5IH2A

Structure, thermodynamics, and the role of conformational dynamics in the interactions between the n-terminal sh3 domain of crkii and proline-rich motifs in cabl
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter molecule crk
molecule tags Signaling protein
source organism Mus musculus
publication title Binding Mechanism of the N-Terminal SH3 Domain of CrkII and Proline-Rich Motifs in cAbl.
pubmed doi rcsb
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ih2A00
2KXCA 1UG1A 2BZYA 2K9GA 3REBB 1J3TA 1OV3A 4IIMA 1HD3A 1WDXA 1NYGA 3H0HA 5GJWB 2CREA 2SEMA 4OMMA 1X69A 2KRSA 4KRTA 2YUPA 3VS2A 1X2QA 3QWXX 3I5RA 1QKXA 1PHTA 4J9HA 1OPKA 4JJDA 1WI7A 5I11A 2BZXA 1JXMA 2DRMA 1ZBJA 2EW3A 2QDLA 4JJCA 1WXBA 2DMOA 2EYWA 2VWFA 3UA7A 4HVUA 3RNJA 3I5SA 2DLPA 2J7IA 1U3OA 1GCQC 2V1RA 1AZGB 2J6OA 5FWBA 3KFVA 2AZSA 3ZL7C 5FWCA 4Z89A 4J9FA 2D8HA 2LJ0A 1PKTA 1UHCA 3QWYA 1MV0B 2EPDA 4RTWA 3CQTA 1GFCA 3PVLA 4ORZA 4RUGA 2DE0X 1UTIA 3RBBB 4JZ4A 2DBMA 2D0NA 2DNUA 2W10A 4LUDA 4M4ZA 1Z9QA 1M3CA 2MCNA 4HVWA 1IO6A 2LQNA 3VS0A 1GFDA 3NMZC 1YN8A 1NM7A 2DL8A 1X27A 2BZ8A 1AOJA 2DVJA 1S1NA 1K0SA 2J6KA 1CKBA 4J9EA 2OI3A 2KBTA 2C0TA 3LH5A 1UHFA 1QLYA 1RLQC 2HDAA 3GBQA 1UGVA 3TSZA 2CT3A 2X3WD 3O5ZA 3C0CA 1T3LA 2LJ3A 1HSQA 4DEYA 1T3SA 4F17A 2DYBA 4OMPA 1OEBA 3M0PA 1KFZA 2ECZA 3PVQA 1Z9ZA 4DEXA 5IXBA 1WIEA 3I35A 1LCKA 2JMCA 4RTVA 2YSQA 2AZVA 2KGTA 2X3XD 4D8DA 5IHIA 4LN2A 2M51A 2KNBB 4AFQC 1ZX6A 1BU1A 1ZUUA 1E6GA 1X6GA 3UA6A 4AG2C 1YWOA 4R0KA 2GTOA 1SRMA 1TUCA 2F2VA 4WCIA 3U23A 2LMJA 1AEYA 2D8JA 2ROLA 1GBRA 1I07A 1GRIA 1JU5C 1BK2A 4Z88A 2RQWA 1M27C 2L0AA 1UE9A 2P4RA 2AKLA 3R6NA 2FPDA 1M3AA 1K9AA 2A08A 1AD5A 2K3BA 2RQVA 3IQLA 2DL4A 4J9IA 2CH4W 2F2XA 3VS3A 1I1JA 1TUDA 1SHFA 4J9BA 1WX6A 1VYVA 1JXOA 1ZSGA 2C0IA 2KYMA 1TG0A 2A28A 2FPEA 1VYTA 2CSIA 2RPNA 4AFZC 2YUQA 2LCSA 1B07A 4AFSC 4JJBA 3NHNA 2DRKA 2JMAA 2YT6A 3EHQA 2FG0A 1M3BA 5GJVB 1M8MA 3M0UA 1U5SA 4J9GA 2K6DA 2E5KA 3JV3A 2EGAA 2AK5A 4LE9A 1K0XA 2ED0A 4FSSA 4RTXA 2LX7A 2FPFA 3VS5A 2EBPA 2KROA 1GCQA 3EG1A 1BB9A 2GBQA 2XMFA 3NPFA 3EG0A 5IHNA 4E6RA 2VKNA 2ED1A 4GBQA 2RQUA 2MIOA 1NEGA 2O2OA 3M0SA 1NLPC 3REAB 3SEMA 3EHRA 1PRMC 1Y57A 1QWFA 1AWWA 1JQQA 4D8KA 4CC4B 1KSWA 2DL5A 3UF4A 1M30A 1I0CA 5IH2A 3M0QA 2J06A 2DBKA 4IIOA 1GCPA 2A36A 2O9SA 1MUZA 2PTKA 2YUNA 1XOVA 4RTZA 4JPBW 2F2WA 3ULRB 1W6XA 2ESWA 4OMLA 4RTTA 1AWOA 1W1FA 2HEQA 4RTUA 5ECAA 1PRLC 3THKA 3SHWA 1RLPC 1AWXA 2DF6A 4Z8AA 1ZUYA 2RQTA 2KRNA 1E7OA 1KJWA 1OPLA 1UECA 5EC7A 2LNHB 2ENMA 4OMOA 1AVZC 3I9QA 2CH4A 2IIMA 2J05A 2DA9A 2OAWA 2DM1A 2LQWA 2L3SA 1JEGA 4X1VA 1VYUA 1KIKA 2MOXA 1T0HA 2DL3A 2K2MA 1PKSA 1OOTA 5HCKA 5FW9A 4CC2A 2K79A 1ABQA 1X6BA 2B86A 1GL5A 1BBZA 4QT7A 1SRLA 2CUBA 2LZ6B 4J9CA 1SEMA 1ARKA 1N5ZA 2KYBA 1SPKA 2EYZA 2LP5A 2W0ZA 2DJQA 2HSPA 2CSQA 1H3HA 2JM8A 2JM9A 3H0IA 2GTJA 2RF0A 2BTTA 2K7AA 1K76A 3PE0A 3H41A 4GLMA 4RTYA 1A0NB 5IXFA 1FMKA 2EGEA 2HBWA 2VVKA 3FJ5A 2DL7A 2AKKA 2L2PA 4K11A 1WFWA 2JT4A 2O88A 1CSKA 4OMNA 3VRYA 1UDLA 2RNAA 2C0OA 2GNCA 2A37A 3EG2A 1NEBA 2L3QA 1FYNA 3TVTA 2V1QA 4Y92A 1HJDA 1AWJA 1SSHA 1UFFA 2EGCA 4CC7A 2KE9A 2YUOA 2I0NA 1RI9A 3TSWA 2JS0A 3EG3A 1NYFA 1Y0MA 2FEIA 1X43A 4EIKA 2YDLA 3H0FA 1QWEA 2KEAA 2J6FA 1GBQA 2CT4A 1ZLMA 2JXBA 1VA7A 4CC3A 4ESRA 2CDTA 2PNIA 1YNZA 1WA7A 2ROTA 1T0JA 1G2BA 2DX1A 2JS2A 2EYYA 1ZUKA 2H8HA 2JW4A 2OJ2A 1NG2A 1SHGA 2G6FX 4HCKA 3VS4A 1PWTA 2EVRA 1PNJA 2KT8A 1NLOC 1UJYA 2FRWA 2KRMA 2NWMA 2O31A 4J9DA 2L3PA 1ABOA 1G83A 1YWPA 1U06A 3VS6A 4JZ3A 4A63B 1WXTA 1EFNA 1UJ0A 4ZNXA 2EYXA 1V1CA 2KXDA 2PZ1A 1W70A 1YCSB 3VRZA 1K1ZA 1X2KA 2LJ1A 3VS7A 2O9VA 2GQIA 5IHKA 2NUZA 2D1XA 2CUDA 2KT1A 4OMQA 4AG1C 3M0RA 2EQIA 2M0YA 4F14A 1JO8A 1MV3A 3EGUA 2FO0A 5I22A 4LUEA 2EKHA 4HVVA 5L23A 1H92A 1H8KA 4LNPA 3M0TA 4HXJA 2GGRA 2SRCA 2ABLA 3A98A 1WYXA 1UUEA 1CKAA 2RN8A 1B3QA 2HCKA 2JTEA 1K4US 2FRYA 4AFUC 1YP5A 2KR3A 3NGPA 3UATA 1RUWA 1QKWA 1WLPB 1AZEA 1QCFA 2RQRA 2DILA 1E6HA 3VS1A 2RMOA 4F16A 1WXUA
chains in the Genus database with same CATH superfamily
1R0CB 3LX7A 2K9GA 3BDUA 1KQ1A 4C5IA 3CCRT 4QVCA 4IIMA 3FLGA 1NYGA 4M75F 3M57A 3KUFA 3M54A 3I56T 2SEMA 4M77A 1X69A 4OMMA 4QKUA 2KRSA 2YHTA 1X2QA 4ZTJA 1QKXA 5I2SA 3VUBA 5A2QE 1Y96A 5CIUA 3TQ7P 1IREB 4X9DA 5GAMf 2BZXA 2CP6A 2DRMA 1ZBJA 2EW3A 2QDLA 5A0DA 5IAYA 4X34A 4FT2A 1M4ZA 3P8DA 1WXBA 1YI2Q 2EYWA 1V29B 2DYIA 1S72T 2AHJB 5FLXE 3I5SA 1FMVA 2ZCFB 5LJ3j 4C92E 4A4GA 2J7IA 3CCUA 3CPWS 2OTLA 1WQ7A 2D0QB 5GAOl 2ZPGB 2D8HA 4C8QF 2GCXA 1Y07A 4PFPA 4ZN3A 2EPDA 1VQMT 3QBYA 1RI0A 4ORZA 1M1KR 4BDZA 3RBBB 2R5MA 3F70A 3RERA 1WNLA 2YRDA 3VS0A 1NM7A 3G4ST 3JB9D 1X27A 5DM7R 1SSFA 2DVJA 3M58A 2NUPB 3CCQA 3BE3A 4EMGA 3OYKA 2LNVA 2C0TA 3P8BB 4BY6C 1QLYA 2HDAA 4N0AC 1UGVA 3ASKA 3OMGA 3TSZA 2CT3A 1ZSZC 4C92D 3OYHA 1HSQA 1YJWQ 3TEEA 1WQWA 3RMSA 1JB0E 2YLBA 3A1PA 1WHLA 2E65A 3PVQA 1Q7YU 1Z9ZA 4M77F 3HFNA 2MF2A 4ELZC 1WIEA 4PJOC 3I35A 3RDVA 4C5GA 4D8DA 2RM4A 2KI7A 5J3BA 3I55A 1ZX6A 3OYGA 2P84A 2DXTA 3CBPA 1YIJT 4L6V5 4FYWB 3RKYA 4FYYB 1WHMA 3Q1JA 2OX7A 9ATCB 1SRMA 2WSEE 3I56A 2F2VA 4WCIA 2NLUA 4E7ZA 2E10A 1KQ2A 3EFOB 4M7AG 5HK0A 2OAUA 3LGLA 5GAN3 2WSFE 1DJ7B 2JNGA 2XIDA 4M77G 1NJIC 4BB7A 3WXMB 4ZGJB 5CCAA 2OTJQ 1GRIA 2DTOA 1JRIA 3DB3A 3JB9G 1UE9A 2P4RA 3R6NA 3HTRA 1M3AA 1K9AA 3QYGB 2K3BA 3OMCA 2QXFA 4J9IA 2CH4W 5DLQE 3CCVT 1MHNA 4DBFA 4LXCA 2JUFA 4QVZA 3UWNA 1WX6A 1W2BA 1JXOA 4QQGA 1TG0A 1WJQA 3JCMg 2RPNA 4XTXA 2YUQA 4AFSC 1VQ5A 2CP2A 3JB9H 1VQOQ 1VQKA 1QVFP 1UGQB 2E12A 2R58A 2DPPB 3EGDB 2XDDA 5GANj 1M3BA 1YHQT 3M0UA 3ZBDA 3EGXA 2KAFA 5D6XA 1VIEA 4J9GA 3GLXA 2K6DA 3JV3A 2QK0A 4IUVA 3C95A 3QO3A 1BYMA 3OW2P 2FPFA 3SWNA 3WVEB 2KROA 4ATOA 4F7UF 1YJ9Q 3M53A 2XHCA 1KD1C 3NPFA 2E6NA 5IHNA 3CCST 4MZMA 2OTJA 1O75A 1ZHIA 2ZAEA 2RJDA 4IUUA 3C94A 1M1KU 1BIBA 1YHQA 4PJOB 1C6VX 4CC4B 4X9CA 3OYDA 3G71A 3UF4A 1M30A 1XQHA 4IIOA 2BE9B 4XU1A 1N27A 2C06A 5M9OA 3JCMV 1SG5A 4XK8E 3JCMd 1W1FA 4BACA 3S3OA 1RAAB 3O8VA 1TSFA 1AWXA 2DF6A 1ZUYA 1KJWA 3H9NA 4B9WA 4FM4B 3JB9J 3CMEQ 1N8RU 3CCLT 5J39A 2IIMA 2J05A 3V8KA 2DA9A 2OAWA 2LQWA 2L3SA 1EX4A 1VYUA 1KIKA 2DL3A 4C0DC 1PKSA 4A4HA 2EJFA 2LCLA 3WVDB 2BE7D 2H3JA 