5IHPA

Crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
246
Chain Sequence
MTRVLAVANQKGGVAKTTTVASIGAALTEQGRRVLLVDLDPQGCLTFSLGHDPDKLPVSVHEVLLGDVEPSAALVRTDEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKLDGDFDVVIIDCPPSLGVLTLNGLTAAHDVIVPLQCETLAHRGVGQFLRTISDVQQITNPDLKLLGALPTLYDSRTTHSRDVLLDVADRYELPVLAPPIPRTRKSKGAIAYREFADALLRHWKSGRKMPTFTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobyrinic Acid a,c-diamide synthase
publication title Crystal Structure of Cobyrinic Acid a,c-diamide synthase from Mycobacterium smegmatis with bound ATP analog and Magnesium
rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Ligase
total genus 81
structure length 246
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5ihpA00
2BM1A 3OEED 4BPBA 4XJXA 3FOZA 3HR7A 3KJGA 4Q7KA 1R5BA 4G5SA 4LJ6A 2R65A 4M9ZA 4B48A 4JSYA 3BJIC 3U7FB 3HWSA 1EG7A 4URXR 1N5JA 1ZM4A 2A5GA 3ADDA 1TNDA 4C0QC 3AKDA 4WXRA 4N0DA 1M7HA 1AIPA 1G7CA 3F3YA 1J7KA 3BRWD 3TUZC 5EXSA 4A8JC 1G8PA 1F3OA 2BKEA 3DMNA 2O8BA 4ON9A 2CHGA 3SC3A 1B0UA 5DO9A 4F92B 2YC2C 2ZAOA 3K53A 1EWRA 1OFIA 1E79A 1IXRC 1GL9B 2GF0A 1C4OA 2J45A 4JLDA 4LJ5A 4TT3A 5H1YA 4AURA 1II8A 1JB1A 2GVZC 4R2IA 1JPNA 2QGZA 2EWVA 5FPSA 1E2JA 2EWWA 2F1JA 4HLUA 1P2SA 1H65A 1GL6A 1QG4A 1XTJA 2JLWA 1P9RA 2IXFA 2XX3A 4NYMR 4S2EA 4GI7A 3AKCA 1XZPA 5EE1A 2C9YA 3AEZA 3IIJA 2IS1A 1SHZA 3AVYA 2UKDA 3TE6A 1DG1G 4TT3D 5JI2E 3QSYA 4MYUA 5CJ2A 1SQ5A 1U81A 3MJRA 3CF6R 1Q22A 5KTYA 1I4DD 2IXEA 5EE9A 1UBEA 1G7SA 4YC7A 4DEXA 1F2TB 1Q3HA 2FN4A 1YQTA 1OV4A 3GEIA 3A1SA 1P2VA 2L0XA 4XIGS 1VCIA 3NEJA 2O52A 4IW3B 4OJQA 2MSCB 1YRBA 5JRJA 3RANA 2ZANA 3RS5A 4CEIB 4XWKA 1AGPA 4LYAA 3ZJYA 2F1HA 4QBHA 2C96A 4DB4A 1L4YA 1PUJA 4C9BA 4DCNA 1QZXA 4PHHA 2CEAA 2G88A 1HE1C 1T4GA 4CT5A 4A6XA 1R6BX 1TX4B 4TLBA 4ZDJA 3RC3A 2HCJB 3OAAA 5EE5B 