1AEYA 4J9GA 3VS2A 2FEIA 3O5ZA 3NGPA 1HD3A 1KSWA 1WXBA 5FW9A 2O88A 1MV3A 3ZL7C 3EHRA 3FJ5A 3UA7A 1X6BA 2O31A 4J9EA 2ESWA 1W70A 1QKWA 3I5SA 2K7AA 2B86A 1WXTA 3VS1A 2L2PA 2W0ZA 3IQLA 4AFZC 1G83A 3EHQA 2EYYA 5ECAA 2EGCA 1XOVA 1GCPA 2DLPA 2AZVA 1OPLA 2J6FA 4JZ4A 2G6FX 1M8MA 3VRYA 1PNJA 1E7OA 4OMLA 5IHIA 2A36A 1Z9ZA 4OMPA 2V1RA 1Y57A 1BU1A 5IHNA 1I0CA 4AFUC 1UECA 2A37A 1ZLMA 2L3SA 2O2OA 2YDLA 2BTTA 2L3PA 1K0SA 4FSSA 2J6KA 4HVVA 2HEQA 2O9SA 2EKHA 2DL7A 4JPBW 2L0AA 4RTUA 1RUWA 2LNHB 2HCKA 5IXFA 4OMMA 4J9FA 4CC7A 1YCSB 2DL5A 2PTKA 2KR3A 2KXCA 2CSQA 1NYFA 2ECZA 1A0NB 1UHCA 2EVRA 4IIMA 3NHNA 2HBWA 4AFSC 2VVKA 1TUDA 5IH2A 3UF4A 4AG2C 1OPKA 2D0NA 4RTZA 3TSWA 1T3LA 3VS6A 1OV3A 2X3WD 1M3BA 4J9BA 4EIKA 2AKKA 4R0KA 2H8HA 4HXJA 2X3XD 3U23A 1NM7A 3R6NA 4ZNXA 2GBQA 1YNZA 4GBQA 2BZ8A 4J9HA 2KGTA 4F16A 4K11A 2DRKA 4DEXA 1GRIA 2C0TA 2DNUA 2KYMA 2SRCA 1SHFA 4OMOA 4ESRA 1X2KA 1X6GA 3VS3A 1UUEA 2FRWA 3EGUA 2EGEA 2J05A 2NWMA 1EFNA 1VYVA 1U06A 4RTWA 3EG0A 3TSZA 1I1JA 4J9CA 1ZBJA 2F2VA 3I5RA 2LX7A 3JV3A 2KRNA 2GGRA 2OJ2A 2DILA 1KIKA 1X2QA 2YUOA 2EW3A 2RN8A 1NG2A 2J7IA 3EG1A 2CT3A 3EG2A 2D1XA 2QDLA 1JXMA 3C0CA 4CC3A 2CH4A 1X69A 1GBQA 1E6HA 4F14A 3M0PA 1T3SA 3M0QA 3NPFA 2EYWA 1VYTA 1WYXA 2HSPA 2YT6A 1GFCA 1GFDA 2JMCA 2FPEA 5IHKA 3UATA 2KRSA 1GBRA 4JJDA 2W10A 1UJ0A 2DL3A 2PZ1A 5GJVB 1AWOA 2FRYA 2ABLA 2K6DA 1BK2A 1AZEA 1ABOA 4AG1C 2K2MA 2RNAA 4M4ZA 4RTTA 1X27A 2DA9A 2KNBB 2DBMA 4IIOA 2FO0A 2BZYA 2KYBA 2KT8A 2P4RA 1NLOC 4HCKA 2EQIA 2DM1A 1CKBA 2K79A 2LCSA 2AZSA 1WX6A 1NLPC 3RNJA 2OAWA 2RMOA 4RUGA 2KROA 2NUZA 2V1QA 5HCKA 1AWJA 2JW4A 4Z8AA 2RQVA 4ORZA 1M27C 2F2WA 1UE9A 2M51A 1MV0B 4D8DA 1Y0MA 2KRMA 2DVJA 4RTXA 2DJQA 4LUDA 1YWOA 1RLPC 4OMNA 2LP5A 1ABQA 2LJ3A 2RPNA 1M30A 2RQUA 2C0IA 2RQWA 3I9QA 5I22A 4LE9A 1NEGA 1SSHA 3H0IA 5L23A 1AWWA 4F17A 1KJWA 1I07A 2FPFA 3M0TA 2RF0A 2YUNA 1WIEA 2EBPA 1HSQA 1AD5A 2ROTA 4DEYA 1B3QA 1WXUA 2ENMA 2YUPA 2LMJA 4J9IA 1QWFA 2JXBA 2CUBA 1CSKA 1SPKA 3H0HA 2LJ0A 1S1NA 3I35A 4D8KA 2DL4A 2GTOA 2MCNA 1WLPB 3H0FA 2GNCA 1K1ZA 1UFFA 1PHTA 2EYZA 2SEMA 1QCFA 1FYNA 1UTIA 3KFVA 1OEBA 4OMQA 1NEBA 2JT4A 4JJBA 4X1VA 1GL5A 1K9AA 2EYXA 3SEMA 2KXDA 2A08A 3QWXX 1ZSGA 2LJ1A 2ROLA 3CQTA 2EPDA 4CC4B 3PE0A 1BB9A 4HVUA 1LCKA 2K3BA 4QT7A 1QLYA 2XMFA 3NMZC 1B07A 1MUZA 1M3AA 2M0YA 2LQWA 1AVZC 1YN8A 2KE9A 2DL8A 1Z9QA 3QWYA 2FG0A 1W1FA 3EG3A 1GCQA 1ARKA 1PKSA 1SEMA 3VS5A 1IO6A 2J6OA 3ULRB 1T0JA 2CH4W 1H3HA 1ZUUA 4Z89A 1ZX6A 2D8JA 4LN2A 2I0NA 4AFQC 2IIMA 2J06A 2KBTA 1PRMC 1UDLA 2O9VA 1V1CA 1PRLC 1N5ZA 2HDAA 3M0SA 1JQQA 4GLMA 1JU5C 1SHGA 1W6XA 2RQTA 4Z88A 3LH5A 2PNIA 4LNPA 2VWFA 3GBQA 3TVTA 1HJDA 2JM9A 4CC2A 4LUEA 3PVLA 2BZXA 2JM8A 1CKAA 1G2BA 4HVWA 1YWPA 1J3TA 5FWCA 1RI9A 1K0XA 4KRTA 2MOXA 2OI3A 4WCIA 1JO8A 2RQRA 3VS0A 4Y92A 2C0OA 1M3CA 1H92A 1RLQC 2CDTA 1OOTA 1UGVA 3VRZA 2LZ6B 2CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GQI A;  5I11 A;  4JJC A;  2L3Q A;  1VYU A;  3M0R A;  4RTV A;  1QWE A;  4E6R A;  2E5K A;  1FMK A;  2JS0 A;  1UHF A;  1JEG A;  3PVQ A;  1PWT A;  3SHW A;  5IXB A;  2LQN A;  1K76 A;  1AWX A;  1H8K A;  1X43 A;  1U5S A;  2KT1 A;  2JMA A;  5GJW B;  4JZ3 A;  1E6G A;  2AKL A;  2ED0 A;  3VS4 A;  3A98 A;  3M0U A;  3RBB B;  4J9D A;  2AK5 A;  3VS7 A;  1NYG A;  1WA7 A;  1GCQ C;  1WFW A;  5EC7 A;  2VKN A;  1QKX A;  2YUQ A;  1ZUK A;  3THK A;  4A63 B;  1K4U S;  2K9G A;  2DE0 X;  2D8H A;  1WDX A;  1SRL A;  1JXO A;  1SRM A;  2YSQ A;  3UA6 A;  2DRM A;  3H41 A;  3REB B;  1WI7 A;  1TG0 A;  1UJY A;  2JS2 A;  1PKT A;  1TUC A;  1ZUY A;  2EGA A;  2KEA A;  2A28 A;  1YP5 A;  1VA7 A;  2DX1 A;  2MIO A;  2DBK A;  1U3O A;  3REA B;  1AZG B;  2JTE A;  2DYB A;  4RTY A;  2DMO A;  2DF6 A;  1AOJ A;  2FPD A;  5FWB A;  1KFZ A;  2GTJ A;  1T0H A;  1BBZ A;  2CUD A;  2CT4 A;  2ED1 A;  2CRE A;  2F2X A;  1UG1 A;  1AEY A;  4J9G A;  3VS2 A;  2FEI A;  3O5Z A;  3NGP A;  1HD3 A;  1KSW A;  1WXB A;  5FW9 A;  2O88 A;  1MV3 A;  3ZL7 C;  3EHR A;  3FJ5 A;  3UA7 A;  1X6B A;  2O31 A;  4J9E