1N9SA 3MEWA 1XNIA 2X4XA 3FRNA 4BI3A 3I55T 4LD6A 5FRNA 2GFUA 5GAOq 4F7UA 4XQ3A 3CC4A 2X4YA 2DXBA 2EYZA 2W0ZA 2L8DA 2DAQA 3CCQQ 2DJQA 2CSQA 3E19A 3URGA 3QSUA 2M02A 2P0KA 2E3IA 3H41A 5IXFA 4QW2A 2EGEA 4LDYA 3OYEA 1XTDA 2RB6A 1LVKA 3MP8A 4E7JA 2RNAA 1KG1A 3EG2A 2L3QA 5GAOn 1HJDA 1SSHA 4HCBA 1UFFA 3QDFA 4C92B 4CC7A 2KE9A 4DBHA 2I0NA 4PLLA 2XK0A 2PUKB 4EIKA 5KYUA 3V7RA 3H0FA 2KEAA 3ZEHA 1M90U 4C0ZA 5FROA 3MEUA 2RHIA 1VQKT 1PM3A 1UB4A 1F1BB 2DERA 2EWNA 1WJRA 4BI8B 1G2BA 5J26A 2RH2A 2DEUA 2V8KA 4HCKA 1M9SA 1S72A 1ZBXA 2F1LA 1UJYA 2FRWA 2CP3A 1VQMA 2O31A 2VXFA 1YWPA 1U06A 3L42A 2R57A 4Y91A 1EFNA 2FL7A 1D3BB 2PZ1A 1W70A 1YCSB 2JOYA 4JRQA 1M1KC 4JDSA 3VS7A 2QEXT 3CPWP 2A7YA 4F7UB 1VQ8A 5IHKA 2NUZA 1D1AA 2QA4T 4OMQA 3M0RA 3CCMA 1Q82C 2EQIA 2M0YA 2K5IA 5LJ5g 2XG8D 3G1JA 2JVVA 2HL3A 1IB8A 3META 2V26A 1YITQ 4Z02A 1H8KA 2CKKA 4D6WA 3MEVA 4M77E 2JTEA 5CAIA 4M78B 3OW2S 1D1CA 1QKWA 2M1HA 5LL6S 4FW2A 1AZEA 1VQLA 1QVPA 2MAMA 1JEGA 2KXCA 3EH2A 1UG1A 2BZYA 1BCMA 4FIBA 1OV3A 2NYSA 2O01E 1WDXA 2CREA 4EMKA 4OMFB 4XU2A 3FC3A 4N0AA 3VS2A 3X25B 4XTVA 2VYTA 3M59A 3PT9A 4YTLA 2RO0A 1WI7A 1JXMA 1N8RC 2E3HA 4JJCA 4LDVA 1TH7A 3OBYA 4M78C 4DBRA 3NTIA 1LJOA 5KCOA 5GAN2 4C8QE 4M75G 1NJIR 4HKEA 4Q5WA 3DB4A 1U3OA 2FYKA 2AZSA 4OB1B 3ZL7C 5FWCA 1MMGA 4J9FA 3V8JA 1TU0B 2LJ0A 3CCVA 4HCZA 1UHCA 2VXEA 4RTWA 4OF1A 1GFCA 5I21A 5GAMj 4RUGA 4M7DE 2DE0X 4WTOB 2DBMA 2D0NA 4F7UE 4LUDA 4M4ZA 1M3CA 2LQNA 1GFDA 5GAOm 2COYA 3NMZC 1YN8A 2DL8A 1AOJA 4M7DF 1W2BP 1CKBA 2LQ8A 2DD4A 5CKBA 4C8QG 3LH5A 1BI1A 1RLQC 3GBQA 2YXYA 3JCMW 4E2FB 3MCAB 5GAN4 2P0QA 1YJNT 3C0CA 4M7DD 3ER0A 4Y28E 1VQ7Q 2EAYA 4EDUA 4PJOD 2JJ9A 2PU9B 2ECZA 3SDZA 3BFMA 2HBPA 5D6WA 2LC4A 2E41A 2L5QA 1AT1B 1G3YA 1FXXA 2JMCA 3SFMA 2YSQA 4LN2A 1YFNA 2M51A 2KNBB 1VQPT 3OYAA 1PD1A 1VUBA 4BUGA 3EFRA 3L1AA 1X6GA 3UA6A 4AG2C 2PUOB 1YWOA 2QDYB 4PJOE 3EGDA 5CVIA 2PQWA 2EFIA 1G3SA 3MO8A 2O4XA 5KYUB 3G6EQ 1AEYA 1RAEB 2FVUA 1KD1U 1N9RA 3L2ZA 3G71T 4B6MA 4QQDA 3G4SA 1D0YA 3P8HA 1GBRA 1VQNQ 4E7IA 3CCEQ 2DVEA 2DFUA 3UDCA 5CKFA 4Z88A 1M27C 2AKLA 1JBMA 2QYZA 1BKBA 2A08A 4BE0A 1AD5A 3IQLA 3CCJQ 2F2XA 4CRIA 1I1JA 3QJYA 5D6YA 3A8HB 2OTLT 3JCMc 2CZ1B 4M75A 1G3WA 2KYMA 4FT4A 1Q86C 1RADB 2A28A 2FPEA 2MMPA 2LCSA 1B07A 2QA4A 5A0GA 2A0FB 3OW2A 1I5LA 3EFOA 3NHNA 1OZ2A 3OS2A 5GAMd 2JMAA 2GFAA 2MWOA 1VQ4A 3BDLA 2QASA 3FDRA 3VKIA 5GANf 4OB0B 4FCYA 3JCMJ 4A53A 2DKGA 2E5KA 2I2LA 4J5YA 4C92A 2E1HA 2AK5A 1K0XA 4FSSA 2X4WA 4RTXA 4O6JA 4KUIA 2RK1A 3CXCS 4RKUE 8ATCB 1VQ4Q 3CD6T 3VS5A 1NJIU 1EZZB 3EG1A 1BB9A 2MK5A 2FHDA 4E6RA 2X51A 3M9QA 4XTUA 2ED1A 3TREA 2DTIA 1G5VA 4AMCA 2MIOA 1K8AR 4N4HA 4EPCA 4OVAA 1D0XA 4L5GA 3SEMA 4BI4A 3EHRA 3HPWA 3CCRQ 3QHSA 1PRMC 4UC4A 1OQKA 1AWWA 1JQQA 4HCCA 1H3ZA 5GANh 3DKMA 4E47A 2DL5A 1RAGB 5IH2A 4RCBA 5HY6A 2HQEA 2J06A 2XICA 2DBKA 5L8RE 1K9MU 1GCPA 1M1FA 2RHXA 2O9SA 2PTKA 2RJFA 1HXDA 3M5AA 1U8RA 4RTZA 4JPBW 2LTOA 4PFOA 1Y96B 3SD4A 2ESWA 4MMKA 3CC7A 1AWOA 2HEQA 4RTUA 5C6SA 3THKA 4KBMB 5KYNA 3QIIA 1KC8U 4Z8AA 1S72Q 2LT1A 2QQSA 1FX7A 1E7OA 3VYHB 2F5KA 2COZA 1UECA 5EC7A 2LNHB 1UGRB 3OYLA 2ENMA 1BI2A 4M7AC 4OMOA 5LJ5h 1AVZC 3VYGA 2CH4A 4KH1B 3PIPA 5FU7C 2HNIA 5GMKl 1VQMQ 4X1VA 4C0DB 3CXCA 2MOXA 2WSCE 5GAN7 2K2MA 2HSEB 1Q81R 1SF9A 1WHKA 5FW9A 3GP8A 3TCJA 1BCOA 2B86A 3E9FA 4M7AE 1OU8A 3LYIA 1SRLA 3GIBA 3A8OB 3OB9A 4E7KA 2K3XA 1SEMA 1ARKA 3CMAT 2XD0A 2FB7A 1N5ZA 4EMKB 2X9HA 1SPKA 1IGUA 3RKWA 1U1TA 2FZKB 1MMNA 2JM8A 2JM9A 3H0IA 1W2BS 2DD5A 4PJOF 2EIFA 1ZA2B 1K76A 1IZ6A 1K73U 2CP7A 1K73R 1VQPA 2HBWA 3C12A 4C92G 4K11A 1WFWA 2O88A 1N6AA 4VUBA 3QYHB 4M78A 1ZA1B 3CC4Q 1D0ZA 2HAXA 2XKOC 4M78E 1VQ9Q 2E70A 2JN0A 2C0OA 2A37A 1BI3A 1NEBA 2LDMA 5GMKi 2QTXA 1RI9A 1YIJQ 1NBEB 3EG3A 3OYNA 4A4FA 4BE1A 1MNEA 3MP1A 1X01A 2J6FA 3X24B 1RAHB 3A8GB 4JLGA 1GBQA 1VOMA 1YIJA 4L59A 1D3BA 3LWHA 1VA7A 3CXCP 2CDTA 2PNIA 1YNZA 3PTAA 1VQLQ 4M7AA 1WA7A 2ROTA 1N8RR 2OTJT 1WPYA 3L2WA 2K57A 5AYFA 2DX1A 2JS2A 1ZUKA 1NG2A 2JW4A 2OJ2A 1B34A 3INZA 4BY6B 3VS4A 3CC2T 1JJ2A 1PNJA 1R0BG 4J9DA 2L3PA 4R56A 4OGCA 3CCUQ 4JZ3A 3MEAA 4ZNXA 1KHCA 2EQKA 1KC8C 2EJGA 1K1ZA 1X2KA 6AT1B 1SKUB 4JUVA 2QI2A 3ME9A 3JCMf 4AG1C 2E4HA 3GNFB 2L89A 3OYYA 3HSBA 3EGUA 2FO0A 4LUEA 4HXJA 2GGRA 2M9UA 2ABLA 3A98A 2DK3A 2RN8A 3UATA 1RUWA 1M90C 1YJ9T 2DILA 1E6HA 2JTMA 3VS1A 3X26B 5LJ5f 3UPUA 3CCSQ 2L3RA 5KYYB 3EH1A 1J3TA 1WJSA 1HD3A 5LJ5e 5GAN5 1LPLA 3H0HA 3D7SB 3CC7Q 2YUPA 1JJ2P 1PHTA 3G6EA 3CPWA 1QCNA 4RCCA 1OPKA 3HL8A 4LDXA 4M75C 4J6WA 5CQYA 3CCMT 4KGXB 2NUTA 2VWFA 1VQ8T 4HVUA 5LJ3f 3OQ5A 2QEXA 3V8LA 3J7AF 4P5NA 2DXCA 4MDXA 4M77C 4MMLA 5FWBA 3KFVA 4KULA 4C5HA 2M16A 4TVRA 1PKTA 2BIVA 1W4SA 3QWYA 3CQTA 2WACA 2DZ9A 3OA6A 4PJMA 5I2MA 1UTIA 3I56Q 1G3TA 2KQWA 2VGMA 4A4EA 4HVWA 1IO6A 5CKEA 4JRIA 1KD1R 4PJNA 2BZ8A 1FMWA 4MZPA 2RHUA 2J6KA 2COWA 4XU3A 3PMIA 3I55Q 4J9EA 2HKNA 1PSFA 3V7CA 4M7DC 1YI2T 1UHFA 4M77B 4PFZA 1VQ6T 4F04B 1X6OA 2X3WD 3O5ZA 3CCQT 4C0GA 2LJ3A 2QG9B 2DTHA 3CMEA 3GF5A 4JRKA 1T3SA 2IVWA 4E7LA 3H6ZA 5KYYA 4KUDK 2DYBA 4OMPA 4QVDA 1OEBA 4F16A 3PIOA 2KSSA 4DOVA 5KYXB 2PVGB 1TTHB 3E2UA 1Q82U 5GAMh 5IXBA 4J6XA 4J8OA 2AIRB 1LCKA 4NS5A 3SWNB 5IHIA 3OYFA 4OGEA 2ZZDA 4MZTA 1IHVA 1BU1A 1YJNA 1ZUUA 3G7ZA 4RG8A 3VV0A 1R8OB 3A8LB 1YJWA 5GAOp 2GTOA 1TUCA 4A4KA 4II1A 4GY5A 1YHQQ 3U23A 3R6OA 2LMJA 4ANJA 4C8QB 1NPPA 3JCMX 2D8JA 2ROLA 3M4YA 4EMKC 1I07A 3QZ5B 2JZ2A 1BK2A 5FU6C 2RQWA 4ELYC 5GAMg 2FPDA 2P4TA 3AT1B 3OS5A 4DA4A 2RQVA 2DL4A 2ZPBB 2EQJA 4PJLA 2K2VA 3MPUB 1SHFA 4J9BA 1IRXA 1VYVA 1WHJA 2EJ9A 1HYOA 3CD6A 2HQHA 1VYTA 4AFZC 3CCEA 1I8FA 4JJBA 1YJ9A 1D09B 3NTKA 2DRKA 2QAZA 5CQXA 1TOVA 5GMKj 3JCMQ 3OYMA 2YT6A 3CEYA 1Q81C 2FG0A 1VQOA 3QUIA 1PC0A 1C1AA 2RI3A 2QGGA 1QMCA 2CZ7B 4LE9A 2RK2A 4E7HA 1ZSZA 4PL6A 4C8QC 4ZTFA 2JTFA 3T9NA 2EBPA 5CK9A 2YLCA 1OULA 3QXEB 1VQ5Q 2BUDA 4FYVB 2RQUA 5HK3A 1NEGA 1YBYA 5CKDA 4J7IA 1K73C 3LW5E 5GANg 2K5LA 3BY7A 3CCSA 2RA2A 4XTWA 3E9GA 1Y57A 1VQOT 1QWFA 3EAEA 3QG1A 5GAOr 2DO3A 1M1GA 1TWBA 3M0QA 1MUZA 3MKDA 2K4YA 2V8IA 1BIAA 1XOVA 3HP9A 1Y71A 2F2WA 5LJ5d 5CO7A 1W6XA 4OMLA 5ECAA 3QDRB 1JJ2S 1RLPC 2KVQG 1V76A 2KRNA 4NOYA 1OPLA 2KK4A 1Q82R 3I9QA 3CCJA 3QKJA 4B9XA 