4LJYA 1RYHA 5CDFA 1GKYA 4CZ2A 4LYFA 3H2YA 1KMHA 2R6AA 1Z5ZA 5AJVB 1P5ZB 2RGAA 1V5WA 2FE4A 5SZJA 1N6LA 4TN1A 1E2NA 3VR5A 3AVPA 3TR5A 4WZ6A 5KSPA 1JR3A 1KK0A 5KSYA 4V03A 4OKSA 4B33A 1K8RA 2OXCA 5DNYB 3C15C 5J4KA 4QHYA 3OAAD 2NPIA 1O87A 4LV5B 3W3ZB 3RDPA 3T15A 2P67A 4QXAA 4HAUA 1US8A 1ZMXA 5TDHA 1H8HA 1HQCA 4YDSA 2CLDX 3THXB 1F5NA 2IYYA 1N6PA 2IYWA 1OH8A 4TYWA 4Q1CA 3K09C 3L0OA 4TQUS 4HDCA 4U5XA 4YONB 3EIEA 4FCTA 4QM6A 3WHLA 4JLOA 1YRAA 3TBKA 1H8HD 2CL0X 3SYLA 5FH9A 3PEYA 2ZI3A 1E1RA 1UBCA 3GJ8A 4BFTA 4FMCF 2GAOA 4Q7MB 3AGQA 3D7MA 4LPSA 1KOFA 4P4SB 4A0GA 2IYTA 3QG1A 4OQXA 2V7QA 2D06A 3BFKA 4V0NA 5E3HA 3W6OA 4R9UC 3UMFA 4HZUB 2D2EA 1E1RD 1R10A 5SZIA 3X1ZA 1ZU5A 4PSVA 3IILA 2ZRMA 1G17A 2Z83A 1KO8A 3KKQA 4LZZA 3E2IA 2XTNA 4Q1BA 2V7QD 2IF0A 3QKSB 1KNXA 1L8QA 1SHKA 1OIXA 4Q01A 3FKSA 1E6CA 2QP9X 4BASA 4NCNA 2AXPA 5FL7A 3T5DA 4QNMA 4F4IA 3D8BA 1VHTA 4K81B 2GNOA 1IN8A 1CF4A 1LNZA 3P27A 5C18A 3FMPB 3KKPA 1TTTA 4JYCA 4DDUA 1Q12A 4M9QA 5B57C 3NH6A 5E7IA 3VR6A 2CL7X 2GVDC 3FKSD 3PEUA 4B3DA 1FZQA 3ECCA 5FL7D 3VHXA 1P73A 5BN4A 1Z3IX 4F4CA 1S4QA 1S1CA 1ZIPA 2ZYWX 3MWYW 5FL3A 2ZRJA 3PFIA 5SZHB 2IUTA 2D3WA 3G82C 3L0SA 3AH8A 3LXRA 1DEKA 3NKVA 2OAQ1 2W00A 2GILA 4QBIA 3KFVA 4HAVA 3WRYC 4DC9A 2DFLA 1G5PA 3NVAA 1NG1A 3LW8A 1IONA 1NVVQ 2IS4A 1ESNA 1X86B 2AD1A 3N2EA 3VNVA 1AS2A 1HQYE 2EFHB 5AR1A 5FI1B 1XMJA 4EJSA 1P3JA 2RHMA 3EWSA 4DLZA 1KGDA 3MFYA 1NP6A 5F3WB 5J4LA 1EFRA 2ZU6A 1T8UA 2J7PA 3BB1A 5F9FA 1D9XA 621PA 1W36B 1Z2CA 3CONA 4UXHA 4IDOA 4MKGA 3SJCA 3BAFA 3PVSA 4UNRA 4DRZA 2ODEA 3LY5A 2WV9A 5GADl 2YKGA 2CHQA 3ZQ6A 2P0EA 2JDIA 4CF7A 2VHJA 1KI1A 2J0SA 1NVWQ 1EFRD 1NVUQ 2J7PD 1M6NA 3RSOA 2OG2A 2CJWA 3HJNA 3U6KA 2YNMA 5DYIA 1I4TD 2UVQA 3ICEA 4D4MA 3PUXA 2QN6A 3QUSA 2LWIA 3QEOA 3PXGA 5KSOA 5B30A 2JDID 5G53C 2PH1A 3NH9A 2ODWA 3THWB 4MA4A 4TSFA 