5IHPA

Crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
246
Chain Sequence
MTRVLAVANQKGGVAKTTTVASIGAALTEQGRRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGDVEPSAALVRTDEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPDLKLLGALPTLYDSRTTHSRDVLLDVADRYELPVLAPPIPRTRKSKGAIAYREFADALLRHWKSGRKMPTFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Ligase
molecule keywords Cobyrinic Acid a,c-diamide synthase
total genus 81
structure length 246
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ihpA00
1YJ5A 5L3VA 1N6NA 1XCMA 2WJYA 4MGIR 2J0VA 3ZZUA 4OQMA 4Q7KA 2UZ3A 3WYFA 2H17A 3SC3A 3MJHA 3I73A 2IUTA 2GHIA 221PA 1QHYA 5CK5A 1VYTA 4HAXA 4AC9A 1E4YA 2Z6VA 4HATA 5DHFA 3LBIA 4A2WA 4KFTA 2X8AA 4M53A 4YMSA 4MITA 3NBXX 5AJXA 2VP9A 2ZRIA 1KI3A 4C0KA 3IQXA 3CIOA 3GP8A 3K70B 4BQSA 2BCGY 2N46A 5AUPB 4KAXA 3E70C 3BC1A 4LHZA 2IC5A 1T3HA 5DI3B 3SS8A 5FPYA 2WM9B 3U4QB 3TUJC 1OPXA 1SVIA 3K0EA 1LVGA 1KMQA 4TYWA 1EWRA 2OCYC 4KSBA 1R7RA 3AKDA 3DZ8A 4WAUA 3GJXC 4A36A 1MRSA 1KIMA 2VTKA 2OM2A 2F43B 2VP4A 1UJ2A 3LW8A 1VECA 5FUVA 1P3JA 3IPXA 1YR7A 4L16A 4HLUA 5KNBA 2DFTA 4HB0A 1JR3A 4XJXA 4D82A 5KDLA 4QOSA 4RCYA 5J4VA 1Z6GA 4IDPA 3K9LA 3R9XA 3IHLA 3WHKA 3AUYA 3VKHA 4KI0A 1BMFA 2HEIA 3CONA 2GXAA 3K1JA 4UJ5A 3N2IA 4H9GA 2P0EA 1Z47A 4M1OA 3R8CA 4CT4B 2RB4A 2IYVA 3AM1A 2HJVA 6Q21A 2V7QD 2YHSA 4QBIA 2O8FB 5KOYA 2CNWA 1T4GA 5CB6A 2FFAA 4BFSA 4B71A 3GJ4A 5CK4A 3GJ3A 3BJIC 1OV4A 3L0SA 4JT2A 2IS2A 1DS6A 3WBKA 2QP9X 1E2FA 1FOEB 1DELA 1ZVQA 2GAOA 3LRPA 2B92A 3ZJYA 4XD7D 4A6PA 4PAMA 3NKVA 2VLIA 3RWOA 3VTKA 1NL3A 3BH7A 1CF4A 3CF6R 2J0QA 1G3QA 5FPKA 4F38A 4EDHA 5JEDA 4EPXA 1N3BA 3AUXA 3KQKA 4QG7A 2C9YA 3ZVNA 2OLKA 3K0AA 2OBNA 5FPHA 3KQHA 2YVUA 1OB2A 2J46A 2ZI6A 2GZDA 1RIFA 2NO7A 2O8EA 4AWXA 1E2QA 1TQ4A 1UM8A 3KJEA 5FUXA 2F1IA 3FWYA 4JJKA 2AWNA 2HUPA 2WIAA 4TTQA 5E7MA 1KO4A 2IL1A 2HT1A 3K0CA 2HJGA 2J0UA 2XNDD 3EZFA 3U6KA 4X8OA 5E95A 3RABA 1JAHA 3CRW1 5AJZA 2BVNA 2BCJQ 2FN4A 2W2TA 3R9IA 5HE8A 3T1QA 1J8YF 4V0OA 1AKEA 3HU1A 1JALA 4OQXA 2R9VA 5KHOC 2LKDA 2OBLA 4A1FA 1FUKA 1E79A 5C4GB 4DSNA 3CBQA 3CRQA 2SHKA 4JKYA 1E0SA 1TQDA 1T0HB 3TLXA 1L4YA 4O2RA 1IJFA 4IOJA 3KZ1E 1NN3A 1GL9B 2DBYA 5TVKA 1OXTA 2N42A 1F6BA 2YWGA 2G3YA 2HXYA 3A1VA 1JI0A 1LTQA 3ADCA 1SVKA 3KXKA 4L9WA 4ESHA 3D7MA 1T0JB 2GCNA 4IVPA 2O8FA 4IHQA 1D2NA 2FGKA 3WY9A 2VSFA 3ZGXA 2ZRLA 1G16A 1KDRA 3I62A 4JVNA 2O8CA 3O8RA 1YR9A 2F3RA 2A9KA 3A36A 2ZRNA 3MG9A 3THOA 3CPEA 3NXSA 1W36D 2C2HA 1Z6YA 2ZAOA 1P62B 2ZS8A 3DM5A 3IIMA 2CBZA 3P26A 1N6HA 1KJYA 3GD7A 5EE3A 3H84A 3DO6A 1G20E 2CHQA 1OH5A 1GILA 2RHDA 4TSFA 3QPWA 1GRNA 4ZIRB 4FMCB 3ZVMA 2QM8A 2O5VA 1Z3IX 3PCRB 1MV5A 1G7SA 5J4KA 1IONA 4FIDA 3QKRA 2IWHA 3C14C 3M4YA 4OI2A 4R71A 3VHXA 4B33A 3VX3A 2GJKA 1Q1BA 1VHLA 1C1YA 1M7BA 3E2IA 1E1RD 2L0XA 4PHTA 1KO8A 1U0JA 1DBSA 1SHKA 1D2MA 3O8BA 1W48A 2ATXA 2HLDA 1NVWQ 2QPOA 1F2UB 5IK2A 2CEAA 4Y0AA 2HLDD 5F9HA 3HR8A 4LJAA 2JLUA 3FYHA 1DAKA 3OFNA 1E2HA 1FMJA 2CE2X 4FCTA 1MABA 2NPIA 3CX7A 3QPUA 3EPLA 4IJMA 4M1SA 2A7QA 2X19A 4HAVA 4O2LA 1JJ7A 4IFBA 4D4LA 2CL0X 2C77A 3CNNA 4NCNA 4MQBA 4MYTA 1E9RA 2WPDD 4JLNA 3EZ6A 1IY2A 4RD1A 2XTZA 1LNZA 3AVUA 1E94E 1FNMA 2EFCB 2EYQA 3IEVA 2VL7A 1TMKA 1KK1A 4QJ3A 2ZJ2A 3O8DA 2VHUA 1W44A 2JJ2D 2WWWA 2V1UA 1VHTA 2DWQA 1W4BA 3TQCA 4KCGA 1R4AA 1TPZA 4LZZA 5CITA 3EPJA 2QENA 2XJ9A 2ZANA 2PX0A 1Y63A 2D7CA 2FFQA 2VIIA 1KDOA 3T5DA 1XBTA 3WXMA 4OI4A 1RJ9B 1ZBDA 5DI3A 1UBFA 2ZE8A 2PT5A 1KK0A 2Q9CA 2OV2A 3MSXA 1ZU4A 2AL7A 4CRWB 3FOZA 2ZSEA 4TYNA 3LX8A 4RD3A 1KI8A 1S0UA 2CK3A 2OE2A 1OF1A 4BWYA 4Q4LA 4B6FA 1ZCAA 1M1YE 3TUIC 2ATVA 2R6AA 3RS0A 1OE0A 1PZNA 1ZJ6A 3KJIA 4JL5A 2P6UA 4KBGA 4KYIB 4Q7LA 1N5JA 4Z54A 2X1VA 1HT2E 1BOFA 5LDDC 1NLFA 3KKOA 4U00A 3R7WB 3IO5A 4M8NE 1Y3AA 1MABB 5L3RA 2IYQA 2IWRA 1E96A 4CEJB 1G3MA 3WP0A 4PC7A 1G7TA 2G88A 1A2KC 1SVOA 4MKHA 1NF3A 1E2MA 1S4QA 3DKVA 2C9CA 2AK2A 2CE7A 2QAGA 5L3SA 2BBTA 3HYRA 4I1OA 4D4KA 3KKNA 3TH5A 3ZZTA 1YE8A 4GBMA 2VYFA 2BMFA 3QY0A 3CWQA 1QHIA 3LLMA 2W0MA 1XEXB 4Q4AA 3GMTA 1WA5A 3QXSA 4TZ0A 2H7VA 3WNBA 2NZJA 3DEFA 2WV9A 3QNUA 4LJ4A 3S1AA 5BN3A 1NY6A 4QKQA 1R2QA 2IYYA 3BXZA 5JS7A 2WAYA 4RFSB 3U4QA 4A0GA 1HEIA 2FSFA 4B3GA 1HUQA 5JRZA 1NY5A 3TK1A 3FKQA 1P9RA 1F3OA 3I8XA 1XRJA 3KFXA 5EZ5A 2I1VB 2IXFA 4JLJA 1XPOA 1OT3A 4PAQA 1S9HA 2BM1A 3W6PA 3ZLJA 1LV7A 3GLHE 4P32A 2DPXA 5DN6A 3U3MA 1DEKA 1GG2A 2IT1A 4JLOA 4OHXA 1W2GA 4ERNA 4Q1EA 4Q47A 1G5PA 1KI1A 4DCNA 3OEEA 2EFGA 2C8VA 4MRVA 4UNSA 3U44A 4ZDWA 3QG5A 1GUAA 2ZVPX 4N0EA 1F48A 2VP2A 1XEXA 4S35A 4FCVA 2W6ID 4P0TA 4RKFA 5KSOA 1N25A 4IDQA 1KZGB 2IS6A 1AS2A 3QSYA 1SVMA 3KKQA 3EXAA 2MMGA 4PHHA 3KX2A 1XMJA 3WP1B 4DT1A 4XVUA 3A6PC 4TL8A 1RRGA 2A5YB 2F1JA 1G8GA 1AZSC 3AVWA 2CJWA 2OSBA 1G5TA 5A5GA 2YC4C 2H18A 3BIFA 1L7VC 2FGJA 4JIMA 4V0NA 4EJSC 2OZEA 1A4RA 4M9QA 3FMIA 4PAOA 1W49A 1B0UA 4BFWA 2QL6A 5DO9A 4G0NA 2OCPA 2WMNB 2LKCA 3RDPA 1YZTA 4BFZA 2F55A 2ZVQX 4NDZA 3TMKA 4BRWA 2E87A 1XD2B 1Q3HA 3WRXC 3DOEA 4K46A 4B3FX 4BPBA 1EWQA 4Q00A 1T3SA 2CDNA 2EFEB 3L8YA 4C3ZA 3CW2A 4ZCMA 1KDPA 2O0JA 1E2LA 3AVOA 5C46F 5L8VA 4C7OB 2D06A 