5IHPA

Crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
246
Chain Sequence
MTRVLAVANQKGGVAKTTTVASIGAALTEQGRRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGDVEPSAALVRTDEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPDLKLLGALPTLYDSRTTHSRDVLLDVADRYELPVLAPPIPRTRKSKGAIAYREFADALLRHWKSGRKMPTFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Ligase
molecule keywords Cobyrinic Acid a,c-diamide synthase
total genus 81
structure length 246
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ihpA00
1CTQA 1FUUA 1GL9B 3OEED 4MGIR 4OJQA 3KX2A 5F2EA 4EKDA 5IHPA 3NXSA 1TTTA 1F2UA 1OW3B 4WW0A 1E1QD 3EG5A 3EZFA 2DPXA 4OQLA 3ZQJA 4Q7JB 5CM9C 5FTNA 1R0WA 5IT5A 2FZLA 5DN6A 4LRWA 2FGKA 1TQ4A 1CR2A 3LBIA 1A7JA 3K09C 4BZQA 4A15A 5DYIA 4MKHA 1OFUX 3KZ1E 3PV0A 3QBVA 4X8OA 1COWA 2SHKA 2EYUA 1H8HA 3F0TA 4KXFB 2JLXA 2QRZA 2CLDX 2FH5B 2KBFA 4JT4A 3TUJC 4HAXA 2W6IA 3NH9A 4LHZA 1G8PA 3LW7A 2GTPA 4TTPA 1XD8A 2JJ2A 1M2OB 3VR5A 1KO4A 3A4LA 2RGNA 1PVOA 1Q3TA 2Q0HA 2GRJA 2BBOA 2XTZA 4B44A 3A1TA 2QP3A 3AF2A 2C5LA 2WJJA 4PANA 1ZIOA 4AK9A 1DAFA 4DSTA 4JYBA 5TXGA 1DAIA 3AVWA 1US8B 1XTJA 2E87A 4PPNA 3CX6A 1G16A 1E0AA 2DFNA 1G5TA 1JJ7A 5JWHA 4KODA 5J4YA 3AVVA 5JJIA 1OYYA 5KUTA 3KUDA 1OH7A 1W2GA 2YKGA 2JATA 3Q85A 2A3RA 2GWHA 4MKGA 1YZUA 3V4RA 1YZQA 4LV6A 1OKKA 1M6NA 1VYVA 2QPTA 3SEAA 1W0KA 3IBGA 1DAHA 3TSWA 3LLMA 4AIIA 1KDPA 1DPFA 5G53C 4JLDA 1KO8A 2WVJA 3T5GA 1IBRA 1IN5A 1XEWX 4D82A 1G8FA 3GLHA 3I72A 5A5GA 2JDIA 2WMOB 4B3GA 4A36A 1ZC3A 3A37A 5IDVA 2ZSFA 1XD9A 4HZUA 4G5SA 5DYGA 3T15A 2HUPA 1N0VC 2EU8A 1Z3IX 2NPFA 2AKAB 4RKEA 1XRJA 3RS0A 1XJ0A 4F7WA 5KSPA 1KY2A 3WYGA 2KI5A 2OCAA 5K8LA 5H70A 1UFQA 1W5SA 1N0UA 2ZROA 4CT5A 2OXCA 1IM2A 4CRWB 1YE8A 1IJEA 3ZGXA 1WB9A 1NBME 1UPTA 2AD1A 5CYOA 4BLQA 2AXPA 2W0MA 1XU4A 2HXSA 4PC7A 4NL4H 1RRCA 3WHLA 2RAPA 2CBZA 2CNWA 2QZ4A 2DCUA 4TMKA 5B64A 1TU3A 3ZQ6A 2XNDA 5JEDA 4AY2A 1P9RA 4A92A 2QSZA 4IDPA 2GBLC 1L2TA 3EIHA 2EFHB 5JJLA 2XB2A 3VR1A 1RZ3A 4GP7A 1GVNB 4F4JA 3AM1A 4GPTA 4IEEA 1ZM9A 3VX3A 5F9FA 4HDOB 3L0SA 3MD0A 5ANRB 1P62B 2REOA 3IEUA 3REFA 1XXHB 2Z6VA 2R6FA 2D74A 2VIIA 1WE2A 3GD7A 4PR0A 2J9RA 2IXGA 1E4VA 4M1MA 3K9HA 1KKLA 1T5LA 4RJLA 3NC1C 2C8VA 1N5KA 1E2FA 4F4IA 4DDUA 4RZUA 2VPPA 3KKNA 5A4JA 1M8PA 3KL4A 1D2MA 4NTZA 1G8GA 3OEHD 4BFWA 1MRNA 2FSHA 1XCGB 1YJ5A 1Z06A 2Z4SA 2ERXA 3IPXA 2J41A 4PZLA 4JKYA 4Q9HA 1N3BA 4MUBA 2J45A 5FOUA 2JASA 2NG1A 3OIUA 1CXZA 2WWIA 5CB8A 1W5TA 4BFYA 1ZUIA 5C2JB 1QHGA 3FHTA 2MMGA 3DKVA 2WKQA 4HLDA 3WP0A 4E07A 3PJRA 4G5GA 4CW7A 2GA8A 4DUGD 4DDWA 4WZBE 2C03A 3IKJA 4PHHA 1N6KA 2ODBA 4S2EA 3GJ3A 4LWZA 2DB3A 1BMFD 1CRQA 3TW4A 2AL7A 4EFMA 5HPYB 5KU1A 2DWPA 2OE2A 1KKMA 4D4KA 1YU9A 5HTKA 2LWIA 5CIWA 4BEBA 3SHFA 2BEKA 2C9OA 4L15A 2OO7A 3WYFA 2JLVA 1YKSA 1M7HA 2BDTA 2R62A 3WNCA 3AVYA 1R7RA 2UKDA 3QKSA 3ND8A 2WOOA 4BRUA 4U7DA 1QHNA 1TQ2A 1Z08A 4C0KA 1LF0A 1XJQA 2OM2A 5CJPA 1KI2A 1SVOA 1E2DA 3VKGA 1Z07A 5FOTA 1NN1A 1ZVQA 1ODFA 1G291 3B1YA 5TVKA 2OCYC 3VMFA 2EW1A 3B85A 4Z54A 5HZHA 4Q4JB 1UEJA 3DHWC 3KJGA 4QJ4A 4V0OA 3W5IA 1W0KD 2CNWD 3C15C 2QAGC 1T9HA 2PMKA 2QY9A 3I3SR 3OFNA 4M4SA 4DBLC 1QBKC 2FPMA 3KQNA 4LJ6A 1J8YF 4ESVA 2CJWA 1OHHA 2F1JA 3LY5A 1NSFA 1OFHA 1ESMA 4DB4A 1OV4A 4RD6A 1X1RA 2ZU6A 5FBQB 4ZKEA 3UMFA 5KDLA 1JEDA 3VR6A 2O0HA 2ORIA 4HB0A 3QKUA 2ZIAA 4QHSA 1QRAA 1DOAA 2NTYC 3CO5A 1K5DA 1N6LA 2XITA 5GJCA 3Q7QA 4LBVA 2R2AA 5G40A 2NO7A 2ZAOA 5JSZA 3THXA 1QHYA 2ZITA 1E9BA 1FFHA 1W4BA 2W6ID 4NYIQ 4AYWA 4EPVA 2ZRMA 3C5CA 4JSYA 2ORWA 5JFGA 1VMAA 1ZD9A 4OHWA 4BFTA 1CJTC 2MSCB 3ETLA 5CJ2A 2TMKA 4EDHA 1U9IC 3TRFA 2DFKB 4B2IA 4TTRA 2G77B 4M1SA 1P9NA 4U5XA 2LKCA 4HYYA 1CJVC 4JLKA 3RNLA 1P60A 3MWLA 221PA 2R6GA 5FOSA 1OYWA 1AZTA 4PQYA 3K70C 4PC2A 5EP3A 3HPQA 1SHZA 2RMKA 4KAXA 1M34E 5KSZA 5DN6D 2C78A 2EFCB 2D62A 3B9QA 3BH0A 1LV7A 3LAWA 5SZIA 2FE4A 4PPGA 5H68A 2RGEA 1WRBA 1QHHA 2HYIC 3AV0B 4N1AA 1D2EA 1J99A 4NYIR 3SFVA 1W4RA 2QMHA 2VP5A 4BECA 2V8OA 4Q1FA 2ZI6A 4FWIB 1Q21A 3W6PA 1OPXA 5FPYA 2ZI5A 1KOFA 1A82A 1VG1A 4ZDIA 3GPLA 4YONB 3EPLA 5JWOA 5JWRA 4P4SB 4R7ZA 4NH0A 2NMVA 1SXJA 1H8HD 3A1UA 5DIFA 3QI2A 3I5YA 4LY6A 1KI1A 2IEYA 4OK5A 1R8SA 5FOVA 1VG9B 3CRW1 1COWD 2ZJAA 1S96A 2ZI9A 5EE3A 3ECCA 4RZXA 2C99A 4B33A 4P4UA 3GLFA 5ELXA 3EIEA 4D6PA 2IYZA 4WZAE 3SZRA 1Q44A 2JLWA 3BB3A 3LBHA 5B30A 3LWNA 3N5CA 5SZHB 4DSUA 4C0JA 3KB1A 3OESA 1Q22A 2GEDA 4KVAA 3TH5A 4US2R 5A0FA 3BC1A 2O0KA 4DJTA 3TR0A 4F91B 1N6NA 3H84A 1TU4A 4HSEA 1MR3F 3KJIA 2FF7A 2QSYA 3AP1A 3FKQA 3UG6A 4C0SA 4TL9A 2WJVA 4CGZA 2CXXA 3NKVA 4TTQA 3TKLA 3IHLA 3BOSA 2J7KA 1ZM2A 3BAFA 4DCNA 1N6OA 4OKSA 3M6AA 2QRNA 4IXMA 3U7EB 4IOJA 4BLPA 1NF3A 3W8NA 1GOTA 1P3JA 3D31A 2ZR9A 4TL6A 1D9XA 5HCNA 5GVRA 421PA 1E2QA 1TMKA 5E7MA 4ZDJA 1JNYA 5J47A 1IAQA 1CULC 1G3MA 2WJHA 4OI0A 1SVKA 2OAP1 1NKSA 3ICQB 1FNNA 1GZSA 1QHXA 3DEFA 3NBFA 3SYNA 4PFSA 3H4MA 2A5GA 2DBYA 4LI0A 2ZRIA 2F1IA 4HAZA 1RW4A 4NCKA 1ZCAA 1CR4A 4KYUA 4W5WA 1LF5A 1KDRA 3TK1A 4DWJA 5EP2A 3BB1A 4OBEA 4OL0A 1R5NA 1W0JD 1G4UR 2Z43A 2AWNA 2FEOA 2QU8A 2ZVPX 4TSFA 4ZI3A 2PJRA 1KI6B 3NHAA 4IRUB 2F1HA 2B7CA 4L4UA 