1XJCA 4II7A 3B85A 4MGZR 3ZD7A 1E9SA 3QKUA 4NYJR 3T12A 3W8NA 4FCVA 3Q85A 3W9YA 1G9XA 3CNLA 2F7SA 2GJKA 4Z1MA 2GCOA 4OK6A 4G1UC 2IEYA 2WBLC 2ZSDA 3QXSA 1FX0A 4F91B 1OKKA 2NTYC 2X8AA 4TSFD 1FTNA 1MV5A 3B6EA 2VHCA 1NVVR 5BN3A 2XEXA 2P2LA 3BIFA 5B2ZA 3DKVA 1KY2A 3B82A 1FUKA 4KLNA 5FBQB 3NEYA 1WB9A 4Z1MD 1ZD8A 3CR7A 3EW9A 2O8DA 3IO3A 4PC1A 2C77A 1CJUC 4Q4HA 4W5JA 4M1SA 3IGFA 4ACAA 1DVRA 4JLMA 1OKKD 4XSGA 4A2WA 3IEUA 2IWRA 4B75A 3T61A 2QRZA 4BZXA 4FMCB 2KSQA 2R62A 1R0ZA 2A5JA 2QL6A 3CRMA 3V00A 1E0AA 1XXHA 4WOPA 4ZIRA 4DCTA 1YZQA 1P9NA 2AD5A 4IOJA 4FMDB 4I1SA 4OHWA 1YZNA 3OHMA 2GBLA 1ZYUA 1ZU4A 2OUKA 3IDQA 4BFSA 5FPTA 4Q9KA 4OYHA 3U2QA 4DT1B 4TMTA 4ZO4A 2FEMA 4AKHA 3SZRA 1SXJB 5EE3A 4D82A 2G0TA 3MWJA 2AWOA 4TLCA 3QJYA 3RS3A 4B71A 2J46A 4PSKA 4D0GA 3GFOA 1MR3F 4WIAA 4ZCIA 1MRNA 1Z6XA 3K8YA 1VYVA 1K5DA 2ZRHA 3RHFA 3U61B 1WMSA 4ZCMA 4PTLA 1RJ9B 4QJ3A 2WKPA 4F38A 4Q5IA 2A5YB 4TTRA 2QP4A 1GG2A 2XSZA 2AK2A 4RZ3A 2R8RA 3EC1A 1E99A 2PCLA 1VG8A 1W4BA 1G3UA 3NC0C 3GLHB 1CBUA 3B13B 2O8CA 4QC2A 3T1TA 4B34A 2JJ1A 1SVWA 1XD2A 1G64A 4ZDIA 4AD8A 4NZYA 3MSXA 4HLQB 3KUCA 2YWFA 2XSZD 1OXSC 1G8FA 3W3AA 1G3QA 2FGKA 4BFVA 4IDPA 5L3RA 2IHBA 4BLOA 4JVLA 1VKJA 2WWIA 2WICA 2NIPA 5KU1A 2YJTD 4YLGA 5L3QA 1I2MA 1XMSA 2FG5A 2JJ1D 3K9HA 1Z63A 2EQBA 4ARZA 4C0JA 4LX0A 2ZR7A 2HF9A 3I72A 5CLLA 3HU3A 4ZKEA 3GLGE 2NO1A 1LS6A 4TYPA 8OHMA 2QSYA 3C14C 1Z6AA 5TY0A 3ZZTA 4AI6A 3OZXA 1YR8A 2ZRCA 4TWZA 3OE7A 2FF7A 5JSZB 1D5CA 1EFHA 3CLVA 5EP3A 4QGAA 1BKDR 1NY5A 3Q7QA 1NMYA 1XNJA 4V0KA 2AFIE 1KO1A 4B44A 1KYIA 5H68A 2ERXA 4Z51A 2ZVPX 3FMIA 3P1JA 3R8CA 3RWOA 4BLSA 4KVAA 2IUUA 4HDQB 2B8TA 4C4PA 2ZJ8A 5JMTA 4LY6A 2VPPA 3K0SA 3D31A 2BCJQ 3BBPA 2J87A 4KODA 5J4YA 4DBLC 4D4LA 2BDTA 3OIYA 1KJYA 4LOAA 3P26A 4JLJA 2PX0A 4IDQA 2ORIA 4BFUA 4FN5A 3ZVNA 1SULA 2V6IA 1SKQA 2WWGA 5BWMA 2ZI4A 