5IHNA

Crystal structure of the alpha spectrin sh3 domain mutant n47g
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
KELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVGDRQGFVPAAYVKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, non-erythrocytic 1
publication title Crystal Structure of the alpha spectrin SH3 domain mutant N47G
rcsb
source organism Gallus gallus
molecule tags Structural protein
total genus 12
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5ihnA00
1AWXA 2YUPA 3EG1A 3VRYA 5FWBA 2K79A 2DM1A 4QT7A 1OV3A 2L3SA 1AWJA 5IHIA 3TSZA 3A98A 1IO6A 2O31A 1ZUKA 2X3WD 2J06A 4J9IA 2DF6A 1CKAA 1M3CA 1T0HA 1WXUA 1MUZA 1X69A 4R0KA 4OMOA 4J9EA 2QDLA 2EBPA 3TSWA 2DL8A 2MCNA 1X2QA 1K4US 2RMOA 2M0YA 1B07A 1JXMA 1J3TA 1HD3A 4LN2A 1JXOA 2LP5A 2J6FA 3H0FA 2JS2A 3I5SA 1KSWA 1H8KA 3I5RA 5IHNA 5ECAA 1GRIA 2PNIA 1UTIA 1S1NA 4AFZC 2HSPA 3C0CA 1AVZC 2KYMA 2HDAA 4ZNXA 1K0SA 1M8MA 1OPLA 2GTOA 2GTJA 3EG3A 2AZSA 3REBB 1K0XA 2B86A 1VA7A 3PVQA 1WFWA 5IHKA 3ULRB 1NEBA 3KFVA 1M30A 2DL7A 4OMNA 1VYTA 2W0ZA 2F2XA 1NYFA 3RNJA 1E6GA 2BZYA 1K76A 1G2BA 2LCSA 2C0IA 2CSIA 1JQQA 1SHFA 2DBKA 1T0JA 1M3BA 2ENMA 2FPDA 2RNAA 1TUCA 1Z9ZA 2EYYA 2I0NA 2D1XA 4DEYA 1Y0MA 2O9SA 2LJ3A 3M0UA 3UF4A 2K7AA 1NM7A 2ED0A 1GCQA 1JO8A 4J9FA 1RLQC 2F2WA 5I11A 2C0TA 2DE0X 2FPFA 1YWPA 4RTWA 3VS0A 1WLPB 2A28A 2DLPA 2AZVA 2KRNA 2A08A 2FRYA 1K9AA 1YNZA 2VKNA 3UA7A 2CH4A 1PWTA 1UUEA 2OI3A 4HVVA 4JPBW 1BBZA 1UDLA 1AD5A 2GQIA 2K3BA 1YWOA 2JS0A 1ZLMA 2VVKA 4J9BA 4D8KA 1W70A 2JW4A 2CH4W 2KRSA 2LZ6B 2ESWA 2JMCA 3QWXX 4Z8AA 1WDXA 2K2MA 1GBQA 1YCSB 2H8HA 2KROA 1KJWA 1FMKA 3EGUA 4X1VA 4LE9A 3VS2A 4AG2C 1LCKA 1M3AA 3ZL7C 1CKBA 1CSKA 1SRLA 1JU5C 2RQRA 1X6GA 1BK2A 3TVTA 1RI9A 2CT4A 3VS7A 3LH5A 2EGAA 4OMMA 3M0RA 1E6HA 4GBQA 2FRWA 2KR3A 4RUGA 1FYNA 2A36A 5IH2A 4F17A 1ZSGA 3THKA 4FSSA 1UHFA 2KYBA 1AZGB 1UJYA 2HCKA 3NMZC 3REAB 1HSQA 4OMLA 4AFQC 2FEIA 4Z88A 4LUEA 4RTVA 1BB9A 2RF0A 2DL5A 4AFUC 1AWOA 2KEAA 3EHRA 4HVWA 1UFFA 3VRZA 1RUWA 2CT3A 2L2PA 1AEYA 1RLPC 2A37A 4LUDA 4AG1C 2DBMA 2RQVA 4CC7A 2YUOA 3VS3A 2RQUA 1U3OA 2LX7A 2GNCA 4Z89A 1BU1A 3VS5A 1V1CA 2JXBA 4D8DA 3NHNA 3VS4A 1WI7A 2J7IA 4WCIA 2YUQA 1G83A 1N5ZA 2W10A 2YDLA 3M0SA 2AK5A 4CC3A 1WXBA 2KT1A 4JZ3A 1SSHA 1X27A 4RTZA 3SEMA 2DX1A 1ABOA 2O88A 5FWCA 2KT8A 4F16A 1PKTA 1QWFA 1Y57A 1SPKA 2GBQA 1PHTA 1QLYA 1PNJA 2DILA 1WIEA 2ECZA 4IIOA 2EW3A 1XOVA 2BZ8A 1NYGA 2HBWA 2X3XD 3UATA 3M0PA 5IXBA 1MV3A 2EVRA 2MOXA 1E7OA 4RTUA 4HCKA 2DVJA 3SHWA 1MV0B 2AKLA 2P4RA 4F14A 3H0IA 1ZUUA 2ED1A 1EFNA 2EPDA 2L3PA 1ABQA 3CQTA 2KE9A 4J9CA 1WYXA 2D0NA 5IXFA 2D8JA 4OMQA 2JTEA 1X43A 1I07A 1UGVA 2E5KA 4HXJA 2D8HA 2NWMA 2V1RA 3QWYA 4RTXA 1GCQC 3U23A 4AFSC 2YT6A 2CSQA 2DMOA 2EYXA 4E6RA 1JEGA 3VS6A 4JJDA 1YP5A 1AZEA 1HJDA 1H92A 4J9HA 2KBTA 2KXCA 2EQIA 1PKSA 3PVLA 1PRLC 2NUZA 3H0HA 4RTYA 2BZXA 2C0OA 3H41A 2LNHB 2LQNA 2DRKA 5HCKA 1GL5A 2G6FX 2JMAA 3EHQA 1PRMC 2SRCA 2DA9A 1SRMA 1OOTA 1U5SA 2O2OA 2O9VA 1OPKA 2FO0A 3NPFA 1NLPC 1X2KA 4CC4B 1VYVA 2KGTA 3R6NA 1TUDA 2EYZA 2V1QA 3O5ZA 4CC2A 1UECA 2DL4A 2IIMA 4RTTA 3I9QA 4GLMA 2OJ2A 3I35A 1TG0A 1SHGA 1H3HA 2KNBB 2JM9A 1I0CA 1GBRA 4J9GA 3PE0A 1ZBJA 4JJCA 1ZX6A 1ZUYA 2EKHA 1GCPA 1AOJA 1U06A 2ROLA 2DRMA 3M0QA 4IIMA 2CDTA 2JM8A 2RN8A 4M4ZA 1YN8A 2J6OA 2L0AA 2LJ1A 2RPNA 2VWFA 1KIKA 4JZ4A 2DJQA 1WX6A 3UA6A 2KXDA 2J6KA 5GJVB 4DEXA 4HVUA 5FW9A 1K1ZA 2L3QA 1OEBA 1I1JA 5I22A 2EGCA 2OAWA 1Z9QA 2PZ1A 3NGPA 2JT4A 1B3QA 2CUDA 3EG2A 2XMFA 2DNUA 1QKWA 2ABLA 2K9GA 4K11A 1T3SA 2K6DA 4J9DA 2J05A 3GBQA 5EC7A 2F2VA 1X6BA 2LJ0A 1W1FA 2PTKA 2EYWA 5L23A 2FPEA 4KRTA 2FG0A 4A63B 1WXTA 2EGEA 4Y92A 2DL3A 3RBBB 1UHCA 3IQLA 3FJ5A 2M51A 2DYBA 2HEQA 4LNPA 2LQWA 1AWWA 1W6XA 1KFZA 1GFDA 4ORZA 2YSQA 2RQWA 4EIKA 1UE9A 1QWEA 1GFCA 1NLOC 3EG0A 1NG2A 1QCFA 2BTTA 5GJWB 1SEMA 2ROTA 3JV3A 2SEMA 1UG1A 3M0TA 2KRMA 2CREA 1UJ0A 4OMPA 3VS1A 1QKXA 4ESRA 2CUBA 1NEGA 2YUNA 1M27C 4JJBA 2LMJA 2AKKA 2RQTA 1A0NB 1ARKA 1WA7A 1VYUA 1T3LA 2MIOA 2GGRA
chains in the Genus database with same CATH superfamily
1AWXA 2CP0A 4C0GA 3D7SB 5FU7C 5FWBA 4OB3B 4HT9A 3RKYA 5J26A 4J6YA 4QT7A 3TSZA 4TVRA 4M7AD 2O31A 3EH1A 2J06A 4J9IA 3PFSA 3S6WA 1YITT 1X6OA 4QVZA 1D09B 3X25B 4M77C 2F5KA 3TSWA 1BKBA 2FZGB 3INZA 2ZPHB 1D1CA 4XTWA 1F1BB 3OYEA 2JS2A 3I5SA 4OP0A 1FXXA 1I8FA 2EKOA 3I5RA 5ECAA 2PNIA 2RK2A 1UTIA 1NJIU 4BE0A 5GAOr 2DZ9A 3EG9B 5FROA 4C92D 4GLKA 4Y28E 5D6WA 2DD4A 1JJ2S 2X35A 2JNGA 3PVQA 3CCRA 5KCOA 3KXTA 1QP3A 2DL7A 4XU1A 4EDUA 3OW2P 1NYFA 1YCYA 2KMTA 5KYXB 3JCMe 3OYBA 4M78D 5LJ5j 5GAMj 1SHFA 1VUBA 1T0JA 2P84A 4KH0B 1IHWA 4XAXB 2EYYA 2I0NA 1G3YA 3OYGA 1WJSA 3PGGA 3M0UA 1X75C 2JOYA 3M9QA 3DB4A 1IB8A 2COWA 3GNGA 4B9WA 2CGHA 1YI2Q 2KVQG 4JRIA 2Y4YA 1YHQQ 2MYSA 1G5VA 4RTWA 3T9NA 2DLPA 5GAN3 2KRNA 4M7AB 1K9AA 2CH4A 2EYQA 2OI3A 3QYGB 4HVVA 4M7AF 1BBZA 2GQIA 2JS0A 1RABB 2VVKA 1FMWA 3CD6Q 1W70A 3SDZA 1Q81R 3M4YA 2ESWA 3QWXX 1KG1A 1D0YA 1RADB 4Z8AA 1WDXA 2H8HA 3MPUB 2M16A 2B8AA 4M7DG 2F69A 4LE9A 1M3AA 3ZL7C 2FB7A 3CPWP 1CKBA 1CSKA 4ZGJB 2QA4A 1Q7YU 1OX9A 1JU5C 3FEOA 2CT4A 5LJ3g 2EGAA 3PMIA 5GAMh 1WGSA 4C92B 2DFUA 1N8RU 4M7DE 2QQSA 4RUGA 4NS5A 1RI0A 2CP7A 3THKA 3M54A 1UHFA 1AZGB 2RK1A 3EFOA 4OMLA 1Y07A 4M78B 4Z88A 1WHHA 2QG9B 1BB9A 2RF0A 1VQ5Q 4PJOA 1KHIA 1ZQ1A 3EHRA 3MP6A 3FIFA 5LJ3e 4HCZA 2L2PA 3CCLA 4UC4A 3I55A 4OGEA 4IUTA 2DBMA 2HL3A 3V8KA 1XTDA 3JCMf 1YI2T 4FCYA 2J7IA 4P5NA 1YHQT 4PL6A 2YUQA 3CCVT 2AK5A 2CKKA 1LJOA 1P92A 1WXBA 5KYYA 2O88A 2KK4A 3I56Q 2GQVA 4ME7A 1Y57A 1C6VX 1PHTA 2LQKA 5KYWB 1BCOA 2QEXA 1QVGP 1WIEA 2ECZA 2IPOB 3F70A 3L2WA 3CCMQ 1NYGA 4M77D 1YJ9A 3J80E 2MOXA 1E7OA 2X4JA 4FW2A 3SHWA 2P4RA 1R77A 4F14A 1ZUUA 4ZTJA 5CKEA 4QQ6A 2LT1A 3CCST 2KE9A 2YLBA 4J9CA 2D0NA 1Q95G 4OMQA 2JTEA 4HXJA 1K9MR 2D8HA 4RTXA 1RAHB 4M7AG 3NTKA 2DMOA 4E6RA 4JJDA 1YP5A 3M53A 2R57A 4PFPA 1H92A 1Y96A 5KYNA 4DQ2A 2KBTA 4FYYB 2CYZB 2RB6A 2E1HA 3PVLA 2RHYA 2XI9A 3BDUA 1ZSZC 2BZXA 1VQKQ 4PLIA 2CP5A 2LNHB 5I2SA 3VUBA 2LQNA 1VQ5T 2DRKA 2XIDA 3A8MB 4FM4B 4BDYA 4M7AE 3G7ZA 1GL5A 2EFIA 4MZMA 2G6FX 3VYHB 2JMAA 5LL6S 5LJ5g 1PRMC 4J6WA 4PFZA 1SRMA 4C92G 3Q1JA 3V8JA 2DIGA 2O2OA 4PKCC 2ATCB 