4YMSA 4BFSA 3ADBA 1OB2A 1P73A 1Z29A 2B7BA 3U3MA 1IY1A 2G1KA 1YR7A 4TSFD 1MABB 2XJ4A 1MO3A 4FMDB 1AKEA 1KMHB 1OFTA 2N46A 1II8B 5TV2A 1KSJA 1YRAA 4OI2A 2QN6A 1ZRHA 2E1RA 1AZSC 4CT4B 3T1TA 4CEJB 1S0UA 2R6CA 3ASYA 3C41J 3U7FB 3EC1A 5CLLA 4G1UC 1W7AA 3LW8A 2IS6A 4QOSA 3LQRA 1LVGA 1GG2A 5EUQB 1G7TA 4PC1A 1W2HA 2ZRGA 1JR6A 1ONBA 1E2NA 4URZR 3HYRA 3REGA 4LCBA 2R65A 3LX8A 4UNQA 3THOA 1SXJB 4V03A 2ODEA 3CZPA 2EVWX 5FBWB 1HEIA 2RH5A 2NOAA 3EA5A 4TLAA 4NU0A 2FFHA 2P5SA 3UMRA 3GJ0A 3CPJB 1XZPA 1XD2B 2J0UB 4V0MA 2CLSA 2QT0A 3QEJA 3KUCA 2V6JA 621PA 3GJ5A 1US8A 4D2IA 1X8KA 3L82B 2DHRA 4H1VA 4Q1EA 3IHWA 4RFVA 2IS4A 2CHVA 1FTNA 1HTWA 4NCHA 2KSQA 3T12A 3WBJA 1AS2A 3CF6R 3VNVA 1KK1A 1Z5ZA 3IILA 4ASUA 1OSNA 4AKGA 3P4XA 1ZD1A 2XSZD 4Q9KA 4B6EA 2HCBA 5AJWA 4C0QC 4PAMA 2DY1A 2WMNB 1ZM7A 1JXMA 4TZ0A 1MOZA 3P32A 3ZIAA 2W2XA 1TX4B 3RRYA 4W5JA 5JCZA 5C4MA 3P26A 2VHCA 3HP1A 2IX3A 3TVDA 4OHYA 1R5OA 1HT1E 2RGGA 4Q4AA 1T4GA 1SVSA 2GJ8A 3B1XA 3U3RA 1NVVR 3L2OB 1XPOA 1G6OA 3IO5A 2Q21A 1NY6A 5DE3A 1LW7A 1DBSA 3FE2A 2OFXA 4L16A 3AP3A 2ZSBA 3UWKA 1T8UA 5JJKA 4A0FA 1FOEB 2ZS8A 1KTVA 1NG1A 2Z5FA 3K09A 4W5HA 3FOZA 5L3VA 3TUZC 5EXPA 5BN3A 4Q19A 2A5DA 4KO8A 2Y8EA 2EFDB 2OILA 3SU8A 3PUVA 3RRMA 1GP2A 4HEJA 3GLHE 3W90A 4QFMA 2VEDA 2VP2A 3RSLA 1KK0A 1ZU5A 4AD8A 4URVR 4TYWA 3BGWA 4M2LA 1CR0A 5AUNB 4A0RA 3I73A 2HXYA 2IWHA 3RRZA 1HA3A 2D06A 2HDNB 2ZVQX 1NVVQ 1NBMD 1OXTA 2MSEB 2G0TA 4WAUA 3VQTA 4JL6A 5FBRB 4HLUC 5E3HA 1E2EA 3SR0A 4P3YA 2HF8A 2RGAA 1CJMA 5DHAA 3BRWD 4GT1A 3UWOA 1KI4A 1UM8A 1SVMA 4PPFA 3IIJA 1NIJA 2JJ8A 3M0EA 1E69A 4EPWA 3R7WA 5F3WB 3ZH9B 5JRZA 3EPHA 1GIAA 1XJCA 1E79D 1JR3D 1QG4A 1TEVA 5HCIA 4J0QA 1PLLA 1WA5A 2H17A 4JS0A 2D7DA 1DAKA 4CEHB 3GLFB 1E9EA 2FEMA 4D0LB 3S1AB 1T3HA 2QQ0A 3OFND 3GLGB 1W36C 2W58A 4UQOA 5GJVC 4JLOA 4UNNA 2ECKA 5DGXA 1R5BA 3SBDA 1D5CA 2HF9A 2W83A 2XNSA 4OQFA 3V00A 3LXRA 4MH0R 3CNLA 3LFUA 5FH9A 2BMJA 4RD1A 4URXR 3THWA 1PUIA 4XVUA 4B3CA 4CZ2A 4I81A 4QJ3A 4ZV4A 4CEHA 2YJTD 2A7QA 1ZU4A 4GP6A 5BQ5A 1E94E 2RGNC 3U60B 4NCIA 4PHTA 4X8MA 4N3NA 1EX6A 5AUQA 5JZVA 3C16C 1LTQA 2WWFA 2Q9BA 1D2NA 1HYQA 3TGPA 4KITB 1Z22A 4A6XA 1KK3A 4YXWA 5TB5A 1E2GA 1CR1A 1XTQA 1OHHD 4K8OA 5IK2A 1MO4A 2IK8A 4HUQA 1SKYB 1Q1QA 3OHMA 1X1SA 2CL7X 4L9SA 1RRGA 3PEWA 1S8FA 2BKUA 3CH4B 4C7OA 4JLMA 3BK7A 3B1VA 4LYFA 4C4PA 4LJ8A 2OAQ1 2HEIA 2WJIA 2ZRBA 4OYHA 5JI2E 2ZYVX 3CNOA 3B13B 4JVLA 3EXAA 4PSKA 2BCJQ 4M9XA 4TLDA 4BLTA 1W46A 2JLZA 2WWXA 2H92A 3H2YA 4C30A 3CUEF 1D6JA 1PLJA 4QL3A 3KXIA 5J5CA 1E0SA 3PCRB 2QMEA 4R71A 5LB2A 4B75A 3RS4A 2O8FB 4OQMA 2EQBA 4V0LA 2YOGA 4EJSC 1S4QA 3GJXC 3G0HA 3THYB 3ADKA 4NMMA 2GCOB 2GJKA 1DE0A 3LBNA 1G3QA 2NZJA 2IT1A 4Q4AB 3O8CA 1AM4D 4OHVA 3U44A 1GRQA 4HLCA 3W6OA 4NBSA 4YDHB 1OLOA 1T3SA 4BUJA 8OHMA 2B92A 3EIQA 3IQXA 4AKEA 5AJYA 1F60A 2IYVA 2VSXA 4ZIRB 1NIPA 1MKYA 2HLDA 4HAWA 3BORA 1X8LA 4Q7KA 2QAGA 3CRRA 1E3MA 3SE0A 4MYHA 1XP8A 1GITA 1SULA 2ODNA 2UVQA 2XEXA 1OH6A 4KHZA 2Z83A 1G3UA 3SDZA 2YINC 1T0HB 1DEKA 3DMNA 3B5JA 3KJEA 1KGDA 4DLZA 3GQBA 4AURA 3I92A 1U0JA 4JZKA 4YMVA 4WXRA 5KO2A 4A0HA 4B3XA 2A9KA 3TAHA 2OLJA 4E09A 3PXGA 3TSZA 4R9UC 4TMWA 2GNOA 2OBMA 2QPAA 3WBKA 2A2ZA 2J0UA 1UF9A 2JLQA 2BBTA 1AS0A 3SOPA 1YQTA 3QF4A 1N0WA 4YMUA 4KJZA 1SQ5A 4M1TA 4N0EA 3K9LA 2FFBA 2OESA 3ND9A 4ARZB 5FUXA 2YNMA 4JMPA 5JS8A 4DDTA 1UAAA 4V0NA 2GF0A 4RD0A 3T34A 4F93B 2VRWA 1KK2A 1PZNA 1AS3A 2RCNA 2QNRA 1Q20A 3PIRA 4B32A 2CEAA 2F6RA 2QI9C 4G5OA 3ZVLA 3KFXA 1WCV1 3AQ4A 2C77A 2GVDC 2XNDD 4FMBB 4BGDA 4O2LA 4LPSA 2ZM5A 1KDOA 1RYFA 1W47A 2CE2X 3K8YA 4QNMA 1FPMA 2EFEB 3QVUA 4JLNA 4QKQA 2IYUA 1FNMA 2VSOA 2ZJOA 4I4LA 1BKDR 1JAIA 2OEPA 3BFKA 1EX7A 5JECA 1VCNA 4UXHA 3TVTA 5HKKA 3W9YA 1XXHA 4AKHA 4RKFA 3A8TA 4MQBA 3ZD7A 2FV8A 2W6JA 2KJQA 1HT2E 4FINA 5G3ZA 4IDOA 3BIFA 2BM1A 3TR5A 2JDID 2F43B 2JJ2D 1R10A 1KJYA 1OIWA 1HY3A 3FMIA 2PT5A 3MWJA 2OSBA 3NVAA 3CR7A 4I1VA 3RS5A 4D0NA 5KTYA 1NI3A 5IRCD 3GLFE 2P6RA 2ZJBA 1R6BX 2IW3A 3QIAA 3K70B 4EJSB 2VP4A 3FTQA 1Z6YA 2XAUA 4DKXA 3H1TA 5J4VA 4JVMA 2ATVA 3KKMA 3TJZA 2DR3A 2J46A 4M1KA 4MKIA 4E22A 5CB6A 1YZTA 2IHYA 1IN4A 1Z2CA 4YMTA 4GOJA 2Z0MA 4ON9A 3EWSA 2C9CA 2ZEJA 5D3MB 2O5VA 5EE0A 521PA 2BKEA 1NL3A 1WP9A 4OJKA 1WF3A 4ERNA 3EARA 2OT3B 3EPJA 1XMSA 3QQ5A 2N42A 4Z8XA 1B0UA 1XDBA 1IY0A 2E9SA 3FKSA 4KLZA 3LRPA 4MRNA 3SC3A 4B73A 5HR5A 2C95A 3I32A 3PENA 4PTLA 3MWYW 4YDSA 2MSDB 3CPHA 3GLHB 1ZP6A 2AX4A 4R98A 2D2EA 3U6KA 3DZDA 1N5IA 1JPNA 3D6TB 1DO2A 3HU3A 3K0CC 2CK3A 4MDEA 3ZDQA 1LS1A 2JIZD 4HDQB 2HJGA 3L8YA 4PXAA 5BYJA 3HR7A 3Q5EA 5G41A 1OJLA 2Q3MA 1S9HA 3VFDA 1AN0A 1RPZA 2F1RA 3QUSA 4TLCA 2IL1A 2QUZA 3D3QA 4ASUD 1Z6TA 2GCPA 4UJ3A 4QBIA 4RCYA 2VP9A 3PR1A 3VTKA 2RGBA 2XTNA 5AJZA 2OFOA 4Q48A 4DSNA 3SJZA 2PMDA 1Q1ZA 2AXNA 2BVNA 1XTSA 2QGNA 1P2VA 2PX0A 3HWSA 3KTAB 2ZRJA 4M22A 1A1VA 2IXFA 1QVAA 2OHFA 3QG1A 1YR6A 3QF7A 4LC0A 3EW9A 3EZ2A 4RD4A 1KYIA 3UPUA 2HJVA 4JLVA 2VF7A 3B78A 2IF0A 3NEJA 2BJWA 4PX9A 5DH9A 1XTIA 2D3WA 3HDTA 5TARA 3AKCA 3L43A 1YHNA 1GUAA 3NH6A 3QPWA 2WZQA 4LC1A 1Q0UA 3KDSE 3GJ4A 3UKDA 5FPKA 2IYRA 2ZS9A 3NHBA 2REXB 4B71A 3WRXC 2YC2C 4WZ6A 4US1R 