A;  2ESW A;  1W70 A;  1QKW A;  3I5S A;  2K7A A;  2B86 A;  1WXT A;  3VS1 A;  2L2P A;  2W0Z A;  3IQL A;  4AFZ C;  1G83 A;  3EHQ A;  2EYY A;  5ECA A;  2EGC A;  1XOV A;  1GCP A;  2DLP A;  2AZV A;  1OPL A;  2J6F A;  4JZ4 A;  2G6F X;  1M8M A;  3VRY A;  1PNJ A;  1E7O A;  4OML A;  5IHI A;  2A36 A;  1Z9Z A;  4OMP A;  2V1R A;  1Y57 A;  1BU1 A;  5IHN A;  1I0C A;  4AFU C;  1UEC A;  2A37 A;  1ZLM A;  2L3S A;  2O2O A;  2YDL A;  2BTT A;  2L3P A;  1K0S A;  4FSS A;  2J6K A;  4HVV A;  2HEQ A;  2O9S A;  2EKH A;  2DL7 A;  4JPB W;  2L0A A;  4RTU A;  1RUW A;  2LNH B;  2HCK A;  5IXF A;  4OMM A;  4J9F A;  4CC7 A;  1YCS B;  2DL5 A;  2PTK A;  2KR3 A;  2KXC A;  2CSQ A;  1NYF A;  2ECZ A;  1A0N B;  1UHC A;  2EVR A;  4IIM A;  3NHN A;  2HBW A;  4AFS C;  2VVK A;  1TUD A;  5IH2 A;  3UF4 A;  4AG2 C;  1OPK A;  2D0N A;  4RTZ A;  3TSW A;  1T3L A;  3VS6 A;  1OV3 A;  2X3W D;  1M3B A;  4J9B A;  4EIK A;  2AKK A;  4R0K A;  2H8H A;  4HXJ A;  2X3X D;  3U23 A;  1NM7 A;  3R6N A;  4ZNX A;  2GBQ A;  1YNZ A;  4GBQ A;  2BZ8 A;  4J9H A;  2KGT A;  4F16 A;  4K11 A;  2DRK A;  4DEX A;  1GRI A;  2C0T A;  2DNU A;  2KYM A;  2SRC A;  1SHF A;  4OMO A;  4ESR A;  1X2K A;  1X6G A;  3VS3 A;  1UUE A;  2FRW A;  3EGU A;  2EGE A;  2J05 A;  2NWM A;  1EFN A;  1VYV A;  1U06 A;  4RTW A;  3EG0 A;  3TSZ A;  1I1J A;  4J9C A;  1ZBJ A;  2F2V A;  3I5R A;  2LX7 A;  3JV3 A;  2KRN A;  2GGR A;  2OJ2 A;  2DIL A;  1KIK A;  1X2Q A;  2YUO A;  2EW3 A;  2RN8 A;  1NG2 A;  2J7I A;  3EG1 A;  2CT3 A;  3EG2 A;  2D1X A;  2QDL A;  1JXM A;  3C0C A;  4CC3 A;  2CH4 A;  1X69 A;  1GBQ A;  1E6H A;  4F14 A;  3M0P A;  1T3S A;  3M0Q A;  3NPF A;  2EYW A;  1VYT A;  1WYX A;  2HSP A;  2YT6 A;  1GFC A;  1GFD A;  2JMC A;  2FPE A;  5IHK A;  3UAT A;  2KRS A;  1GBR A;  4JJD A;  2W10 A;  1UJ0 A;  2DL3 A;  2PZ1 A;  5GJV B;  1AWO A;  2FRY A;  2ABL A;  2K6D A;  1BK2 A;  1AZE A;  1ABO A;  4AG1 C;  2K2M A;  2RNA A;  4M4Z A;  4RTT A;  1X27 A;  2DA9 A;  2KNB B;  2DBM A;  4IIO A;  2FO0 A;  2BZY A;  2KYB A;  2KT8 A;  2P4R A;  1NLO C;  4HCK A;  2EQI A;  2DM1 A;  1CKB A;  2K79 A;  2LCS A;  2AZS A;  1WX6 A;  1NLP C;  3RNJ A;  2OAW A;  2RMO A;  4RUG A;  2KRO A;  2NUZ A;  2V1Q A;  5HCK A;  1AWJ A;  2JW4 A;  4Z8A A;  2RQV A;  4ORZ A;  1M27 C;  2F2W A;  1UE9 A;  2M51 A;  1MV0 B;  4D8D A;  1Y0M A;  2KRM A;  2DVJ A;  4RTX A;  2DJQ A;  4LUD A;  1YWO A;  1RLP C;  4OMN A;  2LP5 A;  1ABQ A;  2LJ3 A;  2RPN A;  1M30 A;  2RQU A;  2C0I A;  2RQW A;  3I9Q A;  5I22 A;  4LE9 A;  1NEG A;  1SSH A;  3H0I A;  5L23 A;  1AWW A;  4F17 A;  1KJW A;  1I07 A;  2FPF A;  3M0T A;  2RF0 A;  2YUN A;  1WIE A;  2EBP A;  1HSQ A;  1AD5 A;  2ROT A;  4DEY A;  1B3Q A;  1WXU A;  2ENM A;  2YUP A;  2LMJ A;  4J9I A;  1QWF A;  2JXB A;  2CUB A;  1CSK A;  1SPK A;  3H0H A;  2LJ0 A;  1S1N A;  3I35 A;  4D8K A;  2DL4 A;  2GTO A;  2MCN A;  1WLP B;  3H0F A;  2GNC A;  1K1Z A;  1UFF A;  1PHT A;  2EYZ A;  2SEM A;  1QCF A;  1FYN A;  1UTI A;  3KFV A;  1OEB A;  4OMQ A;  1NEB A;  2JT4 A;  4JJB A;  4X1V A;  1GL5 A;  1K9A A;  2EYX A;  3SEM A;  2KXD A;  2A08 A;  3QWX X;  1ZSG A;  2LJ1 A;  2ROL A;  3CQT A;  2EPD A;  4CC4 B;  3PE0 A;  1BB9 A;  4HVU A;  1LCK A;  2K3B A;  4QT7 A;  1QLY A;  2XMF A;  3NMZ C;  1B07 A;  1MUZ A;  1M3A A;  2M0Y A;  2LQW A;  1AVZ C;  1YN8 A;  2KE9 A;  2DL8 A;  1Z9Q A;  3QWY A;  2FG0 A;  1W1F A;  3EG3 A;  1GCQ A;  1ARK A;  1PKS A;  1SEM A;  3VS5 A;  1IO6 A;  2J6O A;  3ULR B;  1T0J A;  2CH4 W;  1H3H A;  1ZUU A;  4Z89 A;  1ZX6 A;  2D8J A;  4LN2 A;  2I0N A;  4AFQ C;  2IIM A;  2J06 A;  2KBT A;  1PRM C;  1UDL A;  2O9V A;  1V1C A;  1PRL C;  1N5Z A;  2HDA A;  3M0S A;  1JQQ A;  4GLM A;  1JU5 C;  1SHG A;  1W6X A;  2RQT A;  4Z88 A;  3LH5 A;  2PNI A;  4LNP A;  2VWF A;  3GBQ A;  3TVT A;  1HJD A;  2JM9 A;  4CC2 A;  4LUE A;  3PVL A;  2BZX A;  2JM8 A;  1CKA A;  1G2B A;  4HVW A;  1YWP A;  1J3T A;  5FWC A;  1RI9 A;  1K0X A;  4KRT A;  2MOX A;  2OI3 A;  4WCI A;  1JO8 A;  2RQR A;  3VS0 A;  4Y92 A;  2C0O A;  1M3C A;  1H92 A;  1RLQ C;  2CDT A;  1OOT A;  1UGV A;  3VRZ A;  2LZ6 B;  2CSI A; 