2C96A 2FEMA 4PC6A 5TXGA 3RC8A 4AI6A 3JVUA 2C04A 1DO0A 2XEXA 1U9IC 4D4JA 1P75A 3RC3A 2C99A 1MKYA 4G5SA 1J99A 1HT1E 4IDOA 2QY9A 4EPVA 2AD5A 2UZIR 2J59A 4C0JA 3ASZA 5F9FA 4M22A 4B75A 1YKSA 3T12A 5AR1A 4B3BA 1PUJA 2QAJA 3AVQA 3B82A 3CZQA 4YMUA 2YZ2A 1KI2A 2HYIC 1A82A 2R44A 5DIFA 3MD0A 2QU8A 2WOJA 4BZPA 4C0LA 3CLVA 4PSVA 3UMFA 4FINA 1MT0A 3IO3A 3VR2A 2YOHA 3QEJA 1UDWA 5FOVA 5KSZA 2AN9A 1XEWX 3FVQA 4HZUA 1UEIA 3LH5A 3NEYA 2EFHB 4B3DA 2GBLA 3SYKA 2WJHA 2XJ4A 4A15A 4TT3D 2QI9C 3K09A 1XTQA 1CBUA 4P4SB 1E69A 2OFXA 2ZRHA 1E3MA 4V03A 2J7PD 4OQFA 2H5EA 2D62A 1HQCA 3MAAC 4PZLA 2OO7A 2MSEB 2G9NA 1J90A 2EWVA 3QVUA 4EPTA 1M7GA 2WAXA 3GJ8A 2IX3A 1KTVA 1DAFA 4NCJA 3Q8XB 3GLHB 2V55B 2CCJA 1ZM3A 2CJWB 4BEBA 3B9QA 4CGZA 2JLZA 4X8LA 1KK2A 2C78A 3AKCA 4LHXA 4NYIR 2ZITA 3I3SR 1X86B 2GBLC 3B85A 2WWGA 1YRAA 1NJGA 4LC0A 4GOJA 3VKWA 1OXSC 1BH2A 3W3ZB 4DHEA 2QG6A 1B23P 4A9AA 4BLTA 3OIUA 4KFUA 4PSKA 3QXCA 1IN4A 5CIQA 5H1YA 4G5RA 2Q9AA 2QSZA 1DARA 5AUOB 1OHHA 2AXPA 4DWJA 3DKPA 4HLQB 4ZDJA 1M34E 2IEZA 1GIAA 1JBKA 2X2EA 3JVVA 4IVRA 1EX7A 4AK9A 4DEXA 4DBLC 1UPTA 2BEJA 2OXRA 3BGWA 1Q0UA 3FE2A 3AKEA 3T15A 2Q3FA 1G17A 3THYA 1HH4A 2XOKA 1OKKD 4YLGA 4DLVA 2Q9BA 4IXNA 2JLSA 3WYGA 2VHQA 4R98A 2AX4A 3CUEF 3QI2A 4NONA 3T35A 1ZUHA 2FMXA 2QZ4A 4B3XA 1SVWA 3B7GA 3MWJA 4L15A 2RGCA 1QHNA 4JMPA 2FZ4A 3C16C 1QHXA 4RFVA 3U61B 3KXIA 2BOVA 4B47A 3BORA 1G291 2ZUCA 1YVDA 4Q4AB 1K8RA 3EZ9A 4XOIA 2A5DA 4WZ6A 2AD1A 2HF9A 1E0JA 3IEUA 4HDQB 2VH5R 3BD9A 2ZJOA 2XXAA 3OAAA 3GLGA 2CNWD 4BE7B 5EXSA 2F43A 4F7WA 1CP2A 2JIZA 2YWFA 3IQWA 1FTNA 1E9CA 5JSZA 2XAUA 4DB2A 2LCFA 4M9ZA 3QENA 5CB8A 2FV8A 4P31A 4GDFA 2BIFA 3EC1A 4Q1FA 5AJVB 1N0VC 3UWOA 5FTMA 3AVPA 1HTWA 721PA 5FH9A 2XB4A 1WB9A 2GA8A 4B43A 4ZDKA 1VCIA 2IUSA 3VHLB 1Z0JA 2ZI4A 5DLQC 4URVR 3AVYA 3P27A 2EW1A 3Q72A 4UJ3A 4GZMA 1KOFA 4IEEA 1P2TA 3A1WA 4LGMA 2QQEA 1H8HA 4TTPA 4A4DA 1FNNA 1Q20A 3FB4A 3QE0A 1RFLA 2ZSAA 4MKGA 2HCBA 4M4SA 1OIVA 2CCGA 1XXHB 1MO6A 1Z5ZA 2ZRBA 3X1WA 5L3QB 1ZUIA 4DCSA 1IN5A 4HLUC 4ZCIA 3W8NA 3X2SA 1E1RA 1BKDR 1X3SA 3CRVA 4AKHA 5FL3A 1CKEA 2WWIA 1G4UR 2NTYC 5BXQC 2P2LA 2OLJA 4ASUA 2J5XA 1VYVA 5J47A 3GLIB 1AIPA 5FTLA 1J2JA 3Q3JB 1LB1B 1Z0IA 2N1BA 5G41A 1SVLA 2DYKA 4ACBA 3BS4A 3CX6A 4URWR 1XD2A 1CRQA 4AYWA 2VPPA 4D0NA 1GL6A 2ERYA 2WSMA 2BJWA 3LVRE 1Q57A 1GKIA 4TTRA 5EP2A 3VNVA 4PXAA 3HU2A 1A5TA 2V8OA 1MOZA 1E2GA 5EXPA 5FOTA 3WMFA 4QHSA 2H92A 2ZYTX 1ZNXA 4HUQA 2QMEA 4AD8A 3WMEA 5SZKB 1HA3A 1P4SA 3U3OA 2O8DB 3AF4A 1A2BA 5KNCA 5EP3A 2CHGA 2PL3A 3KQLA 3P32A 4FWTA 3W90A 2OEPA 1Z28A 1EFHA 3AKYA 4A0HA 1ZD1A 1V5WA 1YRBA 4XVQA 4GMXA 4N1AA 1SZPA 4LJYA 2WMOB 4E03A 3T34A 1OYYA 1ZNWA 1OSNA 3UANA 4NL4H 5JWRA 2C95A 1H8EA 1OIWA 2EYUA 5FL7D 2F1RA 1AGPA 2WZQA 2UVQA 1OW3B 1BYIA 2EVWX 3BB3A 4TWZA 2FPLA 1KO5A 3OIWA 1E99A 4W7SA 1XJQA 2C5LA 2OFOA 3KB2A 4BZQA 1Q22A 4D4MA 1U0HC 1S3SA 3BFKA 4JSTA 4KODA 3P1JA 2J45A 2JJ8A 2V54A 1PV4A 1ZM7A 4MKFA 4DVGA 4CEIB 3B2EA 1DVRA 3UATA 4GL2A 1DG1G 4XTCS 2PCLA 4B6EA 5AJYA 4J0QA 4KJZA 5JHGB 4DC9A 2ERXA 1Z6XA 4TN1A 1JQJC 2GNOA 4LWZA 1EFCA 3K70C 2HXSA 4CW7A 5HR5A 1KNXA 1OHHD 1JXOA 2YOGA 2EWWA 2VSXA 3IBYA 2GRJA 3LFUA 3H1TA 4NTZA 3IKJA 3QKRB 4D25A 1Z22A 1YU9A 1JNYA 4UNRA 5B57C 621PA 2IBMA 2W6IA 4HAZA 2IUUA 3GEIA 5TB5A 3QJYA 4UXJA 3EPKA 2NG1A 2QUZA 2KB0A 4OJKA 1K5DA 2OESA 5H68A 2WWYA 2GCOB 1GITA 4NYMQ 3T61A 2V1XA 3CPHA 2AFHE 3LNCA 4BLQA 3BRWD 4CEJA 5B30A 1ZUNB 2W83A 3WMGA 2QP3A 4NKRA 1W47A 2ZE6A 4EPRA 1NSTA 2FOLA 4V0MA 4HEJA 2ZRGA 5JHHB 5JMTA 5JWHA 2J7PA 5FPTA 3RSLA 3KUCA 4IXMA 4C0AC 3RRYA 3K70D 4F4IA 4CZ2A 3IIJA 3CB4A 5CLQA 4QJ5A 4BFVA 2VSOA 4NHOA 4TQUS 2PEYA 1NBMA 1Q3TA 1QHHB 2LWIA 4M1TA 4JLPA 4TL6A 3K53A 3RHFA 4DLRA 3V4RA 1N6PA 3CRMA 1UBCA 3ND8A 2IYUA 3RYTC 1U8ZA 4LJ7A 1L4UA 3CWZA 1G6OA 5TV2A 2ZI5A 1G9XA 1SXJD 2YV5A 4E22A 2GTPA 5JJLA 2NZ8A 1ZC3A 4LY6A 2NO1A 4HYYA 4NYIQ 1U98A 3B6EA 3AQ4A 3GJ6A 2CL6X 2ONKA 4W9MC 1R6BX 2J0SA 4LDJA 2GXSA 1F2TA 3PR1A 4OHVA 4OK6A 2YWEA 3Q7PA 1W2HA 1IY0A 3ASYA 3IUYA 5FI0B 4WVFA 1W7AA 1P60A 2VO1A 2WSSD 4AKIA 2PZGA 2X2FA 1SXJC 1KSHA 4MYHA 4G01B 4M9XA 5HCNA 3IIKA 3OF5A 2RAPA 2XGJA 2A5JA 4DUGA 4LJ9A 4RD4A 1T6NA 3ZS9A 3B13B 2AKAB 2ODEA 4LHWA 1RYHA 5JFGA 1W5TA 5KUTA 2FWRA 3K0FA 3R9WA 1XXHA 3PQCA 1HE8B 1Q1EA 1RRCA 3BFVA 3FKSA 2YYZA 1TEVA 3PJRA 3AVTA 4MYUA 4DCUA 2W6JD 1R0ZA 1IOZA 4TYPA 3V9PA 2AK3A 2WHXA 2ZRCA 3E1SA 5FTKA 3TSOA 2W6JA 1KZ7B 4NYMR 3MJRA 3NBYC 3MLEA 1HQYE 3QXXA 2C03A 4LC1A 1TUEA 2ORVA 2IYXA 2Z4RA 5IF9A 3DPUA 1DPFA 1KJZA 1H8ED 4TL9A 4E07A 4M0LA 4WXPA 5D3MA 1CJUC 3I4LA 4HUTA 2FA9A 5CIWA 2BEKA 2GILA 5JBQA 5LPNA 1WRBA 1OFIA 2V4ZA 3SE0A 2ORWA 1XTKA 4PO1A 1Z08A 1FQJA 4JJZA 4RD0A 5HKKD 2OCAA 1QDEA 3FMOB 4NCKA 3SHWA 4M9SA 3Q85A 2J41A 3BERA 3L0IB 2VP5A 4IEIA 4L9SA 3PUWA 3AP3A 1Z6TA 1I2DA 3ZYCA 4HUQB 4YDSA 3NHBA 3NTUA 2K5UA 4I4LA 3U6BA 4QBFA 3IHWA 3QKUA 3GLHA 2NO0A 2PH1A 4NH0A 4EKDA 2B21A 3MCAA 3QF4B 4DIDA 3I1FA 2P6RA 1SULA 5IK2D 4M21A 4WA7A 3TJZA 4PPFA 2ODNA 4D6PA 2NPFA 4LX0A 3LXXA 3B8HA 4TLDA 3QKTA 1NVUQ 3U3KA 2O52A 1NN5A 5BYKA 2FNAA 1IBRA 1N6KA 1DADA 1ZNZA 5FOWA 3TRFA 3UWKA 5CDFA 1Z07A 3RANA 