2CE7A 1KSGA 3C14C 2PEYA 3GCGA 1ZW6A 1XX6A 1EK0A 1A2BA 3PEVA 2XSZA 1A5TA 2WBLC 1GL7A 2P2LA 2A78A 1OXUA 2H7VA 2ZRPA 5BXQC 4BPBA 2ZJZA 4Q01A 1JB1A 3AVQA 1Z2AA 2IUUA 5JSZB 3RWOA 1X6VA 2GXQA 5K8UA 5GJWC 4BLSA 4D4JA 2ORVA 1LS6A 3GFOA 1G9XA 4KBGA 5KDDA 4BASA 3BWDD 1ZUNB 4Q7MB 4IFEA 4P0TA 1P2UA 2AHOA 2H1LA 3ZYCA 4QJ5A 5KPJA 4C7OB 5AJVB 1U8YA 1IXSB 5FI1B 1LNZA 2PL3A 1ZMXA 4PAOA 4QBHA 2O8EA 1UKZA 4IKEA 2J0VA 3SQXA 1GM5A 1HH4A 1Q57A 1E2PA 4JKIA 3Q7PA 4TMZA 4URYR 1OH5A 1W0JA 1F6BA 5D3QA 2GVZC 4JL5A 2KBEA 3TLXA 2PZEA 2CL0X 2H16A 4DT1A 5FFMA 3A1VA 2UZIR 1W36D 3N2IA 4FMCF 1N6RA 4Q4JA 2WKRA 2J0QA 1G18A 1G1MA 1Z0KA 2VLIA 2IYXA 2XJ9A 2FG5A 3LV8A 5BWMA 3LLUA 2C2HA 4D25A 1G4AE 3SQWA 1B23P 1KI7A 1KJWA 2IA5A 1D8TA 4IFBA 4LV8B 1KIMA 1X86B 3K9NA 2F55A 4TMVA 4AYXA 1VHTA 2IHBA 4BFUA 4B35A 1E1RD 3GLGE 4D26A 2FDCA 1I2MA 1W4AA 2ZRHA 2WWWA 1XFAA 2JAQA 5AR1A 1Q1EA 2ODWA 3PUZA 4BZPA 4QM7A 3AF3A 1JALA 2MMCA 2BHRA 3U4QB 1Q1BA 4LBZA 1R0XA 3ADCA 4O3MA 2WJYA 3FVQA 3H0KA 2V3CC 4LHWA 1QDEA 2HV8A 3VR2A 3M4YA 5L3SA 3I5XA 1MH1A 2IC5A 3FMPB 2J3EA 2ZRLA 2HYDA 1U0HC 4M1YA 5LDDC 3I62A 3E70C 4P33A 2WWGA 3HU1A 4LV5B 4CDGA 4XVQA 3DL0A 3LO5A 3HU2A 2QENA 4GZMA 2QE7D 4Q66C 5L8VA 2J7PA 3A1SA 4RCZA 4F38A 4ZDKA 3VR3A 1IN7A 1UEIA 1Z0DA 4LYAA 4C9BA 3CBQA 5CDFE 3MRSA 4M21A 4DT1B 3AF0A 2AK3A 1GTVA 3RANA 4GI7A 4DZZA 4MITA 2WHXA 2ZI3A 5LBIA 3CR8A 4DLYA 1JI0A 1AGPA 1ZINA 2ZYUX 4EFNA 1TF7A 1VKJA 5J4HA 3QE0A 3GJ7A 5E95A 2F43A 5F98A 1SVWA 3QXHA 2AD5A 4NCNA 3UK6A 1N6HA 1FMLA 2J0SA 2ZRCA 3C5HA 5CLQA 4R2IA 4BQSA 2O8DB 2BC9A 4HB3A 3IBYA 2QAJA 1NLZA 3QPUA 2XX3A 3HR8A 1O87A 3GLIB 1NMZA 2QPOA 1PLKA 4QXAA 3RABA 4AWXA 1XTKA 2V4ZA 2ZJ5A 2BWJA 4KSCA 3IIMA 4HLQB 1KDTA 1BIFA 4OI1A 4CIDA 3SBEA 2QEQA 3BD9A 3IGFA 3MSXA 2RGCA 1E32A 1U99A 1RYHA 4HATA 1JAHA 1Q3HA 2K5UA 3WHKA 5C46F 3FMFA 1L7VC 2CK3D 4IDNA 4RVCA 4I1OA 1I4LD 4RFSB 3CF0A 1BYUA 1KNQA 5DO9A 2H57A 3MJHA 2H18A 3KQLA 1P2TA 3T1VA 3WMEA 3F5FA 2O8CA 4Z1MA 4BZXA 2NO9A 2UZ3A 5UKDA 2WKPA 4Q5IA 5DISB 1CKEA 1UJ2A 1XCPA 2OXRA 4I99A 4QHTA 3QY0A 4D0GA 2R8RA 2IWRA 4ARZA 2V1XA 2FSFA 3KTAA 2ASEA 4D4LA 2BEJA 1Y3AA 3CIOA 4H1UA 2QORA 2F9LA 3QF4B 4ZCIA 1X3SA 5KNBA 1NVXQ 2WWHA 4FCTA 1E2JA 1XD2A 1JBKA 3Q5DA 2X8AA 3O8RA 5FR2A 1SGWA 3ONWA 2CCGA 1FX0A 2PT7A 3MMPA 4HAUA 3W3AA 1ZAKA 3K9GA 1K6MA 2P5TB 3RAPR 4CYMA 1S3GA 4YC7A 2KE5A 4DB2A 1XF9A 1R2QA 5C4GB 3RDPA 1E4YA 2PH1A 3K0FA 1M7GA 2X77A 4GFDA 1G20E 3QENA 2XXAA 3PEYA 5J4KA 3VNUA 1CF4A 4QNRA 1PUJA 3CWZA 3DZ8A 4QBGB 1IOZA 2ZI4A 3WNDA 4B76A 3WP1B 2VH5R 5BN4A 4CEJA 4FD2A 2QAGB 3RWMB 2FSGA 3LX5A 3CZQA 5DI3A 1KI3A 3A6PC 3E1SA 2WIAA 2VL7A 5FR1A 4ZIRA 4KFTA 3BJIC 3G5UA 5HKKD 3CW2A 4DDVA 3K0SA 1FL9A 1QHSA 4RSGA 1FQJA 4BLRA 1VCOA 5BN5A 2PLRA 4NHOA 4IOLA 4JT2A 1ETUA 2R6DA 4RY2A 2Q3HA 4LYJA 5BYKA 2VBCA 3IPYA 4ITRC 2OG2A 1EFRD 2ZTSA 2ZE8A 3QBTA 1BOFA 2D4HA 2ZSDA 4ILEA 2O8FA 4EPTA 1G17A 1KMQA 4TT3A 4DUGA 4A4DA 2VHJA 2ZUDA 4LYHA 1ZNXA 3DKPA 1DG3A 1R0ZA 5E7JA 1EFCA 4FWTA 4TLEA 5JCPA 4LHVA 1Z0FA 5KYKA 1NVWQ 2I4IA 3QVVA 3OAAA 4UNRA 4JVNA 1SVLA 2L0XA 3GEHA 4FCWA 3OZXA 4WIAA 2JEOA 3I1FA 3RYTC 3U61B 3ZVMA 3GP8A 3P27A 3U7HB 2NZ8A 1F2UB 2XOKD 3TQFA 1HQCA 1II9A 2V55B 4M1OA 1NN5A 3G82C 5KDOA 2YVUA 3CB4A 4HUQB 2PEZA 2NGRA 2VP6A 1GNRA 3BFVA 2ZR7A 3AKYA 4V0ME 4HUTA 1Z6GA 4V0KA 3R9XA 4U02A 4ESHA 5FTJA 2ZYWX 5FPHA 2DWOA 2IXEA 4ZDWA 4MRVA 1T0JB 1TQ6A 4LJ7A 1SHKA 2P65A 1CJUC 3QEOA 1KZ7B 5SZJA 1U0LA 2QM8A 4M9SA 3GMTA 3THWB 1NLYA 5B57C 3NEYA 1L8QA 4TT3D 2VF8A 3FFAA 2GAAA 1U8ZA 4MYUA 3SN6A 5L3SB 3LNCA 5CM8B 2GILA 1S1MA 3JVVA 3QKRB 4EUNA 3IO3A 1G21E 3TAUA 4YQFA 3S1AA 3U7GA 2XZLA 1IN8A 3B2EA 5LD2B 1HUQA 1V5WA 2FMXA 4KSBA 1ZM4A 2YWGA 2GJ9A 2ZUBA 1OXSC 4EFLA 2IEZA 4UXJA 2XZPA 4IHQA 1ZUHA 4XTCS 3QSYA 1ZC4A 2EWWA 3IUYA 5L3RA 3KKOA 1DAMA 3NTUA 3R8FA 1W36B 2BJVA 1DAGA 1L4UA 3UIEA 3MWKA 4Z51A 3A1WA 2FNAA 1NMXA 2AWOA 4B2LA 3M1IA 4A8JC 2ZETA 3PG5A 3GFTA 1YZGA 4QHYA 4DIDA 1VYUA 2VQSA 4MKFA 2YWEA 1VG8A 4DCSA 1SKYE 2ZU0C 2NO1A 4DLTA 1R8QA 3W6NA 4CEIB 2ZRDA 1OXXK 3IDQA 1UKEA 3B82A 4PSAA 1DADA 5B58C 1OKKD 5JHGB 3GJ6A 4PQFA 3TNFA 3THYA 2ONJA 3FWYA 3WXMA 1L4YA 2QBYB 1KJZA 3LVQE 3CH5A 4M0LA 1BS1A 4TLBA 5IK2D 4GMDA 3THXB 4K81B 4XOIA 2GCOA 4B48A 1E9DA 1ZNWA 3CKLA 4MGYR 1E96A 2YHSA 3FGNA 4PSVA 5FL7A 5CDFA 2GETA 4AI6A 1KI9A 4WA7A 3AUYA 4GDFA 2GK6A 4EPYA 1UBEA 1ZD8A 2OBLA 3SYLA 1OXVA 2FWRA 1DAEA 4UKDA 4TYPA 4ZPXA 4WOPA 1IJFA 1II0A 2CJWB 2FN4A 1MO5A 4DLRA 1DO0A 1CBUA 2PZGA 5FBLB 3TSOA 1EWQA 1OH8A 5J4LA 3IIKA 1CP2A 1AQYA 2P6NA 3SYKA 4HB2A 3UANA 2GK7A 4FCVA 2OCBA 4EAQA 3BERA 1YZNA 3K0AB 2FPKA 4ZCMA 1U81A 4QC2A 2QQEA 2NQ2C 3B1ZA 3EAQA 3GEIA 3OE7A 4C3ZA 2W00A 1C1YA 3C7KA 3QXCA 4RZ3A 1V43A 4G5QA 4LSGA 1PJRA 2G83A 2PBRA 4JBWA 4TL7A 5FTLA 1P6XA 1HE8B 1VECA 1RIFA 3LD9A 4ZKDA 3AKDA 4C2TA 2IUSA 3BB4A 2NPIA 1QHIA 5L3QB 3PFIA 3T1OA 4B3BA 3U2QA 3TW8B 3V4FA 1E0KA 4M53A 2QTHA 1S3SA 1G8HA 4Q18A 2G6BA 4DHEA 3H86A 2FA9A 1J70A 4LJAA 1ZBDA 1N5JA 3E2IA 4Z1MD 4YLGA 4JLAA 3VU9A 2R44A 1UBCA 2XZOA 4B74A 2G9NA 1P7CA 1XEWY 1NBMA 4H9GA 3SI7A 821PA 1GILA 1P4SA 1U2RA 3QXSA 3R8CA 1Z0IA 3LXXA 3LH5A 4HB4A 1JXOA 2IYYA 