#chains in the Genus database with same CATH topology
 3HRT A;  2K5I A;  3TEE A;  4RTV A;  1FMW A;  2JS0 A;  1UHF A;  2V8I A;  2GFA A;  1PWT A;  2DD4 A;  2QAS A;  5IXB A;  1R0C B;  1D09 B;  1H8K A;  2KT1 A;  1U5S A;  5GJW B;  4C92 G;  1VQ8 Q;  5GAN 7;  3CCU T;  2FL7 A;  4C0D C;  2CP2 A;  1LJO A;  4L6V 5;  3JCM c;  1GCQ C;  3UDC A;  2YUQ A;  1ZUK A;  1PCX A;  4M7A A;  2NUP A;  3FC3 A;  1WGS A;  1K4U S;  2DE0 X;  1IHV A;  3L2R A;  3RUX A;  3UA6 A;  5A0D A;  2RHY A;  1B34 A;  1B7T A;  3EFO B;  2CP7 A;  2P0K A;  4BE2 A;  2RJE A;  5D7U A;  3OMG A;  3QJY A;  3C95 A;  2HZY A;  1FWZ A;  2DBK A;  2OTJ A;  4ME7 A;  1D1A A;  1WJQ A;  4M7D E;  4RTY A;  3JCM e;  1W2B P;  1Q86 C;  1AOJ A;  3GLX A;  2GTJ A;  4JRQ A;  1QP3 A;  2ED1 A;  4FYX B;  2F2X A;  1VQK A;  5HY6 A;  3DB3 A;  2EJG A;  2VC8 A;  1MMA A;  3NGP A;  1HD3 A;  1KSW A;  4QQ6 A;  2D0Q B;  1JRI A;  4M78 A;  5FW9 A;  2O88 A;  1MV3 A;  3EHR A;  3HHT B;  3VYH B;  3FJ5 A;  2RJF A;  4DBH A;  3SDZ A;  4J9E A;  4OGE A;  1W70 A;  4NL3 A;  2AIR B;  3BW1 A;  2L2P A;  1ZA1 B;  3CPW P;  3IQL A;  4AFZ C;  4M77 C;  4M7D D;  1XOV A;  3HPW A;  3JAM E;  1RAC B;  2DLP A;  2EQM A;  4M7D B;  2J6F A;  4M75 G;  3JCM X;  2CP3 A;  3VRY A;  2X4Y A;  3MP6 A;  1E7O A;  3OYC A;  4XQ3 A;  1WHK A;  4OMP A;  2DZC A;  5FRM A;  3JCM f;  2LNV A;  4M78 F;  5IHN A;  1ZBX A;  1I0C A;  2A37 A;  2L8D A;  4FSS A;  4HVV A;  1Q82 C;  3GOX A;  5KYY B;  3LWH A;  4MZM A;  3A1P A;  4JPB W;  3M56 A;  2R5A A;  2HCK A;  4OMM A;  3EAE A;  2RHZ A;  4J9F A;  1YCS B;  3MEV A;  1PSE A;  2KR3 A;  2KXC A;  1KQS P;  3P8D A;  2QAZ A;  4IIM A;  4C8Q G;  2QQR A;  4AFS C;  3I56 Q;  3JB9 H;  5A2Q E;  1VQ4 Q;  4RCB A;  3JRZ A;  2LQ8 A;  1PD0 A;  1YBY A;  2AKK A;  5LJ5 e;  5DM7 R;  3U23 A;  1UGS B;  5D6W A;  4EMK C;  1NM7 A;  5J26 A;  3QG1 A;  3MJX A;  3V8K A;  4GBQ A;  1K73 C;  4J9H A;  4F7U E;  2X51 A;  4F16 A;  3I56 A;  2FYK A;  2OX7 A;  2KQW A;  1QVG S;  1C0M A;  4FYY B;  3CEY A;  3X20 B;  4PJO A;  1KD1 C;  1YIJ Q;  3A5Z B;  3M5A A;  3S6W A;  1X2K A;  1G3S A;  1WHJ A;  2L3R A;  2EFI A;  2M0O A;  2QYZ A;  3PFS A;  3EGU A;  2EGE A;  2J05 A;  3FRN A;  2NWM A;  1VYV A;  3TSZ A;  1I1J A;  4J9C A;  1ZBJ A;  4XTU A;  3CCR T;  3MEW A;  4C0D B;  4HT8 A;  4PFZ A;  2YUO A;  4WTO B;  4KUD K;  5IAY A;  3HFO A;  3EG2 A;  2HQX A;  2K2V A;  5GAO l;  4CC3 A;  4F7U B;  1GBQ A;  1SG5 A;  2F5T X;  4CRI A;  1VYT A;  4FYV B;  4DOV A;  1W4S A;  5C6S A;  3HL8 A;  2JMC A;  2FPE A;  5IHK A;  3UAT A;  3N5B B;  2KRS A;  4JJD A;  4CI0 C;  2W10 A;  4BUG A;  1AWO A;  1VQ9 Q;  3X25 B;  4X9C A;  2ZPG B;  2YLB A;  2X35 A;  2K2M A;  1Q7Y C;  1VQL Q;  1D0Z A;  2P0Q A;  2DBM A;  1M1F A;  4IIO A;  1ZSZ C;  2FO0 A;  2ATC B;  2DEQ A;  1NLO C;  1MGQ A;  4XU0 A;  1WX6 A;  3I55 Q;  1IXD A;  2P0P A;  4FT2 A;  2RO0 A;  3GNF B;  5LJ3 e;  5HCK A;  4DA4 A;  4KH0 B;  2P84 A;  3PNW C;  4IUV A;  1Q86 U;  4TVR A;  2FZG B;  2JW4 A;  4IKF A;  4ORZ A;  1M27 C;  4AT1 B;  5KYY A;  1MV0 B;  1G3W A;  3FIF A;  2KRM A;  3CXC P;  3M4Y A;  4LUD A;  4OMN A;  2VXF A;  2JN0 A;  3X28 B;  3QKJ A;  4Y28 E;  1M90 U;  3OBW A;  3HKS A;  2AHJ B;  2RQU A;  1K8A U;  3OYM A;  3H0I A;  3QUI A;  2JUF A;  2ZPF B;  3JCM d;  3S3M A;  2RF0 A;  2YUN A;  3CCS Q;  2EBP A;  4EPC A;  1AD5 A;  2MYS A;  2ROT A;  2XD0 A;  1VQN Q;  2JNG A;  5HK0 A;  1B3Q A;  1WXU A;  3OYJ A;  5J3B A;  2OTL Q;  4J9I A;  1H64 1;  2JXB A;  1CSK A;  3CCM Q;  4OB2 B;  4C0G A;  3SWN C;  2RHI A;  3H0H A;  3E19 A;  3EGX B;  2CS7 A;  3HP9 A;  4MDW A;  1LNX A;  5LJ3 f;  3CCE A;  1NJI U;  1I5O B;  3H0F A;  2GNC A;  1VQN A;  4JRK A;  4E47 A;  3OS2 A;  2CZ0 B;  2K5L A;  2M9U A;  1RAA B;  1MMN A;  1QCF A;  2F1L A;  1FYN A;  5GAN e;  1YJN A;  4OMQ A;  4X1V A;  4MZP A;  1Q86 R;  2PUK B;  2PVD B;  5GAM e;  1QVG A;  1M1K C;  2WSE E;  3QWX X;  1ZSG A;  2HQH A;  1X6O A;  1XJW