4KHZA 3ICEA 4P4UA 5GJWC 1QVAA 1M7HA 4DXAA 5JCZA 3UPUA 1WBDA 2ZR9A 1E79D 5LBIA 4GI7A 2JCSA 2RHMA 5FUWA 1W0KA 4GPTA 3X1ZA 2YNMA 3RAPR 2FPKA 3EW9A 2QPAA 2G6BA 2QN6A 5FBLB 1XWIA 1G7RA 2ZSFA 4PTLA 2KBEA 2XNDA 5AUNB 1P7CA 1U2RA 4V0LA 2XITA 1OLOA 1DO2A 2XX3A 2ZEJA 4QJ4A 5K8TA 4US0R 3VU9A 4I81A 2XOKD 2FH5B 4Q66C 1UKZA 2DY1A 1XF9A 1UKEA 2ZR7A 2D2FA 4QBHA 5DHAA 4N0DA 2CCKA 1R0YA 2F6RA 1FZQA 4I1UA 4HAWA 3QOFA 4AG5A 4CIDA 3RS5A 2QRZA 4JBWA 1LFDB 2Q3MA 1KI4A 3THWA 5LB4A 1W4RA 4F93B 2HF8A 3ND9A 3LQRA 1UF9A 4BLRA 3SDZA 2KWIA 4EPWA 3AB3A 4NPHA 1KSFX 2FFBA 2J1LA 3GLFE 1U8YA 3I72A 2GK7A 3TR0A 4L5BA 5A4JA 4JYBA 1XEFA 3MFYA 5GJBA 1JB1A 1F60A 4HB2A 1NI3A 3TSWA 1VMAA 4WBSA 4LBVA 1T8TA 2DWOA 1KMHB 2C9OA 4BZXA 5HTKA 1ZAKA 5KU1A 2ZPTX 1WE2A 1AQYA 3MGCA 3M1IA 4LJ6A 3GEHA 1N6RA 4EJSB 4PX9A 5J5CA 3LXRA 4NP6A 2XSZD 3LWNA 1I4DD 5KSYA 1XPUA 1RKBA 1TQ6A 2QSYA 5JRJA 2B8WA 2E9SA 1EFTA 1Q1QA 5AUQA 1NN1A 2BC9A 4OQLA 2DR3A 4WIAA 4Z1MA 2G1KA 4YMTA 4CF7A 4EIWA 1FP6A 1OFUX 4HLDA 2FSHA 4U02A 2KE5A 5TARA 2ZRDA 1OXXK 2GVDC 4Q1CA 3CR8A 4RZUA 5H70A 4V02A 4JL6A 1P9NA 2BV3A 1RJ9A 4HLCA 5FTJA 2JAQA 1T9HA 4QM6A 3P4XA 4Q19A 2ZUBA 1AM4D 4I1VA 3C5HA 1W0JA 4XSGA 1KHTA 4CEHA 2GF0A 5E7IA 1ZW6A 4PR0A 1OH8A 1U8AA 1GNPA 3HP1A 2ZYVX 5C1BA 1RRPA 5JEEA 2REXB 1I2MA 4Q02A 5KNDA 5GADl 1M74A 3QQ5A 3PUZA 4FMBB 4OHYA 3CPJB 3MUFA 1BMFD 1O87A 4CYMA 4G5QA 2JATA 1G8HA 4Q1DA 2YKGA 4TMWA 4QGFA 5JI3E 3GLFB 1NKTA 1QVRA 4DIEA 2A78A 1NMZA 1U9IA 5JLJA 521PA 2CL7X 4OHWA 3PIRA 1P2UA 4OI1A 3SBDA 1GZSA 3GCGA 1J8MF 1FP7A 2HDNB 2NGRA 2OFWA 4US2R 4Q4JA 2IK8A 1TTTA 3GJ0A 3FFBA 3L2OB 4Q9IA 2FJUA 2Z0MA 3QUSA 1KI9A 1PLLA 3KJHA 3SOPA 2IYZA 4RD6A 4RSGA 4OHZA 2DCUA 4JS0A 5DN6D 1KI7A 1D9XA 2J87A 4B76A 2QMHA 1G41A 3R7WA 2JEOA 5EXTA 4UXHA 4DSOA 1E2KA 2ZSBA 3X1DA 4Q9JA 1KSGA 4ESVA 3Q5DA 1IN8A 5DYIA 2QBYA 5KSPA 3THXB 1NMYA 3GLGE 3V4FA 3GLGB 5CLLA 4BGDA 1XJCA 4K8OA 3IBGA 5K8UA 2QA5A 5SZHB 1XB2A 1N5KA 4Q9HA 1W5SA 2WWXA 5KO2A 1VIAA 1LS1A 3EIQA 3F0TA 3FHOA 4EJSA 3ADBA 4DUGD 2JIZD 4TYYA 3A4NA 1CJTC 1MO4A 3BB4A 1P2SA 3QXJA 1G3IA 1H8HD 4JSYA 1CR2A 1GAJA 2ZREA 3VNUA 4YQFA 1P61B 1JEEA 1YQTA 2VQSA 4B35A 2GEDA 1QF9A 3A4MA 3W3AA 1YZLA 2NIPA 3FKSD 3SQWA 2D74A 2VHTA 4LPSA 1P72A 3LQQA 4DSTA 2FFHA 3CKLA 1E6CA 1E32A 1NRJB 2IYRA 2QE7A 1N0WA 4QL3A 1E2IA 3C41J 4HI0E 4DDWA 1YZGA 2BKUA 1US8A 1S8FA 1XEWY 3PUXA 1G4AE 3VR5A 1P2VA 2BWJA 2DFLA 1PJRA 1ELOA 1AA9A 3WNCA 1E9DA 3VFDA 2ZQ5A 4LV8B 4BASA 2QROA 3TNFA 5LD2C 4JZKA 2R65A 3BB1A 2FE4A 3QEOA 4IRUB 1AK2A 4FMDB 5BQ5A 3RS4A 5K8IA 2RGGA 2A3RA 2PX3A 1NVXQ 3M6AA 4C30A 1GSIA 2QGZA 1GRQA 4LBYA 2ORIA 4XD7A 4PQYA 2J0UB 4HAYA 4U7DA 1KO1A 3EWAA 5DE3A 3OZXA 1FUUA 4URYR 2ZXUA 3CR7A 1DAMA 1OXUA 1FTSA 3R20A 4MRSA 3SJBA 4Q1BA 5H8WA 4Q4JB 1XCGB 2UKDA 3A1UA 2ZRJA 3T06B 1E4VA 2WJVA 2D2EA 4MDEA 1R5BA 2ZROA 4TMTA 4JVMA 3EIHA 5FBWB 2QT0A 3ZVLA 3LV8A 4Q7MB 4R7ZA 4AKEA 4D80A 3IGFA 2P67A 3SFVA 4ARZB 3VKGA 4Y0VA 2G0NA 1E0AA 3BOSA 1LW7A 2ZE5A 2IS4A 4MRNA 1KI6A 4OK5A 4Q1AA 4AIIA 2PZFA 2O8BB 4KLZA 1W0KD 2NQ2C 4JYCA 1AGRA 4LPKA 2OBMA 4EQ6B 1D5CA 1PLJA 2D4HA 1GL7A 2REOA 5ANRB 1JJVA 5P21A 2XB2A 1NBME 4NMMA 4XTRA 5KDDA 1G6HA 2ZS7A 2HV8A 2JGNA 4UNPA 3TVDA 2OHFA 1E9EA 5SZJA 4LI0A 1U94A 3FHTA 2VF7A 1W36C 1Z2AA 1EFRD 3CRRA 4XWKA 2YC2C 1K6MA 2BMJA 1HY3A 2RH5A 3SZRA 4TLBA 3ZD7A 3REGA 4MGKR 1K5GA 1P6XA 1SKYE 3ZQJA 4URXR 4A6XA 1WDTA 2ZI9A 1VG9B 2MSCB 3CZPA 3ZIAD 1YR6A 5AWFC 2GAAA 1EFUA 2QM7A 3LA6A 3NG1A 5TMPA 4KU4A 1T3LA 2G1JA 3BK7A 5SZIA 3W8RA 1VG0B 1KMHA 2R6GA 3JZAA 3UK6A 1QG4A 5B58C 3LAWA 3NH6A 3GLIE 1KSJA 4DCTA 3NBZC 2AKYA 3THYB 2GCPA 3GQBA 2O8DA 4FW9A 4NZYA 4HSEA 4QFMA 3SNHA 3GJ7A 5HPYB 4Z8YA 4O0MA 4PQRA 3TKLA 3U7EB 3I61A 2P65A 4OI0A 1LF0A 4G5OA 5CJ2A 1FFHA 2BM0A 2AWOA 2QTHA 2R2AA 5AK0A 4XIGS 3O47A 2JLXA 3AGPA 3S1AB 3UIEA 4DLZA 5IRCD 4NE2A 3TE6A 3PEWA 1ZM2A 2ZU6A 2PJRA 2GXUA 1YZKA 2ZE7A 1BS1A 4PC1A 3KTAA 1T91A 1CTQA 5GVSA 4C0QC 4S2EA 5F3WB 1E98A 1JEDA 1M2OB 2IS1A 5DH9A 4EQ6A 2CK3D 4P3YA 3FPAA 5G53C 5G3ZA 4IOMA 1GVNB 2QORA 3WNDA 4AURA 2FDCA 1Z63A 3G82C 4FMCF 2GETA 1WCV1 4MH0R 2YJTD 4KFSA 4ASUD 3RNLA 4DSUA 4D0LB 4ZKEA 5JSZB 3TUZC 4DLUA 4LBZA 4UQOA 2WKQA 5EJEA 1NMXA 1TF2A 2BBWA 4DB4A 2GVZC 2H16A 4WZBE 2XZOA 2V6JA 1RPZA 4ZKDA 3ZIAA 1E1QD 3ETLA 2VP0A 1G3RA 3FFAA 3A1TA 4G5GA 3VX4A 1DG3A 2WKPA 1KKMA 3W34A 3NHAA 4Z8XA 1CJVC 1VPLA 4AY2A 3IPYA 2RGNA 2XTNA 2QP4A 3H2YA 4LYAA 3RLFA 2R6CA 2BKEA 2WICA 5HE9A 1ESMA 4Q01A 5DSZA 2W2VA 1TEXA 1XCPA 3DMDA 1ZP6A 1QZXA 3OFND 3B5JA 3OIYA 5EUMA 5M04A 2JDIA 4OK3A 421PA 2QT1A 4XSHA 4E5UA 3KQNA 5EP1A 1DAIA 4ZCLA 1DAHA 5TDHA 4RJLA 1J70A 1SXJA 2GJ9A 2JLYA 2PJZA 3VR1A 5EQTA 3AVVA 4BEJA 5CDFE 3H86A 1ZM4A 3REFA 3CNOA 3TSZA 4LCBA 3RSOA 4C4PA 1N5LA 4DLSA 5BYJA 1S2MA 3NEJA 1OH7A 2AHOA 4H1UA 2VHCA 1SHZA 1SKYB 3BAFA 1FL9A 2OILA 1OKKA 1R8SA 5LD2B 3KB1A 1I4LD 3AF2A 2QGNA 1ZIPA 3TAUA 4I99A 5JZVA 1WXQA 2A30A 3OAAD 4KITB 4RKEA 2ASEA 4MGZR 4PZZA 1XFAA 1Z0FA 1TF5A 4PZYA 1CR4A 4RFSA 1G64A 4CVNA 1II9A 1JPNA 2EQBA 1TF7A 3I5XA 5DI9A 3NBFA 4KV9A 1U90A 2RGEA 2QBYB 4QXAA 3KDSE 4P33A 3U44B 4Q48A 4R2IA 4POAA 3KXLA 4GMDA 4JBYA 3PXGA 3DVLA 