2QM7A 3NG1A 2WAYA 4RD2A 4EIWA 5TMPA 4TZ6A 4WBSA 1TADA 5DLQC 2O8BA 4B47A 2RGXA 4NKRA 3U5ZB 3K0CA 2OZEA 2CVFA 2VO1A 2YZ2A 2J87A 3FYHA 3KQKA 1CS4C 2GXUA 3AVPA 2FJUA 4DSOA 3AGPA 3VKWA 121PA 2A5JA 4DXAA 3KQHA 3CPEA 4N0DA 1R0YA 4ZCLA 3DOFA 4KFUA 1QG2A 2Q9AA 3O47A 3OIYA 3X1ZA 2ZJ8A 3A36A 2GZAA 1MABA 2ATXA 4QG7A 3ZZTA 1VIAA 2AFHE 4KYIB 1AA9A 2QTVB 1JQLB 4NYJR 4OQNA 2AKYA 4RD3A 1AIPA 1JR3E 1U98A 5E7IA 4A2QA 5G3YA 1XPUA 1GRNA 4DLUA 1KI6A 4G01B 1VDZA 4HZIA 4DEXA 1DVRA 1UDXA 3R20A 2P67A 2WIBA 1E9CA 3WRYC 1E2HA 1XMJA 2EFGA 4BRWA 3U3JA 3ZIAD 1FUKA 1Z6XA 1P61B 2A5FA 3U3OA 1G8YA 3EA0A 4JBXA 5JEEA 4IDHA 1GKUB 4UXIA 4ZO4A 3KKPA 3QPVA 1CIPA 1EFHA 1K8RA 5K8TA 4OK6A 1SKQA 3Q8XB 1KSFX 1G3IA 3GLIE 1H8ED 1E2LA 5HE9A 2WV9A 4TYYA 2GKSA 2F9MA 4JYCA 1VYTA 2IS2A 3O8BA 4ACBA 3KB2A 4NYJQ 5FUWA 4XD7D 1GL6A 2NO6A 4JBYA 4DLXA 1BH2A 1VTKA 2CLCX 1F2TB 2YWFA 2QP4A 3SJBA 4L5BA 2EYQA 1FMJA 4DVGA 1I2DA 2CMKA 1U94A 1CU1A 3ZS8A 1XWIA 4B3DA 1O3YA 3AVUA 2DYKA 1KAOA 1Z28A 4X8LA 2F3TA 2CHQA 3TQCA 3MAAC 1TNDA 2RHDA 4JLBA 4LJYA 1ZYUA 3SNHA 1XMIA 3RVBA 1IXRC 1UKVY 2N1BA 5DSZA 3BH7A 3OIVA 2ZSAA 1I4TD 3L0PA 1W1WA 2NO0A 1MT0A 3NDPA 2QTFA 4QGFA 2YOHA 4LJ4A 4QGAA 1IY2A 4K46A 5LB4A 3K1JA 2RKOA 3EZ6A 4C0BA 3AF1A 2GZHA 4KLNA 2XGJA 4QGGA 2Q6TA 2Z4RA 1G19A 5CYPA 1NKTA 2W0SA 4Q4LA 4TMTA 3ZVNA 1RE0A 4LDJA 1G5PA 3A4NA 5AK0A 2FU5C 4IW3B 5KNDA 2JLSA 4BE7B 1AK2A 4IVQA 1EGAA 1RVDA 4MRSA 3QXXA 3ADDA 2ZRAA 2BV3A 3MG9A 1Z8FA 1GFIA 4O0MA 3HJNA 1LB1B 2GESA 4Y0AA 1KI8A 2GXAA 5AUOB 2DFTA 1JQJC 3BE4A 3RC3A 5L3QA 1XB2A 1VG0B 3DM5A 2ZYTX 2ZSEA 3FHCB 2I1QA 2QL6A 1FTSA 3CLVA 4KBFA 4XIGS 2BMDA 1UKYA 1QZXA 2ZRNA 2O8CB 5EJEA 4IOMA 1EG7A 4FXPA 3E5HA 3PITA 3MCAA 3LVRE 1Y63A 3VHXA 2YWHA 1TUIA 4RFSA 4P31A 4Q9JA 4P32A 3RRNA 4DCTA 1HE1C 4TYNA 3VHLB 4DEYA 1G7SA 3BFXA 3I8SA 4KFRA 2ZANA 4MYCA 2LCFA 5EUMA 3A58B 1G3RA 1VIYA 1II8A 2O52A 2ONKA 4Z8YA 2V1UA 1S2MA 1FP7A 2WPDA 4GOXA 2D2FA 1H65A 3C8UA 3Q9LA 4GL2A 2PLFA 1YR9A 1Z6AA 1TF5A 1XMVA 3L0OA 3U44B 5CK4A 4LJ5A 3SHWA 3B1WA 4HAVA 4XWKA 2FPLA 4L8GA 3GLIA 1MRSA 4NPHA 1F2TA 5FOWA 1KY3A 4A6PA 4A1FA 2WSSA 4JJKA 4KV9A 3CX8A 3KKQA 2ZXUA 1NRJB 1OB5A 5EZ6B 2A5YB 1CLUA 4XSGA 4DLSA 2GJSA 3V9PA 3DVLA 1AJEA 1LFDB 1VCMA 1E9FA 4MGZR 2BMEA 3JZAA 3OE7D 4U00A 5EE1A 1DARA 3EWAA 5JLJA 1JEEA 2JCSA 4FN5A 2Q3FA 4Q21A 1E2KA 3U3KA 3FMOB 2GBLA 3LDAA 1FP6A 4GRAA 2P6UA 4XWAA 4HI0E 4IDQA 1GKIA 4CEIA 3UG7A 3TMKA 3N2EA 5CK5A 2NIPA 3ZLJA 2ERYA 1TL7C 2HT6A 4FI3C 3AUXA 3MFYA 2W2VA 4GMXA 5KPDA 1KO7A 4I1SA 4DIEA 3CF2A 4KFSA 1N25A 1MO6A 1M1YE 1EESA 2B21A 1S9DA 3QOFA 5JMTA 1J2JA 3CRQA 3FB4A 4G0NA 4Q4HA 3VX4A 2WWYA 2QA5A 2GF9A 1GWNA 2H5EA 4FW9A 4Q1DA 5FL7D 4Q00A 4A8JA 4A82A 1SXJE 2J1LA 1R4AA 5K8IA 1Q12A 4QGHA 4BEJA 2BBSA 3VAAA 5EXSA 4JJZA 4IVPA 1RRPA 3AGQA 3K70D 4S35A 3HPRA 4IEIA 4ABYA 3T06B 1T91A 1GSIA 3FDIA 4JLJA 3AVOA 1BYIA 1YZKA 2I1VB 2XTMA 4LHYA 4LJ9A 2ZREA 5AUPB 1N6PA 4PO1A 3NIBA 4HAYA 1G7RA 4PHGA 3CONA 3X1XA 4LK2A 5JRJA 2ZRFA 4O25A 5FTMA 5CITA 4AYTA 2FOLA 4OQXA 2C96A 5KSOA 4W9MC 4LX0A 5CIQA 2CL6X 2LKDA 3RLFA 1OIXA 4A2PA 5H1YA 2IUTA 4A8JB 2IBMA 2J59A 1QHHB 1Z83A 2W6JD 4BFXA 2WM9B 5E4FA 3NBYC 3NC0C 5EP4A 5SZKB 4R2HA 4Q4HB 2BMFA 1NY5A 4XH9B 1DTSA 4EPXA 4GBMA 2IYWA 3EZ9A 4UNSA 4Q9LA 3B8HA 4ZI2A 4DCVA 1BO6A 3KXKA 4Q9IA 1CEEA 3N70A 1P75A 2O8EB 2V7QA 1XZQA 3K0AA 1BMFA 4FMDF 4JSTA 1Z63A 1EWRA 2PX3A 2V9PA 2IYQA 2BCGY 3A4MA 1MV5A 4GNKA 4NDZA 1HQYE 2EWVA 1NG9A 3K0EA 3KQUA 2I3BA 5EE9A 2ANBA 5FTKA 1T8TA 2WOJA 4URWR 4MDFA 3U6BA 1FW6A 3VR4A 4LZZA 5EP1A 1J90A 3D7MA 3PUYA 1NSTA 4HDCA 4PZZA 4TQAA 1LY1A 1T5IA 2ZR0A 3OEHA 3QKTA 4OI4A 2VYFA 3PQCA 3Q72A 4X8HA 5EZ5A 3T35A 1NJFA 1XEFA 4C0HA 1E99A 3I61A 3FFBA 4PO8A 1S1CA 2JGNA 3EPKA 1SVIA 5EE5B 3ZS9A 3B7GA 2VHUA 1Z0JA 2QBYA 2ZAMA 4JIMA 3JVUA 3DO6A 4DLVA 2XOKA 1T6NA 1ESNA 2VA8A 4ACAA 1Z47A 3QXJA 3TIFA 3D8BA 1TEXA 4B6FA 1WMSA 4URUR 5DI3B 1QF9A 3X1YA 3MJRA 3P1JA 4TQUS 3TBKA 5FBVB 2VHTA 1OE0A 2WAXA 3DDCA 4I1UA 3SJAA 1JPJA 2R9VA 4LHXA 1F5NA 2AFIE 2RHMA 3EZ7A 2VSFA 5LD2C 2XXAB 3K0FB 1A4RA 1U90A 1ZCBA 1UDWA 1N2CE 1P9WA 4PAQA 2ZS7A 2CCJA 4M1WA 1E9RA 2HLDD 3QKSB 3CX7A 4UJ5A 2X19A 3AVTA 4LGMA 5FPSA 1FX0B 1P72A 2HT1A 4DCUA 1NNEA 3CWQA 1FQKA 2V54A 4M9QA 3MLEA 3P4YA 4UNPA 1N6IA 5BW8A 1I4DD 1E9AA 2OV2A 3QKRA 2C04A 2VTKA 2DWQA 1QVRA 3RC8A 2B8WA 1DS6A 3QJYA 3T1QA 2GEVA 2CCKA 1TPZA 2H8KA 3OAAD 4RZ2A 4BWYA 2PCJA 3GJ8A 2IS1A 1WQ1R 1RRFA 4Q1CA 5M04A 3VKHA 1M74A 3MUFA 1HURA 1IHUA 3NWJA 4G3XA 2GEUA 4YMWA 4QM6A 4JVSB 1TQDA 3B60A 4Y0VA 4E03A 1U8AA 2JLRA 3WMFA 2BOVA 1W48A 4NONA 3BBPA 1HV8A 2Q9CA 1OFIA 4Q1BA 1KNXA 2HCJB 3LA6A 5LPNA 1NMYA 1YRBA 3BS4A 4PQRA 1KHTA 4B2PA 1C9KA 1EFTA 1XEXB 2F3RA 2XB4A 4NCJA 3WNBA 3MGCA 4B34A 2ZE6A 4JLPA 1PV4A 1K5GA 3O8DA 4EQ6A 4EJSA 3ZD6A 1KMHA 2FGJA 2QG6A 1YZLA 1EFRA 2VHQA 3SFZA 3ZZUA 4TMXA 5HE8A 3ZVRA 3C4JA 2V7QD 4P4TA 3RHFA 1VHLA 2X1VA 1KZGB 3LQQA 3NBXX 2GDJA 5AJXA 4F4CA 1WBBA 1GDDA 4YXWD 3UATA 2OCPA 1E79A 3ZJYA 2O8DA 5GADl 1TF2A 3AF4A 2FZ4A 2OBNA 4IXNA 2QGZA 4OHZA 5IF9A 3IQWA 4US0R 3QNUA 4MGKR 4DC9A 4B43A 2D7CA 3F8TA 4NZYA 2YC4C 3ZZ0A 2RB4A 3T5DA 4AG6A 5FOXA 2G88A 