2O9VA 4EMKB 1VQLQ 2HMAA 3KBGA 1KQSP 2H3EB 5IN1A 1NLPC 4CC4B 5FU7B 5KE3A 3JB9F 5LJ3f 3O5ZA 2F5TX 4GLMA 4M78G 3I56T 2DVEA 1VQ7Q 1I0CA 1PD1A 4C92E 4J9GA 5LJ5e 1ZBJA 4JJCA 3ASKA 3G6EQ 1M90R 2X4WA 5A0GA 4M77B 2QGFB 3M0QA 4M77F 2CDTA 2JM8A 2RN8A 1YN8A 1M5Q1 1TTHB 4CRIA 2LJ1A 3AT1B 4M78E 2DJQA 1WX6A 2KXDA 5GJVB 3WXMB 2MF2A 3QJYA 3EGXA 2K5FA 3OYKA 2MMPA 4B9XA 2OTLQ 2VGMA 1D3BA 1QVFA 5I22A 1D0ZA 2EGCA 1Z9QA 4RCBA 2JT4A 1B34A 2CZ0B 4X34A 2XMFA 2DNUA 1DJ7B 3OS0A 4OGCA 1G8XA 2XDPA 1W4SA 4Q5WA 4PFOA 1KC8R 4J5YA 4N4IA 1SSFA 2LJ0A 3QXEB 2PTKA 3HFNA 3WVDB 2EYWA 4BI4A 5GMKl 3JRZA 2FG0A 1WXTA 2EGEA 4Y92A 1UHCA 1YIJT 2DYIA 4EMGA 3RMQA 1W6XA 2NUTA 4ORZA 2YSQA 2RQWA 4DBQA 3C95A 2VASA 1UE9A 1QWEA 1GFCA 1IGQA 1VQLT 1QCFA 4M7DA 3V7SA 5DLOA 2LCLA 4JLIA 3C94A 3JV3A 3CBMA 1VQ9Q 1I5LA 3UWNA 2ZGWA 3QHSA 2E41A 4ESRA 3EAEA 1VQ7T 3OBYA 3SWNA 2CZ1B 4C92C 3JCMJ 3QZ5B 3G6ET 1TUGB 1KQSS 1WA7A 1IRXA 1WHKA 3GLXA 3WVEB 4RG8A 1B7TA 2WSEE 3EG1A 3VRYA 2RI3A 2EAYA 1K73R 3HFOA 2C06A 4F04B 2O4XB 1OV3A 4M78C 3JB9G 2P0PA 1IO6A 5KCHA 5LJ5f 1NE8A 3CCEQ 1ZUKA 1MHNA 1PC0A 1CKAA 1T0HA 2NUPA 1YJNA 3EFSA 1YI2A 4R0KA 2CZ6B 4J9EA 3S3NA 3EG9A 2RHZA 2E64A 2QDLA 1YHQA 3N5BB 3CCVA 2MCNA 3FC3A 1X2QA 1K4US 3S3OA 5FRMA 5GMKm 3JCMh 1N9RA 1ZHIA 1M9SA 4M77G 1HD3A 2O01E 2LP5A 3H0FA 1KD1U 2QGGA 1JB0E 1KSWA 1H8KA 2KQWA 1Q82R 3UT1A 5KYXA 3AHUA 1D1AA 4PNOA 1S1NA 2L3RA 2V8IA 5I2MA 2HSPA 3CC4T 1K0SA 1M8MA 1YJWQ 1OPLA 4HA8A 5L8RE 3REBB 1K0XA 4FW1A 1TOVA 1XQHA 4M77E 4PJJA 2Y4XA 5GAN4 3FRNA 4QQGA 1JJ2P 2M1HA 3CCSA 2W0ZA 2F2XA 3RNJA 2PUKB 3M5AA 2BZYA 4OVAA 1K76A 5LJ3j 2AHJB 2LCSA 2C0IA 4E7ZA 2P0QA 1VQ9T 1BCMA 4O5VA 3CCUT 4MDWA 2ENMA 3CPFA 2RNAA 3ZFJA 5DLQE 1OU8A 3S3MA 3NFCA 2D1XA 4M7AA 1MNDA 1TU0B 2O9SA 4PJLA 3UF4A 3URGA 2P4TA 2ED0A 1GCQA 2A7YA 5C0MA 2Y90A 4ZGDB 3CC2T 1VQ5A 1RL2A 5CKHA 2DE0X 2FPFA 3VS0A 3LYIA 1Q81C 3OYHA 1IGUA 5GAMd 4J83A 5GMKe 1VQOQ 4R56A 2E3IA 3UA7A 3RR6A 2M9UA 4JPBW 4NOYA 2WSCE 1QCOA 2HD0A 5HK3A 1HK9A 2MWPA 3OS1A 4FYWB 2LZ6B 4KBMB 4QVCA 3PTAA 4M7DF 1YCSB 3CCJA 1KJWA 4QW2A 4EMKC 3EGUA 3VS2A 1LNXA 3G71T 1ZSZB 3I56A 1UB4A 5HY6A 1WHLA 4N0AA 1X6GA 2L8DA 2RJEA 3JCMP 3QG1A 5LJ3h 1QVFS 2K5LA 2YLCA 4C5GA 2DK3A 3GOXA 4GBQA 2OTJQ 1YJWT 2FRWA 1AT1B 3A8OB 4F17A 2PU9B 2KYBA 3OYCA 1NJIR 4KUIA 1M2VB 3TCJA 3JCMg 2RA2A 4LUEA 1BI2A 4RTVA 1VOMA 3QDFA 1OULA 2DL5A 1FWZA 5FU6B 1AWOA 4LDWA 2XHCA 3DLLA 3L2ZA 1RUWA 3O8VA 2RQVA 2PQWA 1C1AA 4JRKA 1WHJA 2GNCA 2JTFA 4Z89A 1BU1A 2KY9A 2E6ZA 2JXBA 2MPXC 3ER0A 1WI7A 2YWWA 4L5GA 2RJCA 3GIBA 1N5ZA 2YDLA 4ELYC 3M0SA 3H9NA 1YIJA 4CC3A 2KT1A 1X27A 4RTZA 2DX1A 1ABOA 1PKTA 2QQBA 2XU8A 1U8RA 1VQLA 1I4K1 1PNJA 4IIOA 2EW3A 2X3XD 2RD1A 5AT1B 4F7UB 3CMAQ 5IXBA 1MV3A 2E6NA 1OQKA 4F7UF 4RTUA 4E7KA 4HCKA 4OB0B 2K5IA 5CIUA 3HRTA 2AKLA 4M75B 1JRIA 1VQ7A 2L3PA 2ZAEA 1ABQA 3E9GA 3CQTA 2HKQB 4E7HA 3A5ZB 1KQ2A 1PG5B 3UDCA 3G6EA 9ATCB 1QP2A 4A4KA 2NWMA 2EIFA 3CMEQ 2CSQA 3R6OA 1RAAB 1Q7YR 2EYXA 1Q86C 2RI2A 4O6JA 5CQYA 1PSFA 3PIOA 4RCCA 3PT9A 2LNVA 2M02A 3UPUA 4MZPA 4RTYA 1N8RR 1LPLA 3OA6A 4Y91A 3JCMQ 3LGLA 5GMKi 3CC7Q 3DLMA 5LJ5h 3QIIA 3OSVA 1IZ6A 3H8ZA 5HK0A 1OOTA 4C92F 1OPKA 1S72Q 3PNWC 4BD3A 5GANe 3JCMc 3L2VA 4M77A 4ZN1A 1V29B 4BI8B 3CC4A 1VYVA 3R6NA 1M90C 2EYZA 1EZZB 4IUPA 2DL4A 4M78F 1M1KC 2OJ2A 3I35A 2JZ2A 1SHGA 1H3HA 2FZCB 2PVGB 1GBRA 1ZX6A 1VQMQ 1SG5A 1AOJA 1G3TA 3G4SQ 3CMAT 4C8QC 3ME9A 1VQ9A 5GAOq 3CCUA 2DAQA 2HZYA 5J3BA 3EGDA 2L0AA 2K57A 4ELZC 1KIKA 4JZ4A 3LW5E 3OYJA 2KSSA 1KK7A 4HVUA 2GFUA 4J7FA 2L3QA 1OEBA 1WJQA 4DA4A 7AT1B 1I1JA 2OAWA 1ZBXA 3CMET 3CC2A 4R55A 3CD6T 3EFRA 2CUDA 3EG2A 5KH6A 2JJ9A 2QQRA 5A0LA 1WNLA 1W2BA 2ABLA 4K11A 3RMSA 2R5AA 3V7CA 4F7UG 4KGXB 2RJFA 2F2VA 1W1FA 2EJ9A 1U1TA 3HHTB 4KRTA 2ZCFB 1VQPQ 2DL3A 4CI0C 3GNFB 4E7LA 3RBBB 3CC7T 3IQLA 3FJ5A 2DYBA 1M1GA 4LNPA 5FLXE 2V26A 3OB9A 4IUQA 2HNIA 3G71A 3FDRA 3QUIA 2DTHA 4F7UE 1S72T 5GJWB 1SEMA 2OAUA 1WHMA 1SF9A 3A8HB 1K8AC 1C0MA 2SEMA 3M0TA 4XTVA 2CREA 2QTXA 4OMPA 3VS1A 1YJWA 1YITA 1TS9A 1UEBA 1NEGA 4BUGA 5GAOp 1NPPA 4A4GA 2AKKA 3HRUA 4IUUA 5GANf 1A0NB 1R0BG 1RAEB 1VQMT 1UGPB 3VYGA 3META 2GGRA 1EFNA 5GMKj 2QASA 2HSEB 3LWHA 2DM1A 4RG2A 2L3SA 2DTIA 5KE2A 1AWJA 5IHIA 3A98A 4JS4A 1TH7A 4FT4A 2X3WD 4GY5A 5FU6C 4LXCA 2DXBA 1BI1A 5AYFA 2XDDA 1MMGA 5CO7A 1Q86U 1X69A 3J81E 2YHTA 4E47A 1H641 1Y71A 1WQ7A 2DEQA 2EBPA 2L5QA 3CCMT 2DTOA 2M0YA 1W2BP 1N9SA 4DOWA 3MP8A 4LN2A 1JXOA 2HQXA 5IAYA 5IHNA 1QVPA 1GRIA 2LDMA 1VQPT 1MMDA 8AT1B 1VIFA 3C0CA 1AVZC 2KYMA 2HDAA 4XQ3A 1PM3A 2GTOA 2GTJA 3EFOB 3EG3A 1VA7A 5GAOn 3LGFA 3M57A 3X24B 2EQMA 3ULRB 2AT1B 4OMNA 1KHCA 1VYTA 3FB9A 1M4ZA 2FZKB 2QYZA 1G2BA 5CKBA 3L2RA 2CSIA 5CQXA 1JQQA 5GMKh 3A1PA 2H3JA 4M75C 2FL7A 4Z02A 1VQKT 2QA4Q 1M1KU 1TUCA 1Z9ZA 2QQAA 3CCQQ 1Y0MA 2QK0A 4EPCA 2LJ3A 4E7SA 2KAFA 1VQ4Q 3RKWA 1NM7A 3P8HA 1JO8A 4QQDA 1UGQB 4C8QD 3GP8A 3SB2A 3OYNA 4LDXA 1I81A 5KYUB 2QI2A 2DJZA 5D7UA 2C0TA 1G3SA 1YWPA 2V8KA 1NZ9A 4J7IA 2A28A 5LJ3d 4XU3A 2QXFA 4JDSA 3RIRA 2AZVA 2RHUA 2Z0WA 2A08A 2K3XA 1ZSZA 3CXCA 1PWTA 1UUEA 2CP6A 4BY6B 1VQ6Q 1UDLA 2XK0A 2K3BA 4FYVB 4HT8A 1YWOA 3BY7A 3LLRA 3CCLQ 5IT9E 3OYDA 2K2MA 2KROA 1FMKA 4X1VA 2XG8D 4AG2C 4A4FA 5GAN2 1LCKA 4BE2A 1SRLA 4BI3A 3OYMA 1M2VA 2VC8A 1HXDA 3TVTA 1RI9A 2XICA 1NJIC 4OMMA 3HTRA 2LT4A 3M0RA 1Y96B 2E3HA 4C5EA 1RAGB 2OTLT 1KD1R 4BB7A 1FYNA 2A36A 4BE1A 1QVFP 1OYXA 3MEVA 1ZSGA 3QZ9B 2QEXQ 2RM4A 1W2BS 4FSSA 4D6WA 4C0DC 4ANJA 4KT0E 3NMZC 3REAB 2D9TA 1M2OA 1K8AU 4AFQC 2E12A 5M9OA 4BDZA 2HKNA 3CMEA 2RH2A 4HVWA 2BE9B 4L59A 3CD6A 3VRZA 3CCQT 4OB2B 5GANj 1RLPC 4XU0A 4JS5A 4FIBA 4CC7A 1VQ4T 3VS3A 3DB3A 2OX7A 2RQUA 4C8QB 2LX7A 4C8QF 2P0KA 3NHNA 4D8DA 4F7UA 4II1A 4WCIA 3CC7A 1G83A 3E1SA 3M4GA 3MKDA 1SSHA 3SEMA 3VKIA 3CEYA 2XKOC 1VQNA 1VQ6T 4IKFA 1QWFA 5FRNA 4FYXB 1SPKA 2GBQA 2VB6A 4A4EA 1QLYA 1S72A 4NL3A 2DILA 4LDUA 3OYAA 2DEUA 1XOVA 2IG0A 2BZ8A 3UATA 2BKDN 3M0PA 3L1AA 2K4YA 2EVRA 1XNIA 1MGQA 2VXEA 3EGXB 3MHXA 1QQJA 1EIFA 1D3BB 3C4SA 3GPLA 3DKMA 2LQ8A 2ZPEB 4A54A 5LJ5d 1B34B 1WYXA 1ZA1B 5IXFA 2D8JA 3E19A 2PUOB 1I07A 2HBPA 4XTXA 4PJNA 2V1RA 3QWYA 3CCET 2F1LA 3U23A 2E65A 4AFSC 1N8RC 2CZ7B 1OZ2A 3BW1A 2EQUA 2X4XA 2MWOA 2LVMA 2ZPGB 1WJRA 