B;  3OQ5 A;  2QI2 A;  4HVU A;  2K3B A;  2DK3 A;  2DET A;  1M90 R;  1B07 A;  1FXX A;  1M3A A;  4JDS A;  1K8A R;  2XDP A;  1IRE B;  3LLR A;  3CCV Q;  2FG0 A;  3VJP A;  1GCQ A;  1PKS A;  1SEM A;  1IO6 A;  2J6O A;  3ULR B;  4KGZ B;  1YHQ A;  2CH4 W;  4QVD A;  1YIT Q;  4Z89 A;  2VV5 A;  2D8J A;  2QK0 A;  1I5L A;  4A4E A;  1N6A A;  1VIE A;  4AFQ C;  2RA2 A;  4PLI A;  2O9V A;  1TU0 B;  2E5Q A;  1N5Z A;  2LVM A;  1JU5 C;  1K73 U;  3CCV A;  1W6X A;  4Z88 A;  2PNI A;  3CC4 Q;  5GAN f;  2KSS A;  1VQO T;  3GBQ A;  1NJI R;  4E7J A;  4HCZ A;  2JM8 A;  1G2B A;  5KH6 A;  4M7A E;  4FU6 A;  3CCJ T;  2KY9 A;  2H3J A;  4HVW A;  5LJ5 d;  1VQ6 Q;  1K9M C;  1J3T A;  1G5V A;  3MPU B;  2QQB A;  1K0X A;  4JLI A;  1U8R A;  5CVI A;  4KRT A;  1Y71 A;  1QVF S;  2E6Z A;  4M78 G;  4F7U F;  3NTI A;  3CC4 A;  1YI2 Q;  4Y92 A;  2C0O A;  3CC7 T;  5KCO A;  1M3C A;  2XID A;  2QG9 B;  2E3H A;  1OOT A;  3G4S T;  2YXY A;  3VRZ A;  2O4X B;  1XNI A;  2CSI A;  4C5G A;  1PG5 B;  1QWE A;  4E6R A;  2E5K A;  3BDU A;  4QVC A;  1VQ5 A;  3SHW A;  4M77 A;  2QTV A;  5L8R E;  3CME Q;  4HCB A;  2D6F A;  1WPY A;  4JJN K;  5CKB A;  1NZ9 A;  1TXQ A;  3A98 A;  4M7A D;  4J5Y A;  1VQ5 T;  1WFW A;  5EC7 A;  3THK A;  3QXE B;  1BI1 A;  1M8V A;  2K9G A;  3TQ7 P;  1K73 R;  4R56 A;  1JXO A;  2YSQ A;  3JCM b;  3JCM h;  2EKO A;  3H41 A;  2JS2 A;  1Y96 B;  1WQW A;  3JB9 I;  2EGA A;  2KEA A;  1NBE B;  4BAC A;  3RES A;  3CC2 T;  1YP5 A;  1EIF A;  1RAB B;  1BIA A;  3OYL A;  3QSU A;  3A8O B;  3JB9 J;  3ZBD A;  2YRC A;  1BCM A;  4M77 F;  1AZG B;  4M7D C;  3JB9 D;  2DYB A;  2V26 A;  2DKG A;  1BBZ A;  2CUD A;  1U1S A;  3LX7 A;  3JCM W;  4ATO A;  1AEY A;  1OZ3 A;  3VS2 A;  4XTV A;  1ZA2 B;  3S3O A;  1WXB A;  1WNL A;  5GAO m;  1RAF B;  3ZL7 C;  3UA7 A;  1JBM A;  1UEB A;  4EMK A;  1QMC A;  1X6B A;  2ESW A;  1VQM A;  2K7A A;  5LJ3 d;  2CP6 A;  4ZN1 A;  3VS1 A;  1S72 A;  3QDF A;  2W0Z A;  3J80 E;  3G71 Q;  1G83 A;  2LT4 A;  2NLU A;  4RCC A;  1V29 B;  2EGC A;  2HL5 C;  3OW2 S;  4RKU E;  1VQM T;  5CQX A;  5DY9 A;  1N8R U;  2Y90 A;  2QEX Q;  1PNJ A;  3ME9 A;  2DJZ A;  3QYH B;  2A36 A;  3MEU A;  5CIU A;  3H8Z A;  3HRU A;  2DXT A;  4KH1 B;  3CMA Q;  1UEC A;  4O5V A;  3G71 A;  1ZLM A;  4MDX A;  2L3S A;  2FZK B;  3L1A A;  4UC4 A;  4FW2 A;  1QW1 A;  4RTU A;  1RUW A;  2LNH B;  3CCQ T;  3C12 A;  2PTK A;  1M1K U;  3G1J A;  2ECZ A;  2E1H A;  1UHC A;  3CCU Q;  2EVR A;  5LJ5 h;  3OB9 A;  2L5Q A;  1VUB A;  1VQ7 Q;  1G3T A;  3JSC A;  1QVF A;  2O4X A;  2D0N A;  4RTZ A;  5GAN d;  2HL3 A;  2X3W D;  1FX7 A;  1OQK A;  4J9B A;  3VKI A;  4EIK A;  5GAM d;  2WAC A;  3G6E Q;  1C1A A;  2DIG A;  4ZNX A;  4PK4 A;  1N8R R;  4DBR A;  1ZSZ A;  3AT1 B;  2PQW A;  4J6X A;  4DEX A;  1VQ8 A;  1GRI A;  4C0Z A;  2LX9 A;  1I81 A;  1SHF A;  1TWB A;  2EJ9 A;  4ESR A;  2PVG B;  4X9D A;  1ZHI A;  4ZTF A;  1X6G A;  5KYX A;  4C92 E;  3NTK A;  1UUE A;  1GXI E;  2EIF A;  1K9M U;  1EFN A;  2IVW A;  4RTW A;  1Q81 U;  2OTJ T;  1RAD B;  2PVO B;  4E7H A;  2DIL A;  1U1T A;  1M1K R;  4KUI A;  4LDW A;  1M90 C;  2EW3 A;  1QQJ A;  2RN8 A;  1K8A C;  1NG2 A;  1VQK T;  2G3R A;  1TUG B;  1P92 A;  4L59 A;  1TS9 A;  2P4T A;  1X69 A;  4EDU A;  1IHW A;  4F14 A;  3M0P A;  3M0Q A;  2EYW A;  1WJS A;  1WYX A;  4FIB A;  1KQ2 A;  1GFC A;  4C92 D;  5KCH A;  1GFD A;  3SWN A;  4IUT A;  4C92 B;  4V2S A;  4HKE A;  2PZ1 A;  2QDY B;  5GJV B;  3MP1 A;  2K6D A;  1BK2 A;  4J7F A;  5AYF A;  1QP2 A;  1NJI C;  1AZE A;  5LJ3 h;  4ZGJ B;  2LCL A;  4C5E A;  3EH2 A;  1Y7X A;  2E41 A;  1PC0 A;  3GPL A;  1G8X A;  2P4R A;  2KT8 A;  2DTO A;  3M59 A;  2EQI A;  3RER A;  1NLP C;  3OW2 A;  1K9M R;  3R6O A;  1KQ1 A;  1Q81 R;  2YRV A;  2NUZ A;  3OA6 A;  4M75 E;  1AWJ A;  2QA4 Q;  3E9G A;  4D6W A;  1YJW Q;  1WQ7 A;  3BFM A;  2E6N A;  2RQV A;  2F2W A;  1UE9 A;  2M51 A;  9ATC B;  1JJ2 P;  4JLG A;  3PIP A;  2YHT A;  3OYA A;  3EG9 A;  1M30 A;  3I9Q A;  2ZCF B;  3E1S A;  4LE9 A;  1NEG A;  4F7U G;  1SSH