3A8TA 4OBEA 4ITRC 1OFHA 1QHGA 3SJAA 2CMKA 1NSFA 2AR7A 4HZIA 5CYPA 3EWSA 4B2IA 3D8BA 3NC0C 4GSYA 2OUKA 3UXMA 2QMUA 4CEHB 2P5TB 1KO7A 1CULC 1SGWA 3W6OA 3K9HA 3W5IA 1EK0A 1T5LA 2DFKB 3B60A 3BE4A 1XZQA 2DHRA 1X6VA 3F3YA 5FUYA 4WZAE 2J3EA 2ZRKA 2YWHA 4YMVA 3SYLA 4F91B 3MWYW 5JI2E 2ECKA 4MRRA 2JA1A 4WOPA 1DAGA 1J7KA 4A2QA 1NN0A 2JLWA 4ZPXA 1WMSA 3RS3A 5EUQB 4DKXA 1HE1C 2GEVA 5EE5B 4A8JA 1CXZA 4QM7A 1MRNA 2KSQA 5BN5A 2HYDA 3N2EA 1QG2A 3Q5EA 2DFNA 4JVSB 3D3QA 1EX6A 2FSIA 1NKSA 1VG8A 5LB2A 4CT5A 1P9WA 3V00A 1GRRA 3VR4A 3L0PA 3VQTA 4GOKA 4ILEA 4HB4A 4LSGA 2CVFA 4DDVA 4NU0A 3UMRA 1S9DA 4A0FA 3QF4A 4JLVA 4LBWA 3C4JA 3I92A 1ONBA 2QTFA 3TR5A 1V43A 4KSCA 1PUIA 1AQUA 2ZU0C 2G83A 3L0OA 1JAIA 1C4OA 4GZLA 2ZJZA 3J81k 1GWNA 2IYLD 3HDTA 1E9FA 2ZJ5A 4URUR 3WBJA 1HYQA 2Z83A 4XH9B 1QBKC 4JVLA 5F98A 2ANBA 1DOAA 3PUVA 1XNJA 1E0KA 2GK6A 3LY5A 4HZUB 4CEIA 2ZRMA 3LDAA 1E2PA 4D2IA 4MUAA 4US1R 4JLDA 2KI5A 4DRZA 2FG5A 3OESA 3K09C 3OE7A 4HDOB 4V0KA 3QBVA 3IDQA 4BECA 4X8MA 4F4CA 4O3MA 2GESA 1R0XA 1QHSA 2WPDA 2A2ZA 1R8QA 1NP6A 3EZ2A 4BFUA 1G7CA 2OCBA 5L3QA 3ZD6A 5FOXA 5FPSA 4B34A 4IDHA 1XTJA 1UAAA 1M6NA 4KYUA 1W36B 2Q6TA 1NG1A 2I3BA 3DM9B 4N3NA 1U81A 4EUNA 4PSAA 1XDBA 3ZZ0A 3EASA 3GLFA 1WP9A 4BFXA 1X1SA 2QPTA 3DHWC 4P4SA 3SI7A 1IN7A 4P4TA 1VCOA 2GCOA 5C2JB 1G8PA 3L82B 4IDNA 3CNLA 4LK2A 4YXWA 4H1VA 4DCVA 4PHGA 2ODWA 3Q7QA 2XTMA 2BDTA 2V9PA 3R8FA 3HJNA 3CM0A 3GFOA 5F2EA 1RE0A 2DB3A 4JT4A 4MYCA 3A1SA 1II8A 4LJ5A 2IXEA 2B8TA 2FU5C 1US8B 4BFTA 1OFTA 1ZIOA 4Q4HA 4NBSA 2RGBA 1ZD8A 3EA0A 1F2UA 3IILA 4HB3A 4G3XA 1CU1A 3TW4A 4LYFA 2O0KA 3TIFA 3VR3A 2ZJBA 4II7A 2F7SA 1YR8A 4I1SA 4KLNA 3NDPA 4IOKA 4V0ME 2VHJA 1G8FA 1IAQA 2BMEA 4OYHA 2IF0A 2OXCA 5B2ZA 2IHBA 1ANKA 2NO9A 4WXRA 1D6JA 2H57A 4BRUA 4EFLA 5B64A 3EC2A 4PFSA 4BLPA 5JJKA 2I1QA 1COWD 4DT1B 1DAEA 1ZD9A 5FTNA 4IKEA 2ONJA 2W2XA 5FOSA 2GEUA 1Q44A 1P73A 2PLRA 3H4MA 4GNKA 4LRWA 4TLAA 4B3CA 3ONWA 2GJ8A 3I5YA 1JQLB 3KQUA 3KTAB 1I4TD 1F5NA 2WOOA 4YC7A 4B73A 4M1MA 4TMKA 5KPJA 4YONB 1IXZA 1KGDA 1SXJB 4JKIA 2DWPA 1II0A 1MH1A 1NLZA 2REBA 4ABYA 3KUDA 3T5GA 3N5CA 2ZETA 1KYIA 1GKYA 3TBKA 3OEED 1G5RA 1VIYA 1OJLA 2Y8EA 3G0HA 2OT3B 1FPMA 3AF0A 3EZ7A 3OEHA 5AJWA 1TAGA 2VBCA 5GVRA 3U7FB 1SVSA 1VKJA 1VCMA 3SJCA 3FHCB 4B2PA 1RC8A 5TY0A 4NCIA 4UKDA 2JLRA 3U7GA 4W5HA 1E2DA 1TU3A 4GOXA 1BIFA 4TMXA 4D81A 3SR0A 2ZRAA 4W5WA 1E2EA 4OL0A 1XPRA 4DZZA 2TMKA 1Z0DA 5J4LA 3AF3A 2FPMA 3QF7A 3SHFA 2CVHA 4EFMA 3TAHA 1KAGA 1NIJA 2QMOA 3PENA 1IQPA 4QHYA 2ZRFA 1XXHE 3FGNA 3B1WA 2V7QA 3CX8A 3THXA 1XTIA 4L8GA 3PEYA 5DGXA 1N2CE 3JZMA 4MUBA 4TLEA 1NBMD 2VA8A 3FTQA 1L2TA 4HDCA 4AYXA 3AP1A 3KL4A 5EE1A 5JS8A 2B7CA 4AG6A 4A0RA 3EG5A 5CM9C 1UADA 3AH8A 4TMZA 1CR1A 4C0BA 2AFIE 2XZPA 4LHVA 5IHPA 1EG7A 2JDID 2XNSA 3ICQB 4M1KA 5CYOA 4BUJA 2BBSA 5DISB 2ZJAA 4D26A 2GJAA 1FW6A 1U99A 4JLBA 4GP6A 4QBGB 5KDOA 1XTRA 1C9KA 3EARA 3HPRA 2I4IA 4DJTA 1E1QA 2GDJA 1F2TB 2WJIA 1UEJA 2ZJYA 4DLXA 2G77B 3AEZA 4M1YA 2CLSA 4KBFA 1ZCBA 2G0TA 4FN5A 2QRNA 3TGPA 2EU8A 4FD2A 4PO8A 4X8HA 1Z29A 2QAGC 3K0AB 3K9NA 4Z51A 1N6IA 1TX4B 1UBEA 4TT3A 2IHYA 4U5XA 5KPDA 1LY1A 4R2HA 4ZV4A 2A5GA 4B44A 4WW0A 5ELXA 4PPQA 1W4CA 1UKYA 1R0WA 1WQ1R 1HURA 3U2QA 1E2JA 2R8RA 4QNRA 2Z5FA 1E9BA 2ODBA 2V3CC 4LOAA 1Z2CA 2F1HA 1OIXA 5CJPA 1ETUA 2IYWA 3EAQA 1GKUB 3T1TA 5JWOA 3HR7A 1KDTA 2GZAA 2JJ2A 2D7DA 2ZTSA 3B1ZA 3SBEA 1NNEA 1BO6A 3I8SA 5FR1A 3K8YA 1G3UA 3L8ZA 1N6LA 3LO5A 4UNNA 3ZVRA 4L4UA 4DLYA 2Q21A 3K0FB 1X8LA 1XD9A 1KY2A 2WSSA 4QRHA 3HU3A 1ZNYA 2J7KA 2RKOA 1JR3E 5BW8A 1NLYA 3TQFA 4JL8A 4LJ8A 4ZI3A 2PMDA 3RS7A 5HKKA 4TSFD 1CS4C 1JECA 3FDIA 3E5HA 2WKRA 3SU8A 1Z83A 3B9PA 3PUYA 5HZHA 1FQKA 5FOUA 2VEDA 1X8JA 3NC1C 5K8LA 3UMSA 3MRSA 2IA5A 4E09A 5KTYA 1HV8A 2MSDB 2R6FA 2RCNA 4K81B 3LBNA 3ZDQA 4LUCA 4DDUA 2IYSA 3SEAA 3AF1A 1XMVA 2ZYUX 3C7KA 2ZUDA 3BH0A 4FMDF 2BBOA 3CO5A 1D2EA 3NH9A 1NJFA 1NVVR 1EFRA 2E1RA 1SQ5A 1T8UA 3D31A 821PA 1W46A 1KKLA 1RYFA 1ZINA 3ECCA 1KI6B 2R6DA 3M0EA 2GJSA 2GWHA 2O8BA 4RZ2A 1FMLA 1W4AA 2ZYWX 2HT6A 1D9ZA 4R9UC 5DYGA 2GXQA 1JXMA 1JPJA 1ZM9A 4GT1A 1S1MA 1UDXA 3AGQA 121PA 1QRAA 1W1WA 2BJVA 2WJJA 1UBGA 4GRAA 4RY2A 2ZS9A 5FBQB 3U60B 2IXGA 2XZLA 1QHHA 4Q03A 3GFPA 1OH6A 3SQXA 5HZKA 3QBTA 5C18A 5EXXA 1GOTA 4XWAA 4Q7JB 2WVJA 4BLSA 2CHVA 1CR0A 4Q4HB 2RGDA 3SJZA 5GJVC 2JLVA 4Q9KA 4O25A 4MDFA 1Q21A 4PC2A 5CM8B 3QKSA 3VR6A 1XD8A 5BN4A 4B74A 3QPVA 1H65A 2QEQA 1XTSA 3C5CA 5D3QA 1TQ2A 3SN6A 1CJMA 2F3TA 3CH4B 3QIAA 2RGXA 3X1YA 3AP2A 2NOAA 1UKVY 3HYTA 4KO8A 1R5NA 1E2NA 1TNDA 3F5FA 4IFEA 3T1OA 1Z0KA 1X1RA 4LHYA 4KXFB 4W5JA 1LF5A 3B1XA 1KK3A 3BFXA 3KFVA 4OKSA 4M2LA 2Q0HA 2PEZA 1VTKA 4FWIB 1VDZA 5JCPA 4LV6A 2QQ0A 4A2PA 3Q9LA 2O8EB 5EZ6B 4RVCA 3DDCA 2PZEA 4A82A 2OAQ1 4MA4A 1ESNA 1A7JA 3RRMA 1TU4A 2BHRA 1CEEA 3A4LA 2A5FA 1AN0A 1GNRA 1Z6AA 4YXWD 1XZPA 1JR3D 2D3WA 1IXSB 2OG2A 1IM2A 2WWFA 4QNMA 4TL7A 3VU9B 3LD9A 2CLCX 3PVSA 2ZSDA 3KJGA 4OJQA 4MRPA 3PEUA 2JLQA 3QKSB 2B7BA 4TMVA 4D0GA 1OB5A 1GNQA 2IYTA 3RVBA 2W58A 2ZR0A 4DDTA 3AV0B 1SKQA 4PPGA 1EGAA 1XMSA 5EE9A 1NVVQ 3NVAA 2X77A 1S3GA 4FXPA 4YMWA 3GPLA 2WIBA 2BMDA 3OEHD 1SXJE 