3CBPA 1JEGA 1SKUB 1HJDA 1AZEA 3SFMA 5GANh 3MCAB 3OW2A 3QDRB 4C92A 2QTVA 2XDBA 2PVDB 1PD0A 2KXCA 2EQIA 4E7JA 4E7IA 3OYYA 1PRLC 3LX7A 2NUZA 2C0OA 3H41A 2R5MA 4M75D 3JSCA 4YTLA 2IVWA 3TQ7P 4M78A 4ZTFA 2XD0A 2A3LA 3SD4A 3EHQA 3CCMA 1IXDA 2RHIA 2VYTA 4BACA 1VIEA 2YXYA 1MNEA 1U5SA 3HP9A 5GAN5 2AIRB 1LVKA 3L2QA 2FO0A 5DM7R 1BIBA 3JCMb 4ATOA 1VQPA 2X4YA 2COYA 2KGTA 2V1QA 3SWNB 3OSSC 4OF1A 4JJNK 4RTTA 3QSUA 3X28B 2ZZDA 1TG0A 2G3RA 2JM9A 1YBYA 3PE0A 3TEEA 1GCPA 2DKGA 3BE3A 3OBWA 1GXIE 4IIMA 1TWBA 3MEWA 5KYWA 3CPWA 4M4ZA 3PIPA 2JN0A 3OY9A 1VQKA 4PJOC 2EJFA 3JB9I 4C8QG 1TXQA 2LCCA 4WTOB 2RPNA 2VWFA 3HRSA 4C5IA 2NUPB 4JRPA 3CXCS 3UA6A 5FW9A 5HKCA 1BI3A 3LWIA 2KDSA 3RESA 2BIVA 1VQOT 3JCMW 3VV0A 3E9FA 4FT2A 1R8OB 3JB9J 1O9SA 3OYLA 1OX8A 1QKWA 4JLGA 4C8QE 4J8OA 1KQ1A 1K9MC 2J05A 3JAME 3H6ZA 4KH1B 2RO0A 2QDYB 4M75F 3QO3A 3HSBA 3MEUA 4BY6C 1AWWA 1KFZA 1GFDA 2OTJT 1YFNA 1YJNQ 2HQHA 1NLOC 2LC4A 3EG0A 1BYMA 5GANg 3E2UA 1FMVA 2BTTA 2E70A 2DPPB 4MZTA 2ROTA 3G1JA 3CCVQ 1Y7XA 1IHVA 1UG1A 4EMHA 3TU4K 4EMKA 4KGZB 2OTLA 1VQ8Q 1QVGA 2YUNA 3CBOA 4RKUE 1OI1A 4A4HA 3QPHA 4PK4A 1M1FA 2ZPBB 3OYFA 5D6YA 1ARKA 4FU6A 1VYUA 2K3YA 2MIOA 3A8LB 2YUPA 2K79A 4LDVA 1X01A 3CCSQ 2L89A 4VUBA 1Q81U 3CCQA 2ZPIB 1VQ4A 3EH2A 2DF6A 4RMOA 4KGVB 1M3CA 3HL8A 1WXUA 1RAFB 1MUZA 1WQWA 2EWNA 5J39A 4OMOA 3MJXA 5CVIA 2DL8A 1QW1A 4C0DB 2RMOA 3OQ5A 1B07A 3GF5A 1JXMA 1M8VA 2FYKA 1J3TA 1TSFA 2J6FA 1VQ6A 4XU2A 2ZPFB 2DZCA 3L42A 4AFZC 2HL5C 4ZNXA 3NTIA 3JB9H 5CAIA 2AZSA 3OW2S 2B86A 3P8BB 5CCAA 1KC8C 1KQSA 1YJNT 1FX7A 1WFWA 5IHKA 3JB9D 3QJ6A 1NEBA 3KFVA 1M30A 4DBFA 4NL2A 4MDXA 4LD6A 2CP3A 1E6GA 3CCJQ 4LD9K 3M59A 3TREA 4C0ZA 2DBKA 5KYUA 3CCEA 1VQNQ 1M3BA 2FPDA 2RI5A 2E10A 1VQ8T 2DO3A 3JCMV 4M75G 4DEYA 4XTYA 2JUFA 1N6AA 3FJPA 2GFAA 1OZ3A 4QKUA 2K7AA 1D0XA 2DXUA 4J9FA 1IREB 1RLQC 2F2WA 2JTMA 5I11A 2DXTA 1JBMA 4PJOD 1WLPB 5DY9A 2DD5A 5GAOl 1H3ZA 2FRYA 1YNZA 4M75E 2VKNA 3BDLA 2WACA 1AD5A 2O4XA 4A53A 4WF2A 5C6SA 1ZLMA 4M7DC 2VGNA 4J9BA 4D8KA 1K73C 2COZA 2JW4A 2CH4W 2KRSA 4J6XA 2JMCA 3PMTA 3CPWS 2NYSA 1GBQA 3JCMd 2BUDA 4B6MA 3G4ST 1K9MU 3CCRQ 2EQJA 1KD1C 1Q86R 2RQRA 2X9HA 2DETA 3NTHA 5GAN6 1BK2A 3SWNC 3VS7A 3LH5A 1YIJQ 1U1SA 1R0CB 5GAMg 5GAN8 1E6HA 4HKEA 1RAIB 2RHXA 2KR3A 2FVUA 5IH2A 1D1BA 1QMCA 1Q82C 2E5QA 1UJYA 2HCKA 3ZEHA 2CS7A 4L6V5 1HSQA 3RKXA 4X9DA 2FEIA 4C8QA 4HCBA 3CCJT 1VQOA 3HKSA 1VQNT 3VU3C 4AFUC 5CK9A 2KEAA 1UFFA 2DIQA 4N4GA 5GAMe 4XTUA 2CT3A 1AEYA 3OYIA 4OMFB 1BI0A 2A37A 4LUDA 4AG1C 2YUOA 1M1KR 1U3OA 5GAOm 3P8DA 3VS5A 1V1CA 1UGSB 3VS4A 4PJOB 2PVOB 1MMNA 2W10A 1WPYA 1PCXA 4PJOF 4JZ3A 4X9CA 1M90U 1QVGS 2LTOA 3ZBDA 3J7AF 5FWCA 2OTJA 4FSXA 4C5HA 2KT8A 4F16A 3FLGA 3OMGA 5GANd 4PJMA 3EGDB 2HBWA 5D6XA 1V76A 5CKDA 2DVJA 3CCRT 1MV0B 1OU9A 5KYYB 4N4HA 2DXCA 3QKJA 3H0IA 2E4HA 2ED1A 4DBHA 2EPDA 6AT1B 2V8JA 4ZN3A 2QQ9A 4M7AC 3OS2A 2MAMA 3CC4Q 1X43A 1UGVA 2E5KA 2D6FA 4IURA 1GCQC 2YT6A 4FL6A 4MMKA 4E2FB 4C0FA 1KC8U 2LX9A 3VS6A 1JJ2A 1I5OB 2GF7A 4J9HA 2K2VA 1XJWB 3I55Q 1NPRA 2BE7D 4MMLA 1AHJB 1PKSA 3C12A 3H0HA 2YRCA 2M0OA 3MO8A 1NBEB 3CCUQ 1PSEA 3QYHB 1UGRB 5HCKA 2MI6A 1WHGA 4DBRA 2SRCA 1K8AR 3RUXA 4HCCA 2DA9A 3CMAA 3V8LA 1LOJA 1EX4A 3CC2Q 4XTZA 2I2LA 3NPFA 4N0AC 1RACB 1X2KA 1YJ9Q 2RJDA 2VXFA 1QCNA 1TUDA 4CC2A 1UECA 5GAMf 2IIMA 2YRDA 3I9QA 5A2QE 2MK5A 2VUBA 3OMCA 3RDVA 2QA4T 2KNBB 2R58A 3RERA 2VV5A 5CKFA 1K73U 3OS5A 4M7DD 2EJGA 3VUZA 2GCXA 1ZUYA 2EKHA 4AT1B 1U06A 5CR2A 2ROLA 2DRMA 4PLLA 4ZGEB 3G71Q 2EQKA 8ATCB 2J6OA 1VQ8A 3MEAA 4AMCA 1HYOA 2J6KA 4DEXA 4PJOG 3JCMX 2NLUA 3BFMA 1K1ZA 2HAXA 1BIAA 4JRQA 1YITQ 1O75A 4M75A 5A0DA 4QVDA 3CXCP 4OB1B 2PZ1A 3NGPA 2YRVA 2QAZA 1B3QA 1Q82U 1G3WA 3CCLT 2K9GA 3I55T 1T3SA 4XK8E 2K6DA 4J9DA 1ZA2B 3A8GB 1N27A 3GBQA 2X51A 5EC7A 4PJOE 3MP1A 4IUVA 2CP2A 4JUVA 1Q7YC 3X26B 1X6BA 5L23A 2FPEA 4A63B 4KUDK 4DOVA 2HQEA 2M51A 1VQMA 2HEQA 2LQWA 4V2SA 3G4SA 2WSFE 4EIKA 2JVVA 3L2UA 3V7RA 3LH0A 3M56A 1NG2A 2QEXT 3X20B 2A0FB 3M55A 1YJ9T 3VJPA 4KULA 2KRMA 1UJ0A 3QBYA 1ACMB 1QKXA 3KUFA 5I21A 2CUBA 1MMAA 2NUTB 2LRQA 5EG2A 1M27C 4JJBA 2DERA 2LMJA 2KI7A 2RQTA 4LDYA 4M7DB 3M58A 2FHDA 1WZOA 1T3LA 5GAN7 3HPWA 2D0QB
chains in the Genus database with same CATH topology
1AWXA 2YUPA 3EG1A 3VRYA 5FWBA 2K79A 2DM1A 4QT7A 1OV3A 2L3SA 1AWJA 5IHIA 3TSZA 3A98A 1IO6A 2O31A 1ZUKA 2X3WD 2J06A 4J9IA 2DF6A 1CKAA 1M3CA 1T0HA 1WXUA 1MUZA 1X69A 4R0KA 4OMOA 4J9EA 2QDLA 2EBPA 3TSWA 2DL8A 2MCNA 1X2QA 1K4US 2RMOA 2M0YA 1B07A 1JXMA 1J3TA 1HD3A 4LN2A 1JXOA 2LP5A 2J6FA 3H0FA 2JS2A 3I5SA 1KSWA 1H8KA 3I5RA 5IHNA 5ECAA 1GRIA 2PNIA 1UTIA 1S1NA 4AFZC 2HSPA 3C0CA 1AVZC 2KYMA 2HDAA 4ZNXA 1K0SA 1M8MA 1OPLA 2GTOA 2GTJA 3EG3A 2AZSA 3REBB 1K0XA 2B86A 1VA7A 3PVQA 1WFWA 5IHKA 3ULRB 1NEBA 3KFVA 1M30A 2DL7A 4OMNA 1VYTA 2W0ZA 2F2XA 1NYFA 3RNJA 1E6GA 2BZYA 1K76A 1G2BA 2LCSA 2C0IA 2CSIA 1JQQA 1SHFA 2DBKA 1T0JA 1M3BA 2ENMA 2FPDA 2RNAA 1TUCA 1Z9ZA 2EYYA 2I0NA 2D1XA 4DEYA 1Y0MA 2O9SA 2LJ3A 3M0UA 3UF4A 2K7AA 1NM7A 2ED0A 1GCQA 1JO8A 4J9FA 1RLQC 2F2WA 5I11A 2C0TA 2DE0X 2FPFA 1YWPA 4RTWA 3VS0A 1WLPB 2A28A 2DLPA 2AZVA 2KRNA 2A08A 2FRYA 1K9AA 1YNZA 2VKNA 3UA7A 2CH4A 1PWTA 1UUEA 2OI3A 4HVVA 4JPBW 1BBZA 1UDLA 1AD5A 2GQIA 2K3BA 1YWOA 2JS0A 1ZLMA 2VVKA 4J9BA 4D8KA 1W70A 2JW4A 2CH4W 2KRSA 2LZ6B 2ESWA 2JMCA 3QWXX 4Z8AA 1WDXA 2K2MA 1GBQA 1YCSB 2H8HA 2KROA 1KJWA 1FMKA 3EGUA 4X1VA 4LE9A 3VS2A 4AG2C 1LCKA 1M3AA 3ZL7C 1CKBA 1CSKA 1SRLA 1JU5C 2RQRA 1X6GA 1BK2A 3TVTA 1RI9A 2CT4A 3VS7A 3LH5A 2EGAA 4OMMA 3M0RA 1E6HA 4GBQA 2FRWA 2KR3A 4RUGA 1FYNA 2A36A 5IH2A 4F17A 1ZSGA 3THKA 4FSSA 1UHFA 2KYBA 1AZGB 1UJYA 2HCKA 3NMZC 3REAB 1HSQA 4OMLA 4AFQC 2FEIA 4Z88A 4LUEA 4RTVA 1BB9A 2RF0A 2DL5A 4AFUC 1AWOA 2KEAA 3EHRA 4HVWA 1UFFA 3VRZA 1RUWA 2CT3A 2L2PA 1AEYA 1RLPC 2A37A 4LUDA 4AG1C 2DBMA 2RQVA 4CC7A 2YUOA 3VS3A 2RQUA 1U3OA 2LX7A 2GNCA 4Z89A 1BU1A 3VS5A 1V1CA 2JXBA 4D8DA 3NHNA 3VS4A 1WI7A 2J7IA 4WCIA 2YUQA 1G83A 1N5ZA 2W10A 2YDLA 3M0SA 2AK5A 4CC3A 1WXBA 2KT1A 4JZ3A 1SSHA 1X27A 4RTZA 3SEMA 2DX1A 1ABOA 2O88A 5FWCA 2KT8A 4F16A 1PKTA 1QWFA 1Y57A 1SPKA 2GBQA 1PHTA 1QLYA 1PNJA 2DILA 1WIEA 2ECZA 4IIOA 2EW3A 1XOVA 2BZ8A 1NYGA 2HBWA 2X3XD 3UATA 3M0PA 5IXBA 1MV3A 