A;  3VYG A;  1I07 A;  5DLO A;  1BI2 A;  1YJW A;  4B9W A;  1RL2 A;  4RMO A;  4XTW A;  1WIE A;  3L2Z A;  1N9R A;  3CD6 Q;  4LDV A;  4C8Q E;  4NOY A;  1YJ9 Q;  1QWF A;  1VQ4 A;  3CPF A;  4M75 D;  5GAN h;  4KT0 E;  1I4K 1;  3V7S A;  3CCR Q;  1W2B S;  5GAM h;  3I56 T;  2LJ0 A;  4C5H A;  5GMK e;  4D8K A;  2KDS A;  3CD6 A;  3EFO A;  1VQ4 T;  4FL6 A;  3QPH A;  4OGC A;  3PTA A;  1PHT A;  3JCM P;  2MK5 A;  1YJ9 A;  1UGQ B;  2K57 A;  3KFV A;  4J6W A;  1YIJ A;  4JJB A;  1GL5 A;  2KXD A;  1M5Q 1;  1NE8 A;  5GAN 6;  2HKN A;  3NFC A;  3PE0 A;  4M77 G;  1BB9 A;  1WJR A;  5LJ5 f;  1LCK A;  1QLY A;  3CBO A;  4C8Q D;  5GAN 2;  3NMZ C;  3CPW S;  3SFM A;  1MNE A;  4DOW A;  4FYW B;  2KE9 A;  1Z9Q A;  3ZFJ A;  8ATC B;  1W1F A;  3EG3 A;  1ARK A;  3RMQ A;  1TSF A;  4Q5W A;  3J81 E;  1ZUU A;  2I0N A;  5LJ3 j;  3EGD B;  2IIM A;  2J06 A;  4BI3 A;  2A0F B;  1PRL C;  2HDA A;  2X4J A;  3FEO A;  1JQQ A;  4GLM A;  2MWO A;  4J8O A;  2JVV A;  2MMP A;  2RQT A;  3VUB A;  4M7D A;  3LGF A;  2VWF A;  2ZGW A;  4CC2 A;  4LUE A;  1D3B B;  5DLQ E;  1VQ9 A;  3PVL A;  2BZX A;  3RMS A;  1KHC A;  4JRI A;  4M7A C;  1KQS S;  1UGP B;  4PKC C;  5GAO n;  1RI9 A;  1VQL A;  3MEA A;  5A0G A;  2OI3 A;  4OB1 B;  1AHJ B;  1RAG B;  2XI9 A;  4BD3 A;  5CO7 A;  3ASK A;  2BE7 D;  1RLQ C;  2CDT A;  2CGH A;  3OYI A;  3I55 A;  1WZO A;  2EYX A;  4LDU A;  2HQE A;  2ZPI B;  2RH2 A;  3QJ6 A;  4XU3 A;  4M7D F;  3OYY A;  2XK0 A;  3PVQ A;  2XU8 A;  4VUB A;  4LD9 K;  4YTL A;  2FHD A;  1AWX A;  5I21 A;  1QVF P;  4II1 A;  2JMA A;  4KBM B;  4JZ3 A;  5GAN j;  2ZPE B;  1N8R C;  4J9D A;  2AK5 A;  3RDV A;  3VS7 A;  5GAM j;  1WA7 A;  3P8H A;  1JB0 E;  1QKX A;  1H3Z A;  3CCL Q;  2RK1 A;  1WDX A;  1SRL A;  4FSX A;  3CCS A;  2DEU A;  2E65 A;  3JCM J;  1TG0 A;  2HNI A;  3PIO A;  1ZUY A;  4E7K A;  1ACM B;  2OTL A;  3T9N A;  1VA7 A;  2DX1 A;  4A4G A;  3GIB A;  3CCE T;  3CCM A;  1EZZ B;  2MIO A;  3CCL A;  3REA B;  4OB3 B;  2DPP B;  4O6J A;  2JTE A;  1VQN T;  2DMO A;  2BIV A;  4B9X A;  1KFZ A;  2M1H A;  2COW A;  2OAU A;  2HBP A;  1YJN T;  5GAN 4;  1SSF A;  2CT4 A;  1W2B A;  2CRE A;  1NPP A;  1UG1 A;  2E3I A;  2DYI A;  3MKD A;  2E12 A;  4MML A;  3O5Z A;  1OZ2 A;  1VIF A;  3EFR A;  3RIR A;  4N0A C;  3OYB A;  2EAY A;  2X9H A;  3TU4 K;  4F7U A;  3I5S A;  4Z02 A;  1WXT A;  4J6Y A;  5FU6 C;  3PGG A;  1VQO Q;  1YHQ T;  4BY6 C;  3BDL A;  5LL6 S;  2HAX A;  3EHQ A;  2EQK A;  5ECA A;  3CPW A;  1GCP A;  3RKY A;  2AZV A;  1OPL A;  2NUT B;  2I2L A;  1M8M A;  2RK2 A;  3HRS A;  1YIT A;  4OML A;  3UT1 A;  3EGD A;  5GAM f;  5GAO r;  1Z9Z A;  3CCV T;  1Y57 A;  3CC7 Q;  2R57 A;  3ZEH A;  2QTX A;  3OYK A;  4AFU C;  3G4S Q;  3MO8 A;  3KUF A;  4OMF B;  2KI7 A;  3FJP A;  2O2O A;  2YDL A;  1Q81 C;  2BTT A;  2L3P A;  1K0S A;  3D7S B;  2J6K A;  3CXC S;  4PNO A;  2EKH A;  2DL7 A;  2K5F A;  2M02 A;  3V7R A;  4RG2 A;  3OYE A;  1MND A;  4A4K A;  2DL5 A;  3LYI A;  4A54 A;  2XKO C;  2EQU A;  4JRP A;  3OYD A;  2CSQ A;  1NYF A;  1HK9 A;  1VQ6 A;  3CC4 T;  4GLK A;  3A8L B;  1KQS A;  2DXU A;  3NHN A;  3V8L A;  2HBW A;  3HTR A;  2XIC A;  2F5K A;  2VVK A;  1OX8 A;  3OYH A;  2CZ6 B;  1TUD A;  5I2S A;  1YI2 A;  5IH2 A;  4N4G A;  3QO3 A;  1OPK A;  1BCO A;  3TSW A;  1WHH A;  2IPO B;  3VS6 A;  3ER0 A;  1LOJ A;  4EMH A;  4M78 E;  4M7A B;  2NUP B;  4R0K A;  3CC2 Q;  4HXJ A;  2X3X D;  1XTD A;  1M1G A;  2GBQ A;  3M53 A;  3CME A;  1B34 B;  2BZ8 A;  2KGT A;  3SD4 A;  4K11 A;  2C0T A;  2DNU A;  2CZ7 B;  5KYW B;  2RD1 A;  2ZPH B;  2SRC A;  1QCO A;  4BDZ A;  1MMD A;  2PUO B;  4C92 C;  2RHU A;  2VB6 A;  3EGX A;  5CAI A;  4LXC A;  2FRW A;  4PJM A;  1IZ6 A;  1U06 A;  2WSF E;  3I5R A;  3DLL A;  5KYN A;  2LX7 A;  4M78 D;  2GGR A;  1VQP Q;  4ELZ C;  4IUQ A;  2DVE A;  1X2Q A;  3UWN A;  4M78 B;  2X4W A;  2ZAE A;  2J7I A;  2IG0 A;  4BE1 A;  4FT4 A;  1JXM A;  1KHI A;  2LQK A;  3C0C A;  4QQD A;  3RKW A;  4XU2 A;  1E6H A;  1T3S A;  3O8V A;  3QHS A;  4R55 A;  1VQP A;  2YT6 