1G7CA 1GNQA 5C18A 4EQ6B 4CF7A 5F9HA 2P0EA 2GHIA 1XEXA 4PHFA 2X2FA 5EQTA 2BM0A 4POAA 5GVSA 4A2WA 5AWFC 1IONA 3CRMA 1IN6A 2VP0A 4MA4A 5JBQA 3KFVA 4D4MA 2RGDA 3J81k 2WICA 2JLUA 4KU4A 2GZDA 3SS8A 3SJCA 2IYTA 3X1WA 4O2RA 2ZE7A 1GRRA 1JR3A 1ZNZA 2G3YA 4MUAA 4QBFA 1Z0AA 4PPQA 2P3SA 3AEZA 3WYAA 2WSSD 2B8TA 2DFLA 4OHXA 4TYQA 1E1QA 1XCMA 3EC2A 4HZUB 5JS7A 4XVRA 3OEEA 1XPRA 5GJBA 4C0AC 2ZUCA 1SZPA 2WSMA 1AGRA 4A0GA 4XWOA 2WPDD 2O8BB 3EASA 4BFZA 3NDBB 3DM9B 3EX7C 3IEVA 3CM0A 1CJKC 1N5LA 1RFLA 4AKIA 2IYLD 5KNCA 4P4SA 1YR8A 3CRVA 4W7SA 1ZM3A 5HZKA 3W5JA 3AVXA 2J7PD 4TL8A 1AQUA 2QMOA 4IOKA 4XJXA 1XBTA 2QE7A 3VU9B 4Q1AA 3K53A 3UMSA 3ICEA 1W44A 2FX3A 4NE2A 1WDTA 1NP6A 1ZJ6A 2ZJ2A 4JL8A 3JZMA 2ZQ5A 3WMGA 1E9SA 1UBFA 2OLKA 1P2SA 2R6AA 3L8ZA 4D80A 1GNPA 2FSIA 3Q3JB 4NP6A 4LOAA 2C98A 3AB3A 3ASZA 1VCIA 5DI9A 4CVNA 1OF1A 1F48A 4FIDA 1OIVA 1XXHE 2BIFA 4NYMR 5KHOC 4LPKA 3B9PA 1D9ZA 3UXMA 4C0LA 2BBWA 2O0JA 2KB0A 4B3FX 3RS7A 4Q03A 3RSOA 4F92B 2QP9X 1G5RA 3QG5A 4M8NE 4M9ZA 1E1RA 4GOKA 2JJ1A 4IVRA 4Q02A 3W3ZB 4BLOA 1J8MF 1G6HA 1DG1G 1ZIPA 5EXTA 3B6EA 5DNYB 2ZE5A 4LBWA 3L0IB 1RJ9A 1JJVA 2ZPTX 4FMCB 2B6HA 4KCGA 3HYTA 2V6IA 1RKBA 6Q21A 2FFAA 5KOYA 1DELA 5J40A 1RJ9B 4NYMQ 2KWIA 3DMDA 1KO1A 3PVSA 5P21A 2GAOA 3W8RA 1E0JA 4KI0A 2PJZA 4XTRA 2CHGA 4V02A 2GXSA 4A9AA 4Q47A 1P5ZB 4Q7LA 5C1BA 1XNJA 1A2KC 2WTUA 5H8WA 3X1DA 2W2TA 5DHFA 2YOFA 4DLWA 4TQ9A 2QMUA 1W49A 1AKYA 1T3LA 1TAGA 2X2EA 2C9YA 3NBZC 5EXXA 3T61A 4PZYA 3TE6A 5JHHB 4XD7A 3WY9A 3GFPA 4IJMA 1C4OA 1F3OA 1FZQA 1E98A 2OUKA 4LUCA 4EPRA 2AK2A 721PA 3I8XA 3PEUA 5TDHA 1CRPA 2A30A 4C2UA 2F7SA 2CDNA 1IQPA 3KXLA 2JLYA 1KSHA 4PC3A 2YV5A 1X8JA 4L9WA 4MYTA 3GEEA 4KVGA 4MRRA 1NJGA 2CVHA 5TY0A 2GCNA 4GZLA 2ANCA 4XSHA 5KSYA 3RS3A 2JJ1D 3GLGA 3AP2A 4G5RA 1UADA 5FPTA 1NLFA 1E2IA 1ANKA 4MRPA 1EFUA 2AN9A 2REBA 1KAGA 1E6CA 3F3YA 4QRHA 3U4QA 3PUXA 3I4LA 1M7BA 2G0NA 1UBGA 4TN1A 4PO9A 1XTRA 1NN3A 5FUYA 1IXZA 1JECA 1SXJC 3RS2A 5FUVA 4DRZA 3R7WB 3OF5A 5B2ZA 1NN0A 1WXQA 1ZNYA 4LBYA 4D81A 2GJAA 3BH6A 3DPUA 4AC9A 1GKYA 3AH8A 3CNNA 4HLUA 4TWZA 2IF2A 4PC6A 5D3MA 1W4CA 2PZFA 1G41A 1GAJA 2ZI7A 3W34A 1E2MA 1H8EA 4AG5A 2QROA 2QT1A 4GSYA 3FHOA 1J7KA 1KO5A 2WJGA 1U9IA 1VPLA 3BXZA 4WXPA 2J5XA 2ZRKA 1TUEA 4II7A 1EXMA 1NVUQ 1YVDA 4E5UA 3X2SA 1WBDA 2G1JA 1OT3A 1SXJD 4OK3A 3FPAA 4WVFA 3P20A 3R9IA 2ZJYA 2AR7A 2JIZA 2PCLA 2OFWA 3KJHA 3R9WA 3PUWA 5FI0B 2YYZA 5JI3E 3OIWA 1ELOA 5FL3A 4BFVA 1G64A 3TUIC 1RC8A 3DOEA 2IYSA 3AKEA 2JA1A 2FFQA 3FKSD
chains in the Genus database with same CATH superfamily
2YW2A 4BZZA 1PZEA 5IHPA 1LNSA 3KX2A 4BN5A 4EKDA 3NXSA 3UHFA 2O1SA 1F2UA 1YIDA 3DKRA 1RPAA 4BQIA 4Z2AA 3U0VA 4DJJA 3ZQJA 5CM9C 2Y1FA 4FFNA 1BRTA 3JARB 5K0JA 4OXIA 4U7TB 1N5MA 1EWVA 1TQ4A 3H9CA 2XWSA 2GMWA 3IJEB 5G0VA 4WK0B 3BHJA 1PS8A 4IG9A 2WJ6A 4BO3A 3RFTA 2FLVA 3UBTA 1MZPA 4IDDA 4A15A 2NSLA 3CF4A 3D8SA 1NQAO 2NXWA 3SM3A 4WI1A 1L5MA 5CFQA 3I4FA 4AXXA 3RBXA 2SHKA 2EYUA 1AK9A 1A3CA 1FMTA 3LHSA 4NBUA 3UYLA 3ZQ4A 2H4JA 3EYAA 3JSXA 4EGFA 4EUEA 3U4AA 2FH5B 3DEYX 3ANMA 5JFOA 2KBFA 4U4AA 1Y6FA 3T3IA 1W8DA 3NH9A 3VDNB 1XD8A 3BCUA 1M2OB 1KO4A 1G9SA 2C2YA 3GO4A 1EA5A 4MUXA 2PU7A 3A1TA 4B44A 4CUJA 4PIMA 2RB5A 3JYOA 4LW8A 2JKZA 3ZWVA 3HHPA 5BVGA 5ADHA 1JDSA 3L7JA 2L17A 4AK9A 2WIJA 1Q5PA 4QXRA 3ET4A 5TXGA 4FQ8A 1DAIA 1KDVA 5D86A 4ZEMA 4PPNA 3CX6A 5BQ3A 1G16A 3MMSA 4ROSA 4UM9B 5B36A 1UBOS 3I28A 5JWHA 2E7ZA 3L8DA 4YB8A 3L8HA 3L8EA 4YJ2A 4MS1B 3KR9A 1W2GA 2JATA 4OHKA 4YFYA 3UB3A 3KETA 3WV4A 4X1KA 2XA2A 4L9RA 2IELA 2VRCA 1E20A 3I9FA 4RV9A 1KVUA 1DAHA 1UBMS 1SB9A 3D7KA 4RMNA 4OUDB 5DP1A 2ZBUA 1GUDA 1SIOA 3DKIA 4JHXA 2GM4A 4KXUA 1GA1A 4V3BA 2G1PA 3FOAA 2Z2JA 4HNGA 4CIYA 1XEWX 1BEUB 1FYFA 3ANLA 4ICIA 3PXAA 3W05A 3D3EA 3SK0A 3BF7A 1OUMA 1ZC3A 1XROA 5J1TB 4HTFB 5CLFA 4G4JA 4D0SA 5DYGA 5BW5A 3F5SA 3M5WA 1QVWA 5EIXA 1N2OA 1J06A 2JC3A 4RANA 1ML4A 4D9HA 1J9EA 1H2EA 4F7WA 3KZXA 5KSPA 2Z1DA 4LNUA 1OWNA 1O89A 4A2CA 4QTXA 5H70A 3S68A 2YXNA 4RA6B 3W5AA 1B14A 2Q3JA 4P9NA 3W77A 3AZPA 1SEPA 1TFRA 1YE8A 3COJA 1NBME 1V7ZA 3CUWA 2B4YA 4F56A 1LRJA 5AJTA 3RS8A 2HXSA 5EWMA 2NAPA 4TXJA 1ULSA 4PC7A 1RRCA 4UFNA 1A7UA 2QYHA 1M6YA 3NHRA 2CBZA 2W2MA 2E4AA 4F0JA 3RKSA 3OCUA 4ESOA 1TU3A 2QDKA 3ZQ6A 5EMHA 3UWSA 2A0WA 3MGGA 4PZUA 5A02A 2ZTVA 4A92A 3BZBA 3CLSD 2GBLC 4LTDA 2VXOA 4MV8A 4PYJA 1UDBA 1T5DX 1GA6A 5D3KA 4RHCA 4X54A 3S1SA 3KOYA 3C6ZA 4IEEA 3AM1A 4JU8A 2R5FA 3L0SA 2ACVA 3TRHA 3E48A 3ZK7A 5L95A 4XM0A 1XXHB 2JJQA 2Z6VA 4U3JA 3U9TA 4AROA 4BLUA 1TEZA 1NM5C 2J9RA 1I3CA 2NUAA 2VH1A 4L4YA 3RODA 5AVTA 2BFPA 1BHQ1 3U16A 4C0WA 1XDSA 4WOJA 5J2UB 1UMBA 5EHNA 5BSVA 1N5KA 3GG2A 4KWTA 4F4IA 2UXCB 4RZUA 5GAJA 3R0JA 3S7ZA 2DQYA 2D59A 3KKNA 1D2MA 3D8UA 3D59A 4NTZA 4UTPA 1EXVA 1MRNA 3QEBZ 2FFJA 3ZWBA 2ERXA 4IRMA 2RGWA 1Z0SA 4D8VA 2G07A 2XUZA 1GGMA 5CU7A 1RHKA 1QDLB 3UUGA 1UP7A 2K4MA 1BHSA 2WWIA 3STTA 3HI6A 5CB8A 1W5TA 2A0XA 4BFYA 3Q7RA 4MQEB 2NZUG 3CZAA 1I3MA 2OK8A 2WF9A 3X44A 1EHCA 5BW4A 3DKVA 2C5GA 2WKQA 3QH4A 1FDWA 3OU6A 4HLDA 1PSDA 4ZAZA 4E07A 3LUHA 2O1WA 1M34B 2G08A 3CUVA 1EFPB 1ZXXA 2WEKA 2ODBA 4I6EA 4PHHA 4XDYA 1JQBA 