2EVRA 2MOXA 1E7OA 4RTUA 4HCKA 2DVJA 3SHWA 1MV0B 2AKLA 2P4RA 4F14A 3H0IA 1ZUUA 2ED1A 1EFNA 2EPDA 2L3PA 1ABQA 3CQTA 2KE9A 4J9CA 1WYXA 2D0NA 5IXFA 2D8JA 4OMQA 2JTEA 1X43A 1I07A 1UGVA 2E5KA 4HXJA 2D8HA 2NWMA 2V1RA 3QWYA 4RTXA 1GCQC 3U23A 4AFSC 2YT6A 2CSQA 2DMOA 2EYXA 4E6RA 1JEGA 3VS6A 4JJDA 1YP5A 1AZEA 1HJDA 1H92A 4J9HA 2KBTA 2KXCA 2EQIA 1PKSA 3PVLA 1PRLC 2NUZA 3H0HA 4RTYA 2BZXA 2C0OA 3H41A 2LNHB 2LQNA 2DRKA 5HCKA 1GL5A 2G6FX 2JMAA 3EHQA 1PRMC 2SRCA 2DA9A 1SRMA 1OOTA 1U5SA 2O2OA 2O9VA 1OPKA 2FO0A 3NPFA 1NLPC 1X2KA 4CC4B 1VYVA 2KGTA 3R6NA 1TUDA 2EYZA 2V1QA 3O5ZA 4CC2A 1UECA 2DL4A 2IIMA 4RTTA 3I9QA 4GLMA 2OJ2A 3I35A 1TG0A 1SHGA 1H3HA 2KNBB 2JM9A 1I0CA 1GBRA 4J9GA 3PE0A 1ZBJA 4JJCA 1ZX6A 1ZUYA 2EKHA 1GCPA 1AOJA 1U06A 2ROLA 2DRMA 3M0QA 4IIMA 2CDTA 2JM8A 2RN8A 4M4ZA 1YN8A 2J6OA 2L0AA 2LJ1A 2RPNA 2VWFA 1KIKA 4JZ4A 2DJQA 1WX6A 3UA6A 2KXDA 2J6KA 5GJVB 4DEXA 4HVUA 5FW9A 1K1ZA 2L3QA 1OEBA 1I1JA 5I22A 2EGCA 2OAWA 1Z9QA 2PZ1A 3NGPA 2JT4A 1B3QA 2CUDA 3EG2A 2XMFA 2DNUA 1QKWA 2ABLA 2K9GA 4K11A 1T3SA 2K6DA 4J9DA 2J05A 3GBQA 5EC7A 2F2VA 1X6BA 2LJ0A 1W1FA 2PTKA 2EYWA 5L23A 2FPEA 4KRTA 2FG0A 4A63B 1WXTA 2EGEA 4Y92A 2DL3A 3RBBB 1UHCA 3IQLA 3FJ5A 2M51A 2DYBA 2HEQA 4LNPA 2LQWA 1AWWA 1W6XA 1KFZA 1GFDA 4ORZA 2YSQA 2RQWA 4EIKA 1UE9A 1QWEA 1GFCA 1NLOC 3EG0A 1NG2A 1QCFA 2BTTA 5GJWB 1SEMA 2ROTA 3JV3A 2SEMA 1UG1A 3M0TA 2KRMA 2CREA 1UJ0A 4OMPA 3VS1A 1QKXA 4ESRA 2CUBA 1NEGA 2YUNA 1M27C 4JJBA 2LMJA 2AKKA 2RQTA 1A0NB 1ARKA 1WA7A 1VYUA 1T3LA 2MIOA 2GGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWX A;  2YUP A;  3EG1 A;  3VRY A;  5FWB A;  2K79 A;  2DM1 A;  4QT7 A;  1OV3 A;  2L3S A;  1AWJ A;  5IHI A;  3TSZ A;  3A98 A;  1IO6 A;  2O31 A;  1ZUK A;  2X3W D;  2J06 A;  4J9I A;  2DF6 A;  1CKA A;  1M3C A;  1T0H A;  1WXU A;  1MUZ A;  1X69 A;  4R0K A;  4OMO A;  4J9E A;  2QDL A;  2EBP A;  3TSW A;  2DL8 A;  2MCN A;  1X2Q A;  1K4U S;  2RMO A;  2M0Y A;  1B07 A;  1JXM A;  1J3T A;  1HD3 A;  4LN2 A;  1JXO A;  2LP5 A;  2J6F A;  3H0F A;  2JS2 A;  3I5S A;  1KSW A;  1H8K A;  3I5R A;  5IHN A;  5ECA A;  1GRI A;  2PNI A;  1UTI A;  1S1N A;  4AFZ C;  2HSP A;  3C0C A;  1AVZ C;  2KYM A;  2HDA A;  4ZNX A;  1K0S A;  1M8M A;  1OPL A;  2GTO A;  2GTJ A;  3EG3 A;  2AZS A;  3REB B;  1K0X A;  2B86 A;  1VA7 A;  3PVQ A;  1WFW A;  5IHK A;  3ULR B;  1NEB A;  3KFV A;  1M30 A;  2DL7 A;  4OMN A;  1VYT A;  2W0Z A;  2F2X A;  1NYF A;  3RNJ A;  1E6G A;  2BZY A;  1K76 A;  1G2B A;  2LCS A;  2C0I A;  2CSI A;  1JQQ A;  1SHF A;  2DBK A;  1T0J A;  1M3B A;  2ENM A;  2FPD A;  2RNA A;  1TUC A;  1Z9Z A;  2EYY A;  2I0N A;  2D1X A;  4DEY A;  1Y0M A;  2O9S A;  2LJ3 A;  3M0U A;  3UF4 A;  2K7A A;  1NM7 A;  2ED0 A;  1GCQ A;  1JO8 A;  4J9F A;  1RLQ C;  2F2W A;  5I11 A;  2C0T A;  2DE0 X;  2FPF A;  1YWP A;  4RTW A;  3VS0 A;  1WLP B;  2A28 A;  2DLP A;  2AZV A;  2KRN A;  2A08 A;  2FRY A;  1K9A A;  1YNZ A;  2VKN A;  3UA7 A;  2CH4 A;  1PWT A;  1UUE A;  2OI3 A;  4HVV A;  4JPB W;  1BBZ A;  1UDL A;  1AD5 A;  2GQI A;  2K3B A;  1YWO A;  2JS0 A;  1ZLM A;  2VVK A;  4J9B A;  4D8K A;  1W70 A;  2JW4 A;  2CH4 W;  2KRS A;  2LZ6 B;  2ESW A;  2JMC A;  3QWX X;  4Z8A A;  1WDX A;  2K2M A;  1GBQ A;  1YCS B;  2H8H A;  2KRO A;  1KJW A;  1FMK A;  3EGU A;  4X1V A;  4LE9 A;  3VS2 A;  4AG2 C;  1LCK A;  1M3A A;  3ZL7 C;  1CKB A;  1CSK A;  1SRL A;  1JU5 C;  2RQR A;  1X6G A;  1BK2 A;  3TVT A;  1RI9 A;  2CT4 A;  3VS7 A;  3LH5 A;  2EGA A;  4OMM A;  3M0R A;  1E6H A;  4GBQ A;  2FRW A;  2KR3 A;  4RUG A;  1FYN A;  2A36 A;  5IH2 A;  4F17 A;  1ZSG A;  3THK A;  4FSS A;  1UHF A;  2KYB A;  1AZG B;  1UJY A;  2HCK A;  3NMZ C;  3REA B;  1HSQ A;  4OML A;  4AFQ C;  2FEI A;  4Z88 A;  4LUE A;  4RTV A;  1BB9 A;  2RF0 A;  2DL5 A;  4AFU C;  1AWO A;  2KEA A;  3EHR A;  4HVW A;  1UFF A;  3VRZ A;  1RUW A;  2CT3 A;  2L2P A;  1AEY A;  1RLP C;  2A37 A;  4LUD A;  4AG1 C;  2DBM A;  2RQV A;  4CC7 A;  2YUO A;  3VS3 A;  2RQU A;  1U3O A;  2LX7 A;  2GNC A;  4Z89 A;  1BU1 A;  3VS5 A;  1V1C A;  2JXB A;  4D8D A;  3NHN A;  3VS4 A;  1WI7 A;  2J7I A;  4WCI A;  2YUQ A;  1G83 A;  1N5Z A;  2W10 A;  2YDL A;  3M0S A;  2AK5 A;  4CC3 A;  1WXB A;  2KT1 A;  4JZ3 A;  1SSH A;  1X27 A;  4RTZ A;  3SEM A;  2DX1 A;  1ABO A;  2O88 A;  5FWC A;  2KT8 A;  4F16 A;  1PKT A;  1QWF A;  1Y57 A;  1SPK A;  2GBQ A;  1PHT A;  1QLY A;  1PNJ A;  2DIL A;  1WIE A;  2ECZ A;  4IIO A;  2EW3 A;  1XOV A;  2BZ8 A;  1NYG A;  2HBW A;  2X3X D;  3UAT A;  3M0P A;  5IXB A;  1MV3 A;  2EVR A;  2MOX A;  1E7O A;  4RTU A;  4HCK A;  2DVJ A;  3SHW A;  1MV0 B;  2AKL A;  2P4R A;  4F14 A;  3H0I A;  1ZUU A;  2ED1 A;  1EFN A;  2EPD A;  2L3P A;  1ABQ A;  3CQT A;  2KE9 A;  4J9C A;  1WYX A;  2D0N A;  5IXF A;  2D8J A;  4OMQ A;  2JTE A;  1X43 A;  1I07 A;  1UGV A;  2E5K A;  4HXJ A;  2D8H A;  2NWM A;  2V1R A;  3QWY A;  4RTX A;  1GCQ C;  3U23 A;  4AFS C;  2YT6 A;  2CSQ A;  2DMO A;  2EYX A;  4E6R A;  1JEG A;  3VS6 A;  4JJD A;  1YP5 A;  1AZE A;  1HJD A;  1H92 A;  4J9H A;  2KBT A;  2KXC A;  2EQI A;  1PKS A;  3PVL A;  1PRL C;  2NUZ A;  3H0H A;  4RTY A;  2BZX A;  2C0O A;  3H41 A;  2LNH B;  2LQN A;  2DRK A;  5HCK A;  1GL5 A;  2G6F X;  2JMA A;  3EHQ A;  1PRM C;  2SRC A;  2DA9 A;  1SRM A;  1OOT A;  1U5S A;  2O2O A;  2O9V A;  1OPK A;  2FO0 A;  3NPF A;  1NLP C;  1X2K A;  4CC4 B;  1VYV A;  2KGT A;  3R6N A;  1TUD A;  2EYZ A;  2V1Q A;  3O5Z A;  4CC2 A;  1UEC A;  2DL4 A;  2IIM A;  4RTT A;  3I9Q A;  4GLM A;  2OJ2 A;  3I35 A;  1TG0 A;  1SHG A;  1H3H A;  2KNB B;  2JM9 A;  1I0C A;  1GBR A;  4J9G A;  3PE0 A;  1ZBJ A;  4JJC A;  1ZX6 A;  1ZUY A;  2EKH A;  1GCP A;  1AOJ A;  1U06 A;  2ROL A;  2DRM A;  3M0Q A;  4IIM A;  2CDT A;  2JM8 A;  2RN8 A;  4M4Z A;  1YN8 A;  2J6O A;  2L0A A;  2LJ1 A;  2RPN A;  2VWF A;  1KIK A;  4JZ4 A;  2DJQ A;  1WX6 A;  3UA6 A;  2KXD A;  2J6K A;  5GJV B;  4DEX A;  4HVU A;  5FW9 A;  1K1Z A;  2L3Q A;  1OEB A;  1I1J A;  5I22 A;  2EGC A;  2OAW A;  1Z9Q A;  2PZ1 A;  3NGP A;  2JT4 A;  1B3Q A;  2CUD A;  3EG2 A;  2XMF A;  2DNU A;  1QKW A;  2ABL A;  2K9G A;  4K11 A;  1T3S A;  2K6D A;  4J9D A;  2J05 A;  3GBQ A;  5EC7 A;  2F2V A;  1X6B A;  2LJ0 A;  1W1F A;  2PTK A;  2EYW A;  5L23 A;  2FPE A;  4KRT A;  2FG0 A;  4A63 B;  1WXT A;  2EGE A;  4Y92 A;  2DL3 A;  3RBB B;  1UHC A;  3IQL A;  3FJ5 A;  2M51 A;  2DYB A;  2HEQ A;  4LNP A;  2LQW A;  1AWW A;  1W6X A;  1KFZ A;  1GFD A;  4ORZ A;  2YSQ A;  2RQW A;  4EIK A;  1UE9 A;  1QWE A;  1GFC A;  1NLO C;  3EG0 A;  1NG2 A;  1QCF A;  2BTT A;  5GJW B;  1SEM A;  2ROT A;  3JV3 A;  2SEM A;  1UG1 A;  3M0T A;  2KRM A;  2CRE A;  1UJ0 A;  4OMP A;  3VS1 A;  1QKX A;  4ESR A;  2CUB A;  1NEG A;  2YUN A;  1M27 C;  4JJB A;  2LMJ A;  2AKK A;  2RQT A;  1A0N B;  1ARK A;  1WA7 A;  1VYU A;  1T3L A;  2MIO A;  2GGR A; 