4PPNA 2Z4SA 1KAOA 2HCJB 2IF2A 3T1VA 3K0CC 4URZR 1G1MA 4Q18A 3FMFA 1BYUA 4GP7A 4IVQA 2ANCA 1MO5A 3W6NA 2JJ1D 2WBLC 2O0HA 1NIPA 4M1WA 3RRZA 5J4HA 1RZ3A 3CF2A 3ZQ6A 1Z0AA 2R62A 2VP6A 2RMKA 4C0HA 1EXMA 2O8CB 3DZDA 4JLKA 1N6OA 1P5ZB 4NCHA 1RW4A 5EE0A 1MO3A 2FF7A 1IY1A 2IEYA 2AXNA 1VCNA 3ZS8A 5D3MB 1ZC4A 4KVGA 5E3HA 1M8PA 1IJEA 1IXRC 2VRWA 2ZRPA 4F4JA 2W00A 4RCZA 4ZIRA 1FX0A 3MWLA 1PLKA 3NWJA 3WRYC 2PCJA 2KBFA 1O3YA 2P5SA 3BH6A 1TUIA 2WJGA 1WBBA 3HWSA 2IW3A 3W5JA 1YZNA 4EAQA 2NMVA 4RZ3A 1VG1A 2P3SA 2Q3HA 2ZAMA 3PV0A 4JBXA 4BLOA 3LX5A 1CIPA 1TL7C 2CXXA 2KJQA 1Z06A 3OHMA 3EPHA 3B1VA 4A92A 1CRPA 4Z1MD 2C98A 3CF0A 3A58B 5E4FA 1VYUA 4IW3B 4UXIA 4A8JB 2YINC 3VMFA 4C2UA 3U5ZB 1XJ0A 4Q21A 1AZTA 2PLFA 4DLWA 1A1VA 3OE7D 5FR2A 5J4YA 4B48A 3WHLA 3MWKA 4ARZA 4PQFA 1S96A 3LLUA 3WYAA 1W0JD 3TW8B 5G3YA 5A0FA 2JJ1A 4PANA 4UNQA 3FMPB 1FX0B 2YOFA 1DTSA 4QGHA 3TVTA 4BFYA 1KNQA 3QXHA 2PMKA 1CJKC 5J40A 2J9RA 3ADDA 3PFIA 2ZM5A 3PITA 5JJIA 1PVOA 1ODFA 3LW7A 1G8YA 4QGAA 2F9MA 2XSZA 3PEVA 5DNYB 5IT5A 2ZIAA 3X1XA 1RRFA 3KKMA 4QC2A 4ZDIA 1XX6A 3B1YA 1YZQA 4C7OA 4JLMA 3PG5A 3EA5A 5C4MA 1L8QA 4NYJR 1YHNA 2JASA 4ACAA 4CDGA 4XWOA 3U7HB 2V6IA 3ADKA 3EIEA 2WTUA 1COWA 1R10A 4A8JC 3F8TA 3W9YA 3RS2A 3AVXA 2RGAA 2WWHA 1ZU5A 3I32A 1GM5A 2W0SA 1G19A 3D6TB 2VF8A 3A37A 3N70A 4LYHA 3HPQA 4PO9A 3NIBA 1CLUA 3THWB 5UKDA 1E9AA 3RWMB 3GFTA 3EX7C 1G18A 4F92B 1YZUA 2H1LA 4Q9LA 4B32A 1N0UA 3BWDD 5EP4A 2GKSA 4RZXA 3K9GA 4PHFA 4ZO4A 2F9LA 3LVQE 2CLDX 3SFZA 2QTVB 3DL0A 3UG6A 4C2TA 2FEOA 2P6NA 4JLAA 2Z43A 5BWMA 2H8KA 1GDDA 5GJCA 1AS3A 4EFNA 4G1UC 2GZHA 4TLCA 1XP8A 5FFMA 4LV5B 2FZLA 2MMCA 1UFQA 4KFRA 5G40A 4AYTA 2ZI3A 4C0SA 2QAGB 5JECA 5L3SB 4PC3A 3GLIA 1II8B 1Q12A 2NO6A 2PT7A 1GP2A 3ZH9B 1Q1ZA 1AJEA 1OXVA 4LYJA 4YDHB 4RD2A 3QVVA 1T5IA 2QNRA 3LBHA 3BBPA 1LS6A 2ZI7A 3C8UA 4TQ9A 1WF3A 1KY3A 3P4YA 4AKGA 5IDVA 1OYWA 1IHUA 4EPYA 2QE7D 2B6HA 3RRNA 4FCWA 2FX3A 1RVDA 3DOFA 3U3RA 3QG1A 3C15C 3O8CA 3P20A 4ON9A 1S1CA 1R5OA 4MKIA 5FBVB 1DE0A 1GFIA 3K0SA 4IOLA 1AS0A 1U0LA 4XVRA 1NG9A 4ZI2A 3GEEA 1G21E 3G5UA 1EESA 2ZJ8A 3H0KA 4DEYA 5E7JA 4DLTA 3CH5A 5FI1B 4KVAA 3OIVA 4OQNA 4B2LA 1ZMXA 2GF9A 5FBRB 4NYJQ 1X8KA 1XMIA 3DMNA 4MGYR 2PBRA 2RGNC 2EFDB 1Z8FA 2FSGA 1KJWA 3L43A 5KYKA 3UKDA 5FL7A 4FI3C 3MMPA 1XU4A 1GTVA 3NDBB 1AKYA 1D8TA 1ZRHA 4GFDA 1IN6A 1MR3F 1ZYUA 3KKPA 3B78A 3VAAA 4TYQA 1TADA 3GJ5A 3U3JA 4Q5IA 4QGGA 5HCIA 3SYNA 3UG7A 1JR6A 2OAP1 4TQAA 1E9SA 1N5IA 4C9BA 8OHMA 4QHTA 2XXAB 4TZ6A 4HAUA
chains in the Genus database with same CATH superfamily
3ZXUB 5L3VA 3TLBA 3MJDA 3QVWA 2D0DA 3N6RA 3JQBC 1T6YA 3DCYA 3ZZUA 2QLMA 2VPIA 4OQMA 4DTIA 2UZ3A 4TGLA 3MJHA 4ZOBA 3SHQA 2IUTA 2AV6A 2ZTHA 3MUEA 2M9MA 4TWAA 4GMKA 1QHYA 5IKPA 3S3TA 2FMTA 3TLMA 1E4YA 1Z37A 3GRRA 3AY6A 1UJ5A 4HATA 4UULA 4Z7NB 3LBIA 4KFTA 4MR9A 3LVBA 1OC2A 2VP9A 2J9GA 4MLCA 1IVSA 3JQFC 1AUPA 1KYVA 4BQSA 2BCGY 3M6LA 5EL0A 1DCFA 3BC1A 3SIWA 4B7UA 3UWSA 4BJ5A 2G8LA 5HVNA 5JARA 1WSBA 3CURA 2O7VA 3IA7A 2Y92A 4NMLA 2JRCA 3BD7A 2I4MA 3OJOA 3GJQA 1GG9A 4A36A 4DJ5X 3BMCB 3PFGA 5LQSA 5KX5B 4KVFA 1KIMA 1Z74A 1QO9A 3MA0A 3TINA 3G0GA 2VTKA 4U9IS 4QEZA 3A1FA 1U8TA 5ERGB 3UAWA 4AKSA 1DOHA 3PFHA 5FUVA 3A7EA 4F8EA 4JN6B 4QLOA 4EVQA 1YR7A 2I7XA 1YS6A 1Q19A 3QWFA 4HRXA 1D07A 4HB0A 1JR3A 1YIOA 2WDZA 5DKFA 5KDLA 3WWDA 1GQYA 5J4VA 2BDEA 5ALOA 4Q3AA 4E5YA 3WHKA 2VTBB 3DEZA 4KI0A 1ZMBA 2HEIA 3FSGA 2GXAA 4ALNA 1PR5A 3N2IA 4L5AA 1VPEA 2I7VA 1SCBA 3HYLA 1PR2A 3PVCA 4ARBA 5BW6B 3R8CA 3ZD8A 2XOXA 2IYVA 4IRMA 2V7QD 3DAFA 3FI0A 4G67A 4H15A 4RM2A 4CG1A 1T4GA 2GM5A 2NWQA 3OA0A 5LA6F 1YFZA 1DBIA 1WSWA 3RSFA 3WGYA 5JO0A 3CLTC 1C0LA 3ES9A 4NAVA 3BJIC 4EY8A 1SUSA 4X1IB 1TZKA 4FR2A 6YASA 3HV2A 2UUCB 1HLFA 1B16A 4JEHA 3WBKA 2QP9X 3ZJUA 2PUFA 2PBLA 4RVOA 2V5VA 1E2FA 1DELA 1UKAA 1QZUA 4LE0A 3LRPA 3PJEA 4FDMA 4PAMA 3NKVA 1FFXB 3G23A 3RWOA 3VTKA 1K7YA 1CF4A 4KR3A 1L4GA 1HKHA 4C4OA 3L4BC 4KGDA 1SIWA 4EZIA 3DYIA 1NXTA 4F38A 4FLMA 3PWKA 1VE1A 2RHLA 1DQZA 2GBGA 2PT6A 2VRBA 2B4KA 2ZP1A 5FFFA 3SX4A 4CV2A 5B4UA 5CYGA 5JEDA 1BCSA 4QG7A 4DLKA 2Z09A 2OVFA 4MDHA 3WAGA 1NZJA 1J07A 3ZVNA 2I3DA 4IAOA 3IP9A 3OQVA 4DR4B 4RHYA 1PS8A 1Q74A 4ETNA 2J46A 2HA4A 4LZJA 1E1KA 2NO7A 2YXBA 4LGCA 3DZBA 1E2QA 3DAOA 4N03A 1TQ4A 4FQ5A 4QRDA 1UM8A 5BN4B 5J59A 1HNXB 5IFKA 4LQLA 4DV1B 4Y7CA 2LE0A 1L7XA 2HUPA 3LPDA 2IL1A 1YRYE 1GLNA 4RPKA 4UUMA 4P7GA 4Z0NA 1SBNE 4ZVRA 1AKVA 1CZNA 1YBVA 5E95A 2ACEA 1JAHA 3NXKA 5KCZA 2B8EA 1O4WA 3WGOA 1T0IA 2W4MA 3WB9A 2SICE 3PQ7A 3R9IA 5HE8A 5LC1A 3T1QA 1J8YF 1ZG3A 2Y9PB 3AERB 3PZBA 3QVGA 4V0OA 5BT8A 1J0EA 3C8ZA 5FNVF 5KHOC 2R9VA 1C9YA 2I7DA 4FFNA 5KYWA 4W1PA 3P9KA 3DULA 1XAIA 3KYDB 4RPGA 2HCRA 3HVKA 3TXYA 3LHIA 3PI7A 1E0SA 4KXXA 3K1AB 2WHPB 1DCTA 1E59A 1T0HB 3TLXA 1JEYA 2OB1A 1H9AA 2BD0A 1L4YA 1M1NA 3TDNA 5ARDA 1GGJA 1NN3A 1GL9B 2ZT6A 4KN9S 5TVKA 1V6SA 4D8TA 1OXTA 2N42A 4FIZA 3W5BA 1YJXA 2D59A 5LP6C 1AKQA 2C94A 2O2GA 3ADCA 3ZV7A 2QDXA 4JJIA 1R0KA 5B7NA 3HG7A 1T0JB 4BP8A 5BPHA 3KXDA 1D2NA 2FGKA 3GV0A 3RJ9A 3PYMA 1MJHA 2R00C 4JBHA 2NU8B 2WHPA 4X85A 4B6GA 4JVNA 4UTOA 3VR6H 2P2YA 1DJMA 2NV6A 2B8JA 