2VZ0A 4M1ZA 4J49A 3HWWA 3GB9A 3Q9UA 4E94A 3HY6A 3L4JA 4B7UA 4MR7A 1SUIA 5ICMA 3TW4A 2AL7A 3KKEA 3MS4A 1X7XA 2DWPA 4ZAVA 3FIUA 3NONA 3GNQA 5CIWA 4I3FA 4BEBA 1RXYA 4GPEA 3RSCA 3ZNOA 1K68A 3LSYA 2YFHA 5CXXA 3G23A 2JKVA 2XDWA 4TV8F 3WYFA 4MWDA 5CDUA 2O6LA 3RBVA 1L4BA 1C9YA 3HKDA 1RFGE 4UTNA 3FOWA 4AQDA 4BCDA 2BDTA 1SOAA 1EUQA 2Y3IA 3MUNA 4Y9UA 5CVUA 1SD1A 5ESWA 4BRUA 1Z08A 3A6EA 1W59A 4X45A 3H7AA 1SVOA 5IVIA 3UJBA 3ZVKA 2DKNA 1JFRA 3ZHBA 3A9UA 1JG3A 3G5AA 5IJZA 1EP1B 3B1YA 1JKMA 2OCYC 3B85A 4FK8A 3OE1A 4UPEA 1TEHA 2DH5A 5THQA 3JZDA 4C4YA 3TLAA 4KQKA 5AFSA 5GOTA 1O54A 2BTQB 2YJGA 4V0OA 1YJCA 3C74A 4ZQBA 2QG4A 2PL9A 2BHLA 4Y6QA 4M4SA 4ENRA 2PH7A 4BMDA 2BAGA 4J16C 4QYTA 4EG7A 5FAKA 3KQNA 1LRKA 2Q3DA 5C8VA 5BSFA 1BE6A 1MC4A 1OHHA 2L18A 4BNXA 1KZ9A 1YR3A 2XKKA 4F4DA 2ZU6A 4ZKEA 5IDXA 3LUKA 3EFHA 1VE5A 3WK6A 3N74A 2O0HA 2E4YA 2ORIA 2QT9A 4FGUA 1Z12A 4RTLA 2O1EA 1SELA 2NXCA 2DULA 4G1EB 4QDJA 4YQZA 4QHSA 5K8VA 3LTNC 5KVSA 3R7SA 2NTYC 1W4LA 1KYQA 1N6LA 2BFMA 4XVUA 2XITA 4FW8A 4LBVA 5AD1A 4MW7A 2NO7A 1FTGA 4J16A 1JZTA 2DFVA 4N8EA 1ISIA 3DTTA 3K7EA 2SCUB 3FBGA 3LM8A 3T9DA 3TFOA 1VMIA 5A62A 4M36A 3WK4A 1FFHA 1DINA 1W4BA 2X5NA 3H5NA 3V1LA 2CHUA 4K6OA 4ZEVA 3W8DA 1RXSA 1RBZA 5JFGA 1VMAA 1P9LA 4OH7A 4OHWA 5FXMA 2VJQA 3D4BA 4UAUA 4Z9FA 5JO0A 3ETLA 5CJ2A 1S3FA 2C9DA 3OZAA 3TBHA 4BV3A 2OCIA 3U40A 4XYGA 2HRDA 4R1OA 1P9NA 3O94A 2LKCA 4U5XA 4AY4A 2M6SA 3A7EA 2FUEA 4IHJF 1M6WA 5CM2Z 1EXNA 1OYWA 3EZNA 4NJEB 1XRLA 3VU3A 5KWJA 1SHZA 3DNPA 1E6EA 1YBHA 5CA1B 2G8NA 2YRFA 5DNDA 5DN6D 3ETNA 2VJLA 2Y1GA 4NULA 1L4KA 5KTSA 1V8PA 4A8HA 3B9QA 2OC9A 5LYJA 1NOJA 3BH0A 1U04A 5B2FA 1HBJA 5D1NA 3NPMA 3NHWA 5M5BA 2HGZA 2REQB 3AV0B 3CMMA 3I0NA 1D2EA 1JWAB 4NYIR 3SY8A 3QOWA 4HH1A 4E7PA 1FVHA 1RM4A 3EGOA 3H11A 5CT8A 2V8OA 3AOGA 2YQ5A 3A3YA 3AEUA 1SKBA 3I76A 3LC1O 4HVAA 4J3JA 2WWTA 1Q21A 3CLUC 1OPXA 4AN4A 1U2EA 2HADA 3NASA 5TE9A 4C89A 3NHPA 4UDXX 3PFBA 1IM8A 4JLUA 4ARVA 2NMVA 4E5DA 2D8MA 2JD2A 3T5MA 2OM6A 2GBGA 4FEYA 4LZPA 3N6RA 1X74A 4QGBA 2PV0A 1L7OA 4X85A 1I30A 2ZI9A 2PR2A 2X42A 3V55A 1MBZA 3IAS6 2XWBF 2C99A 4RZXA 5ER9A 2G71A 3K92A 4GSKA 1DCFA 1T10A 4P4UA 2JI9A 4OP3A 2MJLA 4XQGA 4N01A 2WAMA 4WZAE 4PYIA 4LVNA 4WMLA 3SZRA 5KHLB 5B30A 3LWNA 3N5CA 4DCOA 3MA0A 3KP1A 4OB6A 3KB1A 3PNVA 2C4TA 3TH5A 1CSEE 2X4DA 3ORQA 4DJTA 2O0KA 4B3IA 1NRWA 1YHZA 3NV7A 3ZK9A 3OQIA 4F91B 4OLBA 2PUFA 1GTMA 3DQPA 2PTGA 3HBAA 4HSEA 1MR3F 4HNAB 5GV8A 6ABPA 1N5RA 3IOEA 1YOVB 2AEFA 2RHCA 4HCJA 4OBBA 2YWCA 2WJVA 1V35A 4W9RA 3DMYA 3LU1A 1XZBA 2CXXA 3NKVA 1XZKA 3LYHA 5CB4B 3MQ4A 3C45A 4RYDA 4B7CA 2BE7A 1NBAA 3BMQB 4RO0A 2QRNA 4IXMA 4IOJA 4BLPA 1QJ4A 1NF3A 3KOOA 3HN7A 1P3JA 3L9XA 2XMBA 3BUSA 3TLYA 1X1TA 3OPYA 1D9XA 3E22A 5GVRA 4DM7A 5AHWA 3RVMA 4ER3A 2FZVA 1F8FA 4W5OA 5ALHA 1JNYA 3Q0EA 1AA6A 2AZDA 1P1BA 4UMFA 2IQIA 1SVKA 4OI0A 2WPNA 3DCIA 5BUCA 2Z2KA 4WKGA 5L7TA 5EJ8A 2GERA 1FIUA 3B6IA 4DEVA 3WB0A 3IE2A 3E2MA 1ODKA 3QUAA 4LI0A 1MTZA 3OQPA 3NIWA 4GKJB 2QUIA 1P1CA 3AFHA 3WQBA 4CKCA 1V45E 2V7VA 4KYUA 1AQJA 1LF5A 2IHUA 2W6CX 4DWJA 4NFLA 4O29A 2AN3A 5EP2A 5A71A 3VYTB 4OL0A 1HZJA 5IKEA 2GPYA 5GZ1A 1W0JD 2VOEA 1E66A 1H6DA 2FEOA 1A76A 1LTHR 2Z56A 1R9MA 1RP7A 5ILQA 4D8XA 4BFSA 2POCA 3WTBA 4NE9A 5ALFA 1Q2UA 2EBUA 2PT9A 3U3MA 5JTTA 1GSAA 2G1KA 4RXTA 2C7PA 4RA6A 1MABB 2XJ4A 4FMDB 1OFTA 2FFRA 2N46A 5GGXA 2JGLA 4AL4A 3LHKA 5EWLB 1ACMA 1YRAA 1HLFA 2OCLA 1DU4A 3RF7A 1NBOA 4ZANA 2IBTA 3O6VA 4QARA 2Q3BA 3EY4A 4GI2A 3WB2A 3SMVA 4CEJB 2HREA 2R6CA 3ETEA 5F51A 1Y9ZA 1U3WA 4GECA 4M87A 1QZTA 1W94A 3HNRA 2IS6A 4GOND 1HT3A 2C7GA 2DUMA 5JDCA 3PFGA 1GG2A 3AF5A 1DP4A 1G7TA 4PC1A 4FEGA 1JR6A 3QX7A 3HCWA 5IWCA 4YIHA 1JXQA 3HYRA 4CTMA 1ICEA 4EO7A 4KXWA 2C5HA 2C5EA 4KOAA 4LDAA 3STWA 1GTRA 5MHTA 3CZPA 1SQGA 3ZJVA 2E4ZA 4WK6A 3NHLA 2FFHA 4UDNA 3PC2A 2AE1A 1XD2B 1YRWA 4R8KA 3FZNA 2PLWA 1DC5A 4AJ9A 1DWUA 3L7AA 2J3KA 5J2TF 3QEJA 4R4JA 4P81A 4GICA 5IH7A 5ARCA 3WLSA 621PA 3AZOA 3GJ5A 1US8A 1WCYA 2R6HA 3LQYA 3PSAA 1YVRA 1B41A 3WIDA 2ACWA 2M98A 4H1VA 4RPCA 3NRCA 4HH4A 4UZSA 3IVCA 5IHXA 2OG1A 4BN4A 2G63A 4OV6B 1S8NA 3UKJA 3WBJA 4DBZA 4GEGA 1AS2A 2O48X 1FFDA 1KK1A 1M1NA 1Z5ZA 1CRWG 1QLJA 4HQLA 4ZMSA 2XUJA 3VNVA 3AJ8A 1ZY2A 5IN5A 3P4XA 3AHCA 4MKZA 4MMXB 1EXDA 1PJQA 3ZNPA 4S12A 2Y0PA 5DGCA 1X13A 2QXUA 3G88A 2FPRA 1TW2A 1JKIA 2WTNA 1O96B 2DR2A 1CY4A 1MOZA 1IZ8A 2D2XA 3KQPA 4JJAA 5JPDA 1KIFA 1V71A 5DYTA 5JCZA 1DIOB 1EX9A 2DKFA 4WLOA 4EA6A 5E1BA 1FU4A 4YCBA 1R5OA 3GC6A 4BJ3A 2IPNA 2WHQA 1GPAA 2CMFA 2QQGA 5SICE 1G2PA 3COPA 1RPNA 1EVZA 2LPMA 1NVVR 4ZU6X 2QRLA 2VDWA 1TD1A 1G42A 3ELBA 5JAUA 4K7JA 2HSZA 4UEOA 4L50A 2WTEA 2BF4A 2BLNA 4K05A 3CVVA 3OCYA 5JJKA 1P5HA 2C8JA 2ZS8A 2Z5FA 4W5HA 3G6KA 4O8CA 3TUZC 2OXTA 3UEOA 5IYZB 3P2MA 1PT7A 2VJYA 3IVXA 5B58T 4CCAA 1L5LA 1FSZA 4S2UA 1JHRA 4TXMA 2WUVA 3W9BA 1U28C 3CZRA 2QN1A 1VCHA 2OILA 3ZTYA 4MO2A 3PQFA 3PUVA 4HRYA 1GP2A 3M9LA 1CEYA 4QFMA 1VP9A 1NI4A 3GX1A 2VP2A 4AD8A 1DO8A 2QV0A 4TM8A 5A5DA 2XLCA 4N48A 3IRUA 4GUDA 3S2FA 2HXYA 3RRZA 4IH9A 3N8KA 1NF2A 2G82A 2ZVQX 4WECA 3KLMX 3OZEA 2RHJA 1OXTA 2MSEB 3NALA 3K32A 2GNAA 