#chains in the Genus database with same CATH topology
 1AWX A;  2CP0 A;  4C0G A;  3D7S B;  5FU7 C;  5FWB A;  4OB3 B;  4HT9 A;  3RKY A;  5J26 A;  4J6Y A;  4QT7 A;  3TSZ A;  4TVR A;  4M7A D;  2O31 A;  3EH1 A;  2J06 A;  4J9I A;  3PFS A;  3S6W A;  1YIT T;  1X6O A;  4QVZ A;  1D09 B;  3X25 B;  4M77 C;  2F5K A;  3TSW A;  1BKB A;  2FZG B;  3INZ A;  2ZPH B;  1D1C A;  4XTW A;  1F1B B;  3OYE A;  2JS2 A;  3I5S A;  4OP0 A;  1FXX A;  1I8F A;  2EKO A;  3I5R A;  5ECA A;  2PNI A;  2RK2 A;  1UTI A;  1NJI U;  4BE0 A;  5GAO r;  2DZ9 A;  3EG9 B;  5FRO A;  4C92 D;  4GLK A;  4Y28 E;  5D6W A;  2DD4 A;  1JJ2 S;  2X35 A;  2JNG A;  3PVQ A;  3CCR A;  5KCO A;  3KXT A;  1QP3 A;  2DL7 A;  4XU1 A;  4EDU A;  3OW2 P;  1NYF A;  1YCY A;  2KMT A;  5KYX B;  3JCM e;  3OYB A;  4M78 D;  5LJ5 j;  5GAM j;  1SHF A;  1VUB A;  1T0J A;  2P84 A;  4KH0 B;  1IHW A;  4XAX B;  2EYY A;  2I0N A;  1G3Y A;  3OYG A;  1WJS A;  3PGG A;  3M0U A;  1X75 C;  2JOY A;  3M9Q A;  3DB4 A;  1IB8 A;  2COW A;  3GNG A;  4B9W A;  2CGH A;  1YI2 Q;  2KVQ G;  4JRI A;  2Y4Y A;  1YHQ Q;  2MYS A;  1G5V A;  4RTW A;  3T9N A;  2DLP A;  5GAN 3;  2KRN A;  4M7A B;  1K9A A;  2CH4 A;  2EYQ A;  2OI3 A;  3QYG B;  4HVV A;  4M7A F;  1BBZ A;  2GQI A;  2JS0 A;  1RAB B;  2VVK A;  1FMW A;  3CD6 Q;  1W70 A;  3SDZ A;  1Q81 R;  3M4Y A;  2ESW A;  3QWX X;  1KG1 A;  1D0Y A;  1RAD B;  4Z8A A;  1WDX A;  2H8H A;  3MPU B;  2M16 A;  2B8A A;  4M7D G;  2F69 A;  4LE9 A;  1M3A A;  3ZL7 C;  2FB7 A;  3CPW P;  1CKB A;  1CSK A;  4ZGJ B;  2QA4 A;  1Q7Y U;  1OX9 A;  1JU5 C;  3FEO A;  2CT4 A;  5LJ3 g;  2EGA A;  3PMI A;  5GAM h;  1WGS A;  4C92 B;  2DFU A;  1N8R U;  4M7D E;  2QQS A;  4RUG A;  4NS5 A;  1RI0 A;  2CP7 A;  3THK A;  3M54 A;  1UHF A;  1AZG B;  2RK1 A;  3EFO A;  4OML A;  1Y07 A;  4M78 B;  4Z88 A;  1WHH A;  2QG9 B;  1BB9 A;  2RF0 A;  1VQ5 Q;  4PJO A;  1KHI A;  1ZQ1 A;  3EHR A;  3MP6 A;  3FIF A;  5LJ3 e;  4HCZ A;  2L2P A;  3CCL A;  4UC4 A;  3I55 A;  4OGE A;  4IUT A;  2DBM A;  2HL3 A;  3V8K A;  1XTD A;  3JCM f;  1YI2 T;  4FCY A;  2J7I A;  4P5N A;  1YHQ T;  4PL6 A;  2YUQ A;  3CCV T;  2AK5 A;  2CKK A;  1LJO A;  1P92 A;  1WXB A;  5KYY A;  2O88 A;  2KK4 A;  3I56 Q;  2GQV A;  4ME7 A;  1Y57 A;  1C6V X;  1PHT A;  2LQK A;  5KYW B;  1BCO A;  2QEX A;  1QVG P;  1WIE A;  2ECZ A;  2IPO B;  3F70 A;  3L2W A;  3CCM Q;  1NYG A;  4M77 D;  1YJ9 A;  3J80 E;  2MOX A;  1E7O A;  2X4J A;  4FW2 A;  3SHW A;  2P4R A;  1R77 A;  4F14 A;  1ZUU A;  4ZTJ A;  5CKE A;  4QQ6 A;  2LT1 A;  3CCS T;  2KE9 A;  2YLB A;  4J9C A;  2D0N A;  1Q95 G;  4OMQ A;  2JTE A;  4HXJ A;  1K9M R;  2D8H A;  4RTX A;  1RAH B;  4M7A G;  3NTK A;  2DMO A;  4E6R A;  4JJD A;  1YP5 A;  3M53 A;  2R57 A;  4PFP A;  1H92 A;  1Y96 A;  5KYN A;  4DQ2 A;  2KBT A;  4FYY B;  2CYZ B;  2RB6 A;  2E1H A;  3PVL A;  2RHY A;  2XI9 A;  3BDU A;  1ZSZ C;  2BZX A;  1VQK Q;  4PLI A;  2CP5 A;  2LNH B;  5I2S A;  3VUB A;  2LQN A;  1VQ5 T;  2DRK A;  2XID A;  3A8M B;  4FM4 B;  4BDY A;  4M7A E;  3G7Z A;  1GL5 A;  2EFI A;  4MZM A;  2G6F X;  3VYH B;  2JMA A;  5LL6 S;  5LJ5 g;  1PRM C;  4J6W A;  4PFZ A;  1SRM A;  4C92 G;  3Q1J A;  3V8J A;  2DIG A;  2O2O A;  4PKC C;  2ATC B;  2O9V A;  4EMK B;  1VQL Q;  2HMA A;  3KBG A;  1KQS P;  2H3E B;  5IN1 A;  1NLP C;  4CC4 B;  5FU7 B;  5KE3 A;  3JB9 F;  5LJ3 f;  3O5Z A;  2F5T X;  4GLM A;  4M78 G;  3I56 T;  2DVE A;  1VQ7 Q;  1I0C A;  1PD1 A;  4C92 E;  4J9G A;  5LJ5 e;  1ZBJ A;  4JJC A;  3ASK A;  3G6E Q;  1M90 R;  2X4W A;  5A0G A;  4M77 B;  2QGF B;  3M0Q A;  4M77 F;  2CDT A;  2JM8 A;  2RN8 A;  1YN8 A;  1M5Q 1;  1TTH B;  4CRI A;  2LJ1 A;  3AT1 B;  4M78 E;  2DJQ A;  1WX6 A;  2KXD A;  5GJV B;  3WXM B;  2MF2 A;  3QJY A;  3EGX A;  2K5F A;  3OYK A;  2MMP A;  4B9X A;  2OTL Q;  2VGM A;  1D3B A;  1QVF A;  5I22 A;  1D0Z A;  2EGC A;  1Z9Q A;  4RCB A;  2JT4 A;  1B34 A;  2CZ0 B;  4X34 A;  2XMF A;  2DNU A;  1DJ7 B;  3OS0 A;  4OGC A;  1G8X A;  2XDP A;  1W4S A;  4Q5W A;  4PFO A;  1KC8 R;  4J5Y A;  4N4I A;  1SSF A;  2LJ0 A;  3QXE B;  2PTK A;  3HFN A;  3WVD B;  2EYW A;  4BI4 A;  5GMK l;  3JRZ A;  2FG0 A;  1WXT A;  2EGE A;  4Y92 A;  1UHC A;  1YIJ T;  2DYI A;  4EMG A;  3RMQ A;  1W6X A;  2NUT A;  4ORZ A;  2YSQ A;  2RQW A;  4DBQ A;  3C95 A;  2VAS A;  1UE9 A;  1QWE A;  1GFC A;  1IGQ A;  1VQL T;  1QCF A;  4M7D A;  3V7S A;  5DLO A;  2LCL A;  4JLI A;  3C94 A;  3JV3 A;  3CBM A;  1VQ9 Q;  1I5L A;  3UWN A;  2ZGW A;  3QHS A;  2E41 A;  4ESR A;  3EAE A;  1VQ7 T;  3OBY A;  3SWN A;  2CZ1 B;  4C92 C;  3JCM J;  3QZ5 B;  3G6E T;  1TUG B;  1KQS S;  1WA7 A;  1IRX A;  1WHK A;  3GLX A;  3WVE B;  4RG8 A;  1B7T A;  2WSE E;  3EG1 A;  3VRY A;  2RI3 A;  2EAY A;  1K73 R;  3HFO A;  2C06 A;  4F04 B;  2O4X B;  1OV3 A;  4M78 C;  3JB9 G;  2P0P A;  1IO6 A;  5KCH A;  5LJ5 f;  1NE8 A;  3CCE Q;  1ZUK A;  1MHN A;  1PC0 A;  1CKA A;  1T0H A;  2NUP A;  1YJN A;  3EFS A;  1YI2 A;  4R0K A;  2CZ6 B;  4J9E A;  3S3N A;  3EG9 A;  2RHZ A;  2E64 A;  2QDL A;  1YHQ A;  3N5B B;  3CCV A;  2MCN A;  3FC3 A;  1X2Q A;  1K4U S;  3S3O A;  5FRM A;  5GMK m;  3JCM h;  1N9R A;  1ZHI A;  1M9S A;  4M77 G;  1HD3 A;  2O01 E;  2LP5 A;  3H0F A;  1KD1 U;  2QGG A;  1JB0 E;  1KSW A;  1H8K A;  2KQW A;  1Q82 R;  3UT1 A;  5KYX A;  3AHU A;  1D1A A;  4PNO A;  1S1N A;  2L3R A;  2V8I A;  5I2M A;  2HSP A;  3CC4 T;  1K0S A;  1M8M A;  1YJW Q;  1OPL A;  4HA8 A;  5L8R E;  3REB B;  1K0X A;  4FW1 A;  1TOV A;  1XQH A;  4M77 E;  4PJJ A;  2Y4X A;  5GAN 4;  3FRN A;  4QQG A;  1JJ2 P;  2M1H A;  