1M2VA 1OYXA 4FW1A 1T0HA 3CPFA 4BD3A 5HCKA 3M55A 3G4SQ 4CC2A 1ABQA 1X6BA 1FWZA 1WGSA 4PJJA 1KQSA 3OSSC 4QT7A 5KCHA 2LZ6B 2DEQA 4IUQA 8AT1B 3V7SA 4OB2B 4J9CA 1Q7YC 2PVOB 2KYBA 2EQMA 2HL5C 2LP5A 2M0OA 1I5OB 1OX9A 2HSPA 2E6ZA 2X4JA 3AHUA 3QZ9B 1YJWT 2GTJA 2RHZA 1K8AU 2EQUA 1YCYA 3CMET 3PE0A 4HT9A 1QVGA 4RTYA 3CCLQ 1A0NB 1FMKA 3CBMA 4O5VA 2E5QA 2DL7A 2AKKA 2L2PA 3X28B 1VQ6A 2JT4A 5CKHA 4IUTA 5KE2A 3HFOA 3RIRA 2CGHA 2YRVA 1VQ7A 1M8VA 3L2QA 3LH0A 3TVTA 2YWWA 4Y92A 1AWJA 1VQPQ 4DOWA 5IN1A 3M4GA 3GOXA 2QGFB 5KH6A 4AT1B 1BI0A 2HD0A 4F7UG 1NYFA 1Y0MA 2FEIA 2MI6A 3EGXB 4XAXB 4J83A 1X43A 3L2RA 2QEXQ 1QVFS 2Y4XA 4J7FA 3RMQA 4C92F 3OBWA 2QQ9A 1D1BA 3NTHA 4JJNK 2CT4A 3S6WA 1ZLMA 2JXBA 3LWIA 4CC3A 5GAN6 2DJZA 3JCMP 3JAME 4PLIA 2EYYA 1KHIA 3HHTB 3CCVQ 4RMOA 3S3MA 2KT8A 1B7TA 2IG0A 3J80E 2KRMA 1Q81U 2VV5A 1RACB 4HA8A 2ZPHB 2LVMA 3VS6A 1WXTA 1KK7A 1UJ0A 5IT9E 3NFCA 2KXDA 4M78D 3VRZA 1NE8A 2LJ1A 5DY9A 2PVDB 3EFSA 3HRTA 2D1XA 2NUPA 2KT1A 2XDPA 1VQKQ 1JO8A 1MV3A 4HT8A 5I22A 2RI5A 4KT0E 2EKHA 5L23A 1UGSB 4LNPA 3M0TA 3S3NA 2SRCA 5GAMe 2YRCA 1UUEA 1VQ4T 2BKDN 3KBGA 1B3QA 4LDUA 2IPOB 3LGFA 2FRYA 4AFUC 1M2VB 2KR3A 3PNWC 3E1SA 1WLPB 1QCFA 2QQRA 3JCMh 2RMOA 4PK4A 1WXUA 3GPLA 1NPRA 1ZQ1A 3REBB 2HMAA 5LJ3e 4C0FA 4ZN1A 4N4IA 1KQSS 5GJWB 1Y7XA 3JB9F 4KRTA 5A0LA 3JSCA 3QWXX 1TXQA 3I5RA 3RUXA 5GMKh 4J9HA 2XU8A 2QA4Q 4ME7A 4DBQA 4JJDA 1PG5B 5I11A 1O9SA 5HKCA 2CZ0B 1MMAA 1VIFA 4IURA 1GXIE 4J6YA 2DMOA 3UA7A 3MJXA 4FYXB 1RAIB 3RNJA 3OYBA 3QJ6A 2DLPA 3FEOA 4CI0C 2VASA 1GCQC 1MGQA 2V1RA 1AZGB 2J6OA 4Z89A 3X20B 2GF7A 1WZOA 1QQJA 4QQ6A 2FZGB 1MV0B 1VQ9A 3FIFA 3PVLA 1WHGA 4KGVB 1M5Q1 4JZ4A 3CC2A 2DNUA 2W10A 2VC8A 3JB9I 5GAN8 2H3EB 1Z9QA 2MCNA 5C0MA 1K9MR 1PSEA 1S1NA 1OI1A 1K0SA 1VQNA 4M77D 1RABB 2OI3A 2KBTA 3OYJA 4M75E 3G71Q 4M7DA 1IGQA 3OS0A 3CBOA 1H641 1T3LA 2ZPEB 5LJ5j 4DEYA 4F17A 2HQXA 3M0PA 1KFZA 3GNGA 4DEXA 2MWPA 3EG9B 2DIQA 4RTVA 3VJPA 2AZVA 2KGTA 2X3XD 4AFQC 1TUGB 2D9TA 3TU4K 2LT4A 1E6GA 2VB6A 4R0KA 4C8QA 2VGNA 3RR6A 5KYWA 1XJWB 1YJNQ 3SB2A 5GMKm 3MP6A 1JU5C 1VQ7T 1QCOA 1VQLT 2L0AA 1HK9A 2LQKA 3CD6Q 1QP2A 1OU9A 3VS3A 2QQBA 3L2UA 2Y90A 3CC2Q 4WF2A 2CYZB 1TUDA 5KYXA 1U1SA 2V8JA 1RL2A 2ATCB 2K3YA 4E7SA 5FRMA 2XDBA 3CCUT 1ZSGA 2C0IA 2B8AA 3HRUA 2EYQA 2CSIA 2LX9A 2ZPIB 1QP3A 3OYIA 1P92A 3QPHA 4PJOG 2X35A 3M56A 2F5TX 3RKXA 4LD9K 3EHQA 1KQSP 5GJVB 1M8MA 1U5SA 3DLLA 2P0PA 4C8QD 2VUBA 1OZ3A 2EGAA 1YITT 3CCET 2ED0A 1C0MA 2LX7A 4JS4A 1QVGS 5LJ3h 1Q7YR 2RJEA 1I81A 1GCQA 3CCJT 4PNOA 2GBQA 1AHJB 2QTVA 1M2OA 2XMFA 3EG0A 2K5FA 4M7DG 2VKNA 4GBQA 4KGZB 4MDWA 1UGPB 4DQ2A 2O2OA 2OTLQ 3M0SA 1NLPC 3REAB 4JRPA 2KDSA 3BW1A 4D8KA 1KSWA 5GANd 4C92C 1I0CA 2NUTB 3VU3C 2D6FA 3CMAA 2A36A 2Y4YA 3VUZA 1YITA 4V2SA 3HKSA 2YUNA 3C4SA 4R55A 1IXDA 4XTZA 2EKOA 2RI2A 2F69A 3ULRB 4RTTA 3A5ZB 3JRZA 1UEBA 1PRLC 1IHWA 3LLRA 2RJCA 3SHWA 2MPXC 1X75C 5GANe 1KC8R 1VQ8Q 2RQTA 4RG2A 3N5BB 2DIGA 4BE2A 4NL2A 2XI9A 3HRSA 2DM1A 3CC4T 5LJ3g 2LCCA 5DLOA 1MNDA 1OOTA 2CS7A 2DXUA 2G3RA 4N4GA 1M90R 2K79A 4XTYA 5EG2A 4FL6A 1GL5A 1BBZA 2CUBA 2ZPFB 4LDWA 2MYSA 2CZ6B 1MMDA 3PFSA 1PD0A 4IKFA 4PJOA 2RHYA 1Q86R 4FU6A 1VQ6Q 1Q86U 2LRQA 1H3HA 2RF0A 3FB9A 2BTTA 2Z0WA 2K7AA 4M75B 5FU7B 3KXTA 4GLMA 3OYCA 2VVKA 3FJ5A 3RESA 1CSKA 1PCXA 4OMNA 3VRYA 1UDLA 1B34B 1OX8A 4BDYA 5CR2A 2GNCA 1ACMB 4IUPA 2QQAA 7AT1B 2HZYA 1FYNA 5FU6B 1ZSZB 4PKCC 2V1QA 3JCMe 2KY9A 4M78F 3CCLA 2GQVA 2DZCA 2EGCA 4EMHA 5KE3A 2YUOA 3UT1A 2A3LA 1NZ9A 2CP0A 1QW1A 2JS0A 3TSWA 5KYWB 2E64A 4NL3A 3SWNC 3ZFJA 2YDLA 3A8MB 1LOJA 1QWEA 3G6ET 5LJ3d 3CMAQ 4M7AD 1K8AC 5GMKe 1VQNT 3JCMb 3OS1A 1I4K1 4GLKA 4ESRA 4A54A 5AT1B 4JS5A 3L2VA 3CCRA 1QVFA 1T0JA 1R77A 2H8HA 1RAFB 1SHGA 2G6FX 4M78G 4M7AF 1QVGP 1PWTA 2FZCB 3DLMA 3EG9A 2EVRA 4OB3B 1NLOC 2NWMA 1TS9A 1VQ9T 3OY9A 5D7UA 3H8ZA 1ABOA 1LNXA 1G83A 4ZGDB 2AT1B 4A63B 4M7AB 3OSVA 2EYXA 1V1CA 3J81E 2RD1A 1YI2A 2CP5A 3CC7T 2O4XB 4M7DB 1G8XA 2O9VA 2DETA 2GQIA 2CUDA 4C5EA 1K9MC 3PMTA 4F14A 3PGGA 1WHHA 2R5AA 3CCMQ 2KMTA 4ZGEB 4HVVA 1H92A 4FSXA 1WYXA 4KH0B 1CKAA 2HCKA 1K4US 2HKQB 1Q95G 1YP5A 3NGPA 4XU0A 3FJPA 2ZGWA 4M75D 1VQ5T 2RQRA 4OP0A 1EIFA 4JLIA 3MHXA
chains in the Genus database with same CATH topology
2KXCA 1UG1A 2BZYA 2K9GA 3REBB 1J3TA 1OV3A 4IIMA 1HD3A 1WDXA 1NYGA 3H0HA 5GJWB 2CREA 2SEMA 4OMMA 1X69A 2KRSA 4KRTA 2YUPA 3VS2A 1X2QA 3QWXX 3I5RA 1QKXA 1PHTA 4J9HA 1OPKA 4JJDA 1WI7A 5I11A 2BZXA 1JXMA 2DRMA 1ZBJA 2EW3A 2QDLA 4JJCA 1WXBA 2DMOA 2EYWA 2VWFA 3UA7A 4HVUA 3RNJA 3I5SA 2DLPA 2J7IA 1U3OA 1GCQC 2V1RA 1AZGB 2J6OA 5FWBA 3KFVA 2AZSA 3ZL7C 5FWCA 4Z89A 4J9FA 2D8HA 2LJ0A 1PKTA 1UHCA 3QWYA 1MV0B 2EPDA 4RTWA 3CQTA 1GFCA 3PVLA 4ORZA 4RUGA 2DE0X 1UTIA 3RBBB 4JZ4A 2DBMA 2D0NA 2DNUA 2W10A 4LUDA 4M4ZA 1Z9QA 1M3CA 2MCNA 4HVWA 1IO6A 2LQNA 3VS0A 1GFDA 3NMZC 1YN8A 1NM7A 2DL8A 1X27A 2BZ8A 1AOJA 2DVJA 1S1NA 1K0SA 2J6KA 1CKBA 4J9EA 2OI3A 2KBTA 2C0TA 3LH5A 1UHFA 1QLYA 1RLQC 2HDAA 3GBQA 1UGVA 3TSZA 2CT3A 2X3WD 3O5ZA 3C0CA 1T3LA 2LJ3A 1HSQA 4DEYA 1T3SA 4F17A 2DYBA 4OMPA 1OEBA 3M0PA 1KFZA 2ECZA 3PVQA 1Z9ZA 4DEXA 5IXBA 1WIEA 3I35A 1LCKA 2JMCA 4RTVA 2YSQA 2AZVA 2KGTA 2X3XD 4D8DA 5IHIA 4LN2A 2M51A 2KNBB 4AFQC 1ZX6A 1BU1A 1ZUUA 1E6GA 1X6GA 3UA6A 4AG2C 1YWOA 4R0KA 2GTOA 1SRMA 1TUCA 2F2VA 4WCIA 3U23A 2LMJA 1AEYA 2D8JA 2ROLA 1GBRA 1I07A 1GRIA 1JU5C 1BK2A 4Z88A 2RQWA 1M27C 2L0AA 1UE9A 2P4RA 2AKLA 3R6NA 2FPDA 1M3AA 1K9AA 2A08A 1AD5A 2K3BA 2RQVA 3IQLA 2DL4A 4J9IA 2CH4W 2F2XA 3VS3A 1I1JA 1TUDA 1SHFA 4J9BA 1WX6A 1VYVA 1JXOA 1ZSGA 2C0IA 2KYMA 1TG0A 2A28A 2FPEA 1VYTA 2CSIA 2RPNA 4AFZC 2YUQA 2LCSA 1B07A 4AFSC 4JJBA 3NHNA 2DRKA 2JMAA 2YT6A 3EHQA 2FG0A 1M3BA 5GJVB 1M8MA 3M0UA 1U5SA 4J9GA 2K6DA 2E5KA 3JV3A 2EGAA 2AK5A 4LE9A 1K0XA 2ED0A 4FSSA 4RTXA 2LX7A 2FPFA 3VS5A 2EBPA 2KROA 1GCQA 3EG1A 1BB9A 2GBQA 2XMFA 3NPFA 3EG0A 5IHNA 4E6RA 2VKNA 2ED1A 4GBQA 2RQUA 2MIOA 1NEGA 2O2OA 3M0SA 1NLPC 3REAB 3SEMA 3EHRA 1PRMC 1Y57A 1QWFA 1AWWA 1JQQA 4D8KA 4CC4B 1KSWA 2DL5A 3UF4A 1M30A 1I0CA 5IH2A 3M0QA 2J06A 2DBKA 4IIOA 1GCPA 2A36A 2O9SA 1MUZA 2PTKA 2YUNA 1XOVA 4RTZA 4JPBW 2F2WA 3ULRB 1W6XA 2ESWA 4OMLA 4RTTA 1AWOA 1W1FA 2HEQA 4RTUA 5ECAA 1PRLC 3THKA 3SHWA 1RLPC 1AWXA 2DF6A 