2VP6A 2G9NA 4KO8A 2ZYVX 1L7VC 2KWIA 2R9VA 3K0FB 3LWNA 3P4XA 4US2R 1GUAA 1N6RA 3U44B 2ONKA 1GWNA 2GXQA 4QGGA 2WOJA 4LPKA 1OXXK 4YMSA 3TGPA 4OHYA 2ZE8A 5FR2A 2EYQA 3DEFA 3W5JA 3EG5A 4ERNA 4AC9A 2F9MA 1HE8B 4IFEA 2O8FA 4QOSA 1ZAKA 3AF2A 3IHLA 2EFDB 3ZS9A 3ZQJA 3E5HA 4DXAA 3ZVRA 4CDGA 1Z0JA 1E9EA 2JLSA 5AJYA 1Z29A 3WNDA 4GFDA 3IPYA 5L3SA 2B92A 3CW2A 2BBOA 2HYDA 3GP8A 2KJQA 4YXWA 1Z07A 2QAGB 2ZSFA 4RFVA 2W83A 3BB3A 4Q1FA 4LV6A 2B7BA 1KSJA 2EU8A 4BLRA 2OFOA 1CR0A 4ZPXA 4BLQA 3GEEA 3A8TA 4IOKA 1NIJA 4RFSB 2OCYC 4MRPA 4YXWD 1UAAA 1AN0A 1P62B 2WKRA 2YINC 5FPYA 5G3ZA 1SKYE 4DEYA 2RAPA 1HT2E 2Z4RA 1T8TA 2WHXA 5EXPA 2QPOA 3VX3A 2WJJA 5EQTA 5AUQA 3WBKA 5HE9A 4Q48A 1L2TA 1M8PA 1E4VA 1SVMA 2PLFA 2BVNA 2BWJA 2OCAA 4LV8B 5FTJA 5F9HA 1W2GA 3OIWA 5E4FA 2ZI5A 1NF3A 2C9CA 1WF3A 1X1SA 3GLFE 1FQJA 1MO5A 1XD8A 1E9DA 2V54A 2WSSA 5IK2A 1NLZA 3ADBA 3A6PC 4X8LA 4L9SA 2HJVA 3AM1A 4D4JA 2ZRLA 4JL5A 2JLYA 5AJXA 1LV7A 4GSYA 2EYUA 1ZVQA 2OFXA 3MMPA 4B3CA 1AQYA 1T5LA 1U0LA 4B3XA 3K0AB 2ZRFA 1Z2AA 2WMNB 2ZS7A 5E95A 2IS6A 3GLIB 2N1BA 5DI3A 4DIEA 5IK2D 2WSSD 5CK5A 1A1VA 1JJ7A 1JI0A 1J8YF 3EZFA 3LBHA 4JSTA 2ZRAA 2F9LA 1A7JA 4H9GA 2ZJ5A 4M21A 3EWAA 4LHXA 5DISB 4LK2A 1OYWA 3KTAB 4N3NA 4PQFA 2B8WA 4LHZA 1TQ2A 2QQ0A 5AWFC 4D81A 2KI5A 1DG3A 1MH1A 4K46A 1Z6GA 3T1OA 3PR1A 3Q8XB 2IWHA 3RLFA 3VQTA 4TMWA 4O3MA 2C04A 3B8HA 3GD7A 2PT7A 4HAZA 4OI1A 1Z0FA 1TEXA 5KYKA 2XITA 3L0IB 2PL3A 1VG9B 1S8FA 1J8MF 1W49A 4IFBA 2Q9AA 4LUCA 1WRBA 3ZVMA 3H86A 4MRSA 4Q7LA 4E22A 2W6JA 3CH4B 1PV4A 2HF8A 3SN6A 3EA5A 3LRPA 1GIAA 2DWQA 3LXXA 4QKQA 2J59A 4UJ5A 3DM9B 1RVDA 1Z22A 1TUEA 1Z8FA 4LJ4A 3SBEA 1XJ0A 4F93B 3TMKA 1NKSA 1G16A 4WBSA 1A5TA 3V4FA 2FEOA 1A82A 4TL8A 4CEHB 4WW0A 3THOA 5CB8A 2A3RA 2WWYA 1RPZA 3M0EA 2W6JD 3TK1A 2WJGA 4DCUA 2JA1A 1T5IA 2JJ2A 1G21E 2QSZA 3B1ZA 5JI3E 3X1WA 4QNRA 