A;  3M4G A;  2AT1 B;  3GF5 A;  3E2U A;  1LVK A;  2BE9 B;  2QQA A;  1PM3 A;  1M9S A;  4KUL A;  1UJ0 A;  1TOV A;  2DL3 A;  4A4H A;  1S72 T;  4LDY A;  4HA8 A;  2ABL A;  4DQ2 A;  3P8B B;  5GAN 3;  2YRD A;  1KC8 U;  2GCX A;  3QBY A;  3CCQ Q;  4AG1 C;  4IUP A;  4M4Z A;  4RTT A;  4ZGD B;  1X27 A;  2DA9 A;  2KNB B;  4XK8 E;  2DXC A;  1R0B G;  2QEX A;  2AZS A;  3WVD B;  3G71 T;  2Y4X A;  3L2U A;  1R77 A;  4PJO E;  4RUG A;  3OS0 A;  3CMA A;  4M75 C;  3OSV A;  5FU6 B;  2QEX T;  4BY6 B;  2YWW A;  4JUV A;  2JTM A;  3NTH A;  4D8D A;  1Y0M A;  2DJQ A;  2LP5 A;  2EWN A;  2LJ3 A;  2RPN A;  3CXC A;  2C0I A;  3EH1 A;  2CP5 A;  3E9F A;  1KJW A;  3CCU A;  2FPF A;  3KBG A;  1VQ7 A;  3QZ9 B;  5GMK h;  4DEY A;  4M7D G;  4FW1 A;  4PJO D;  4C8Q C;  3QII A;  2YUP A;  2LMJ A;  4C0F A;  2FZC B;  3VU3 C;  4PJO B;  2CUB A;  1KC8 R;  1VQ7 T;  4PFO A;  4C5I A;  4ANJ A;  2OTJ Q;  4GY5 A;  3G6E A;  1VQ8 T;  5CKF A;  1S1N A;  3I35 A;  3VV0 A;  2BUD A;  2VGM A;  4ZTJ A;  1Y96 A;  2GTO A;  1WLP B;  1K1Z A;  1OU8 A;  1UFF A;  1VQK Q;  5KYW A;  3G6E T;  2JOY A;  1QVG P;  3OYN A;  5IT9 E;  4L5G A;  1K9A A;  4OVA A;  3INZ A;  3SEM A;  2A08 A;  1SF9 A;  2GFU A;  3OYF A;  2LJ1 A;  2LT1 A;  3CQT A;  2EPD A;  1O75 A;  2DIQ A;  5CKE A;  4CC4 B;  2QQ9 A;  1YFN A;  4QT7 A;  4M7A F;  1Q95 G;  2DAQ A;  1MUZ A;  1DJ7 B;  5GAN 5;  1D0Y A;  2LQW A;  2O01 E;  1AVZ C;  4E7L A;  1HXD A;  3QWY A;  3V8J A;  3VS5 A;  3WXM B;  1T0J A;  1LPL A;  2KK4 A;  1ZX6 A;  2HD0 A;  4KGX B;  4LN2 A;  2JZ2 A;  1PD1 A;  3LWI A;  2EQJ A;  1PRM C;  2KMT A;  1UDL A;  5M9O A;  2VAS A;  1MHN A;  1Y07 A;  1SHG A;  3GNG A;  3A8M B;  3JB9 F;  3LH5 A;  5KE3 A;  1D0X A;  1IGQ A;  4PJJ A;  3TVT A;  1X75 C;  2E64 A;  2JM9 A;  5KYU B;  4PJL A;  1CKA A;  1BI0 A;  1RI0 A;  2QQS A;  4QKU A;  5LJ5 j;  1YWP A;  5EG2 A;  2ZPB B;  3H6Z A;  1NPR A;  4N0A A;  1R8O B;  1JO8 A;  2RQR A;  6AT1 B;  3SB2 A;  2CKK A;  2GQV A;  2GF7 A;  2X4X A;  2LZ6 B;  2GQI A;  5I11 A;  4XU1 A;  2MF2 A;  5CR2 A;  4JJC A;  2L3Q A;  1VYU A;  3M0R A;  3OS1 A;  5FRO A;  4A53 A;  4FCY A;  2XG8 D;  1FMK A;  2QA4 A;  2B8A A;  1JEG A;  5GMK j;  2RI5 A;  1I8F A;  2LQN A;  1K76 A;  1D1C A;  2HKQ B;  3LH0 A;  3VUZ A;  2QGF B;  2DZ9 A;  2R5M A;  1X43 A;  3S3N A;  4J7I A;  3MP8 A;  4EMG A;  4MZT A;  1E6G A;  2AKL A;  2QA4 T;  2ED0 A;  3VS4 A;  3M0U A;  3RBB B;  2WSC E;  1YJW T;  1NYG A;  2JTF A;  4A63 B;  3L2W A;  2VKN A;  1G3Y A;  4XAX B;  1RAH B;  2D9T A;  3J7A F;  2D8H A;  4M75 B;  4P5N A;  2DTI A;  2K3Y A;  1SRM A;  2XDB A;  4HT9 A;  2DRM A;  4X34 A;  4QQG A;  3REB B;  1WI7 A;  1UJY A;  1PKT A;  1TUC A;  2A28 A;  3C94 A;  2H3E B;  4Y91 A;  3H9N A;  5GMK m;  1XQH A;  3PT9 A;  2RI3 A;  3F70 A;  3CD6 T;  1FMV A;  1U3O A;  5C0M A;  3CCR A;  2K3X A;  3A8H B;  3QDR B;  2DF6 A;  2FPD A;  5FWB A;  1YJ9 T;  3HSB A;  1T0H A;  4KGV B;  4B6M A;  4XTX A;  1O9S A;  2E70 A;  1YIJ T;  2LTO A;  3DB4 A;  4J9G A;  2FEI A;  1N9S A;  4C8Q B;  5HKC A;  3RKX A;  2KVQ G;  1QVP A;  5CK9 A;  2O31 A;  4QW2 A;  5D6Y A;  1QKW A;  4PJO F;  2B86 A;  2VGN A;  1IRX A;  4LDX A;  3OS5 A;  4E7S A;  2R58 A;  2EYY A;  4M77 E;  1OUL A;  2RJC A;  2MAM A;  4WF2 A;  1QCN A;  4E7Z A;  3FB9 A;  4AMC A;  4E7I A;  4OP0 A;  4C92 A;  1WHL A;  4JZ4 A;  2G6F X;  2VUB A;  3JCM g;  3G7Z A;  5IHI A;  3OYG A;  2V1R A;  4LD6 A;  1BU1 A;  3OY9 A;  2M16 A;  5CCA A;  1OU9 A;  5CKD A;  1JJ2 S;  1VQ9 T;  2HEQ A;  2O9S A;  5FU7 C;  1SKU B;  2L0A A;  2JJ9 A;  5IXF A;  2LDM A;  5KYU A;  2MPX C;  1VQL T;  3CBM A;  4CC7 A;  4ZN3 A;  3QYG B;  3A8G B;  1A0N B;  1WHG A;  4M77 D;  4C92 F;  5FLX E;  4M77 B;  3I55 T;  5J39 A;  4FM4 B;  2HSE B;  1BIB A;  3CBP A;  3OBY A;  3L2Q A;  3UF4 A;  4AG2 C;  5GAO p;  1UB4 A;  2EJF A;  3WVE B;  4ELY C;  1T3L A;  4M78 C;  1OV3 A;  1M3B A;  3DLM A;  2H8H A;  2VYT A;  2CYZ B;  3R6N A;  1KC8 C;  2XHC A;  2DO3 A;  3CCE Q;  1YNZ A;  8AT1 B;  3MET A;  3L2V A;  2DRK A;  5GAO q;  2KYM