4Z8AA 1ZUYA 2RQTA 2KRNA 1E7OA 1KJWA 1OPLA 1UECA 5EC7A 2LNHB 2ENMA 4OMOA 1AVZC 3I9QA 2CH4A 2IIMA 2J05A 2DA9A 2OAWA 2DM1A 2LQWA 2L3SA 1JEGA 4X1VA 1VYUA 1KIKA 2MOXA 1T0HA 2DL3A 2K2MA 1PKSA 1OOTA 5HCKA 5FW9A 4CC2A 2K79A 1ABQA 1X6BA 2B86A 1GL5A 1BBZA 4QT7A 1SRLA 2CUBA 2LZ6B 4J9CA 1SEMA 1ARKA 1N5ZA 2KYBA 1SPKA 2EYZA 2LP5A 2W0ZA 2DJQA 2HSPA 2CSQA 1H3HA 2JM8A 2JM9A 3H0IA 2GTJA 2RF0A 2BTTA 2K7AA 1K76A 3PE0A 3H41A 4GLMA 4RTYA 1A0NB 5IXFA 1FMKA 2EGEA 2HBWA 2VVKA 3FJ5A 2DL7A 2AKKA 2L2PA 4K11A 1WFWA 2JT4A 2O88A 1CSKA 4OMNA 3VRYA 1UDLA 2RNAA 2C0OA 2GNCA 2A37A 3EG2A 1NEBA 2L3QA 1FYNA 3TVTA 2V1QA 4Y92A 1HJDA 1AWJA 1SSHA 1UFFA 2EGCA 4CC7A 2KE9A 2YUOA 2I0NA 1RI9A 3TSWA 2JS0A 3EG3A 1NYFA 1Y0MA 2FEIA 1X43A 4EIKA 2YDLA 3H0FA 1QWEA 2KEAA 2J6FA 1GBQA 2CT4A 1ZLMA 2JXBA 1VA7A 4CC3A 4ESRA 2CDTA 2PNIA 1YNZA 1WA7A 2ROTA 1T0JA 1G2BA 2DX1A 2JS2A 2EYYA 1ZUKA 2H8HA 2JW4A 2OJ2A 1NG2A 1SHGA 2G6FX 4HCKA 3VS4A 1PWTA 2EVRA 1PNJA 2KT8A 1NLOC 1UJYA 2FRWA 2KRMA 2NWMA 2O31A 4J9DA 2L3PA 1ABOA 1G83A 1YWPA 1U06A 3VS6A 4JZ3A 4A63B 1WXTA 1EFNA 1UJ0A 4ZNXA 2EYXA 1V1CA 2KXDA 2PZ1A 1W70A 1YCSB 3VRZA 1K1ZA 1X2KA 2LJ1A 3VS7A 2O9VA 2GQIA 5IHKA 2NUZA 2D1XA 2CUDA 2KT1A 4OMQA 4AG1C 3M0RA 2EQIA 2M0YA 4F14A 1JO8A 1MV3A 3EGUA 2FO0A 5I22A 4LUEA 2EKHA 4HVVA 5L23A 1H92A 1H8KA 4LNPA 3M0TA 4HXJA 2GGRA 2SRCA 2ABLA 3A98A 1WYXA 1UUEA 1CKAA 2RN8A 1B3QA 2HCKA 2JTEA 1K4US 2FRYA 4AFUC 1YP5A 2KR3A 3NGPA 3UATA 1RUWA 1QKWA 1WLPB 1AZEA 1QCFA 2RQRA 2DILA 1E6HA 3VS1A 2RMOA 4F16A 1WXUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KXC A;  1UG1 A;  2BZY A;  2K9G A;  3REB B;  1J3T A;  1OV3 A;  4IIM A;  1HD3 A;  1WDX A;  1NYG A;  3H0H A;  5GJW B;  2CRE A;  2SEM A;  4OMM A;  1X69 A;  2KRS A;  4KRT A;  2YUP A;  3VS2 A;  1X2Q A;  3QWX X;  3I5R A;  1QKX A;  1PHT A;  4J9H A;  1OPK A;  4JJD A;  1WI7 A;  5I11 A;  2BZX A;  1JXM A;  2DRM A;  1ZBJ A;  2EW3 A;  2QDL A;  4JJC A;  1WXB A;  2DMO A;  2EYW A;  2VWF A;  3UA7 A;  4HVU A;  3RNJ A;  3I5S A;  2DLP A;  2J7I A;  1U3O A;  1GCQ C;  2V1R A;  1AZG B;  2J6O A;  5FWB A;  3KFV A;  2AZS A;  3ZL7 C;  5FWC A;  4Z89 A;  4J9F A;  2D8H A;  2LJ0 A;  1PKT A;  1UHC A;  3QWY A;  1MV0 B;  2EPD A;  4RTW A;  3CQT A;  1GFC A;  3PVL A;  4ORZ A;  4RUG A;  2DE0 X;  1UTI A;  3RBB B;  4JZ4 A;  2DBM A;  2D0N A;  2DNU A;  2W10 A;  4LUD A;  4M4Z A;  1Z9Q A;  1M3C A;  2MCN A;  4HVW A;  1IO6 A;  2LQN A;  3VS0 A;  1GFD A;  3NMZ C;  1YN8 A;  1NM7 A;  2DL8 A;  1X27 A;  2BZ8 A;  1AOJ A;  2DVJ A;  1S1N A;  1K0S A;  2J6K A;  1CKB A;  4J9E A;  2OI3 A;  2KBT A;  2C0T A;  3LH5 A;  1UHF A;  1QLY A;  1RLQ C;  2HDA A;  3GBQ A;  1UGV A;  3TSZ A;  2CT3 A;  2X3W D;  3O5Z A;  3C0C A;  1T3L A;  2LJ3 A;  1HSQ A;  4DEY A;  1T3S A;  4F17 A;  2DYB A;  4OMP A;  1OEB A;  3M0P A;  1KFZ A;  2ECZ A;  3PVQ A;  1Z9Z A;  4DEX A;  5IXB A;  1WIE A;  3I35 A;  1LCK A;  2JMC A;  4RTV A;  2YSQ A;  2AZV A;  2KGT A;  2X3X D;  4D8D A;  5IHI A;  4LN2 A;  2M51 A;  2KNB B;  4AFQ C;  1ZX6 A;  1BU1 A;  1ZUU A;  1E6G A;  1X6G A;  3UA6 A;  4AG2 C;  1YWO A;  4R0K A;  2GTO A;  1SRM A;  1TUC A;  2F2V A;  4WCI A;  3U23 A;  2LMJ A;  1AEY A;  2D8J A;  2ROL A;  1GBR A;  1I07 A;  1GRI A;  1JU5 C;  1BK2 A;  4Z88 A;  2RQW A;  1M27 C;  2L0A A;  1UE9 A;  2P4R A;  2AKL A;  3R6N A;  2FPD A;  1M3A A;  1K9A A;  2A08 A;  1AD5 A;  2K3B A;  2RQV A;  3IQL A;  2DL4 A;  4J9I A;  2CH4 W;  2F2X A;  3VS3 A;  1I1J A;  1TUD A;  1SHF A;  4J9B A;  1WX6 A;  1VYV A;  1JXO A;  1ZSG A;  2C0I A;  2KYM A;  1TG0 A;  2A28 A;  2FPE A;  1VYT A;  2CSI A;  2RPN A;  4AFZ C;  2YUQ A;  2LCS A;  1B07 A;  4AFS C;  4JJB A;  3NHN A;  2DRK A;  2JMA A;  2YT6 A;  3EHQ A;  2FG0 A;  1M3B A;  5GJV B;  1M8M A;  3M0U A;  1U5S A;  4J9G A;  2K6D A;  2E5K A;  3JV3 A;  2EGA A;  2AK5 A;  4LE9 A;  1K0X A;  2ED0 A;  4FSS A;  4RTX A;  2LX7 A;  2FPF A;  3VS5 A;  2EBP A;  2KRO A;  1GCQ A;  3EG1 A;  1BB9 A;  2GBQ A;  2XMF A;  3NPF A;  3EG0 A;  5IHN A;  4E6R A;  2VKN A;  2ED1 A;  4GBQ A;  2RQU A;  2MIO A;  1NEG A;  2O2O A;  3M0S A;  1NLP C;  3REA B;  3SEM A;  3EHR A;  1PRM C;  1Y57 A;  1QWF A;  1AWW A;  1JQQ A;  4D8K A;  4CC4 B;  1KSW A;  2DL5 A;  3UF4 A;  1M30 A;  1I0C A;  5IH2 A;  3M0Q A;  2J06 A;  2DBK A;  4IIO A;  1GCP A;  2A36 A;  2O9S A;  1MUZ A;  2PTK A;  2YUN A;  1XOV A;  4RTZ A;  4JPB W;  2F2W A;  3ULR B;  1W6X A;  2ESW A;  4OML A;  4RTT A;  1AWO A;  1W1F A;  2HEQ A;  4RTU A;  5ECA A;  1PRL C;  3THK A;  3SHW A;  1RLP C;  1AWX A;  2DF6 A;  4Z8A A;  1ZUY A;  2RQT A;  2KRN A;  1E7O A;  1KJW A;  1OPL A;  1UEC A;  5EC7 A;  2LNH B;  2ENM A;  4OMO A;  1AVZ C;  3I9Q A;  2CH4 A;  2IIM A;  2J05 A;  2DA9 A;  2OAW A;  2DM1 A;  2LQW A;  2L3S A;  1JEG A;  4X1V A;  1VYU A;  1KIK A;  2MOX A;  1T0H A;  2DL3 A;  2K2M A;  1PKS A;  1OOT A;  5HCK A;  5FW9 A;  4CC2 A;  2K79 A;  1ABQ A;  1X6B A;  2B86 A;  1GL5 A;  1BBZ A;  4QT7 A;  1SRL A;  2CUB A;  2LZ6 B;  4J9C A;  1SEM A;  1ARK A;  1N5Z A;  2KYB A;  1SPK A;  2EYZ A;  2LP5 A;  2W0Z A;  2DJQ A;  2HSP A;  2CSQ A;  1H3H A;  2JM8 A;  2JM9 A;  3H0I A;  2GTJ A;  2RF0 A;  2BTT A;  2K7A A;  1K76 A;  3PE0 A;  3H41 A;  4GLM A;  4RTY A;  1A0N B;  5IXF A;  1FMK A;  2EGE A;  2HBW A;  2VVK A;  3FJ5 A;  2DL7 A;  2AKK A;  2L2P A;  4K11 A;  1WFW A;  2JT4 A;  2O88 A;  1CSK A;  4OMN A;  3VRY A;  1UDL A;  2RNA A;  2C0O A;  2GNC A;  2A37 A;  3EG2 A;  1NEB A;  2L3Q A;  1FYN A;  3TVT A;  2V1Q A;  4Y92 A;  1HJD A;  1AWJ A;  1SSH A;  1UFF A;  2EGC A;  4CC7 A;  2KE9 A;  2YUO A;  2I0N A;  1RI9 A;  3TSW A;  2JS0 A;  3EG3 A;  1NYF A;  1Y0M A;  2FEI A;  1X43 A;  4EIK A;  2YDL A;  3H0F A;  1QWE A;  2KEA A;  2J6F A;  1GBQ A;  2CT4 A;  1ZLM A;  2JXB A;  1VA7 A;  4CC3 A;  4ESR A;  2CDT A;  2PNI A;  1YNZ A;  1WA7 A;  2ROT A;  1T0J A;  1G2B A;  2DX1 A;  2JS2 A;  2EYY A;  1ZUK A;  2H8H A;  2JW4 A;  2OJ2 A;  1NG2 A;  1SHG A;  2G6F X;  4HCK A;  3VS4 A;  1PWT A;  2EVR A;  1PNJ A;  2KT8 A;  1NLO C;  1UJY A;  2FRW A;  2KRM A;  2NWM A;  2O31 A;  4J9D A;  2L3P A;  1ABO A;  1G83 A;  1YWP A;  1U06 A;  3VS6 A;  4JZ3 A;  4A63 B;  1WXT A;  1EFN A;  1UJ0 A;  4ZNX A;  2EYX A;  1V1C A;  2KXD A;  2PZ1 A;  1W70 A;  1YCS B;  3VRZ A;  1K1Z A;  1X2K A;  2LJ1 A;  3VS7 A;  2O9V A;  2GQI A;  5IHK A;  2NUZ A;  2D1X A;  2CUD A;  2KT1 A;  4OMQ A;  4AG1 C;  3M0R A;  2EQI A;  2M0Y A;  4F14 A;  1JO8 A;  1MV3 A;  3EGU A;  2FO0 A;  5I22 A;  4LUE A;  2EKH A;  4HVV A;  5L23 A;  1H92 A;  1H8K A;  4LNP A;  3M0T A;  4HXJ A;  2GGR A;  2SRC A;  2ABL A;  3A98 A;  1WYX A;  1UUE A;  1CKA A;  2RN8 A;  1B3Q A;  2HCK A;  2JTE A;  1K4U S;  2FRY A;  4AFU C;  1YP5 A;  2KR3 A;  3NGP A;  3UAT A;  1RUW A;  1QKW A;  1WLP B;  1AZE A;  1QCF A;  2RQR A;  2DIL A;  1E6H A;  3VS1 A;  2RMO A;  4F16 A;  1WXU A; 