2ODNA 3JVVA 4Q1DA 1UKEA 2WM9B 3WXMA 1RZ3A 3KKOA 4ASUA 2NOAA 4LRWA 1GZSA 1EGAA 3QENA 1W1WA 3C5CA 2F3TA 5FOXA 3R7WB 1TQDA 721PA 4IEEA 1W4RA 2RGXA 1E2DA 2FU5C 5K8UA 4F4JA 2V3CC 2JJ2D 1FPMA 2ZRIA 5EUMA 1JEDA 2F1IA 1BOFA 3RRNA 4KI0A 2IYXA 4D0NA 4KLZA 2ZSBA 4NYMQ 1NN3A 1T3SA 3PCRB 2IUSA 4ASUD 4X8HA 4PFSA 4JLKA 1NI3A 2I1VB 1R0XA 3ZDQA 4C0KA 4E03A 2NMVA 4Q4JA 2B7CA 2NQ2C 5EXTA 5J47A 3AV0B 2XZLA 5CM8B 1UKVY 4TL6A 3VR2A 4QJ4A 2W2XA 1JAHA 3FHTA 4PO8A 1C1YA 1XTRA 4BFXA 4BEBA 4XH9B 3K0CC 4PXAA 2VLIA 2D74A 4J0QA 4B47A 3K70B 2QI9C 3HYTA 4RD6A 1GL7A 3R9IA 1OIVA 1D9ZA 1Q1BA 1T3LA 3PV0A 3CRQA 1MABA 2FSHA 2JATA 1KDRA 4Q47A 5TB5A 1XZQA 3H1TA 4GBMA 2KE5A 2RGNC 5BN5A 2FPLA 3F8TA 5GJCA 4BECA 5C2JB 1R5OA 5JJKA 4TMVA 3KL4A 1PLJA 4PPQA 1VMAA 2AHOA 2IC5A 3FTQA 4LJ7A 1NVXQ 2P6NA 4NCIA 4TMXA 1CP2A 2XZOA 2ZE7A 2ANBA 5EE0A 1E2GA 4M9XA 1FMJA 5FPHA 4B6FA 4A82A 1CR4A 2VHTA 3O47A 4JKYA 2HEIA 3DKPA 3SJZA 3AVXA 2O8DB 1I2DA 1IHUA 3F5FA 4PHFA 3TSZA 3JZMA 3QKRB 1P2UA 3ZIAA 1KAGA 3B2EA 4MDEA 1NMZA 2WJHA 3NTUA 1KDTA 3QNUA 3IIKA 1F2TA 2OLJA 1YU9A 1O3YA 3WP0A 3A1TA 2BC9A 1UF9A 2NZ8A 4EAQA 2LKDA 4DB2A 3LQRA 4KHZA 2WSMA 3WYAA 1XEXA 1U2RA 1N3BA 2GKSA 2ZUDA 1E96A 3ZIAD 1BIFA 4IVPA 2AN9A 1ZNZA 2CVFA 1KI8A 2ZRGA 3B60A 5TXGA 2CHVA 1EX6A 1GNPA 3U3KA 4BRUA 2O8BB 3K1JA 3Q3JB 1NY6A 3X1DA 4B74A 1S9HA 4ZKDA 4GPTA 3QPWA 1ZJ6A 2F6RA 2JJ8A 2PX3A 2W0SA 2ZRKA 3BC1A 1E2KA 4QG7A 5FOWA 3TVDA 5EP2A 2HV8A 1FFHA 4WA7A 1LF5A 1OH5A 1MO6A 2ZJOA 2QP3A 5KPDA 2YWGA 4O2LA 1II8B 1G4UR 4A0FA 3CF0A 4M0LA 3AB3A 2ZETA 4ACBA 4BLPA 5BW8A 4OI0A 3GJXC 3ZD6A 5H70A 4BUJA 3L8YA 3MWLA 2D2FA 2ZITA 2OE2A 3RRZA 2E87A 1II0A 3ZYCA 4TL7A 1SVLA 3GFPA 5CIQA 4M1WA 5G3YA 2OO7A 1RIFA 2WOOA 4D2IA 4A92A 2GXUA 3RVBA 4U7DA 4PQYA 3J81k 1QHIA 2RB4A 3GJ0A 4B2PA 3EARA 5JWOA 4OHXA 4BE7B 2J0VA 1E32A 1XTSA 2MMCA 1CKEA 1DO0A 