3CCS A;  2W0Z A;  2F2X A;  3RNJ A;  2PUK B;  3M5A A;  2BZY A;  4OVA A;  1K76 A;  5LJ3 j;  2AHJ B;  2LCS A;  2C0I A;  4E7Z A;  2P0Q A;  1VQ9 T;  1BCM A;  4O5V A;  3CCU T;  4MDW A;  2ENM A;  3CPF A;  2RNA A;  3ZFJ A;  5DLQ E;  1OU8 A;  3S3M A;  3NFC A;  2D1X A;  4M7A A;  1MND A;  1TU0 B;  2O9S A;  4PJL A;  3UF4 A;  3URG A;  2P4T A;  2ED0 A;  1GCQ A;  2A7Y A;  5C0M A;  2Y90 A;  4ZGD B;  3CC2 T;  1VQ5 A;  1RL2 A;  5CKH A;  2DE0 X;  2FPF A;  3VS0 A;  3LYI A;  1Q81 C;  3OYH A;  1IGU A;  5GAM d;  4J83 A;  5GMK e;  1VQO Q;  4R56 A;  2E3I A;  3UA7 A;  3RR6 A;  2M9U A;  4JPB W;  4NOY A;  2WSC E;  1QCO A;  2HD0 A;  5HK3 A;  1HK9 A;  2MWP A;  3OS1 A;  4FYW B;  2LZ6 B;  4KBM B;  4QVC A;  3PTA A;  4M7D F;  1YCS B;  3CCJ A;  1KJW A;  4QW2 A;  4EMK C;  3EGU A;  3VS2 A;  1LNX A;  3G71 T;  1ZSZ B;  3I56 A;  1UB4 A;  5HY6 A;  1WHL A;  4N0A A;  1X6G A;  2L8D A;  2RJE A;  3JCM P;  3QG1 A;  5LJ3 h;  1QVF S;  2K5L A;  2YLC A;  4C5G A;  2DK3 A;  3GOX A;  4GBQ A;  2OTJ Q;  1YJW T;  2FRW A;  1AT1 B;  3A8O B;  4F17 A;  2PU9 B;  2KYB A;  3OYC A;  1NJI R;  4KUI A;  1M2V B;  3TCJ A;  3JCM g;  2RA2 A;  4LUE A;  1BI2 A;  4RTV A;  1VOM A;  3QDF A;  1OUL A;  2DL5 A;  1FWZ A;  5FU6 B;  1AWO A;  4LDW A;  2XHC A;  3DLL A;  3L2Z A;  1RUW A;  3O8V A;  2RQV A;  2PQW A;  1C1A A;  4JRK A;  1WHJ A;  2GNC A;  2JTF A;  4Z89 A;  1BU1 A;  2KY9 A;  2E6Z A;  2JXB A;  2MPX C;  3ER0 A;  1WI7 A;  2YWW A;  4L5G A;  2RJC A;  3GIB A;  1N5Z A;  2YDL A;  4ELY C;  3M0S A;  3H9N A;  1YIJ A;  4CC3 A;  2KT1 A;  1X27 A;  4RTZ A;  2DX1 A;  1ABO A;  1PKT A;  2QQB A;  2XU8 A;  1U8R A;  1VQL A;  1I4K 1;  1PNJ A;  4IIO A;  2EW3 A;  2X3X D;  2RD1 A;  5AT1 B;  4F7U B;  3CMA Q;  5IXB A;  1MV3 A;  2E6N A;  1OQK A;  4F7U F;  4RTU A;  4E7K A;  4HCK A;  4OB0 B;  2K5I A;  5CIU A;  3HRT A;  2AKL A;  4M75 B;  1JRI A;  1VQ7 A;  2L3P A;  2ZAE A;  1ABQ A;  3E9G A;  3CQT A;  2HKQ B;  4E7H A;  3A5Z B;  1KQ2 A;  1PG5 B;  3UDC A;  3G6E A;  9ATC B;  1QP2 A;  4A4K A;  2NWM A;  2EIF A;  3CME Q;  2CSQ A;  3R6O A;  1RAA B;  1Q7Y R;  2EYX A;  1Q86 C;  2RI2 A;  4O6J A;  5CQY A;  1PSF A;  3PIO A;  4RCC A;  3PT9 A;  2LNV A;  2M02 A;  3UPU A;  4MZP A;  4RTY A;  1N8R R;  1LPL A;  3OA6 A;  4Y91 A;  3JCM Q;  3LGL A;  5GMK i;  3CC7 Q;  3DLM A;  5LJ5 h;  3QII A;  3OSV A;  1IZ6 A;  3H8Z A;  5HK0 A;  1OOT A;  4C92 F;  1OPK A;  1S72 Q;  3PNW C;  4BD3 A;  5GAN e;  3JCM c;  3L2V A;  4M77 A;  4ZN1 A;  1V29 B;  4BI8 B;  3CC4 A;  1VYV A;  3R6N A;  1M90 C;  2EYZ A;  1EZZ B;  4IUP A;  2DL4 A;  4M78 F;  1M1K C;  2OJ2 A;  3I35 A;  2JZ2 A;  1SHG A;  1H3H A;  2FZC B;  2PVG B;  1GBR A;  1ZX6 A;  1VQM Q;  1SG5 A;  1AOJ A;  1G3T A;  3G4S Q;  3CMA T;  4C8Q C;  3ME9 A;  1VQ9 A;  5GAO q;  3CCU A;  2DAQ A;  2HZY A;  5J3B A;  3EGD A;  2L0A A;  2K57 A;  4ELZ C;  1KIK A;  4JZ4 A;  3LW5 E;  3OYJ A;  2KSS A;  1KK7 A;  4HVU A;  2GFU A;  4J7F A;  2L3Q A;  1OEB A;  1WJQ A;  4DA4 A;  7AT1 B;  1I1J A;  2OAW A;  1ZBX A;  3CME T;  3CC2 A;  4R55 A;  3CD6 T;  3EFR A;  2CUD A;  3EG2 A;  5KH6 A;  2JJ9 A;  2QQR A;  5A0L A;  1WNL A;  1W2B A;  2ABL A;  4K11 A;  3RMS A;  2R5A A;  3V7C A;  4F7U G;  4KGX B;  2RJF A;  2F2V A;  1W1F A;  2EJ9 A;  1U1T A;  3HHT B;  4KRT A;  2ZCF B;  1VQP Q;  2DL3 A;  4CI0 C;  3GNF B;  4E7L A;  3RBB B;  3CC7 T;  3IQL A;  3FJ5 A;  2DYB A;  1M1G A;  4LNP A;  5FLX E;  2V26 A;  3OB9 A;  4IUQ A;  2HNI A;  3G71 A;  3FDR A;  3QUI A;  2DTH A;  4F7U E;  1S72 T;  5GJW B;  1SEM A;  2OAU A;  1WHM A;  1SF9 A;  3A8H B;  1K8A C;  1C0M A;  2SEM A;  3M0T A;  4XTV A;  2CRE A;  2QTX A;  4OMP A;  3VS1 A;  1YJW A;  1YIT A;  1TS9 A;  1UEB A;  1NEG A;  4BUG A;  5GAO p;  1NPP A;  4A4G A;  2AKK A;  3HRU A;  4IUU A;  5GAN f;  1A0N B;  1R0B G;  1RAE B;  1VQM T;  1UGP B;  3VYG A;  3MET A;  2GGR A;  1EFN A;  5GMK j;  2QAS A;  2HSE B;  3LWH A;  2DM1 A;  4RG2 A;  2L3S A;  2DTI A;  5KE2 A;  1AWJ A;  5IHI A;  3A98 A;  4JS4 A;  1TH7 A;  4FT4 A;  2X3W D;  4GY5 A;  5FU6 C;  4LXC A;  2DXB A;  1BI1 A;  5AYF A;  2XDD A;  1MMG A;  5CO7 A;  1Q86 U;  1X69 A;  3J81 E;  2YHT A;  4E47 A;  1H64 1;  1Y71 A;  1WQ7 A;  2DEQ A;  2EBP A;  2L5Q A;  3CCM T;  2DTO A;  2M0Y A;  1W2B P;  1N9S A;  4DOW A;  3MP8 A;  4LN2 A;  1JXO A;  2HQX A;  5IAY A;  5IHN A;  1QVP A;  1GRI A;  2LDM A;  1VQP T;  1MMD A;  8AT1 B;  1VIF A;  3C0C A;  1AVZ C;  2KYM A;  2HDA A;  4XQ3 A;  1PM3 A;  2GTO A;  2GTJ A;  3EFO B;  3EG3 A;  1VA7 A;  5GAO n;  3LGF A;  3M57 A;  3X24 B;  2EQM A;  3ULR B;  2AT1 B;  4OMN A;  1KHC A;  1VYT A;  3FB9 A;  1M4Z A;  2FZK B;  2QYZ A;  1G2B A;  5CKB A;  3L2R A;  2CSI A;  5CQX A;  1JQQ A;  5GMK h;  3A1P A;  2H3J A;  4M75 C;  2FL7 A;  4Z02 A;  1VQK T;  2QA4 Q;  1M1K U;  1TUC A;  1Z9Z A;  2QQA A;  3CCQ Q;  1Y0M A;  2QK0 A;  4EPC A;  2LJ3 A;  4E7S A;  2KAF A;  1VQ4 Q;  3RKW A;  1NM7 A;  3P8H A;  1JO8 A;  4QQD A;  1UGQ B;  4C8Q D;  3GP8 A;  3SB2 A;  3OYN A;  4LDX A;  1I81 A;  5KYU B;  2QI2 A;  2DJZ A;  5D7U A;  2C0T A;  1G3S A;  1YWP A;  2V8K A;  1NZ9 A;  4J7I A;  2A28 A;  5LJ3 d;  4XU3 A;  2QXF A;  4JDS A;  3RIR A;  2AZV A;  2RHU A;  2Z0W A;  2A08 A;  2K3X A;  1ZSZ A;  3CXC A;  1PWT A;  1UUE A;  2CP6 A;  4BY6 B;  1VQ6 Q;  1UDL A;  2XK0 A;  2K3B A;  4FYV B;  4HT8 A;  1YWO A;  3BY7 A;  3LLR A;  3CCL Q;  5IT9 E;  3OYD A;  2K2M A;  2KRO A;  1FMK A;  4X1V A;  2XG8 D;  4AG2 C;  4A4F A;  5GAN 2;  1LCK A;  4BE2 A;  1SRL A;  4BI3 A;  3OYM A;  1M2V A;  2VC8 A;  1HXD A;  3TVT A;  1RI9 A;  2XIC A;  1NJI C;  4OMM A;  3HTR A;  2LT4 A;  3M0R A;  1Y96 B;  2E3H A;  4C5E A;  1RAG B;  2OTL T;  1KD1 R;  4BB7 A;  1FYN A;  2A36 A;  4BE1 A;  1QVF P;  1OYX A;  3MEV A;  1ZSG A;  3QZ9 B;  2QEX Q;  2RM4 A;  1W2B S;  4FSS A;  4D6W A;  4C0D C;  4ANJ A;  4KT0 E;  3NMZ C;  3REA B;  2D9T A;  1M2O A;  1K8A U;  4AFQ C;  2E12 A;  5M9O A;  4BDZ A;  2HKN A;  3CME A;  2RH2 A;  4HVW A;  2BE9 B;  4L59 A;  3CD6 A;  3VRZ A;  3CCQ T;  4OB2 B;  5GAN j;  1RLP C;  4XU0 A;  4JS5 A;  4FIB A;  4CC7 A;  1VQ4 T;  3VS3 A;  3DB3 A;  2OX7 A;  2RQU A;  4C8Q B;  2LX7 A;  4C8Q F;  2P0K A;  3NHN A;  4D8D A;  4F7U A;  4II1 A;  