#chains in the Genus database with same CATH topology
 1R0C B;  3LX7 A;  2K9G A;  3BDU A;  1KQ1 A;  4C5I A;  3CCR T;  4QVC A;  4IIM A;  3FLG A;  1NYG A;  4M75 F;  3M57 A;  3KUF A;  3M54 A;  3I56 T;  2SEM A;  4M77 A;  1X69 A;  4OMM A;  4QKU A;  2KRS A;  2YHT A;  1X2Q A;  4ZTJ A;  1QKX A;  5I2S A;  3VUB A;  5A2Q E;  1Y96 A;  5CIU A;  3TQ7 P;  1IRE B;  4X9D A;  5GAM f;  2BZX A;  2CP6 A;  2DRM A;  1ZBJ A;  2EW3 A;  2QDL A;  5A0D A;  5IAY A;  4X34 A;  4FT2 A;  1M4Z A;  3P8D A;  1WXB A;  1YI2 Q;  2EYW A;  1V29 B;  2DYI A;  1S72 T;  2AHJ B;  5FLX E;  3I5S A;  1FMV A;  2ZCF B;  5LJ3 j;  4C92 E;  4A4G A;  2J7I A;  3CCU A;  3CPW S;  2OTL A;  1WQ7 A;  2D0Q B;  5GAO l;  2ZPG B;  2D8H A;  4C8Q F;  2GCX A;  1Y07 A;  4PFP A;  4ZN3 A;  2EPD A;  1VQM T;  3QBY A;  1RI0 A;  4ORZ A;  1M1K R;  4BDZ A;  3RBB B;  2R5M A;  3F70 A;  3RER A;  1WNL A;  2YRD A;  3VS0 A;  1NM7 A;  3G4S T;  3JB9 D;  1X27 A;  5DM7 R;  1SSF A;  2DVJ A;  3M58 A;  2NUP B;  3CCQ A;  3BE3 A;  4EMG A;  3OYK A;  2LNV A;  2C0T A;  3P8B B;  4BY6 C;  1QLY A;  2HDA A;  4N0A C;  1UGV A;  3ASK A;  3OMG A;  3TSZ A;  2CT3 A;  1ZSZ C;  4C92 D;  3OYH A;  1HSQ A;  1YJW Q;  3TEE A;  1WQW A;  3RMS A;  1JB0 E;  2YLB A;  3A1P A;  1WHL A;  2E65 A;  3PVQ A;  1Q7Y U;  1Z9Z A;  4M77 F;  3HFN A;  2MF2 A;  4ELZ C;  1WIE A;  4PJO C;  3I35 A;  3RDV A;  4C5G A;  4D8D A;  2RM4 A;  2KI7 A;  5J3B A;  3I55 A;  1ZX6 A;  3OYG A;  2P84 A;  2DXT A;  3CBP A;  1YIJ T;  4L6V 5;  4FYW B;  3RKY A;  4FYY B;  1WHM A;  3Q1J A;  2OX7 A;  9ATC B;  1SRM A;  2WSE E;  3I56 A;  2F2V A;  4WCI A;  2NLU A;  4E7Z A;  2E10 A;  1KQ2 A;  3EFO B;  4M7A G;  5HK0 A;  2OAU A;  3LGL A;  5GAN 3;  2WSF E;  1DJ7 B;  2JNG A;  2XID A;  4M77 G;  1NJI C;  4BB7 A;  3WXM B;  4ZGJ B;  5CCA A;  2OTJ Q;  1GRI A;  2DTO A;  1JRI A;  3DB3 A;  3JB9 G;  1UE9 A;  2P4R A;  3R6N A;  3HTR A;  1M3A A;  1K9A A;  3QYG B;  2K3B A;  3OMC A;  2QXF A;  4J9I A;  2CH4 W;  5DLQ E;  3CCV T;  1MHN A;  4DBF A;  4LXC A;  2JUF A;  4QVZ A;  3UWN A;  1WX6 A;  1W2B A;  1JXO A;  4QQG A;  1TG0 A;  1WJQ A;  3JCM g;  2RPN A;  4XTX A;  2YUQ A;  4AFS C;  1VQ5 A;  2CP2 A;  3JB9 H;  1VQO Q;  1VQK A;  1QVF P;  1UGQ B;  2E12 A;  2R58 A;  2DPP B;  3EGD B;  2XDD A;  5GAN j;  1M3B A;  1YHQ T;  3M0U A;  3ZBD A;  3EGX A;  2KAF A;  5D6X A;  1VIE A;  4J9G A;  3GLX A;  2K6D A;  3JV3 A;  2QK0 A;  4IUV A;  3C95 A;  3QO3 A;  1BYM A;  3OW2 P;  2FPF A;  3SWN A;  3WVE B;  2KRO A;  4ATO A;  4F7U F;  1YJ9 Q;  3M53 A;  2XHC A;  1KD1 C;  3NPF A;  2E6N A;  5IHN A;  3CCS T;  4MZM A;  2OTJ A;  1O75 A;  1ZHI A;  2ZAE A;  2RJD A;  4IUU A;  3C94 A;  1M1K U;  1BIB A;  1YHQ A;  4PJO B;  1C6V X;  4CC4 B;  4X9C A;  3OYD A;  3G71 A;  3UF4 A;  1M30 A;  1XQH A;  4IIO A;  2BE9 B;  4XU1 A;  1N27 A;  2C06 A;  5M9O A;  3JCM V;  1SG5 A;  4XK8 E;  3JCM d;  1W1F A;  4BAC A;  3S3O A;  1RAA B;  3O8V A;  1TSF A;  1AWX A;  2DF6 A;  1ZUY A;  1KJW A;  3H9N A;  4B9W A;  4FM4 B;  3JB9 J;  3CME Q;  1N8R U;  3CCL T;  5J39 A;  2IIM A;  2J05 A;  3V8K A;  2DA9 A;  2OAW A;  2LQW A;  2L3S A;  1EX4 A;  1VYU A;  1KIK A;  2DL3 A;  4C0D C;  1PKS A;  4A4H A;  2EJF A;  2LCL A;  3WVD B;  2BE7 D;  2H3J A;  1N9S A;  3MEW A;  1XNI A;  2X4X A;  3FRN A;  4BI3 A;  3I55 T;  4LD6 A;  5FRN A;  2GFU A;  5GAO q;  4F7U A;  4XQ3 A;  3CC4 A;  2X4Y A;  2DXB A;  2EYZ A;  2W0Z A;  2L8D A;  2DAQ A;  3CCQ Q;  2DJQ A;  2CSQ A;  3E19 A;  3URG A;  3QSU A;  2M02 A;  2P0K A;  2E3I A;  3H41 A;  5IXF A;  4QW2 A;  2EGE A;  4LDY A;  3OYE A;  1XTD A;  2RB6 A;  1LVK A;  3MP8 A;  4E7J A;  2RNA A;  1KG1 A;  3EG2 A;  2L3Q A;  5GAO n;  1HJD A;  1SSH A;  4HCB A;  1UFF A;  3QDF A;  4C92 B;  4CC7 A;  2KE9 A;  4DBH A;  2I0N A;  4PLL A;  2XK0 A;  2PUK B;  4EIK A;  5KYU A;  3V7R A;  3H0F A;  2KEA A;  3ZEH A;  1M90 U;  4C0Z A;  5FRO A;  3MEU A;  2RHI A;  1VQK T;  1PM3 A;  1UB4 A;  1F1B B;  2DER A;  2EWN A;  1WJR A;  4BI8 B;  1G2B A;  5J26 A;  2RH2 A;  2DEU A;  2V8K A;  4HCK A;  1M9S A;  1S72 A;  1ZBX A;  2F1L A;  1UJY A;  2FRW A;  2CP3 A;  1VQM A;  2O31 A;  2VXF A;  1YWP A;  1U06 A;  3L42 A;  2R57 A;  4Y91 A;  1EFN A;  2FL7 A;  1D3B B;  2PZ1 A;  1W70 A;  1YCS B;  2JOY A;  4JRQ A;  1M1K C;  4JDS A;  3VS7 A;  2QEX T;  3CPW P;  2A7Y A;  4F7U B;  1VQ8 A;  5IHK A;  2NUZ A;  1D1A A;  2QA4 T;  4OMQ A;  3M0R A;  3CCM A;  1Q82 C;  2EQI A;  2M0Y A;  2K5I A;  5LJ5 g;  2XG8 D;  3G1J A;  2JVV A;  2HL3 A;  1IB8 A;  3MET A;  2V26 A;  1YIT Q;  4Z02 A;  1H8K A;  2CKK A;  4D6W A;  3MEV A;  4M77 E;  2JTE A;  5CAI A;  4M78 B;  3OW2 S;  1D1C A;  1QKW A;  2M1H A;  5LL6 S;  4FW2 A;  1AZE A;  1VQL A;  1QVP A;  2MAM A;  1JEG A;  2KXC A;  3EH2 A;  1UG1 A;  2BZY A;  1BCM A;  4FIB A;  1OV3 A;  2NYS A;  2O01 E;  1WDX A;  2CRE A;  4EMK A;  4OMF B;  4XU2 A;  3FC3 A;  4N0A A;  3VS2 A;  3X25 B;  4XTV A;  2VYT A;  3M59 A;  3PT9 A;  4YTL A;  2RO0 A;  1WI7 A;  1JXM A;  1N8R C;  2E3H A;  4JJC A;  4LDV A;  1TH7 A;  3OBY A;  4M78 C;  4DBR A;  3NTI A;  1LJO A;  5KCO A;  5GAN 2;  4C8Q E;  4M75 G;  1NJI R;  4HKE A;  4Q5W A;  3DB4 A;  1U3O A;  2FYK A;  2AZS A;  4OB1 B;  3ZL7 C;  5FWC A;  1MMG A;  4J9F A;  3V8J A;  1TU0 B;  2LJ0 A;  3CCV A;  4HCZ A;  1UHC A;  2VXE A;  4RTW A;  4OF1 A;  1GFC A;  5I21 A;  5GAM j;  4RUG A;  4M7D E;  2DE0 X;  4WTO B;  2DBM A;  2D0N A;  4F7U E;  4LUD A;  4M4Z A;  1M3C A;  2LQN A;  1GFD A;  5GAO m;  2COY A;  3NMZ C;  1YN8 A;  2DL8 A;  1AOJ A;  4M7D F;  1W2B P;  1CKB A;  2LQ8 A;  2DD4 A;  5CKB