3F47A 4HG2A 4ZJUA 1ZONA 1WR8A 2WYOA 1L5KA 5CB4A 1ZK1A 5FBRB 1RXVA 3O8LA 3SR0A 1MD9A 4FEEA 4PG7A 2RGAA 3NIDB 3OCCA 4IFTA 1IL0A 1ACJA 1QMPA 4GT1A 2GZ2A 4YBZA 1UM8A 2BHNA 1SVMA 2QKYA 4F5WA 2CNOA 2RHWA 3IIJA 4KQXA 2FMFA 4LJRA 3FLEA 1JDUA 3IE0A 2O2IA 4D9FA 4YV2A 1AKTA 2DT5A 1IY9A 2GCGA 4N5HX 1E79D 1Z7GA 1U0GA 1U4OA 5HCIA 3A6DA 5LUBA 1PLLA 3HBLA 2H17A 4EFDA 3EBPA 3GLFB 1E9EA 2GSWA 4K6CA 5H83A 1NMQA 4QYMA 2OVBA 5AVSA 5IABA 2IDMA 3Q11A 1T3HA 2QQ0A 5JCJA 1RBMA 1SD2A 1FNCA 1JT9A 3OZRA 4KMOA 4UNNA 2PKQP 2QXTA 4ZZIA 3SBDA 2W83A 1ZI9A 1CY1A 4J4HA 3V00A 3ZE7A 4CQMB 4DLAA 1NDHA 5FH9A 3EE6A 1PJCA 1QH8B 3PDUA 4URXR 2XKAA 4FS3A 4Y1RB 3QGMA 4LRQA 1CF2O 1CT9A 1S02A 4QJ3A 1RI1A 1EK5A 1UT5A 3NHKA 1UJ5A 2A7QA 4ITUA 1MO2A 2ATEA 2ECOA 1EX6A 4N3NA 5ITSA 1R50A 4DMHA 4MJ7A 1LTQA 2B98A 4CI0B 2YUIA 5TLSA 1TT5A 2JFZA 5HUJA 5EKUA 5GM1A 2C9BA 1YZHA 1FA9A 4PBTA 1Z22A 4Q05A 2ZIXA 4YXWA 5IT0A 5TB5A 1Y37A 2UYYA 2C5SA 4PN7A 1CR1A 4XSVA 3MJVA 3SKXA 4J4TA 1CY6A 4NU8X 2NW6A 4RF4A 1H2FA 5DLPA 5KYUA 3UAWA 4DM3A 1OA1A 1WDMA 4L9SA 3O7WA 1BD3A 5DHUA 3EQ7A 2PUVA 4ATNA 4LDQA 1KF0A 7AT1A 3IE1A 2UYGA 2WDZA 1JHVA 1J0AA 2ZJ6A 3GVHA 2OAQ1 3H8SA 4LYFA 4ZAWA 4BNDB 4OYHA 3V8BA 1CDDA 1LJ8A 2VUSA 3FYUA 1PD0A 1T9DA 4FNMA 4CU2A 1QQTA 4M9XA 3V2UA 1YONA 1D2RA 3OJOA 3EJ6A 3UH1A 3VYSB 2W71A 3HVHA 3LLVA 3VPDA 1JNXX 3HXTA 5TJHA 4AP6A 5IUNC 2WFAA 3MN1A 3BF8A 4IQ0A 1E1CA 2DHEA 2QMEA 3OZBA 5EJIA 1R0LA 3MFQA 4ZO8A 1DKUA 2YNMD 5EFZA 1LTKA 3KZNA 2O8FB 2ZSKA 1VKOA 1YU6A 4EJSC 1RU3A 3F96A 2QUJA 2YVKA 2DP4E 2PS1A 3G9TA 3ADKA 1ZN8A 2VBFA 3BFJA 3ESRA 2GJKA 4HFRA 5I8PA 1DE0A 3JRWA 4ENQA 1I6MA 4Q4AB 1WUKS 4BMCA 3K9QO 1REQB 2OB2A 3ZDYB 3TFQA 5FYQA 2QM0A 2CJPA 1Y4UA 3MB5A 3QEKA 8OHMA 3IQXA 3PRHA 3HYSA 5AJYA 3SSNA 1F60A 3HE3A 3PHGA 3WOHA 2HLDA 4XM2A 4OLFA 3MTIA 1U1FA 3CRRA 1PK8A 3CEJA 4MYHA 1GZHB 3ZDCA 1RTTA 3LVFO 4R51A 4MULA 4Q93A 4R1TA 4RACA 5GWXA 2ODNA 2CB0A 2H31A 1U2GC 2UVQA 3E3LA 4KAFA 5BUSA 1O9BA 3WBFA 1V1RA 2Z83A 7GPBA 1IXYA 3FIJA 5AI0A 1WIWA 1Z6QA 3HKCA 3TTUA 4OM7A 2ONZA 3WAKA 1WB5A 4MQFA 4E33A 2XYRA 3MTGA 1ONSA 4LJLA 1UPXA 4P34A 1QIIA 2BONA 4BX0A 3I92A 3O4HA 1U0JA 3S2YA 1NDUA 4OY3A 4WXRA 1GUBA 3RTAA 1NTOA 5IASA 3IAHA 3TSZA 1B15A 1MX5A 2ZCUA 4FHZA 2OBMA 4G9EA 4IEFB 3PP8A 4FOOA 1CERA 2R6JA 3Q10A 2JLQA 3M5PA 3QVGB 3SOPA 1CUAA 1NXOA 3G8CA 3AEXA 1CQIB 4TWJA 3QF4A 4TVSA 3SX0A 2XD9A 1SUAA 3ZWNA 4HLNA 4AECA 1QBGA 2WMYA 4GX2A 4EX6A 5FUXA 4EYQA 4JMPA 4MP8A 4RJTA 4OFZA 5JS8A 4EKEA 3WSTA 3IEXA 3FF4A 1PTKA 1VL5A 5BVGB 10MHA 2O3QA 4RD0A 3SXJA 3T34A 4F93B 5M7EA 1N77A 1S2GA 4FUTA 1AS3A 3GJYA 1PJ8A 4KN6A 5J5VA 3VBEA 1A04A 2F6RA 2QI9C 4YUZA 4KO1S 2VWPA 4UUOA 1I4WA 4HUJA 4XYEA 1RXUA 2WKWA 3BSYA 2WZCA 4HRVA 1U65A 2C77A 3DYIA 4WKNA 2FR1A 4OH1A 3AOEA 2XNDD 3EXIA 1YAHA 4FMBB 4R9VA 3WJ7A 4BGDA 5IN4A 2UUOA 1TK2A 4Q37A 1XTVA 3GLIA 2FZWA 2CE2X 4QXOA 5AJUA 4R0MA 4OP2A 3MLBA 4ND4A 3BKWA 3T7KA 3TMAA 1ZVVA 4C2AA 4HWSA 3F90A 4R2LA 4X6UA 1IM5A 1MQAA 4B31A 3T5AA 3ABRB 1QCDA 1WDKA 5CA0F 3U5TA 1BKDR 4H6WA 5BVHB 1R6VA 1FZTA 5BXYA 1N2EA 3WB1A 5KINB 1EX7A 1G4HA 1O8CA 1IHPA 3BTOA 1C3XA 5HFNA 3W5SA 1KXJA 1J5EB 4G8CA 3AERA 1L5NA 4RKFA 1JN0A 4GOMD 1W6UA 3ZD7A 4F85A 1UM9A 3O1LA 4RXUA 1VJ0A 1Z38A 4IDOA 1A69A 2BM1A 2JDID 1XQXA 2F43B 4NCXA 1IUKA 3SF8A 4AJ1A 4DV4B 2JVIA 3R4VA 3NVAA 3DXYA 3K70B 2Z30A 3C6XA 2ZJBA 3QIAA 5FF9A 2P6RA 1EEHA 1GGHA 3OZFA 3RJ9A 2I2BA 5EZYF 4DMLA 3LC0A 1JEYA 1NYRA 1E5DA 2OWEA 3BGOS 3GRKA 1YS2X 3PVZA 2UYHA 3SVTA 2R68A 1DJLA 3E3OA 4N76A 3LPDA 1NE2A 1N1MA 5E2IA 1T15A 1WDLA 3TJZA 2DR3A 4IKOA 5KQGA 2J46A 4M1KA 4ZXFA 5H7XA 1YZTA 4JJIA 3Q3HA 1ISMA 3WSVA 4QT4A 3SVLA 3DQZA 3VTFA 1W29A 1XMQB 4RL4A 3EB9A 1YQDA 2ZEJA 3QYJA 1JV2B 4FNGA 4LQDA 2H4FA 1NYLA 2MIIA 4J94A 1NL3A 1IBSA 1WF3A 4OJKA 4UUAA 5AW8A 2VKTA 1Q50A 3CGWA 4P3NA 4ZCQA 1HDOA 1QV9A 4Z8XA 1XA0A 2E9SA 5ESXA 1IY0A 4IIFA 3W1VA 3LRPA 3HVIA 4B73A 2PKEA 5HR5A 1Z35A 2PZJA 2MSDB 3CPHA 1XQ6A 2R79A 1CK4A 3N2ZB 4EDFA 3OOEA 4J7UA 5E4JA 3MBIA 3G2QA 3NYRA 2B6NA 2R25B 3NTLA 3Q2OA 3W7VA 2E5WA 2XIJA 3E35A 1X8XA 1XP5A 1M72A 1QK5A 4K8RB 4K9KA 4GVXA 5EN4A 4X0EA 3ZDQA 2QN8A 1RQ7A 1WVGA 3IAUA 1YV9A 4QBKA 4KXNA 2HLPA 4LCEA 2B61A 5CVVA 5KOIA 4RVDA 4QU8A 5ENZA 1AN0A 2LRHA 4ONEA 2F1RA 2GZ3A 4TLCA 4X1KB 4BAZA 2BP7A 2NV2B 13PKA 2QUZA 3FPLA 2ZATA 4DXDA 4DMUB 1AUPA 1NJSA 1YDFA 4UJ3A 3WIEA 3EUEA 1HXHA 3F4BA 3PNOA 4EHFA 4QBIA 4RCYA 3PR1A 4PX2A 2B4RO 4ZT6A 2XTNA 3AR9A 5AM0A 2OFOA 2W8BA 2XT6A 5E1MA 4BWGA 2H7XA 3ZZMA 1RBYA 4HNQA 1ZMOA 2BN4A 4G8BA 3BQNB 1Q1ZA 1DB3A 3KTAB 3LWZA 1P2VA 5IUKC 1J9ZA 1U6IA 5CCXA 2WHYA 1A1VA 2Q8QA 2Q1WA 2OHFA 2W37A 1OI3A 5D5QA 4MARA 1A9XA 4KR3A 3EW9A 1TU0A 3EZ2A 5FT9A 4PLGA 3W04A 1CUEA 1E3JA 4JLVA 4Q3NA 2DERA 4Z86A 2BJWA 5DNAA 1XTIA 1EMDA 2R48A 2HX1A 2Y1EA 2C8KA 3AKCA 5FUQA 5B1IA 3OKCA 3FSRA 3QPWA 4H7DA 1OC2A 3GJ4A 4UHCA 1QP4A 1Y9DA 2IYRA 5FPKA 4B71A 5JYDA 4IZIA 4RMHA 4PVCA 4US1R 3ZUGA 1KSGA 1LX6A 3C14C 3VYWA 1EWTA 2PEYA 4F11A 1KZYC 1L3CA 4F5EA 5HWSA 5NULA 3AXTA 4FHCA 3JASB 2E82A 1A2BA 3PEVA 1A5TA 1CUXA 3PA8A 1YC2A 4DV0B 5EHIA 3L6RA 2X5OA 4J90A 5GY7A 2ZRPA 3PHLA 4Q01A 4XCQA 4M60A 2IUUA 