2QTHA 4CT4B 3DOFA 3G5UA 5J4HA 4D26A 4L15A 4AKGA 1D2NA 1W48A 4YMVA 4EPRA 2V4ZA 1N5IA 2WVJA 2NO7A 121PA 3KQHA 1RW4A 1UBFA 2XNDA 4JVMA 3U5ZB 1OW3B 3GFTA 5K8LA 4OQFA 2Q0HA 3QXCA 4PAMA 1AA9A 1EX7A 1XU4A 2HT6A 1Z6TA 5JEDA 1H8EA 3VKHA 1Q1ZA 5JS8A 4H1VA 3GJ5A 1J70A 3K0EA 2BKUA 3MAAC 5KNCA 5JJLA 1I4LD 2XOKA 1R7RA 1SXJC 3B1VA 3TAHA 5A4JA 1CJKC 4W7SA 1KSGA 4LHVA 2XNDD 2GJ9A 4HZUA 4XVUA 3QEJA 1IN6A 3UMRA 3AVTA 5JHGB 4MGKR 4EPYA 4EPVA 1QHYA 1R0WA 5CK4A 1H8ED 5DSZA 1N6IA 4GZMA 3T06B 2B21A 1FNNA 1P61B 3GLGA 2XOKD 3LVQE 1Q44A 4FMDF 3AP1A 3PENA 1US8B 2NZJA 3EXAA 4UXJA 3UKDA 1KO4A 4I1VA 4FD2A 4GNKA 1ZNXA 3TW8B 4RCZA 2BIFA 1QHNA 1JECA 4PC7A 1QHSA 4ZI3A 2HJGA 4TLDA 2FJUA 4OK3A 3B1WA 2WJIA 4QFMA 5EXXA 3KQKA 4HUQB 2Z43A 4UXIA 2F55A 2IYSA 2C9OA 5CITA 5JBQA 4P4TA 3CZQA 2VRWA 3NBFA 4LJ9A 4PAQA 5L3VA 1RRCA 2DR3A 2E9SA 3AF1A 3FVQA 1G4AE 4BQSA 2HUPA 1KTVA 5LB2A 3LLMA 3KQLA 1TQ4A 3ADKA 1YZTA 4JL8A 2XJ9A 3S1AA 3U4QA 1YZKA 2RCNA 4GOJA 1M1YE 3RAPR 2WIAA 4ZDKA 4MITA 4EUNA 5FBRB 1Q1QA 2DB3A 4M8NE 4OL0A 3TAUA 3WRXC 2CMKA 4RKEA 4RZ2A 3CIOA 2GAAA 821PA 2AWNA 2O0HA 4A8JA 1KIMA 1HY3A 3LX5A 4Q18A 1E2PA 4NYJQ 2ASEA 4RZUA 1KI3A 4B35A 3PUZA 3RC8A 1L4UA 2BHRA 1S96A 1KZGB 3M4YA 1Z0DA 4DSNA 3RRYA 1P72A 1DAMA 2PZFA 4DSUA 3ETLA 1IN4A 3CF2A 3I8XA 4B3BA 3CPHA 1KJZA 4G5GA 2DFTA 1CJMA 3GJ6A 2AKAB 1P75A 3EZ9A 1T9HA 2H8KA 4DSOA 1KJWA 2ANCA 1G18A 1X6VA 1QRAA 4LC1A 1U0HC 1PLKA 4Z54A 5HZKA 4DDWA 3ZLJA 4L4UA 3FKQA 4CEJA 1KDPA 4AG6A 1E2QA 2QBYA 2A2ZA 1DELA 4HDOB 5C4MA 3A58B 2RH5A 3FE2A 5AK0A 521PA 1OIWA 1GKUB 2XTZA 1T3HA 1E94E 2NG1A 3QQ5A 1P60A 2GK6A 1KNQA 4TTQA 5HKKA 1IY1A 2VA8A 4O0MA 5JS7A 1TF5A 4B73A 2GZHA 1XP8A 3CX8A 4Q1AA 4LWZA 3KXKA 4CIDA 5LPNA 4ABYA 4HUTA 4FXPA 4P31A 1CJTC 4MGIR 1GM5A 1G41A 5LD2B 3SFZA 4R2HA 3AVQA 4FINA 2QMOA 2P3SA 1NSFA 2W0MA 4L5BA 2H92A 4IRUB 3SNHA 4Q9LA 