A;  4C8Q G;  3LH5 A;  1BI1 A;  1RLQ C;  3GBQ A;  2YXY A;  3JCM W;  4E2F B;  3MCA B;  5GAN 4;  2P0Q A;  1YJN T;  3C0C A;  4M7D D;  3ER0 A;  4Y28 E;  1VQ7 Q;  2EAY A;  4EDU A;  4PJO D;  2JJ9 A;  2PU9 B;  2ECZ A;  3SDZ A;  3BFM A;  2HBP A;  5D6W A;  2LC4 A;  2E41 A;  2L5Q A;  1AT1 B;  1G3Y A;  1FXX A;  2JMC A;  3SFM A;  2YSQ A;  4LN2 A;  1YFN A;  2M51 A;  2KNB B;  1VQP T;  3OYA A;  1PD1 A;  1VUB A;  4BUG A;  3EFR A;  3L1A A;  1X6G A;  3UA6 A;  4AG2 C;  2PUO B;  1YWO A;  2QDY B;  4PJO E;  3EGD A;  5CVI A;  2PQW A;  2EFI A;  1G3S A;  3MO8 A;  2O4X A;  5KYU B;  3G6E Q;  1AEY A;  1RAE B;  2FVU A;  1KD1 U;  1N9R A;  3L2Z A;  3G71 T;  4B6M A;  4QQD A;  3G4S A;  1D0Y A;  3P8H A;  1GBR A;  1VQN Q;  4E7I A;  3CCE Q;  2DVE A;  2DFU A;  3UDC A;  5CKF A;  4Z88 A;  1M27 C;  2AKL A;  1JBM A;  2QYZ A;  1BKB A;  2A08 A;  4BE0 A;  1AD5 A;  3IQL A;  3CCJ Q;  2F2X A;  4CRI A;  1I1J A;  3QJY A;  5D6Y A;  3A8H B;  2OTL T;  3JCM c;  2CZ1 B;  4M75 A;  1G3W A;  2KYM A;  4FT4 A;  1Q86 C;  1RAD B;  2A28 A;  2FPE A;  2MMP A;  2LCS A;  1B07 A;  2QA4 A;  5A0G A;  2A0F B;  3OW2 A;  1I5L A;  3EFO A;  3NHN A;  1OZ2 A;  3OS2 A;  5GAM d;  2JMA A;  2GFA A;  2MWO A;  1VQ4 A;  3BDL A;  2QAS A;  3FDR A;  3VKI A;  5GAN f;  4OB0 B;  4FCY A;  3JCM J;  4A53 A;  2DKG A;  2E5K A;  2I2L A;  4J5Y A;  4C92 A;  2E1H A;  2AK5 A;  1K0X A;  4FSS A;  2X4W A;  4RTX A;  4O6J A;  4KUI A;  2RK1 A;  3CXC S;  4RKU E;  8ATC B;  1VQ4 Q;  3CD6 T;  3VS5 A;  1NJI U;  1EZZ B;  3EG1 A;  1BB9 A;  2MK5 A;  2FHD A;  4E6R A;  2X51 A;  3M9Q A;  4XTU A;  2ED1 A;  3TRE A;  2DTI A;  1G5V A;  4AMC A;  2MIO A;  1K8A R;  4N4H A;  4EPC A;  4OVA A;  1D0X A;  4L5G A;  3SEM A;  4BI4 A;  3EHR A;  3HPW A;  3CCR Q;  3QHS A;  1PRM C;  4UC4 A;  1OQK A;  1AWW A;  1JQQ A;  4HCC A;  1H3Z A;  5GAN h;  3DKM A;  4E47 A;  2DL5 A;  1RAG B;  5IH2 A;  4RCB A;  5HY6 A;  2HQE A;  2J06 A;  2XIC A;  2DBK A;  5L8R E;  1K9M U;  1GCP A;  1M1F A;  2RHX A;  2O9S A;  2PTK A;  2RJF A;  1HXD A;  3M5A A;  1U8R A;  4RTZ A;  4JPB W;  2LTO A;  4PFO A;  1Y96 B;  3SD4 A;  2ESW A;  4MMK A;  3CC7 A;  1AWO A;  2HEQ A;  4RTU A;  5C6S A;  3THK A;  4KBM B;  5KYN A;  3QII A;  1KC8 U;  4Z8A A;  1S72 Q;  2LT1 A;  2QQS A;  1FX7 A;  1E7O A;  3VYH B;  2F5K A;  2COZ A;  1UEC A;  5EC7 A;  2LNH B;  1UGR B;  3OYL A;  2ENM A;  1BI2 A;  4M7A C;  4OMO A;  5LJ5 h;  1AVZ C;  3VYG A;  2CH4 A;  4KH1 B;  3PIP A;  5FU7 C;  2HNI A;  5GMK l;  1VQM Q;  4X1V A;  4C0D B;  3CXC A;  2MOX A;  2WSC E;  5GAN 7;  2K2M A;  2HSE B;  1Q81 R;  1SF9 A;  1WHK A;  5FW9 A;  3GP8 A;  3TCJ A;  1BCO A;  2B86 A;  3E9F A;  4M7A E;  1OU8 A;  3LYI A;  1SRL A;  3GIB A;  3A8O B;  3OB9 A;  4E7K A;  2K3X A;  1SEM A;  1ARK A;  3CMA T;  2XD0 A;  2FB7 A;  1N5Z A;  4EMK B;  2X9H A;  1SPK A;  1IGU A;  3RKW A;  1U1T A;  2FZK B;  1MMN A;  2JM8 A;  2JM9 A;  3H0I A;  1W2B S;  2DD5 A;  4PJO F;  2EIF A;  1ZA2 B;  1K76 A;  1IZ6 A;  1K73 U;  2CP7 A;  1K73 R;  1VQP A;  2HBW A;  3C12 A;  4C92 G;  4K11 A;  1WFW A;  2O88 A;  1N6A A;  4VUB A;  3QYH B;  4M78 A;  1ZA1 B;  3CC4 Q;  1D0Z A;  2HAX A;  2XKO C;  4M78 E;  1VQ9 Q;  2E70 A;  2JN0 A;  2C0O A;  2A37 A;  1BI3 A;  1NEB A;  2LDM A;  5GMK i;  2QTX A;  1RI9 A;  1YIJ Q;  1NBE B;  3EG3 A;  3OYN A;  4A4F A;  4BE1 A;  1MNE A;  3MP1 A;  1X01 A;  2J6F A;  3X24 B;  1RAH B;  3A8G B;  4JLG A;  1GBQ A;  1VOM A;  1YIJ A;  4L59 A;  1D3B A;  3LWH A;  1VA7 A;  3CXC P;  2CDT A;  2PNI A;  1YNZ A;  3PTA A;  1VQL Q;  4M7A A;  1WA7 A;  2ROT A;  1N8R R;  2OTJ T;  1WPY A;  3L2W A;  2K57 A;  5AYF A;  2DX1 A;  2JS2 A;  1ZUK A;  1NG2 A;  2JW4 A;  2OJ2 A;  1B34 A;  3INZ A;  4BY6 B;  3VS4 A;  3CC2 T;  1JJ2 A;  1PNJ A;  1R0B G;  4J9D A;  2L3P A;  4R56 A;  4OGC A;  3CCU Q;  4JZ3 A;  3MEA A;  4ZNX A;  1KHC A;  2EQK A;  1KC8 C;  2EJG A;  1K1Z A;  1X2K A;  6AT1 B;  1SKU B;  4JUV A;  2QI2 A;  3ME9 A;  3JCM f;  4AG1 C;  2E4H A;  3GNF B;  2L89 A;  3OYY A;  3HSB A;  3EGU A;  2FO0 A;  4LUE A;  4HXJ A;  2GGR A;  2M9U A;  2ABL A;  3A98 A;  2DK3 A;  2RN8 A;  3UAT A;  1RUW A;  1M90 C;  1YJ9 T;  2DIL A;  1E6H A;  2JTM A;  3VS1 A;  3X26 B;  5LJ5 f;  3UPU A;  3CCS Q;  2L3R A;  5KYY B;  3EH1 A;  1J3T A;  1WJS A;  1HD3 A;  5LJ5 e;  5GAN 5;  1LPL A;  3H0H A;  3D7S B;  3CC7 Q;  2YUP A;  1JJ2 P;  1PHT A;  3G6E A;  3CPW A;  1QCN A;  4RCC A;  1OPK A;  3HL8 A;  4LDX A;  4M75 C;  4J6W A;  5CQY A;  3CCM T;  4KGX B;  2NUT A;  2VWF A;  1VQ8 T;  4HVU A;  5LJ3 f;  3OQ5 A;  2QEX A;  3V8L A;  3J7A F;  4P5N A;  2DXC A;  4MDX A;  4M77 C;  4MML A;  5FWB A;  3KFV A;  4KUL A;  4C5H A;  2M16 A;  4TVR A;  1PKT A;  2BIV A;  1W4S A;  3QWY A;  3CQT A;  2WAC A;  2DZ9 A;  3OA6 A;  4PJM A;  5I2M A;  1UTI A;  3I56 Q;  1G3T A;  2KQW A;  2VGM A;  4A4E A;  4HVW A;  1IO6 A;  5CKE A;  4JRI A;  1KD1 R;  4PJN A;  2BZ8 A;  1FMW A;  4MZP A;  2RHU A;  2J6K A;  2COW A;  4XU3 A;  3PMI A;  3I55 Q;  4J9E A;  2HKN A;  1PSF A;  3V7C A;  4M7D C;  1YI2 T;  1UHF A;  4M77 B;  4PFZ A;  1VQ6 T;  4F04 B;  1X6O A;  2X3W D;  3O5Z A;  3CCQ T;  4C0G A;  2LJ3 A;  2QG9 B;  2DTH A;  3CME A;  3GF5 A;  4JRK A;  1T3S A;  2IVW A;  4E7L A;  3H6Z A;  5KYY A;  4KUD K;  2DYB A;  4OMP A;  4QVD A;  1OEB A;  4F16 A;  3PIO A;  2KSS A;  4DOV A;  5KYX B;  2PVG B;  1TTH B;  3E2U A;  1Q82 U;  5GAM h;  5IXB A;  4J6X A;  4J8O A;  2AIR B;  1LCK A;  4NS5 A;  3SWN B;  5IHI A;  3OYF A;  4OGE A;  2ZZD A;  4MZT A;  1IHV A;  1BU1 A;  1YJN A;  1ZUU A;  3G7Z A;  4RG8 A;  3VV0 A;  1R8O B;  3A8L B;  1YJW A;  5GAO p;  2GTO A;  1TUC A;  4A4K A;  4II1 A;  4GY5 A;  1YHQ Q;  3U23 A;  3R6O A;  2LMJ A;  4ANJ A;  4C8Q B;  1NPP A;  3JCM X;  2D8J A;  2ROL A;  3M4Y A;  4EMK C;  1I07 A;  3QZ5 B;  2JZ2 A;  1BK2 A;  5FU6 C;  2RQW A;  4ELY C;  5GAM g;  2FPD A;  2P4T A;  3AT1 B;  3OS5 A;  4DA4 A;  2RQV A;  2DL4 A;  2ZPB B;  2EQJ A;  4PJL A;  2K2V A;  3MPU B;  1SHF A;  4J9B A;  1IRX A;  1VYV A;  1WHJ A;  2EJ9 A;  1HYO A;  3CD6 A;  2HQH A;  1VYT A;  4AFZ C;  3CCE A;  1I8F A;  4JJB A;  1YJ9 A;  1D09 B;  3NTK A;  2DRK A;  2QAZ A;  5CQX A;  1TOV A;  5GMK j;  3JCM Q;  3OYM A;  2YT6 A;  3CEY