1Q0LA 1G8MA 4RV4A 3RWOA 1AV6A 2GM5A 5K8UA 4BLSA 4OGLA 1JR4A 3IHKA 2OAEA 1PGOA 4IM7A 4ML3A 3GFOA 4EGJA 4L0CA 5KDDA 4FFBA 1ZOSA 4DQUA 2WI8A 5K0NA 3NKLA 3H9BA 1LDMA 1ZUNB 2GPTA 4IFEA 1P2UA 3DV2A 3H5AA 4NV1A 1ADBA 1RM0A 5AJVB 2DLCX 5EIWA 1IXSB 3UTCA 4AMGA 1LNZA 3CEPB 2FTKE 3ZCUA 4C0XA 4X7PA 1ZMXA 1Z7EA 2SKEA 4PAOA 3VR6H 4C1BA 3NOXA 2P6OA 5GONB 1UMDA 4IKEA 5A3QA 1ZHFA 4O1HA 5C8YF 4NF2A 1MAWA 1HH4A 5C35A 4JKIA 5JOQA 2Q2VA 1O5IA 1SG9A 2VCEA 1BWRA 1W0JA 3KPWA 2WUDA 1GNSA 1I2BA 4NMLA 2GVZC 4R54A 2KBEA 3PXUA 1J09A 2IEIA 4DJAA 4ZJYA 5K3AA 3L07A 3PNSA 2O7QA 3VI4B 3A1VA 3F1LA 3HDGA 3L0YA 3N2IA 2X4GA 1JJIA 1WMDA 3KKKA 3R5TA 4FMCF 2YHUA 3PHIA 1G18A 4Q4JA 1M54A 1Z0KA 2CXHA 4H1WA 3KWLA 2XJ9A 2VWHA 2R87A 2C2HA 3B70A 1B23P 1IDOA 1KI7A 4IFBA 4FBGA 4M9RA 3BDIA 1X86B 3RQSA 5KMGA 2G76A 1Z5WA 2EJCA 3HL4A 4TMVA 3UT6A 2B82A 3GL9A 4AYXA 1J5XA 5JD6A 5JXIA 3C7AA 1Z73A 3DE5X 3GWZA 2Z98A 5KOJA 3GLGE 3CA8A 1NYQA 2FDCA 2BHTA 1W4AA 2HJ9A 3IEIA 3HB9A 1VMDA 1IWOA 2WQZA 1XVAA 2JAQA 3MPOA 2ODWA 1E1YA 3PUZA 4RENA 3UAOA 1QWSA 4ZOLB 4X94A 3U4QB 3W8EA 1CNMA 3AW9A 3PBKA 1B0ZA 1CVRA 1R0XA 1SA0B 2C1ZA 4H7EA 3FVQA 3TJRA 2D1SA 4ZRDA 4Z4FA 1PT9A 1QO0A 4LHWA 1QCCA 3WGHA 1DAPA 5BWNA 2HV8A 2P0YA 4I19A 1FF9A 1P9OA 1ZA2A 5DV9A 3LUPA 4HKTA 4QOHA 5U9CA 3CH6A 2HYDA 1KEZA 3WGVA 5LDDC 1FXUA 3HUUA 2HWXA 2HSEA 1VJRA 4BU0A 1D1PA 4REMA 2WINI 4U2GA 5HYVA 1VKHA 5KYTA 3DL0A 3PFNA 1H5NA 5G1OA 2BSQA 1YTUA 4FFPA 4RCZA 4F38A 4XGNA 4GWLA 2NYUA 2A0YA 1CFZA 3BCHA 4L8VA 4WNAA 5CDFE 5HKBA 3U1BA 4NBTA 3FNGA 1I7SB 3D1JA 5FLEX 3N2GA 2ZBFA 1UC8A 4GI7A 1Z2EA 2VK4A 1HTBA 4MITA 3STUA 2ZAGA 3I2FA 3VC3A 2H1RA 4NI5A 4XD2A 3HXQA 2CUTA 3PEEA 2HPZA 1IB0A 1K7FB 3GJ7A 3D3KA 8LDHA 5J4HA 1SVWA 4HAOA 2JI8A 4GGPA 4ZAFA 4HX2A 4ZU3A 1ABFA 4ZCTA 3EOBI 3TL6A 3T41A 1N6HA 4OP1A 4UVHA 2E37A 1TB4A 1X7DA 2B4KA 5LOVA 4XDHA 1WF6A 3O4FA 2Z57A 1OA0A 5LP6B 3GCXA 2HB6A 5DW3A 1GPJA 1XYGA 1EGMB 2HQSA 2R60A 1KYZA 4ARUA 5HIMA 4HN2A 1WUJS 5C37A 3GLTA 3PIIA 1PLKA 2CVOA 4QXAA 3RABA 1Z2OX 5IMBA 3IIMA 3OOYA 4HLQB 1KDTA 2O3SA 1BIFA 4YCAA 1WUTA 3SBEA 3ZY2A 2EG5A 1AB6A 2BFOA 2QEQA 3GYGA 3AM4A 2C9MA 2Q2WA 2RGCA 5JNTA 4KR6A 3G0DA 4HDKA 1H85A 3NWBA 1FJGB 1XHEA 2YN2A 1JAHA 3EXIB 3VDQA 3G9QA 3WHKA 1SRQA 1L7VC 2CK3D 4RVCA 4I1OA 2IZ0A 3T3PB 5GINE 4ARBA 2ZUVA 4EATA 3MJHA 2H18A 5LQRA 2DGDA 4C6HA 3FBTA 2JS7A 4O4HF 4WCVA 1G21A 4Z5XA 2O8CA 4ER7A 1SU6A 1EFDN 2A92A 2UZ3A 1BAPA 4G4GA 1N9KA 3PGKA 5JZBA 1XCPA 3AIOA 3OJFA 4I55A 1RSZA 2ADOA 4XUCA 2R8RA 2IWRA 4ARZA 1NA5A 2V1XA 3GEGA 2FSFA 5JXJA 1HNXB 1VHQA 2ASEA 4CKEA 2BEJA 5A5FA 1IZYA 1RTKA 2L42A 1L3BA 1DEXA 4PGGA 3EF0A 1EUDA 2V0NA 3MMXA 3ICVA 3JQ7B 1ZSVA 3QV1A 4JNKA 4OXQA 1P1HA 1NVDA 2PKCA 3DBLB 2VAWA 2YQZA 2VJDA 4YJFA 4CIBA 4H1TA 2OPBA 1ISRA 5IAGA 2GZ1A 3PQ5A 4LI3X 1TYDE 3AHGA 2QVGA 2YNMC 1C7ZA 3I9JA 2PT7A 1CW2B 1I6KA 3II6X 4YA6A 3K9GA 4HEHA 3PNYA 1JTFA 2P5TB 4UM5A 1YL5A 5EWJA 4CYMA 4UMDA 2KE5A 1XF9A 4XR4A 1R2QA 2PG3A 5C4GB 1E4YA 4YT5A 1ZL2A 1YR1A 2PH1A 2R4QA 2HY7A 3WFIA 5F77A 1CZHA 2RARA 3D7RA 4GFDA 1MVOA 2XXAA 1VRVA 2PUAA 1S3IA 2EX4A 4MO9A 3CWZA 3FY4A 4YAFA 1BWQA 4QOIA 4TTVA 4A26A 3JTMA 2V7UA 1DQYA 4BVFA 5AVYA 2ZI4A 5K3FB 2EEZA 3GUHA 4HGZA 1H2XA 4FZRA 2VH5R 5AXAA 3FDFA 1ZMTA 2GX6A 4CMAA 2D5IA 4CEJA 1C3LA 2R8YA 4IH4A 2DUJA 2UZ1B 4N6GA 2J3DA 1U8XX 2FSGA 4B45A 4CKEB 1JU9A 4X71A 1O0SA 1DC4A 2VL7A 2WIAA 4F5YA 1F14A 3G5UA 3GHYA 4CUKA 2MCFA 4F5ZA 3K0SA 1T6BY 3JWEA 2XUKA 4N7RA 5HDBB 1ODJA 2J3JA 3D54D 3G2PA 5JATA 3EEOA 1P1KA 4IY1A 1T3ZA 2RKBA 5K01A 4NHOA 3EHEA 3EXG2 1ETUA 5HF9A 4ND6A 2R6DA 1ZN2A 1M6VB 4KPGA 3IPYA 1JDVA 1G5QA 2RGRA 3BJRA 1H2AS 3CV3A 4HTAA 4KB5A 4LJKA 2V6MA 3F7MA 2Y9MB 3BPSA 3QBTA 4TSKA 2D4HA 2P4EA 4YCDA 1FFAA 4R68A 1T36B 4EPTA 1G17A 3TXAA 1KMQA 1YL6A 4QRIA 3KOWA 2XE4A 4R7TA 2FCRA 2OV4A 2XMGA 3A9CA 3DKPA 1Y4SA 1MENA 1CG6A 3FWHA 4NECA 2FZ5A 3S2UA 1TJ4A 5F1PA 3HXMA 2CXTA 2DU8A 4TKVA 1Y1LA 2V74B 3AQIA 2QB5A 4OKIA 2FSSA 4ZXPA 3EEQA 3HTXA 3AUJB 5LQJA 2YXBA 9LDBA 1V5IA 3OAAA 4UNRA 1N75A 1LQ2A 1M76A 1SVLA 1VGRA 4FDTA 1FFBA 1LBSA 4NNOA 3RYTC 3I1FA 5EJ4A 3OOHA 4HQ0A 2Z3VA 3U61B 3AERB 3RRJA 3U7HB 3EN0A 4MVJH 4M83A 1II9A 5IT9A 2C3UA 3MJ4A 3FR8A 4NU6A 1G5HA 1T5BA 1QJCA 2B1JA 3PLNA 4NZNA 3BREA 4X9XA 4HFJA 1HQDA 2VRNA 2NGRA 4Q9NA 2JIMA 4EI2A 3D9QX 5IANA 2X22A 3BFVA 2ZR7A 3NHYA 1XTTA 1MX9A 3BMOA 3G2JA 3R9XA 4J6EA 4ESHA 5FTJA 1DWOA 5L4NA 1TT5B 1E3DA 3U0BA 3H4TA 5F2NA 3GA5A 1K2WA 3IUNA 1W4ZA 2OQIA 1UZAA 3RUEA 3FRHA 3QY9A 2O5RA 1JH8A 1T0JB 1XGKA 3PYMA 4MRVA 4YFVA 4ZDWA 2I7TA 1D6SA 2CFOA 3G1WA 3GBPA 3PF9A 4YRCA 5IW8A 3QEOA 4X24A 5SZJA 1KZ7B 2Y1OA 3H2HA 3DPSA 3MQFA 3ZHUA 4D99A 1IN1A 1ZKMA 2C07A 3B2NA 4M9SA 3GMTA 4WCFB 4Y2YA 1KEUA 2CUZA 3CISA 3HGMA 3L7NA 4HGYA 5ARDA 5K6AC 1C4WA 1K63A 2EL7A 2FMUA 2P9BA 1OZFA 3FFTA 3L8CA 3JALA 4FQ7A 4CMIB 3SC2A 2G9UA 1KEKA 2Y05A 4CCSA 1U8ZA 3CUUA 1GZ3A 3HZRA 3SN6A 4EUHA 1PJ3A 4EY7A 2H5JA 2PWAA 2GILA 2AEEA 4U7JA 5CM8B 4F6CA 3FPHA 2D2VA 4JP3A 5K6AA 4CTOA 3RUDA 4JCOA 4ZOBA 2Z58A 3NYWA 2BLLA 3B2EA 1QAOA 3DBOB 3TINA 1HUQA 1V5WA 2BGTA 4G36A 1TO1E 4D4GA 3A3NA 3T4EA 5LD2B 1ZM4A 4ZOLA 2YWGA 2ZUBA 3CVYA