A;  4DBF A;  3M55 A;  1YJN Q;  4OMO A;  1M2V B;  2PU9 B;  3CCS T;  4M75 A;  3VS3 A;  3RR6 A;  2LCC A;  4DBQ A;  4J83 A;  4PFP A;  2OTL T;  3CCM T;  3CCL T;  3FLG A;  2E4H A;  3EG0 A;  3M57 A;  2F2V A;  3JV3 A;  2KRN A;  1Q82 U;  1BKB A;  2OJ2 A;  5AT1 B;  1KIK A;  5LJ5 g;  1YHQ Q;  3EG1 A;  2CT3 A;  2COY A;  2RJD A;  4EMK B;  2D1X A;  2QDL A;  4HCC A;  2CH4 A;  3QZ5 B;  1VOM A;  1WHM A;  3TRE A;  4NS5 A;  3NPF A;  3AHU A;  4C8Q A;  4M75 F;  2HSP A;  3LW5 E;  5GAN 8;  2VXE A;  4ZGE B;  1HYO A;  2MI6 A;  3M9Q A;  3CCJ Q;  4M7A G;  4N4H A;  1GBR A;  5KE2 A;  4BI4 A;  1PSF A;  2FRY A;  3BE3 A;  3M54 A;  2NYS A;  2XDD A;  1EX4 A;  1M4Z A;  2CZ1 B;  1VQO A;  1ABO A;  3EFS A;  2RNA A;  4PJN A;  2HMA A;  1YIT T;  1TTH B;  1MMG A;  4XTY A;  2DXB A;  3CCJ A;  2COZ A;  2BZY A;  2KYB A;  4HCK A;  3OW2 P;  1OYX A;  3FDR A;  2LC4 A;  2DM1 A;  1KD1 U;  1CKB A;  2K79 A;  2LCS A;  1UGR B;  1D3B A;  4BDY A;  2FB7 A;  4C8Q F;  4PJO C;  3RNJ A;  3JB9 G;  2OAW A;  2E10 A;  2QGG A;  2RMO A;  2KRO A;  2V1Q A;  3CC7 A;  2V8K A;  1D1B A;  1BYM A;  1Q82 R;  4RG8 A;  3G4S A;  1VQ5 Q;  3GP8 A;  5GMK i;  4Z8A A;  4BE0 A;  1OI1 A;  1TH7 A;  2F69 A;  4IUU A;  4RTX A;  2DVJ A;  1YWO A;  1RLP C;  1ABQ A;  2L89 A;  1JJ2 A;  1VQ6 T;  2RHX A;  2RQW A;  4PLL A;  5I22 A;  5FRN A;  3HFN A;  3DKM A;  1RAI B;  5L23 A;  4JS4 A;  2DER A;  1AWW A;  4F17 A;  2A3L A;  1YCY A;  1YI2 T;  3M0T A;  3PMI A;  2YLC A;  5D6X A;  1HSQ A;  3C4S A;  3TCJ A;  1IB8 A;  1ZSZ B;  2QXF A;  5FU7 B;  1M2O A;  4PL6 A;  1C6V X;  2ENM A;  4OF1 A;  5IN1 A;  1KK7 A;  3JCM Q;  3CME T;  1SPK A;  5LJ3 g;  2RI2 A;  3CC2 A;  4NL2 A;  5GMK l;  5CKH A;  5KYX B;  4BB7 A;  4F04 B;  2K4Y A;  2RB6 A;  3M58 A;  3LGL A;  3V7C A;  3X26 B;  1V76 A;  4XTZ A;  2DL4 A;  2MCN A;  2FVU A;  1Q7Y U;  1KD1 R;  3MHX A;  2EYQ A;  3X24 B;  2EYZ A;  7AT1 B;  3BY7 A;  1KG1 A;  2SEM A;  1M2V A;  1UTI A;  2A7Y A;  2Z0W A;  1OX9 A;  1OEB A;  1NEB A;  2JT4 A;  4QVZ A;  4N4I A;  4OB0 B;  2CP0 A;  2MWP A;  2ROL A;  5A0L A;  1VQM Q;  2XMF A;  1S72 Q;  4A4F A;  3KXT A;  2M0Y A;  1X01 A;  1YN8 A;  2V8J A;  2DL8 A;  4E2F B;  3JCM V;  2RM4 A;  5CQY A;  3SWN B;  3URG A;  1ZQ1 A;  4JS5 A;  1H3H A;  2DD5 A;  3PMT A;  2DTH A;  2Y4Y A;  1VQP T;  3MCA B;  1RAE B;  2KBT A;  3OSS C;  4IUR A;  1V1C A;  1N27 A;  3Q1J A;  3M0S A;  4MMK A;  1IGU A;  5GAN g;  4PJO G;  5HK3 A;  4BI8 B;  5GAM g;  2C06 A;  2DFU A;  2ZZD A;  2NUT A;  4LNP A;  1HJD A;  2KAF A;  1Q7Y R;  1BI3 A;  2BKD N;  3CCQ A;  5I2M A;  3UPU A;  5FWC A;  3L42 A;  1F1B B;  1AT1 B;  2MOX A;  4WCI A;  2LRQ A;  3VS0 A;  3EG9 B;  3OMC A;  3CMA T;  1H92 A;  1UGV A; 
#chains in the Genus database with same CATH homology
 2GQI A;  5I11 A;  4JJC A;  2L3Q A;  1VYU A;  3M0R A;  4RTV A;  1QWE A;  4E6R A;  2E5K A;  1FMK A;  2JS0 A;  1UHF A;  1JEG A;  3PVQ A;  1PWT A;  3SHW A;  5IXB A;  2LQN A;  1K76 A;  1AWX A;  1H8K A;  1X43 A;  1U5S A;  2KT1 A;  2JMA A;  5GJW B;  4JZ3 A;  1E6G A;  2AKL A;  2ED0 A;  3VS4 A;  3A98 A;  3M0U A;  3RBB B;  4J9D A;  2AK5 A;  3VS7 A;  1NYG A;  1WA7 A;  1GCQ C;  1WFW A;  5EC7 A;  2VKN A;  1QKX A;  2YUQ A;  1ZUK A;  3THK A;  4A63 B;  1K4U S;  2K9G A;  2DE0 X;  2D8H A;  1WDX A;  1SRL A;  1JXO A;  1SRM A;  2YSQ A;  3UA6 A;  2DRM A;  3H41 A;  3REB B;  1WI7 A;  1TG0 A;  1UJY A;  2JS2 A;  1PKT A;  1TUC A;  1ZUY A;  2EGA A;  2KEA A;  2A28 A;  1YP5 A;  1VA7 A;  2DX1 A;  2MIO A;  2DBK A;  1U3O A;  3REA B;  1AZG B;  2JTE A;  2DYB A;  4RTY A;  2DMO A;  2DF6 A;  1AOJ A;  2FPD A;  5FWB A;  1KFZ A;  2GTJ A;  1T0H A;  1BBZ A;  2CUD A;  2CT4 A;  2ED1 A;  2CRE A;  2F2X A;  1UG1 A;  1AEY A;  4J9G A;  3VS2 A;  2FEI A;  3O5Z A;  3NGP A;  1HD3 A;  1KSW A;  1WXB A;  5FW9 A;  2O88 A;  1MV3 A;  3ZL7 C;  3EHR A;  3FJ5 A;  3UA7 A;  1X6B A;  2O31 A;  4J9E A;  2ESW A;  1W70 A;  1QKW A;  3I5S A;  2K7A A;  2B86 A;  1WXT A;  3VS1 A;  2L2P A;  2W0Z A;  3IQL A;  4AFZ C;  1G83 A;  3EHQ A;  2EYY