A;  1Q81 C;  2FG0 A;  1VQO A;  3QUI A;  1PC0 A;  1C1A A;  2RI3 A;  2QGG A;  1QMC A;  2CZ7 B;  4LE9 A;  2RK2 A;  4E7H A;  1ZSZ A;  4PL6 A;  4C8Q C;  4ZTF A;  2JTF A;  3T9N A;  2EBP A;  5CK9 A;  2YLC A;  1OUL A;  3QXE B;  1VQ5 Q;  2BUD A;  4FYV B;  2RQU A;  5HK3 A;  1NEG A;  1YBY A;  5CKD A;  4J7I A;  1K73 C;  3LW5 E;  5GAN g;  2K5L A;  3BY7 A;  3CCS A;  2RA2 A;  4XTW A;  3E9G A;  1Y57 A;  1VQO T;  1QWF A;  3EAE A;  3QG1 A;  5GAO r;  2DO3 A;  1M1G A;  1TWB A;  3M0Q A;  1MUZ A;  3MKD A;  2K4Y A;  2V8I A;  1BIA A;  1XOV A;  3HP9 A;  1Y71 A;  2F2W A;  5LJ5 d;  5CO7 A;  1W6X A;  4OML A;  5ECA A;  3QDR B;  1JJ2 S;  1RLP C;  2KVQ G;  1V76 A;  2KRN A;  4NOY A;  1OPL A;  2KK4 A;  1Q82 R;  3I9Q A;  3CCJ A;  3QKJ A;  4B9X A;  1M2V A;  1OYX A;  4FW1 A;  1T0H A;  3CPF A;  4BD3 A;  5HCK A;  3M55 A;  3G4S Q;  4CC2 A;  1ABQ A;  1X6B A;  1FWZ A;  1WGS A;  4PJJ A;  1KQS A;  3OSS C;  4QT7 A;  5KCH A;  2LZ6 B;  2DEQ A;  4IUQ A;  8AT1 B;  3V7S A;  4OB2 B;  4J9C A;  1Q7Y C;  2PVO B;  2KYB A;  2EQM A;  2HL5 C;  2LP5 A;  2M0O A;  1I5O B;  1OX9 A;  2HSP A;  2E6Z A;  2X4J A;  3AHU A;  3QZ9 B;  1YJW T;  2GTJ A;  2RHZ A;  1K8A U;  2EQU A;  1YCY A;  3CME T;  3PE0 A;  4HT9 A;  1QVG A;  4RTY A;  3CCL Q;  1A0N B;  1FMK A;  3CBM A;  4O5V A;  2E5Q A;  2DL7 A;  2AKK A;  2L2P A;  3X28 B;  1VQ6 A;  2JT4 A;  5CKH A;  4IUT A;  5KE2 A;  3HFO A;  3RIR A;  2CGH A;  2YRV A;  1VQ7 A;  1M8V A;  3L2Q A;  3LH0 A;  3TVT A;  2YWW A;  4Y92 A;  1AWJ A;  1VQP Q;  4DOW A;  5IN1 A;  3M4G A;  3GOX A;  2QGF B;  5KH6 A;  4AT1 B;  1BI0 A;  2HD0 A;  4F7U G;  1NYF A;  1Y0M A;  2FEI A;  2MI6 A;  3EGX B;  4XAX B;  4J83 A;  1X43 A;  3L2R A;  2QEX Q;  1QVF S;  2Y4X A;  4J7F A;  3RMQ A;  4C92 F;  3OBW A;  2QQ9 A;  1D1B A;  3NTH A;  4JJN K;  2CT4 A;  3S6W A;  1ZLM A;  2JXB A;  3LWI A;  4CC3 A;  5GAN 6;  2DJZ A;  3JCM P;  3JAM E;  4PLI A;  2EYY A;  1KHI A;  3HHT B;  3CCV Q;  4RMO A;  3S3M A;  2KT8 A;  1B7T A;  2IG0 A;  3J80 E;  2KRM A;  1Q81 U;  2VV5 A;  1RAC B;  4HA8 A;  2ZPH B;  2LVM A;  3VS6 A;  1WXT A;  1KK7 A;  1UJ0 A;  5IT9 E;  3NFC A;  2KXD A;  4M78 D;  3VRZ A;  1NE8 A;  2LJ1 A;  5DY9 A;  2PVD B;  3EFS A;  3HRT A;  2D1X A;  2NUP A;  2KT1 A;  2XDP A;  1VQK Q;  1JO8 A;  1MV3 A;  4HT8 A;  5I22 A;  2RI5 A;  4KT0 E;  2EKH A;  5L23 A;  1UGS B;  4LNP A;  3M0T A;  3S3N A;  2SRC A;  5GAM e;  2YRC A;  1UUE A;  1VQ4 T;  2BKD N;  3KBG A;  1B3Q A;  4LDU A;  2IPO B;  3LGF A;  2FRY A;  4AFU C;  1M2V B;  2KR3 A;  3PNW C;  3E1S A;  1WLP B;  1QCF A;  2QQR A;  3JCM h;  2RMO A;  4PK4 A;  1WXU A;  3GPL A;  1NPR A;  1ZQ1 A;  3REB B;  2HMA A;  5LJ3 e;  4C0F A;  4ZN1 A;  4N4I A;  1KQS S;  5GJW B;  1Y7X A;  3JB9 F;  4KRT A;  5A0L A;  3JSC A;  3QWX X;  1TXQ A;  3I5R A;  3RUX A;  5GMK h;  4J9H A;  2XU8 A;  2QA4 Q;  4ME7 A;  4DBQ A;  4JJD A;  1PG5 B;  5I11 A;  1O9S A;  5HKC A;  2CZ0 B;  1MMA A;  1VIF A;  4IUR A;  1GXI E;  4J6Y A;  2DMO A;  3UA7 A;  3MJX A;  4FYX B;  1RAI B;  3RNJ A;  3OYB A;  3QJ6 A;  2DLP A;  3FEO A;  4CI0 C;  2VAS A;  1GCQ C;  1MGQ A;  2V1R A;  1AZG B;  2J6O A;  4Z89 A;  3X20 B;  2GF7 A;  1WZO A;  1QQJ A;  4QQ6 A;  2FZG B;  1MV0 B;  1VQ9 A;  3FIF A;  3PVL A;  1WHG A;  4KGV B;  1M5Q 1;  4JZ4 A;  3CC2 A;  2DNU A;  2W10 A;  2VC8 A;  3JB9 I;  5GAN 8;  2H3E B;  1Z9Q A;  2MCN A;  5C0M A;  1K9M R;  1PSE A;  1S1N A;  1OI1 A;  1K0S A;  1VQN A;  4M77 D;  1RAB B;  2OI3 A;  2KBT A;  3OYJ A;  4M75 E;  3G71 Q;  4M7D A;  1IGQ A;  3OS0 A;  3CBO A;  1H64 1;  1T3L A;  2ZPE B;  5LJ5 j;  4DEY A;  4F17 A;  2HQX A;  3M0P A;  1KFZ A;  3GNG A;  4DEX A;  2MWP A;  3EG9 B;  2DIQ A;  4RTV A;  3VJP A;  2AZV A;  2KGT A;  2X3X D;  4AFQ C;  1TUG B;  2D9T A;  3TU4 K;  2LT4 A;  1E6G A;  2VB6 A;  4R0K A;  4C8Q A;  2VGN A;  3RR6 A;  5KYW A;  1XJW B;  1YJN Q;  3SB2 A;  5GMK m;  3MP6 A;  1JU5 C;  1VQ7 T;  1QCO A;  1VQL T;  2L0A A;  1HK9 A;  2LQK A;  3CD6 Q;  1QP2 A;  1OU9 A;  3VS3 A;  2QQB A;  3L2U A;  2Y90 A;  3CC2 Q;  4WF2 A;  2CYZ B;  1TUD A;  5KYX A;  1U1S A;  2V8J A;  1RL2 A;  2ATC B;  2K3Y A;  4E7S A;  5FRM A;  2XDB A;  3CCU T;  1ZSG A;  2C0I A;  2B8A A;  3HRU A;  2EYQ A;  2CSI A;  2LX9 A;  2ZPI B;  1QP3 A;  3OYI A;  1P92 A;  3QPH A;  4PJO G;  2X35 A;  3M56 A;  2F5T X;  3RKX A;  4LD9 K;  3EHQ A;  1KQS P;  5GJV B;  1M8M A;  1U5S A;  3DLL A;  2P0P A;  4C8Q D;  2VUB A;  1OZ3 A;  2EGA A;  1YIT T;  3CCE T;  2ED0 A;  1C0M A;  2LX7 A;  4JS4 A;  1QVG S;  5LJ3 h;  1Q7Y R;  2RJE A;  1I81 A;  1GCQ A;  3CCJ T;  4PNO A;  2GBQ A;  1AHJ B;  2QTV A;  1M2O A;  2XMF A;  3EG0 A;  2K5F A;  4M7D G;  2VKN A;  4GBQ A;  4KGZ B;  4MDW A;  1UGP B;  4DQ2 A;  2O2O A;  2OTL Q;  3M0S A;  1NLP C;  3REA B;  4JRP A;  2KDS A;  3BW1 A;  4D8K A;  1KSW A;  5GAN d;  4C92 C;  1I0C A;  2NUT B;  3VU3 C;  2D6F A;  3CMA A;  2A36 A;  2Y4Y A;  3VUZ A;  1YIT A;  4V2S A;  3HKS A;  2YUN A;  3C4S A;  4R55 A;  1IXD A;  4XTZ A;  2EKO A;  2RI2 A;  2F69 A;  3ULR B;  4RTT A;  3A5Z B;  3JRZ A;  1UEB A;  1PRL C;  1IHW A;  3LLR A;  2RJC A;  3SHW A;  2MPX C;  1X75 C;  5GAN e;  1KC8 R;  1VQ8 Q;  2RQT A;  4RG2 A;  3N5B B;  2DIG A;  4BE2 A;  4NL2 A;  2XI9 A;  3HRS A;  2DM1 A;  3CC4 T;  5LJ3 g;  2LCC A;  5DLO A;  1MND A;  1OOT A;  2CS7 A;  2DXU A;  2G3R A;  4N4G A;  1M90 R;  2K79 A;  4XTY A;  5EG2 A;  4FL6 A;  1GL5 A;  1BBZ A;  2CUB A;  2ZPF B;  4LDW A;  2MYS A;  2CZ6 B;  1MMD A;  3PFS A;  1PD0 A;  4IKF A;  4PJO A;  2RHY A;  1Q86 R;  4FU6 A;  1VQ6 Q;  1Q86 U;  2LRQ A;  1H3H A;  2RF0 A;  3FB9 A;  2BTT A;  2Z0W A;  2K7A A;  4M75 B;  5FU7 B;  3KXT A;  4GLM A;  3OYC A;  2VVK A;  3FJ5 A;  3RES A;  1CSK A;  1PCX A;  4OMN A;  3VRY A;  1UDL A;  1B34 B;  1OX8 A;  4BDY A;  5CR2 A;  2GNC A;  1ACM B;  4IUP A;  2QQA A;  7AT1 B;  2HZY A;  1FYN A;  5FU6 B;  1ZSZ B;  4PKC C;  2V1Q A;  3JCM e;  2KY9 A;  4M78 F;  3CCL A;  2GQV A;  2DZC A;  2EGC A;  4EMH A;  5KE3 A;  2YUO A;  3UT1 A;  2A3L A;  1NZ9 A;  2CP0 A;  1QW1 A;  2JS0 A;  3TSW A;  5KYW B;  2E64 A;  4NL3 A;  3SWN C;  3ZFJ A;  2YDL A;  3A8M B;  1LOJ A;  1QWE A;  3G6E T;  5LJ3 d;  3CMA Q;  4M7A D;  1K8A C;  5GMK e;  1VQN T;  3JCM b;  3OS1 A;  1I4K 1;  4GLK A;  4ESR A;  4A54 A;  5AT1 B;  4JS5 A;  3L2V A;  3CCR A;  1QVF A;  1T0J A;  1R77 A;  2H8H A;  1RAF B;  1SHG A;  2G6F X;  4M78 G;  4M7A F;  1QVG P;  1PWT A;  2FZC B;  3DLM A;  3EG9 A;  2EVR A;  4OB3 B;  1NLO C;  2NWM A;  1TS9 A;  1VQ9 T;  3OY9 A;  5D7U A;  3H8Z A;  1ABO A;  1LNX A;  1G83 A;  4ZGD B;  2AT1 B;  4A63 B;  4M7A B;  3OSV A;  2EYX A;  1V1C A;  3J81 E;  2RD1 A;  1YI2 A;  2CP5 A;  3CC7 T;  2O4X B;  4M7D B;  1G8X A;  2O9V A;  2DET A;  2GQI A;  2CUD A;  4C5E A;  1K9M C;  3PMT A;  4F14 A;  3PGG A;  1WHH A;  2R5A A;  3CCM Q;  2KMT A;  4ZGE B;  4HVV A;  1H92 A;  4FSX A;  1WYX A;  4KH0 B;  1CKA A;  2HCK A;  1K4U S;  2HKQ B;  1Q95 G;  1YP5 A;  3NGP A;  4XU0 A;  3FJP A;  2ZGW A;  4M75 D;  1VQ5 T;  2RQR A;  4OP0 A;  1EIF A;  4JLI A;  3MHX A; 