1EVZA 1Z7GA 4OP1A 3CPEA 5REQB 4G4SP 1RTTA 2ZS8A 2FSVC 2XRMA 1WVGA 5CA1F 3ZTYA 2CBZA 3OZVA 4IYRA 2FJ0A 3R2JA 3P26A 4KQWA 3GLUA 4YS6A 4CV3A 5KQSA 4R7TA 1DRJA 1G20E 5A3VA 1YB6A 1GILA 2RHDA 3ITKA 3ROQA 3WGQA 1EWYA 5BP7A 1FTWA 4B4WA 4ZIRB 4FMCB 5ITZB 4RTNA 2O5VA 1GPAA 1ZCJA 4L95C 1SUBA 1MV5A 5J4KA 4FYJA 1IONA 1TXGA 1U2PA 3Q15C 1NP3A 3NJ4A 2IWHA 3C14C 4OI2A 4J1TC 3R7LA 4B33A 1EVJA 2GJKA 3FCEA 3UC5A 1M1UA 4PYMA 4N0PA 4RZSA 3E2IA 2XRZA 1O2DA 4MI1A 2QRVA 3ANNA 1KO8A 1U0JA 1UANA 1DBSA 1SHKA 1SUIA 1RI2A 2V5AA 3BZBA 3O8BA 2P9JA 1SZJG 4WXYB 4D0SA 4B8ZA 5JJ5A 2CV2A 1MT3A 1IEVA 1NVWQ 1F2UB 3LUJA 3DLBA 5B12A 3QFTA 1T3ZA 1GAQA 3QMMA 1NNI1 1E2HA 2QD1A 3M4ZA 3OD1A 3VOAA 1MABA 4ILKA 1U9JA 1ORIA 1N4DA 1J97A 3KYCB 4PBRA 2AZXA 3QPUA 1RPNA 4J9UE 4YWJA 2A7QA 2X19A 4O2LA 4RS3A 3IQEA 2CL0X 3EEIA 2Y2UA 1W76A 2ENUA 1S3IA 2ZB8A 3HDQA 2KHZA 2BFCA 4FKBA 3L79A 2UXBB 3TTUA 2V7WA 3AVUA 4LRTB 2JFPA 1E94E 4IIVA 3KR9A 3TLGA 4O4JA 2EYQA 3DJFA 2BI4A 4P5PA 5H3LA 2PS9A 3S70A 4UM7A 1KK1A 1FDRA 5AXCA 4QJ3A 3H5LA 2P3LA 2OBFA 4FCCA 2OD2A 3PQ8A 2E21A 2JJ2D 2V7XA 3KTFA 1KJJA 4F12A 1W4BA 2ZBRA 3TQCA 1WB6A 3NHWA 1E5DA 1R4AA 1ULAA 4KCGA 4MUXA 4YT4A 2XJ9A 3REQB 5I7VA 1Y63A 1R8JA 1PDVA 1KDOA 2VIIA 3JV7A 4OI4A 5HXAA 2C29D 2JIQA 4H0CA 1RJ9B 5GIOE 1VRCA 4DAEA 5DI3A 4QTTB 2YJNA 5HJEA 3LYUA 1KK0A 2OV2A 2R6R1 5J2TF 3MSXA 3L8MA 1H6CA 4HVTA 1NVGA 4JH0A 1ZU4A 2JFYA 1PZHA 3LGXA 1UBOS 2ZSEA 3EIOA 3LX8A 5CCBA 2CV1A 4JXZA 4YRAA 8AT1A 2CXTA 3IXLA 5ALJA 4DXDA 4XLZA 3AY7A 1TK9A 3H0EA 1N7JA 3PD1A 2X7HA 5ESXA 3IUPA 3T6KA 2H7XA 2HDHA 4IIHA 4BNLA 5IJZA 1LQTA 2P2NA 3GVHA 1FRFS 3RS0A 1XTBA 4DCCA 4L73A 1YQDA 4TV8B 2RHRA 3ZHYA 4AKTA 2G9VA 4Q7LA 1UM9B 1E66A 3EDRA 4EVRA 2WKWA 2PD4A 1NLFA 5LDDC 3KKOA 4U00A 3U4IA 2GEBA 2I3GA 1RIIA 3G1TA 3UF0A 4UTXA 1Y3AA 3QEMA 2I54A 1PSWA 4OHKA 4BYMA 4TUYA 2IWRA 1ATIA 2I2XB 3WP0A 4UTVA 1X2EA 1A2KC 4FB5A 2FLKA 5JH7A 3G0DA 3OF3A 6AT1A 1LDEA 2L17A 1JIVA 2SBTA 3DKVA 3GJTA 2C9CA 2AK2A 3ILSA 3KQOA 1XN1A 1K8YB 1V1JA 2PZAA 4I1OA 3WK9A 2HSGA 4CM1A 1B76A 3ZZTA 4GBMA 4MTCA 3CWQA 1QHIA 3A6EA 4RC9A 4O4LA 4M9CA 3FZNA 1HT3A 4UDYX 3N0WA 2VQFB 4Q4AA 2EQ5A 3GMTA 3QXSA 4NNOA 1KS9A 2WTEA 5HKBA 3WNBA 3R76A 3AJ8A 1ULTA 2LDBA 3KO8A 3KP1A 1ZJYA 3DEFA 4G0XA 2P7HA 2YCBA 3C4QA 4FBMA 2AFIA 4HXFB 1EQAA 1Z38A 4JWKA 1NY6A 2I8AA 4QKQA 3ZLTA 1E8DA 1T6BY 1DRKA 1LGYA 1IXYA 2G04A 3CJQA 4KBYA 3X1MA 5C7YA 4B3GA 1MO2A 1XZLA 4FM9A 4CMHA 3EH2A 4P98A 4PZ0A 5TGDA 1YQQA 4P3XA 4EUHA 4JNKA 1RLJA 2EL7A 1P9RA 3LY7A 5FNVB 2YASA 3W9BA 4Z7QB 2CWWA 2I1VB 1L1FA 1QYCA 4JLJA 2EG9A 5ENZA 4KAJA 1O6GA 5SYMA 2JAWA 4MRMB 1IEQA 1S9HA 3DEAA 3HJGA 2ET6A 4GLOA 4AZ0B 1IU9A 2BM1A 3W6PA 3UMMA 1CK4A 4P32A 5KTNA 2A35A 2DPXA 5DN6A 4MVJP 3VKFA 1XYVA 2HWXA 1MFPA 2BHSA 4I19A 3CE9A 1A96A 2PV7A 3FDXA 3MMXA 3OEEA 3PGLA 4WLOA 1MB0A 3LKVA 4W4TA 1I5RA 2VP2A 2R8PA 4GIBA 4RK4A 2A33A 1CX9B 1OJ7A 5KSOA 4QAJA 3JWHA 3ACBA 4AJJA 4GM1A 2HBYA 2XYGA 3HADA 1QO0A 1QMGA 3G49A 2DQZA 3BBLA 3KKQA 1KPHA 3KX2A 5C1IA 4DT1A 4PN7A 2F3PA 1H94A 2P8SA 4DSAA 1X13A 2DJIA 1L1RA 1Q1NA 4CU2A 2A5YB 3EVAA 3EEYA 2KX7A 1UBTS 4LF8B 3ZXYA 1OC4A 2JB9A 4MDYA 3R77A 1V0JA 1VKNA 4ONEA 1ZWKA 2IOFK 4MAMA 4A7PA 3S2EA 1ECPA 4LC9A 4LJRA 1GU1A 4PCVA 4B3RB 2JJYA 3V2GA 1SOUA 1B0UA 5K3SA 4OJMX 1Q83A 1RD4A 2QL6A 2JAUA 2FRVA 4Q37A 2JIPA 3MTGA 5DNWA 2DQ4A 4BRWA 3UHFA 4EO9A 1A9YA 4NMXB 1C9EA 1Q3HA 1I7NA 4K46A 1EWQA 5LP6F 1T3SA 3RFCA 4YJDA 1WPQA 1VHWA 1E8MA 2HPHA 3TL3A 4ZCMA 3O7MA 1GCUA 5C46F 5L8VA 3D2BA 1Y6ZA 2C07A 2D06A 4MP6A 1PL0A 3PQ4A 4W8GA 4YRMA 4PC6A 2HO4A 3RT9A 3VPFA 4DYDA 3WNZA 5C7IO 2DETA 2P41A 3JVUA 1V3UA 4KQFA 4BNDB 2ATIA 4YN3A 5KU7A 1PDWA 3C8HA 3CLUD 4D4JA 3JAWA 3RC3A 4GLLA 5LU9A 1P81A 2QY9A 1BQEA 1MA0A 1PJTA 2AD5A 5IWCA 3DV2A 4G1CA 1OBFO 3OZCA 4JT8A 4M22A 2OCGA 3T4UA 2WQ7A 2FWJA 4QUAA 5AR1A 3T12A 4WBNA 4YWHA 3X44A 3LCJA 4KDRA 1QIGA 3AVQA 3B82A 4UTPA 2ICAA 3N74A 5FOQA 3CE6A 1I2AA 4EA6A 4K88A 1E0DA 4P38A 5DIFA 1D0IA 2QU8A 3CLVA 4N5IX 1XQXA 3DHNA 3G8AA 4YIKA 4F06A 5L7TA 3VR2A 2YOHA 3FDZA 1USUA 4UREA 4L85A 3AOEC 1E3QA 5ICCA 4I4IA 1LSUA 1TJ3A 1Y1PA 2FUCA 2JVIA 2EFHB 3EJ6A 5EJFA 3I0MA 3TSYA 4B3DA 4EI8A 2GBLA 3B6IA 5KWSA 3WX0A 3G0IA 3GVIA 4UUQA 3DEIA 3F96A 4MSUA 3RT7A 1MJNA 2QI9C 5PGMA 1PG0A 1CBUA 4WNYA 3ZDCA 1E69A 1E3MA 3W2EA 1QJCA 1I1OA 1UZAA 4ND2A 2QQFA 7MDHA 2VTBA 3PGJA 2R97A 4GKKB 4PZLA 3DFMA 3DYVA 4OHCA 1ECFA 1HSOA 2UV8A 3L1UA 4UAGA 5THKA 2IE0A 1UP6A 2C3YA 5FEUA 4DPKA 2IX3A 1KTVA 3E9MA 1KVRA 3ICVA 1RRKA 3GLHB 1HSZA 2O50A 2VNIA 3E7FA 4BEBA 3VNBA 2XCUA 1SXGA 2XVXA 3AKCA 1DCKA 3D54D 1VKHA 2PS3A 3DG9A 3GRVA 3KHUA 3QOYA 4RMNA 2ZITA 3WJ7A 1WDKA 1YH3A 2GBLC 2VJMB 4XB1A 4F5DA 3COJA 1B23P 3PE4A 1BH2A 1WHSB 2B37A 2YTZA 3CLTD 4MGEA 4BLTA 4CM4A 3WVNA 4PFKA 4QO7A 2R1VA 4TTTS 1IH8A 3E9QA 4UEJA 5H1YA 1IN4A 2PKQO 3LC2O 4G5RA 2M6LA 2H0AA 1GARA 1XAJA 2WJZB 2NZ2A 1DARA 4H1TA 3NM6B 4O2BB 4BVBA 2WJWA 3THSA 4ISCA 1DDGA 3IR5A 1T0UA 4HR7A 2QT9A 4EHAA 5K3CA 1M34E 1A5SB 1VRVA 3R1IA 5D5HA 2IEZA 1QFSA 5AVVA 1UMCA 3F6PA 4GEKA 3JVVA 4AK9A 1NNLA 4DBLC 3BGWA 3Q8KA 4HXGA 1G17A 1OKKD 2AG6A 4DLVA 4IXNA 1KARA 4ZODA 3NAGA 