4WCI A;  3CC7 A;  1G83 A;  3E1S A;  3M4G A;  3MKD A;  1SSH A;  3SEM A;  3VKI A;  3CEY A;  2XKO C;  1VQN A;  1VQ6 T;  4IKF A;  1QWF A;  5FRN A;  4FYX B;  1SPK A;  2GBQ A;  2VB6 A;  4A4E A;  1QLY A;  1S72 A;  4NL3 A;  2DIL A;  4LDU A;  3OYA A;  2DEU A;  1XOV A;  2IG0 A;  2BZ8 A;  3UAT A;  2BKD N;  3M0P A;  3L1A A;  2K4Y A;  2EVR A;  1XNI A;  1MGQ A;  2VXE A;  3EGX B;  3MHX A;  1QQJ A;  1EIF A;  1D3B B;  3C4S A;  3GPL A;  3DKM A;  2LQ8 A;  2ZPE B;  4A54 A;  5LJ5 d;  1B34 B;  1WYX A;  1ZA1 B;  5IXF A;  2D8J A;  3E19 A;  2PUO B;  1I07 A;  2HBP A;  4XTX A;  4PJN A;  2V1R A;  3QWY A;  3CCE T;  2F1L A;  3U23 A;  2E65 A;  4AFS C;  1N8R C;  2CZ7 B;  1OZ2 A;  3BW1 A;  2EQU A;  2X4X A;  2MWO A;  2LVM A;  2ZPG B;  1WJR A;  3CBP A;  1JEG A;  1SKU B;  1HJD A;  1AZE A;  3SFM A;  5GAN h;  3MCA B;  3OW2 A;  3QDR B;  4C92 A;  2QTV A;  2XDB A;  2PVD B;  1PD0 A;  2KXC A;  2EQI A;  4E7J A;  4E7I A;  3OYY A;  1PRL C;  3LX7 A;  2NUZ A;  2C0O A;  3H41 A;  2R5M A;  4M75 D;  3JSC A;  4YTL A;  2IVW A;  3TQ7 P;  4M78 A;  4ZTF A;  2XD0 A;  2A3L A;  3SD4 A;  3EHQ A;  3CCM A;  1IXD A;  2RHI A;  2VYT A;  4BAC A;  1VIE A;  2YXY A;  1MNE A;  1U5S A;  3HP9 A;  5GAN 5;  2AIR B;  1LVK A;  3L2Q A;  2FO0 A;  5DM7 R;  1BIB A;  3JCM b;  4ATO A;  1VQP A;  2X4Y A;  2COY A;  2KGT A;  2V1Q A;  3SWN B;  3OSS C;  4OF1 A;  4JJN K;  4RTT A;  3QSU A;  3X28 B;  2ZZD A;  1TG0 A;  2G3R A;  2JM9 A;  1YBY A;  3PE0 A;  3TEE A;  1GCP A;  2DKG A;  3BE3 A;  3OBW A;  1GXI E;  4IIM A;  1TWB A;  3MEW A;  5KYW A;  3CPW A;  4M4Z A;  3PIP A;  2JN0 A;  3OY9 A;  1VQK A;  4PJO C;  2EJF A;  3JB9 I;  4C8Q G;  1TXQ A;  2LCC A;  4WTO B;  2RPN A;  2VWF A;  3HRS A;  4C5I A;  2NUP B;  4JRP A;  3CXC S;  3UA6 A;  5FW9 A;  5HKC A;  1BI3 A;  3LWI A;  2KDS A;  3RES A;  2BIV A;  1VQO T;  3JCM W;  3VV0 A;  3E9F A;  4FT2 A;  1R8O B;  3JB9 J;  1O9S A;  3OYL A;  1OX8 A;  1QKW A;  4JLG A;  4C8Q E;  4J8O A;  1KQ1 A;  1K9M C;  2J05 A;  3JAM E;  3H6Z A;  4KH1 B;  2RO0 A;  2QDY B;  4M75 F;  3QO3 A;  3HSB A;  3MEU A;  4BY6 C;  1AWW A;  1KFZ A;  1GFD A;  2OTJ T;  1YFN A;  1YJN Q;  2HQH A;  1NLO C;  2LC4 A;  3EG0 A;  1BYM A;  5GAN g;  3E2U A;  1FMV A;  2BTT A;  2E70 A;  2DPP B;  4MZT A;  2ROT A;  3G1J A;  3CCV Q;  1Y7X A;  1IHV A;  1UG1 A;  4EMH A;  3TU4 K;  4EMK A;  4KGZ B;  2OTL A;  1VQ8 Q;  1QVG A;  2YUN A;  3CBO A;  4RKU E;  1OI1 A;  4A4H A;  3QPH A;  4PK4 A;  1M1F A;  2ZPB B;  3OYF A;  5D6Y A;  1ARK A;  4FU6 A;  1VYU A;  2K3Y A;  2MIO A;  3A8L B;  2YUP A;  2K79 A;  4LDV A;  1X01 A;  3CCS Q;  2L89 A;  4VUB A;  1Q81 U;  3CCQ A;  2ZPI B;  1VQ4 A;  3EH2 A;  2DF6 A;  4RMO A;  4KGV B;  1M3C A;  3HL8 A;  1WXU A;  1RAF B;  1MUZ A;  1WQW A;  2EWN A;  5J39 A;  4OMO A;  3MJX A;  5CVI A;  2DL8 A;  1QW1 A;  4C0D B;  2RMO A;  3OQ5 A;  1B07 A;  3GF5 A;  1JXM A;  1M8V A;  2FYK A;  1J3T A;  1TSF A;  2J6F A;  1VQ6 A;  4XU2 A;  2ZPF B;  2DZC A;  3L42 A;  4AFZ C;  2HL5 C;  4ZNX A;  3NTI A;  3JB9 H;  5CAI A;  2AZS A;  3OW2 S;  2B86 A;  3P8B B;  5CCA A;  1KC8 C;  1KQS A;  1YJN T;  1FX7 A;  1WFW A;  5IHK A;  3JB9 D;  3QJ6 A;  1NEB A;  3KFV A;  1M30 A;  4DBF A;  4NL2 A;  4MDX A;  4LD6 A;  2CP3 A;  1E6G A;  3CCJ Q;  4LD9 K;  3M59 A;  3TRE A;  4C0Z A;  2DBK A;  5KYU A;  3CCE A;  1VQN Q;  1M3B A;  2FPD A;  2RI5 A;  2E10 A;  1VQ8 T;  2DO3 A;  3JCM V;  4M75 G;  4DEY A;  4XTY A;  2JUF A;  1N6A A;  3FJP A;  2GFA A;  1OZ3 A;  4QKU A;  2K7A A;  1D0X A;  2DXU A;  4J9F A;  1IRE B;  1RLQ C;  2F2W A;  2JTM A;  5I11 A;  2DXT A;  1JBM A;  4PJO D;  1WLP B;  5DY9 A;  2DD5 A;  5GAO l;  1H3Z A;  2FRY A;  1YNZ A;  4M75 E;  2VKN A;  3BDL A;  2WAC A;  1AD5 A;  2O4X A;  4A53 A;  4WF2 A;  5C6S A;  1ZLM A;  4M7D C;  2VGN A;  4J9B A;  4D8K A;  1K73 C;  2COZ A;  2JW4 A;  2CH4 W;  2KRS A;  4J6X A;  2JMC A;  3PMT A;  3CPW S;  2NYS A;  1GBQ A;  3JCM d;  2BUD A;  4B6M A;  3G4S T;  1K9M U;  3CCR Q;  2EQJ A;  1KD1 C;  1Q86 R;  2RQR A;  2X9H A;  2DET A;  3NTH A;  5GAN 6;  1BK2 A;  3SWN C;  3VS7 A;  3LH5 A;  1YIJ Q;  1U1S A;  1R0C B;  5GAM g;  5GAN 8;  1E6H A;  4HKE A;  1RAI B;  2RHX A;  2KR3 A;  2FVU A;  5IH2 A;  1D1B A;  1QMC A;  1Q82 C;  2E5Q A;  1UJY A;  2HCK A;  3ZEH A;  2CS7 A;  4L6V 5;  1HSQ A;  3RKX A;  4X9D A;  2FEI A;  4C8Q A;  4HCB A;  3CCJ T;  1VQO A;  3HKS A;  1VQN T;  3VU3 C;  4AFU C;  5CK9 A;  2KEA A;  1UFF A;  2DIQ A;  4N4G A;  5GAM e;  4XTU A;  2CT3 A;  1AEY A;  3OYI A;  4OMF B;  1BI0 A;  2A37 A;  4LUD A;  4AG1 C;  2YUO A;  1M1K R;  1U3O A;  5GAO m;  3P8D A;  3VS5 A;  1V1C A;  1UGS B;  3VS4 A;  4PJO B;  2PVO B;  1MMN A;  2W10 A;  1WPY A;  1PCX A;  4PJO F;  4JZ3 A;  4X9C A;  1M90 U;  1QVG S;  2LTO A;  3ZBD A;  3J7A F;  5FWC A;  2OTJ A;  4FSX A;  4C5H A;  2KT8 A;  4F16 A;  3FLG A;  3OMG A;  5GAN d;  4PJM A;  3EGD B;  2HBW A;  5D6X A;  1V76 A;  5CKD A;  2DVJ A;  3CCR T;  1MV0 B;  1OU9 A;  5KYY B;  4N4H A;  2DXC A;  3QKJ A;  3H0I A;  2E4H A;  2ED1 A;  4DBH A;  2EPD A;  6AT1 B;  2V8J A;  4ZN3 A;  2QQ9 A;  4M7A C;  3OS2 A;  2MAM A;  3CC4 Q;  1X43 A;  1UGV A;  2E5K A;  2D6F A;  4IUR A;  1GCQ C;  2YT6 A;  4FL6 A;  4MMK A;  4E2F B;  4C0F A;  1KC8 U;  2LX9 A;  3VS6 A;  1JJ2 A;  1I5O B;  2GF7 A;  4J9H A;  2K2V A;  1XJW B;  3I55 Q;  1NPR A;  2BE7 D;  4MML A;  1AHJ B;  1PKS A;  3C12 A;  3H0H A;  2YRC A;  2M0O A;  3MO8 A;  1NBE B;  3CCU Q;  1PSE A;  3QYH B;  1UGR B;  5HCK A;  2MI6 A;  1WHG A;  4DBR A;  2SRC A;  1K8A R;  3RUX A;  4HCC A;  2DA9 A;  3CMA A;  3V8L A;  1LOJ A;  1EX4 A;  3CC2 Q;  4XTZ A;  2I2L A;  3NPF A;  4N0A C;  1RAC B;  1X2K A;  1YJ9 Q;  2RJD A;  2VXF A;  1QCN A;  1TUD A;  4CC2 A;  1UEC A;  5GAM f;  2IIM A;  2YRD A;  3I9Q A;  5A2Q E;  2MK5 A;  2VUB A;  3OMC A;  3RDV A;  2QA4 T;  2KNB B;  2R58 A;  3RER A;  2VV5 A;  5CKF A;  1K73 U;  3OS5 A;  4M7D D;  2EJG A;  3VUZ A;  2GCX A;  1ZUY A;  2EKH A;  4AT1 B;  1U06 A;  5CR2 A;  2ROL A;  2DRM A;  4PLL A;  4ZGE B;  3G71 Q;  2EQK A;  8ATC B;  2J6O A;  1VQ8 A;  3MEA A;  4AMC A;  1HYO A;  2J6K A;  4DEX A;  4PJO G;  3JCM X;  2NLU A;  3BFM A;  1K1Z A;  2HAX A;  1BIA A;  4JRQ A;  1YIT Q;  1O75 A;  4M75 A;  5A0D A;  4QVD A;  3CXC P;  4OB1 B;  2PZ1 A;  3NGP A;  2YRV A;  2QAZ A;  1B3Q A;  1Q82 U;  1G3W A;  3CCL T;  2K9G A;  3I55 T;  1T3S A;  4XK8 E;  2K6D A;  4J9D A;  1ZA2 B;  3A8G B;  1N27 A;  3GBQ A;  2X51 A;  5EC7 A;  4PJO E;  3MP1 A;  4IUV A;  2CP2 A;  4JUV A;  1Q7Y C;  3X26 B;  1X6B A;  5L23 A;  2FPE A;  4A63 B;  4KUD K;  4DOV A;  2HQE A;  2M51 A;  1VQM A;  2HEQ A;  2LQW A;  4V2S A;  3G4S A;  2WSF E;  4EIK A;  2JVV A;  3L2U A;  3V7R A;  3LH0 A;  3M56 A;  1NG2 A;  2QEX T;  3X20 B;  2A0F B;  3M55 A;  1YJ9 T;  3VJP A;  4KUL A;  2KRM A;  1UJ0 A;  3QBY A;  1ACM B;  1QKX A;  3KUF A;  5I21 A;  2CUB A;  1MMA A;  2NUT B;  2LRQ A;  5EG2 A;  1M27 C;  4JJB A;  2DER A;  2LMJ A;  2KI7 A;  2RQT A;  4LDY A;  4M7D B;  3M58 A;  2FHD A;  1WZO A;  1T3L A;  5GAN 7;  3HPW A;  2D0Q B; 