#chains in the Genus database with same CATH homology
 2KXC A;  1UG1 A;  2BZY A;  2K9G A;  3REB B;  1J3T A;  1OV3 A;  4IIM A;  1HD3 A;  1WDX A;  1NYG A;  3H0H A;  5GJW B;  2CRE A;  2SEM A;  4OMM A;  1X69 A;  2KRS A;  4KRT A;  2YUP A;  3VS2 A;  1X2Q A;  3QWX X;  3I5R A;  1QKX A;  1PHT A;  4J9H A;  1OPK A;  4JJD A;  1WI7 A;  5I11 A;  2BZX A;  1JXM A;  2DRM A;  1ZBJ A;  2EW3 A;  2QDL A;  4JJC A;  1WXB A;  2DMO A;  2EYW A;  2VWF A;  3UA7 A;  4HVU A;  3RNJ A;  3I5S A;  2DLP A;  2J7I A;  1U3O A;  1GCQ C;  2V1R A;  1AZG B;  2J6O A;  5FWB A;  3KFV A;  2AZS A;  3ZL7 C;  5FWC A;  4Z89 A;  4J9F A;  2D8H A;  2LJ0 A;  1PKT A;  1UHC A;  3QWY A;  1MV0 B;  2EPD A;  4RTW A;  3CQT A;  1GFC A;  3PVL A;  4ORZ A;  4RUG A;  2DE0 X;  1UTI A;  3RBB B;  4JZ4 A;  2DBM A;  2D0N A;  2DNU A;  2W10 A;  4LUD A;  4M4Z A;  1Z9Q A;  1M3C A;  2MCN A;  4HVW A;  1IO6 A;  2LQN A;  3VS0 A;  1GFD A;  3NMZ C;  1YN8 A;  1NM7 A;  2DL8 A;  1X27 A;  2BZ8 A;  1AOJ A;  2DVJ A;  1S1N A;  1K0S A;  2J6K A;  1CKB A;  4J9E A;  2OI3 A;  2KBT A;  2C0T A;  3LH5 A;  1UHF A;  1QLY A;  1RLQ C;  2HDA A;  3GBQ A;  1UGV A;  3TSZ A;  2CT3 A;  2X3W D;  3O5Z A;  3C0C A;  1T3L A;  2LJ3 A;  1HSQ A;  4DEY A;  1T3S A;  4F17 A;  2DYB A;  4OMP A;  1OEB A;  3M0P A;  1KFZ A;  2ECZ A;  3PVQ A;  1Z9Z A;  4DEX A;  5IXB A;  1WIE A;  3I35 A;  1LCK A;  2JMC A;  4RTV A;  2YSQ A;  2AZV A;  2KGT A;  2X3X D;  4D8D A;  5IHI A;  4LN2 A;  2M51 A;  2KNB B;  4AFQ C;  1ZX6 A;  1BU1 A;  1ZUU A;  1E6G A;  1X6G A;  3UA6 A;  4AG2 C;  1YWO A;  4R0K A;  2GTO A;  1SRM A;  1TUC A;  2F2V A;  4WCI A;  3U23 A;  2LMJ A;  1AEY A;  2D8J A;  2ROL A;  1GBR A;  1I07 A;  1GRI A;  1JU5 C;  1BK2 A;  4Z88 A;  2RQW A;  1M27 C;  2L0A A;  1UE9 A;  2P4R A;  2AKL A;  3R6N A;  2FPD A;  1M3A A;  1K9A A;  2A08 A;  1AD5 A;  2K3B A;  2RQV A;  3IQL A;  2DL4 A;  4J9I A;  2CH4 W;  2F2X A;  3VS3 A;  1I1J A;  1TUD A;  1SHF A;  4J9B A;  1WX6 A;  1VYV A;  1JXO A;  1ZSG A;  2C0I A;  2KYM A;  1TG0 A;  2A28 A;  2FPE A;  1VYT A;  2CSI A;  2RPN A;  4AFZ C;  2YUQ A;  2LCS A;  1B07 A;  4AFS C;  4JJB A;  3NHN A;  2DRK A;  2JMA A;  2YT6 A;  3EHQ A;  2FG0 A;  1M3B A;  5GJV B;  1M8M A;  3M0U A;  1U5S A;  4J9G A;  2K6D A;  2E5K A;  3JV3 A;  2EGA A;  2AK5 A;  4LE9 A;  1K0X A;  2ED0 A;  4FSS A;  4RTX A;  2LX7 A;  2FPF A;  3VS5 A;  2EBP A;  2KRO A;  1GCQ A;  3EG1 A;  1BB9 A;  2GBQ A;  2XMF A;  3NPF A;  3EG0 A;  5IHN A;  4E6R A;  2VKN A;  2ED1 A;  4GBQ A;  2RQU A;  2MIO A;  1NEG A;  2O2O A;  3M0S A;  1NLP C;  3REA B;  3SEM A;  3EHR A;  1PRM C;  1Y57 A;  1QWF A;  1AWW A;  1JQQ A;  4D8K A;  4CC4 B;  1KSW A;  2DL5 A;  3UF4 A;  1M30 A;  1I0C A;  5IH2 A;  3M0Q A;  2J06 A;  2DBK A;  4IIO A;  1GCP A;  2A36 A;  2O9S A;  1MUZ A;  2PTK A;  2YUN A;  1XOV A;  4RTZ A;  4JPB W;  2F2W A;  3ULR B;  1W6X A;  2ESW A;  4OML A;  4RTT A;  1AWO A;  1W1F A;  2HEQ A;  4RTU A;  5ECA A;  1PRL C;  3THK A;  3SHW A;  1RLP C;  1AWX A;  2DF6 A;  4Z8A A;  1ZUY A;  2RQT A;  2KRN A;  1E7O A;  1KJW A;  1OPL A;  1UEC A;  5EC7 A;  2LNH B;  2ENM A;  4OMO A;  1AVZ C;  3I9Q A;  2CH4 A;  2IIM A;  2J05 A;  2DA9 A;  2OAW A;  2DM1 A;  2LQW A;  2L3S A;  1JEG A;  4X1V A;  1VYU A;  1KIK A;  2MOX A;  1T0H A;  2DL3 A;  2K2M A;  1PKS A;  1OOT A;  5HCK A;  5FW9 A;  4CC2 A;  2K79 A;  1ABQ A;  1X6B A;  2B86 A;  1GL5 A;  1BBZ A;  4QT7 A;  1SRL A;  2CUB A;  2LZ6 B;  4J9C A;  1SEM A;  1ARK A;  1N5Z A;  2KYB A;  1SPK A;  2EYZ A;  2LP5 A;  2W0Z A;  2DJQ A;  2HSP A;  2CSQ A;  1H3H A;  2JM8 A;  2JM9 A;  3H0I A;  2GTJ A;  2RF0 A;  2BTT A;  2K7A A;  1K76 A;  3PE0 A;  3H41 A;  4GLM A;  4RTY A;  1A0N B;  5IXF A;  1FMK A;  2EGE A;  2HBW A;  2VVK A;  3FJ5 A;  2DL7 A;  2AKK A;  2L2P A;  4K11 A;  1WFW A;  2JT4 A;  2O88 A;  1CSK A;  4OMN A;  3VRY A;  1UDL A;  2RNA A;  2C0O A;  2GNC A;  2A37 A;  3EG2 A;  1NEB A;  2L3Q A;  1FYN A;  3TVT A;  2V1Q A;  4Y92 A;  1HJD A;  1AWJ A;  1SSH A;  1UFF A;  2EGC A;  4CC7 A;  2KE9 A;  2YUO A;  2I0N A;  1RI9 A;  3TSW A;  2JS0 A;  3EG3 A;  1NYF A;  1Y0M A;  2FEI A;  1X43 A;  4EIK A;  2YDL A;  3H0F A;  1QWE A;  2KEA A;  2J6F A;  1GBQ A;  2CT4 A;  1ZLM A;  2JXB A;  1VA7 A;  4CC3 A;  4ESR A;  2CDT A;  2PNI A;  1YNZ A;  1WA7 A;  2ROT A;  1T0J A;  1G2B A;  2DX1 A;  2JS2 A;  2EYY A;  1ZUK A;  2H8H A;  2JW4 A;  2OJ2 A;  1NG2 A;  1SHG A;  2G6F X;  4HCK A;  3VS4 A;  1PWT A;  2EVR A;  1PNJ A;  2KT8 A;  1NLO C;  1UJY A;  2FRW A;  2KRM A;  2NWM A;  2O31 A;  4J9D A;  2L3P A;  1ABO A;  1G83 A;  1YWP A;  1U06 A;  3VS6 A;  4JZ3 A;  4A63 B;  1WXT A;  1EFN A;  1UJ0 A;  4ZNX A;  2EYX A;  1V1C A;  2KXD A;  2PZ1 A;  1W70 A;  1YCS B;  3VRZ A;  1K1Z A;  1X2K A;  2LJ1 A;  3VS7 A;  2O9V A;  2GQI A;  5IHK A;  2NUZ A;  2D1X A;  2CUD A;  2KT1 A;  4OMQ A;  4AG1 C;  3M0R A;  2EQI A;  2M0Y A;  4F14 A;  1JO8 A;  1MV3 A;  3EGU A;  2FO0 A;  5I22 A;  4LUE A;  2EKH A;  4HVV A;  5L23 A;  1H92 A;  1H8K A;  4LNP A;  3M0T A;  4HXJ A;  2GGR A;  2SRC A;  2ABL A;  3A98 A;  1WYX A;  1UUE A;  1CKA A;  2RN8 A;  1B3Q A;  2HCK A;  2JTE A;  1K4U S;  2FRY A;  4AFU C;  1YP5 A;  2KR3 A;  3NGP A;  3UAT A;  1RUW A;  1QKW A;  1WLP B;  1AZE A;  1QCF A;  2RQR A;  2DIL A;  1E6H A;  3VS1 A;  2RMO A;  4F16 A;  1WXU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...