1ZONA 3WLNA 2NT4A 1WWKA 4D56A 2GBCA 3KPVA 2J6CA 2NXNA 2AX4A 3HLYA 3Q11A 3UJ9A 1KRXA 3CUEF 1LX6A 1OAOC 2HDOA 3LGSA 4NONA 4PZPA 1ZUHA 2FMXA 2QZ4A 2RG1A 3LKBA 1H05A 4OQEA 5I8WA 1SVWA 2WTNA 3EXIA 1CUZA 4XPIA 2RGCA 4D98A 2FZ4A 5CTAA 4J4BA 2J5KA 3L9XA 3W7VA 3M6IA 1Z88A 3OBBA 1C81A 2BOVA 3LO8A 2AOUB 3BWVA 2PZKA 3DEJA 4FK8A 3TXXA 4B47A 1TIKA 2H1IA 4Q93A 4ZEWA 1G291 3KJZA 4WESB 4CHGA 3WYNA 5L40A 1K8RA 3NYQA 3EZ9A 2I6UA 4A8HA 2A5DA 2BL4A 3IEUA 1XSEA 3OZWA 4WXMA 3I9V1 3NV7A 2YHIB 1MB3A 1TM4E 2Y6VA 2YBDA 1VQ1A 2XEDA 4A6PA 4A03A 3IEIA 1TAQA 1IMOA 1TGYA 1ZN9A 3IPCA 3HXLA 3IQWA 3COWA 3RYHA 2G5TA 1E9CA 4OOEA 2XAUA 3LP8A 3EWNA 3N1UA 4DB2A 3H5RA 4MUHA 3U4CA 3BSFA 4M9ZA 1VHJA 2JD0A 2FV8A 2PFSA 2QL7A 4RVSA 3VPSA 2FN3A 4Z4GA 4X93A 5E2BA 3VR3D 1VJ5A 3EC1A 3EXG1 4CI9A 1N2XA 3SSMA 3AVPA 3X1JA 1GPMA 2OSVA 4R9SA 1NBIA 3G2NA 3FYUB 5HNKA 3WYBA 5IJAA 2X15A 4QGSA 5BR7A 1DBRA 4S1WA 4J16C 4J3FA 2C2KA 3NHUA 1SCDA 2ADFA 3ANXA 3V4SA 1TK2A 1Z0JA 4Q39A 5BSTA 1F38A 3ZI7A 5KYXB 1EDOA 3ZW9A 4UJ3A 2O54A 4BVFA 4F0JA 1GKLA 4IEEA 4XYBA 3A1WA 1HYGA 4HGNA 4LGMA 4NV1A 4JV5B 2HIAA 3QEBZ 4A4DA 3K2IA 5SYNA 3FB4A 2BHLA 4ZMRA 2A9OA 1KZ1A 2BMVA 2FSUA 1MB9A 1RFLA 2BUCA 5KYUA 1IVNA 4ZI7A 1L8XA 4LMPA 1Z5ZA 3MERA 2ZRBA 4TZTA 1T6XA 5L3QB 3NIGB 1VSBA 4RTMA 4DCSA 2VQEB 4WZAA 1ZK0A 4HLUC 4QUKA 5B37A 5B3JC 1PSDA 3TB4A 3E8MA 1AURA 2OP1A 1D03A 5CFLA 2QUJA 2WWIA 1Y1LA 3H16A 3W78A 5LVAA 2NTYC 3DB2A 5BXQC 3MUOA 4IINA 2P2LA 4OUDB 3H1EA 4WCVA 1VYVA 4NJOA 3UUGA 5FTLA 1J2JA 4XFDA 1BEZA 1I3NA 1TU0A 2YXNA 3E1GA 1LB1B 1Y82A 1OAOA 4M8SA 4PIPA 3L7MA 1SVLA 3R5XA 3IV9A 3Q0EA 3LYAA 5K45A 3W9UA 4URWR 1XD2A 3EQ9A 1RAAA 4ZAYA 3VH2A 1U0GA 3VJLA 1EJBA 5A6SB 1P1CA 3RSQA 3LVRE 4TTRA 1GKIA 2C8JA 2HK8A 4OP2A 4P35A 5EP2A 3GU3A 4LY0A 4TLMB 1V4VA 2V8OA 1MOZA 1E2GA 1H2BA 1HTBA 3EEBA 3F78A 3CZ4A 5FOTA 2IGBA 2ZUUA 4QHSA 2H92A 4R1TA 1EDBA 2ZYTX 2LNDA 2O9JA 5IYZB 1HFEL 2QMEA 2CMHA 5CEEA 3W5CA 2IOHA 2OGTA 4C78A 4URFA 1KPIA 1V4NA 1HA3A 1G4HA 3BHIA 4YJGA 5AVKA 5BN5B 1B8PA 1A2BA 2Y1EA 3AF4A 3GLKA 3X43A 3BCSA 4HN4B 5EP3A 3GN2A 5EHIA 4PYJA 1WD5A 2PL3A 1D4FA 1T8WA 3P32A 4K9PA 2Z30A 3W90A 3G0BA 3ANYB 2YH2A 1MUUA 5K05A 3KZCA 2MYNA 4YTEA 4XVQA 2ODQA 2X58A 3GEGA 3ZBTA 1UWKA 5DW0A 4MOWA 4AMGA 1OYYA 1ZNWA 4J0IA 3UANA 3GY0A 4NL4H 1YZFA 1H4QA 3PHIA 1OIWA 4OJNA 4A0QA 2F1RA 4HQRA 5FAKA 2UVQA 3ENZA 3BQMB 4TVSA 3BB3A 5AFSA 1YA4A 2VCYA 4RVNA 4FOSA 1PFKA 1GPYA 4W7SA 4ARAA 4EKYA 3RSGA 1Y3HA 3BQ9A 4CKWA 5KI6A 4DBZA 3R6GA 1T8PA 2D8MA 2ECPA 2IRWA 1BQ4A 2ZWMA 2YY6A 1ENOA 2JFOA 1CQIB 2H2WA 2V54A 3AR3A 3EGDA 4KODA 1ZM7A 2ZVJA 4DVGA 3IODA 4IUDS 4K5QA 4XTCS 4M0EA 4WLNA 4B6EA 4KJZA 1X80B 1GT6A 2ID7A 1K0UA 4DC9A 4DL9A 4Y2TA 4TN1A 4D9MA 2CXUA 1F8FA 4E2YA 1JEQB 3LNTA 4PNPA 5C3UA 5A04A 4LWZA 1WM1A 2IXDA 1KP2A 5FXMA 2HXSA 4XI9A 3VNAA 3PYLA 2FG6C 4X97A 4CUJA 1HDOA 4Y18A 1JXOA 3HKCB 4GHWA 3HA5A 3H1TA 5BRAA 5IXSA 3TKYA 2B20A 3A4YA 2AN4A 1C30A 3QKRB 1Z22A 1H4TA 2P6PA 3RVKA 5AXAA 1CLEA 1ESEA 4UNRA 4EO7A 3BAZA 4NS4A 3BCUA 1N2CB 3ZWXA 4INAA 4C1NA 1XC7A 4MW4A 4N5LA 4NG4A 3GXBA 3NM5A 1YMVA 3OZRA 4ZANA 4UXJA 4CPDA 2NG1A 3EPKA 1V3VA 1KQ3A 4JWTA 4M89A 2TSYB 4WY8A 1O95D 4OJKA 1K5DA 4FDLA 5H68A 2GCOB 1GITA 3MMZA 4AJOA 3EUEA 4LXYA 2AFHE 2RKWA 3LNCA 3BRWD 4Q3BA 5J43A 1NUTA 3AEUA 1RJFA 1ZUNB 1ZLYA 5F2KA 4N48A 2QP3A 3BL5A 4NKRA 4NEHB 4ZD6A 1JHUA 3RTEA 3UHJA 4A0SA 1XZDA 4HJXA 2ZE6A 4K7JA 4DNQA 5BV2P 3CTMA 1NSTA 4AFNA 1I7PA 2F3UA 2DPLA 2ZRGA 4HEJA 4DCGA 5JHHB 1NUUA 2I78A 5FULA 3UV3A 3EQZA 4C0AC 1PX0A 2C4WA 5LQMA 2F59A 1GA1A 4NQRA 4UHEA 1TMYA 3DDOA 5CLQA 1ZWLA 4CZ2A 5MHTA 5HKLA 3G3EA 5A2QA 4WZBA 4N9QA 3TTXA 2OYRA 3T0IA 2LWIA 3VYTB 2XUKA 4JLPA 5FPQA 3TB6A 3CRMA 1R18A 5DLYA 2QD3A 3IOBA 1KERA 1U8ZA 1NX6A 2EZUA 4TPKA 1N8TA 5K0FA 5CA1B 1G6OA 1QUEA 1OZ0A 2ZI5A 1SCKA 1SXJD 1VLMA 2H1SA 1E5QA 2VRCD 2JBHA 3IR6A 3UQYS 4KRGA 3AR6A 1XL1A 5KYVA 1A4IA 1ZC3A 2SECE 3W04A 3BPSA 4HYYA 4AM8A 1U98A 1U2DC 1YDHA 3AQ4A 3B6EA 3ETEA 4DA0A 1BU5A 2ONKA 4EYSA 4LF6B 1H2HA 2M32A 4CKYA 3ZKAA 3KSDO 1F2TA 1FSZA 4WLEA 7ABPA 1RXWA 2YWEA 3AKZA 1W2HA 2WB4A 3RREA 3NMUF 4NU6A 3VUEA 4PZEA 3IUYA 4HWKA 5FI0B 3DFUA 5JMOA 4JQZA 2AJ8A 1XJWA 2DSTA 1EUCB 1FS6A 1UIRA 1ZIDA 2GSWA 2PZGA 4I9HA 1SXJC 4GGPA 4JGGA 4L4YA 4MYHA 4OHUA 5ER9A 2YXPX 2VYQA 5H16A 3V1KA 1A71A 4F46A 4M9XA 3A3PA 5J1SB 4KSYA 4U6SA 4ZMBA 5EFZA 2Z9CA 5AKIA 1K5PA 1UWVA 1ISPA 3IP7A 2NU6B 5E6RB 4RD4A 4MINA 1WV1A 2OK8A 4EG3A 5HS4A 1EBFA 5K6TA 4ZMSA 3G9XA 4PICA 3QEMB 1E63A 3JARB 2AJCA 2V59A 3K72B 5F35A 5KUTA 1NXSA 2FWRA 3EDMA 1NJ8A 2WLTA 1XXHA 5EXEA 3PQCA 1IL0A 5C5CA 3ETGA 3FKSA 3O4FA 4B9AA 3B52X 4C6TA 3O1JC 2VJKA 1NZDA 3JR3A 1EM6A 3E9RA 2W6JD 4MYUA 3WKAA 1QRSA 1ONSA 3V9PA 2WHXA 1WETA 3E1SA 4H7FA 3TSOA 1GZHB 1U02A 2P4EA 3FPJA 1KZ7B 3NUGA 2OO5C 3MJRA 2F90A 5KTRA 2BH2A 4R05A 2X1MA 3QXXA 4BJHB 2C03A 2ZT8A 5ICMA 1TIPA 3IVAA 5LLDA 2ORVA 2Z4RA 5IF9A 4LXGA 4QYMA 5JY6A 3DPUA 2DU8A 1NW7A 1BEUB 1KJZA 3PHJA 3KR2A 4NR0A 4E07A 4M0LA 3WXBA 1CJUC 1NR1A 4FEGA 2FA9A 4HUTA 3AHDA 4XWGA 4PIMA 1BKYA 3CUSA 1XTKA 3DR3A 4PO1A 2P0YA 4L07A 4Z5XA 5HKKD 4Q3DA 1C29B 3RARA 1A95A 5L3ZA 3FMOB 3MIIA 