A;  5ECA A;  2EGC A;  1XOV A;  1GCP A;  2DLP A;  2AZV A;  1OPL A;  2J6F A;  4JZ4 A;  2G6F X;  1M8M A;  3VRY A;  1PNJ A;  1E7O A;  4OML A;  5IHI A;  2A36 A;  1Z9Z A;  4OMP A;  2V1R A;  1Y57 A;  1BU1 A;  5IHN A;  1I0C A;  4AFU C;  1UEC A;  2A37 A;  1ZLM A;  2L3S A;  2O2O A;  2YDL A;  2BTT A;  2L3P A;  1K0S A;  4FSS A;  2J6K A;  4HVV A;  2HEQ A;  2O9S A;  2EKH A;  2DL7 A;  4JPB W;  2L0A A;  4RTU A;  1RUW A;  2LNH B;  2HCK A;  5IXF A;  4OMM A;  4J9F A;  4CC7 A;  1YCS B;  2DL5 A;  2PTK A;  2KR3 A;  2KXC A;  2CSQ A;  1NYF A;  2ECZ A;  1A0N B;  1UHC A;  2EVR A;  4IIM A;  3NHN A;  2HBW A;  4AFS C;  2VVK A;  1TUD A;  5IH2 A;  3UF4 A;  4AG2 C;  1OPK A;  2D0N A;  4RTZ A;  3TSW A;  1T3L A;  3VS6 A;  1OV3 A;  2X3W D;  1M3B A;  4J9B A;  4EIK A;  2AKK A;  4R0K A;  2H8H A;  4HXJ A;  2X3X D;  3U23 A;  1NM7 A;  3R6N A;  4ZNX A;  2GBQ A;  1YNZ A;  4GBQ A;  2BZ8 A;  4J9H A;  2KGT A;  4F16 A;  4K11 A;  2DRK A;  4DEX A;  1GRI A;  2C0T A;  2DNU A;  2KYM A;  2SRC A;  1SHF A;  4OMO A;  4ESR A;  1X2K A;  1X6G A;  3VS3 A;  1UUE A;  2FRW A;  3EGU A;  2EGE A;  2J05 A;  2NWM A;  1EFN A;  1VYV A;  1U06 A;  4RTW A;  3EG0 A;  3TSZ A;  1I1J A;  4J9C A;  1ZBJ A;  2F2V A;  3I5R A;  2LX7 A;  3JV3 A;  2KRN A;  2GGR A;  2OJ2 A;  2DIL A;  1KIK A;  1X2Q A;  2YUO A;  2EW3 A;  2RN8 A;  1NG2 A;  2J7I A;  3EG1 A;  2CT3 A;  3EG2 A;  2D1X A;  2QDL A;  1JXM A;  3C0C A;  4CC3 A;  2CH4 A;  1X69 A;  1GBQ A;  1E6H A;  4F14 A;  3M0P A;  1T3S A;  3M0Q A;  3NPF A;  2EYW A;  1VYT A;  1WYX A;  2HSP A;  2YT6 A;  1GFC A;  1GFD A;  2JMC A;  2FPE A;  5IHK A;  3UAT A;  2KRS A;  1GBR A;  4JJD A;  2W10 A;  1UJ0 A;  2DL3 A;  2PZ1 A;  5GJV B;  1AWO A;  2FRY A;  2ABL A;  2K6D A;  1BK2 A;  1AZE A;  1ABO A;  4AG1 C;  2K2M A;  2RNA A;  4M4Z A;  4RTT A;  1X27 A;  2DA9 A;  2KNB B;  2DBM A;  4IIO A;  2FO0 A;  2BZY A;  2KYB A;  2KT8 A;  2P4R A;  1NLO C;  4HCK A;  2EQI A;  2DM1 A;  1CKB A;  2K79 A;  2LCS A;  2AZS A;  1WX6 A;  1NLP C;  3RNJ A;  2OAW A;  2RMO A;  4RUG A;  2KRO A;  2NUZ A;  2V1Q A;  5HCK A;  1AWJ A;  2JW4 A;  4Z8A A;  2RQV A;  4ORZ A;  1M27 C;  2F2W A;  1UE9 A;  2M51 A;  1MV0 B;  4D8D A;  1Y0M A;  2KRM A;  2DVJ A;  4RTX A;  2DJQ A;  4LUD A;  1YWO A;  1RLP C;  4OMN A;  2LP5 A;  1ABQ A;  2LJ3 A;  2RPN A;  1M30 A;  2RQU A;  2C0I A;  2RQW A;  3I9Q A;  5I22 A;  4LE9 A;  1NEG A;  1SSH A;  3H0I A;  5L23 A;  1AWW A;  4F17 A;  1KJW A;  1I07 A;  2FPF A;  3M0T A;  2RF0 A;  2YUN A;  1WIE A;  2EBP A;  1HSQ A;  1AD5 A;  2ROT A;  4DEY A;  1B3Q A;  1WXU A;  2ENM A;  2YUP A;  2LMJ A;  4J9I A;  1QWF A;  2JXB A;  2CUB A;  1CSK A;  1SPK A;  3H0H A;  2LJ0 A;  1S1N A;  3I35 A;  4D8K A;  2DL4 A;  2GTO A;  2MCN A;  1WLP B;  3H0F A;  2GNC A;  1K1Z A;  1UFF A;  1PHT A;  2EYZ A;  2SEM A;  1QCF A;  1FYN A;  1UTI A;  3KFV A;  1OEB A;  4OMQ A;  1NEB A;  2JT4 A;  4JJB A;  4X1V A;  1GL5 A;  1K9A A;  2EYX A;  3SEM A;  2KXD A;  2A08 A;  3QWX X;  1ZSG A;  2LJ1 A;  2ROL A;  3CQT A;  2EPD A;  4CC4 B;  3PE0 A;  1BB9 A;  4HVU A;  1LCK A;  2K3B A;  4QT7 A;  1QLY A;  2XMF A;  3NMZ C;  1B07 A;  1MUZ A;  1M3A A;  2M0Y A;  2LQW A;  1AVZ C;  1YN8 A;  2KE9 A;  2DL8 A;  1Z9Q A;  3QWY A;  2FG0 A;  1W1F A;  3EG3 A;  1GCQ A;  1ARK A;  1PKS A;  1SEM A;  3VS5 A;  1IO6 A;  2J6O A;  3ULR B;  1T0J A;  2CH4 W;  1H3H A;  1ZUU A;  4Z89 A;  1ZX6 A;  2D8J A;  4LN2 A;  2I0N A;  4AFQ C;  2IIM A;  2J06 A;  2KBT A;  1PRM C;  1UDL A;  2O9V A;  1V1C A;  1PRL C;  1N5Z A;  2HDA A;  3M0S A;  1JQQ A;  4GLM A;  1JU5 C;  1SHG A;  1W6X A;  2RQT A;  4Z88 A;  3LH5 A;  2PNI A;  4LNP A;  2VWF A;  3GBQ A;  3TVT A;  1HJD A;  2JM9 A;  4CC2 A;  4LUE A;  3PVL A;  2BZX A;  2JM8 A;  1CKA A;  1G2B A;  4HVW A;  1YWP A;  1J3T A;  5FWC A;  1RI9 A;  1K0X A;  4KRT A;  2MOX A;  2OI3 A;  4WCI A;  1JO8 A;  2RQR A;  3VS0 A;  4Y92 A;  2C0O A;  1M3C A;  1H92 A;  1RLQ C;  2CDT A;  1OOT A;  1UGV A;  3VRZ A;  2LZ6 B;  2CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...