#chains in the Genus database with same CATH homology
 1AWX A;  2YUP A;  3EG1 A;  3VRY A;  5FWB A;  2K79 A;  2DM1 A;  4QT7 A;  1OV3 A;  2L3S A;  1AWJ A;  5IHI A;  3TSZ A;  3A98 A;  1IO6 A;  2O31 A;  1ZUK A;  2X3W D;  2J06 A;  4J9I A;  2DF6 A;  1CKA A;  1M3C A;  1T0H A;  1WXU A;  1MUZ A;  1X69 A;  4R0K A;  4OMO A;  4J9E A;  2QDL A;  2EBP A;  3TSW A;  2DL8 A;  2MCN A;  1X2Q A;  1K4U S;  2RMO A;  2M0Y A;  1B07 A;  1JXM A;  1J3T A;  1HD3 A;  4LN2 A;  1JXO A;  2LP5 A;  2J6F A;  3H0F A;  2JS2 A;  3I5S A;  1KSW A;  1H8K A;  3I5R A;  5IHN A;  5ECA A;  1GRI A;  2PNI A;  1UTI A;  1S1N A;  4AFZ C;  2HSP A;  3C0C A;  1AVZ C;  2KYM A;  2HDA A;  4ZNX A;  1K0S A;  1M8M A;  1OPL A;  2GTO A;  2GTJ A;  3EG3 A;  2AZS A;  3REB B;  1K0X A;  2B86 A;  1VA7 A;  3PVQ A;  1WFW A;  5IHK A;  3ULR B;  1NEB A;  3KFV A;  1M30 A;  2DL7 A;  4OMN A;  1VYT A;  2W0Z A;  2F2X A;  1NYF A;  3RNJ A;  1E6G A;  2BZY A;  1K76 A;  1G2B A;  2LCS A;  2C0I A;  2CSI A;  1JQQ A;  1SHF A;  2DBK A;  1T0J A;  1M3B A;  2ENM A;  2FPD A;  2RNA A;  1TUC A;  1Z9Z A;  2EYY A;  2I0N A;  2D1X A;  4DEY A;  1Y0M A;  2O9S A;  2LJ3 A;  3M0U A;  3UF4 A;  2K7A A;  1NM7 A;  2ED0 A;  1GCQ A;  1JO8 A;  4J9F A;  1RLQ C;  2F2W A;  5I11 A;  2C0T A;  2DE0 X;  2FPF A;  1YWP A;  4RTW A;  3VS0 A;  1WLP B;  2A28 A;  2DLP A;  2AZV A;  2KRN A;  2A08 A;  2FRY A;  1K9A A;  1YNZ A;  2VKN A;  3UA7 A;  2CH4 A;  1PWT A;  1UUE A;  2OI3 A;  4HVV A;  4JPB W;  1BBZ A;  1UDL A;  1AD5 A;  2GQI A;  2K3B A;  1YWO A;  2JS0 A;  1ZLM A;  2VVK A;  4J9B A;  4D8K A;  1W70 A;  2JW4 A;  2CH4 W;  2KRS A;  2LZ6 B;  2ESW A;  2JMC A;  3QWX X;  4Z8A A;  1WDX A;  2K2M A;  1GBQ A;  1YCS B;  2H8H A;  2KRO A;  1KJW A;  1FMK A;  3EGU A;  4X1V A;  4LE9 A;  3VS2 A;  4AG2 C;  1LCK A;  1M3A A;  3ZL7 C;  1CKB A;  1CSK A;  1SRL A;  1JU5 C;  2RQR A;  1X6G A;  1BK2 A;  3TVT A;  1RI9 A;  2CT4 A;  3VS7 A;  3LH5 A;  2EGA A;  4OMM A;  3M0R A;  1E6H A;  4GBQ A;  2FRW A;  2KR3 A;  4RUG A;  1FYN A;  2A36 A;  5IH2 A;  4F17 A;  1ZSG A;  3THK A;  4FSS A;  1UHF A;  2KYB A;  1AZG B;  1UJY A;  2HCK A;  3NMZ C;  3REA B;  1HSQ A;  4OML A;  4AFQ C;  2FEI A;  4Z88 A;  4LUE A;  4RTV A;  1BB9 A;  2RF0 A;  2DL5 A;  4AFU C;  1AWO A;  2KEA A;  3EHR A;  4HVW A;  1UFF A;  3VRZ A;  1RUW A;  2CT3 A;  2L2P A;  1AEY A;  1RLP C;  2A37 A;  4LUD A;  4AG1 C;  2DBM A;  2RQV A;  4CC7 A;  2YUO A;  3VS3 A;  2RQU A;  1U3O A;  2LX7 A;  2GNC A;  4Z89 A;  1BU1 A;  3VS5 A;  1V1C A;  2JXB A;  4D8D A;  3NHN A;  3VS4 A;  1WI7 A;  2J7I A;  4WCI A;  2YUQ A;  1G83 A;  1N5Z A;  2W10 A;  2YDL A;  3M0S A;  2AK5 A;  4CC3 A;  1WXB A;  2KT1 A;  4JZ3 A;  1SSH A;  1X27 A;  4RTZ A;  3SEM A;  2DX1 A;  1ABO A;  2O88 A;  5FWC A;  2KT8 A;  4F16 A;  1PKT A;  1QWF A;  1Y57 A;  1SPK A;  2GBQ A;  1PHT A;  1QLY A;  1PNJ A;  2DIL A;  1WIE A;  2ECZ A;  4IIO A;  2EW3 A;  1XOV A;  2BZ8 A;  1NYG A;  2HBW A;  2X3X D;  3UAT A;  3M0P A;  5IXB A;  1MV3 A;  2EVR A;  2MOX A;  1E7O A;  4RTU A;  4HCK A;  2DVJ A;  3SHW A;  1MV0 B;  2AKL A;  2P4R A;  4F14 A;  3H0I A;  1ZUU A;  2ED1 A;  1EFN A;  2EPD A;  2L3P A;  1ABQ A;  3CQT A;  2KE9 A;  4J9C A;  1WYX A;  2D0N A;  5IXF A;  2D8J A;  4OMQ A;  2JTE A;  1X43 A;  1I07 A;  1UGV A;  2E5K A;  4HXJ A;  2D8H A;  2NWM A;  2V1R A;  3QWY A;  4RTX A;  1GCQ C;  3U23 A;  4AFS C;  2YT6 A;  2CSQ A;  2DMO A;  2EYX A;  4E6R A;  1JEG A;  3VS6 A;  4JJD A;  1YP5 A;  1AZE A;  1HJD A;  1H92 A;  4J9H A;  2KBT A;  2KXC A;  2EQI A;  1PKS A;  3PVL A;  1PRL C;  2NUZ A;  3H0H A;  4RTY A;  2BZX A;  2C0O A;  3H41 A;  2LNH B;  2LQN A;  2DRK A;  5HCK A;  1GL5 A;  2G6F X;  2JMA A;  3EHQ A;  1PRM C;  2SRC A;  2DA9 A;  1SRM A;  1OOT A;  1U5S A;  2O2O A;  2O9V A;  1OPK A;  2FO0 A;  3NPF A;  1NLP C;  1X2K A;  4CC4 B;  1VYV A;  2KGT A;  3R6N A;  1TUD A;  2EYZ A;  2V1Q A;  3O5Z A;  4CC2 A;  1UEC A;  2DL4 A;  2IIM A;  4RTT A;  3I9Q A;  4GLM A;  2OJ2 A;  3I35 A;  1TG0 A;  1SHG A;  1H3H A;  2KNB B;  2JM9 A;  1I0C A;  1GBR A;  4J9G A;  3PE0 A;  1ZBJ A;  4JJC A;  1ZX6 A;  1ZUY A;  2EKH A;  1GCP A;  1AOJ A;  1U06 A;  2ROL A;  2DRM A;  3M0Q A;  4IIM A;  2CDT A;  2JM8 A;  2RN8 A;  4M4Z A;  1YN8 A;  2J6O A;  2L0A A;  2LJ1 A;  2RPN A;  2VWF A;  1KIK A;  4JZ4 A;  2DJQ A;  1WX6 A;  3UA6 A;  2KXD A;  2J6K A;  5GJV B;  4DEX A;  4HVU A;  5FW9 A;  1K1Z A;  2L3Q A;  1OEB A;  1I1J A;  5I22 A;  2EGC A;  2OAW A;  1Z9Q A;  2PZ1 A;  3NGP A;  2JT4 A;  1B3Q A;  2CUD A;  3EG2 A;  2XMF A;  2DNU A;  1QKW A;  2ABL A;  2K9G A;  4K11 A;  1T3S A;  2K6D A;  4J9D A;  2J05 A;  3GBQ A;  5EC7 A;  2F2V A;  1X6B A;  2LJ0 A;  1W1F A;  2PTK A;  2EYW A;  5L23 A;  2FPE A;  4KRT A;  2FG0 A;  4A63 B;  1WXT A;  2EGE A;  4Y92 A;  2DL3 A;  3RBB B;  1UHC A;  3IQL A;  3FJ5 A;  2M51 A;  2DYB A;  2HEQ A;  4LNP A;  2LQW A;  1AWW A;  1W6X A;  1KFZ A;  1GFD A;  4ORZ A;  2YSQ A;  2RQW A;  4EIK A;  1UE9 A;  1QWE A;  1GFC A;  1NLO C;  3EG0 A;  1NG2 A;  1QCF A;  2BTT A;  5GJW B;  1SEM A;  2ROT A;  3JV3 A;  2SEM A;  1UG1 A;  3M0T A;  2KRM A;  2CRE A;  1UJ0 A;  4OMP A;  3VS1 A;  1QKX A;  4ESR A;  2CUB A;  1NEG A;  2YUN A;  1M27 C;  4JJB A;  2LMJ A;  2AKK A;  2RQT A;  1A0N B;  1ARK A;  1WA7 A;  1VYU A;  1T3L A;  2MIO A;  2GGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...