1I0LA 3SHWA 3UM9A 5IEJA 3UW3A 4M9SA 3UWDA 3BXOA 3IUJA 5HIIA 3H2JA 1VP9A 3AP3A 3NOVA 3WA7A 10MHA 3IMCA 4M87A 2K5UA 4KKVA 3K8OE 2X4LA 3L8FA 4ME6A 4EHLA 3C98A 1XZ8A 4EW2A 3QKUA 4RKWA 5ESDA 3PDCA 4LF7B 2JH3A 4ND3A 1Z3CA 4X44A 1S6YA 3LWZA 4YGYA 4NZ9A 2P6RA 2F8SA 3QFSA 4O2AA 5IK2D 4G0WA 4M21A 2PWZA 4FZ5A 4D6PA 4F97A 2NPFA 3N28A 2YS7A 2QTBA 3ZI4A 3LUGA 4LE1A 3L46A 2XT0A 2OG1A 3B8HA 3UAXA 4DIBA 4YRFA 3FNGA 3AUFA 1YI1A 3K20A 2EERA 1P4AA 4KQ6A 3RUIA 3L4JA 4Z3OA 4JJ6A 1PZEA 1CJSA 3QX8A 4I3HA 4R1LA 2FNAA 1DO8A 1DADA 1HQKA 1MPTA 3H6KA 1XZCA 3D8RA 3T52A 4JP2A 4H0NA 4KHZA 1P2FA 2TMYA 4DOMA 1QR2A 4OKIA 4EY6A 5JNLA 2XNJA 1QVAA 1EK5A 1M7HA 5JCZA 1CIVA 2A0YA 2ZR9A 2J4FA 2ZAYA 1ZI9A 1PG5A 1CEXA 3A6JA 1GT91 4JX8A 1E79D 1Z5UA 3LC0A 4MR8B 5TT1A 3T4XA 3KYBA 1K8QA 2VTVA 2YVQA 1V45E 3N3BC 3PQ6A 4GI7A 5D8DA 3WIDA 1N1GA 2DBVO 3HJUA 1YIAA 3ESQA 3L49A 1K3TA 4GPTA 2AI2A 3R0IA 1GEEA 2FPKA 5EHZA 4RVUA 4ML3A 5DXFA 5FBLB 2WJ3A 4E33A 1UKBA 1G7RA 2ZSFA 1L0BA 1NQOA 1RWNA 3DDZX 4L3VA 1B73A 3AOGA 4EENA 1OLOA 1DO2A 2XX3A 3H9EO 5K8TA 3AESB 3VU9A 2X9GA 3BD8A 1JAYA 5ABPA 2XOKD 4N9WA 4XWTA 3NIFB 4YCDA 5B1HA 4BB0A 3TZLA 4RTKA 3B2NA 1UKEA 2OV1A 4MPDA 4PGFA 4V39A 2JIBA 3EXEA 2ARKA 2FUKA 2DG2A 4HX2A 4MULA 2F6RA 1RC1A 4TXHA 4HAWA 4Z4CA 1NJSA 1KYWA 1TT5B 2QUBA 2RGUA 2UVDA 3QJGA 1PRYA 4HTFA 1KI4A 4E7OA 1WUKS 2ZVDA 1T9GS 1KYZA 1FEZA 2Q1UA 1HRKA 1THZA 3ND9A 3R09A 3WOVA 3QV2A 3J81A 2NSYA 2JLBA 4DCJA 3C3AA 3AB3A 4I55F 4LJSA 4JI4B 1WXEA 5CGQB 2FFBA 1U4SA 3BCRA 2CNNA 3ITEA 2HI0A 1SD1A 3V2IA 2VDJA 4DGQA 5JV5A 3RC7A 2B0CA 2EDCA 3G5LA 4JYBA 5LA6A 3MFYA 5I7EA 1PIWA 5AXDA 4CR6A 1NI3A 1FCJA 3HRHA 3F5SA 1BWPA 1SCUB 1GPH1 3WMRA 1W96A 2V0CA 3PHCA 4YUXA 3FFXA 1TOAA 3HO8A 2NN3C 2F8LA 2VUTA 3CBGA 4LBVA 5C80A 1ND5A 2FG7C 2HRQA 3VYSB 1ZUNA 1KMHB 2ZB7A 4XDHA 1ES9A 1Z33A 5KU1A 3AONB 4M54A 3CEPB 4GR9A 3O2SB 4XASA 2GK3A 4IIGA 2C7GA 3GEHA 3O5AA 5E1MA 3AHFA 2DE0X 3O26A 3PDUA 4FDTA 4QXOA 2K6GA 3IKLA 1XPUA 1PK8A 4ZO6A 5JRJA 5AUQA 3SBXA 1EFTA 1FSPA 1OZAA 1NN1A 4YMTA 5F5NA 1ILEA 4LISA 1M2WA 1FP6A 2DLNA 4CTNA 4OQPA 3K2QA 2PGLA 1Q7BA 2MOKA 1JQKA 2KE5A 2YQ4A 1OXXK 1D0VA 4KR6A 2RJNA 4RZUA 1U3DA 5H70A 2H2HA 3M5DA 5K0NA 1Y9DA 1RJ9A 2BV3A 4KXNA 3DO8A 3I6MA 2AIRA 5K8VA 3ILXA 5LU8A 3M5CA 2UDPA 3WK7A 4I1VA 5A5FA 2AKEA 4LZNA 1KHTA 3JR7A 4X90A 4FN4A 1H4SA 1LZLA 1XK7A 1PQWA 1TCUA 1Z0SA 5D5QA 5K8JB 1B0PA 3KLBA 4YCCA 1ZW6A 5DM4A 1AE1A 1RLUA 3K0HA 1ZQ9A 4DV2B 1ZIYA 2X5JO 3BMOA 4IWXA 1BE6A 1I2MA 1W73A 5KNDA 3PUZA 4OHYA 3CPJB 3MUFA 2Z3VA 2G7MC 1MJ5A 3ZHCA 2R8BA 3FSGD 5LZ5A 4G5QA 4JI8B 2CVOA 3PIIA 4Q1DA 1NJ5A 1DMSA 3NTOA 1U3FA 4CL0A 1QANA 4OXYA 4JYZA 4RY0A 3OZ7A 2Q28A 1TKBA 2QD2A 4PG7A 4ZTBA 3TDMA 2AJTA 4RHTA 3HZRA 3GGGA 4V2IA 4R1UA 3GB9A 521PA 3L8HA 4TS3A 5FO0A 1SOAA 2JG3A 4Q3CA 3OLQA 2PUVA 3DE3X 1A97A 2L42A 1FP7A 2FOXA 2NGRA 2W2LD 3MAGA 5J2UB 2Q9UA 1CF2O 2EBWA 4CL8A 2BFPA 2IK8A 3GDFA 4E46A 3L2OB 4HNTA 4BVHA 3ND7A 3ZY3A 1KI9A 2V7GA 2XUAA 1BW9B 4AXXA 1O95C 2JFVA 3R74A 2DCUA 4JS0A 1L5MA 3Q1LA 4KLCA 4CMBA 1DCMA 1QTNA 3LK6A 1PJZA 4B76A 1CV2A 3R7WA 1G8SA 2WYHA 2VDQB 3KUXA 4UXHA 2CLFB 4Q9JA 1KSGA 1JDBB 4BO5A 4P5DA 3Q5DA 4IBOA 5DYIA 1WCYA 5LNK6 3UQZA 2QBYA 1Z13A 5KSPA 3LGAA 4E1VA 4DR7B 3PWSA 1HZZA 1QU3A 3THXB 3S5JA 1NMYA 3GLGE 2XHZA 4NFHA 5CLLA 1A3CA 3A3YA 4FGKA 3IBGA 3L6DA 2IHJA 4FC7A 1W5SA 2I3AA 3TQSA 2A59A 1E3IA 3FHOA 3E3AA 3ADBA 2JIZD 1L7OA 4TYYA 1CJTC 3MXTA 2PHZA 4MUFA 1G3IA 1H8HD 3QE2A 2FB9A 4XUDA 3VDXA 4D02A 4Q4CA 2N9UA 1CR2A 4E6EA 3VNUA 3DT6A 3OE1A 1P61B 1XLUA 1RQRA 1JEEA 4BKUA 3V7FA 1Z5GA 2OTCA 1MX3A 3IE2A 4B35A 3WGMA 3W3AA 2HDWA 2RHHA 3FKSD 3PQEA 2D74A 1A77A 1RI5A 2O5CA 2GZ1A 3QX7A 1P72A 1VE5A 1YXMA 3TFQA 4DIMA 3LQQA 1ZH2A 2E0IA 3BJRA 4DSTA 1OGJA 4WLVA 4QL3A 1N0WA 5I5EA 3COPA 5KWEA 2QRPA 1VXRA 3S4YA 3F67A 1J20A 4YRNA 2HREA 3ZJ5A 5IASA 1X2BA 4KUEA 4R54A 2DPMA 2QYSA 2JI6A 2DFLA 3A1DA 3FSEA 3NKLA 1ELOA 4HQLA 1JEQA 5ES3A 1AA9A 1L5KA 3RQIA 1E9DA 3UUFA 3VFDA 2JEZA 3BA1A 4YJ3F 3TTWA 1SUDA 2IXBA 3VO1A 3R5JA 3I01M 4G2NA 2R65A 3OD5A 5A9SB 1UDAA 1E58A 5E6UA 4ALJA 2PSDA 2WFLB 4IRUB 1AK2A 4N01A 4UE3S 5F2OA 5CA0A 3R8XA 3GEPA 3LQYA 2A3RA 5F73A 4I46A 5BSKA 2HBQA 3PFKA 4LFBB 4GW3A 4LBYA 3M3PA 2ORIA 1IBSA 4WZZA 1LBIA 1X87A 2P2GA 5EIXA 1KO1A 5K01A 1YE3A 3EWAA 4BNUA 1N2SA 1R00A 2Q2WA 4IILA 1DAMA 1OXUA 1PKXA 3SJBA 1FMFA 2AE2A 5LYJB 1VMEA 2ZUVA 1BE0A 4Q4JB 1J5EB 5EUBA 5JSHA 3R0QA 2ZRJA 1E4VA 1KFKB 3H87A 3DFKA 2HTEA 1XGKA 3SLRA 4F6LA 2DULA 2C4UA 1J2UA 4DJJA 1R5BA 4TMTA 4XX0B 4JVMA 1TLFA 3EIHA 8ABPA 3COSA 5FWDA 1XWFA 1FS5A 3IGFA 3SFVA 1T8RA 2G4CA 4JJ4A 3VKGA 3U9LA 1JHDA 5HJ5A 3W7AA 1YAHA 3KAPA 5GONF 4MRNA 2O8BB 4Q1AA 1TD1A 5IH7A 1ZEJA 2GZSA 3GFSA 3OI7A 4KLZA 5E2AA 1BX3A 3FI9A 4EEKA 1H69A 1W0KD 3VZDA 3OTWA 3U81A 3TM4A 4LPKA 1AVTA 2I34A 3G1WA 4YIHA 1D5CA 1CETA 4YJGB 4BXOA 5LKRA 3S1SA 3DKKA 1DP4A 1JJVA 1EI9A 1A2OA 2B4YA 5P21A 3RSZA 4G09A 3WRXA 4J16A 3GJSA 4RTJA 2Y66A 2Q3DA 5CFPA 1SG6A 3R7NA 4UNPA 1T1SA 2O3RA 1KEEA 2OXTA 2OHFA 3G7UA 3KSBC 2R79A 4O29A 4K87A 4FFBA 3FHTA 2NP6A 2XMBA 3T5AA 1W36C 1FS4A 4TKLA 4Y9UA 4XWKA 4R4JA 1C8BA 1FNDA 2VDUE 2WUFA 3JYHA