5HKKD 3LNCA 1G1MA 4LYJA 4HAXA 3FPAA 4Q03A 4EJSB 1JAIA 4JVSB 3NWJA 1G19A 2G83A 4U02A 3EZ7A 2QGNA 2WAYA 2JCSA 3AUYA 3GLFA 1TPZA 4JBWA 2AR7A 4BLTA 4XTRA 1EFCA 3CX6A 1OE0A 3MUFA 2QAGC 2Z5FA 1CU1A 2D7DA 2BMEA 3GJ7A 2QA5A 4OI2A 1E2IA 2O8EA 3CM0A 5CIWA 1J90A 1ZM9A 4W9MC 3T35A 4RSGA 1YR6A 1W0KA 1W4AA 3VTKA 5H8WA 1DE0A 5FUWA 2XB2A 1GTVA 1Q1EA 2RGEA 3W6NA 2CJWB 3BERA 3RS7A 4HLDA 4PR0A 3SS8A 2DFNA 5FTMA 4C0LA 4KV9A 2VP9A 3FFBA 3EPJA 1C9KA 1E9RA 3ICQB 4WVFA 4NBSA 1B23P 5JRZA 4AG5A 4GMXA 3LVRE 1W0KD 3K09A 3W6PA 4EPXA 2WJVA 5BYJA 2X2FA 4HAYA 4IOLA 3F0TA 4JZKA 5C4GB 4EFMA 4D25A 1XPUA 2FNAA 1UKYA 2GCOB 1JXOA 2UZ3A 3PJRA 1KO5A 3AVUA 4LBYA 3CRVA 1VCNA 4BEJA 4XD7A 2J41A 3ADCA 1IN5A 3CUEF 4FMBB 1ONBA 4HYYA 4EQ6A 4DDTA 1KI6A 2R6DA 4L8GA 2DCUA 3HR8A 1IOZA 4GP6A 3UPUA 3OIUA 1E4YA 1SVOA 2Z6VA 3AF0A 1GAJA 3JVUA 3VFDA 1P7CA 2ZRDA 3EPHA 1FQKA 4JKIA 4M2LA 4HB4A 1R5NA 5FBVB 4Q4HB 3CWQA 2J3EA 3CNNA 4MH0R 3D6TB 4XD7D 2HXYA 4W5HA 1K5GA 2A9KA 5IHPA 4URYR 4HB3A 2DBYA 2HT1A 3L0PA 2YVUA 3UMSA 2FH5B 5JEEA 1COWA 3H84A 1ZP6A 1XXHB 3WMGA 1XF9A 4YMUA 4PO9A 2W2TA 1N6OA 2G77B 1HTWA 2GJAA 4Q9HA 4YMWA 1VHLA 4C2TA 3QG5A 2FV8A 4KJZA 3V4RA 4JLVA 1W7AA 4JLAA 2BJWA 1BYIA 2AK3A 3GJ4A 4JIMA 4V0MA 2Q21A 1S3GA 2FOLA 4RY2A 5JCPA 1COWD 2ZI6A 2V1UA 3E70C 1XPOA 2CNWA 1Z6YA 2GHIA 2JLZA 1ZNYA 1ZW6A 3THYA 4KSCA 2IL1A 1BH2A 2X2EA 3PUYA 3SFVA 4TLAA 2GESA 4TYYA 1VYUA 1XWIA 5JSZA 2AKYA 1PLLA 4Q9JA 1GNQA 3MCAA 4C0SA 4M1KA 3EIHA 2XXAA 4AY2A 4DDVA 2CNWD 1QBKC 3Q7PA 2VEDA 4LC0A 3IBYA 1JQJC 1MRSA 2GK7A 2OZEA 5FOTA 3SYKA 2GA8A 5JECA 2MMGA 4A1FA 1DAEA 5FTLA 2JASA 4C0HA 3LO5A 3LH5A 2QMEA 2ZR0A 5EJEA 3U7HB 1TUIA 4DLUA 4EDHA 2PLRA 2O8CB 2SHKA 3UG6A 1XD2B 2BV3A 2GETA 5F98A 1OB2A 1F2UA 2WZQA 1OLOA 2QT1A 3QF4A 5FUVA 1FW6A 2ZE6A 4A6PA 3SHFA 2R6GA 5D3MA 3PEWA 4AYXA 1W5SA 3HU1A 1UPTA 3BOSA 3UANA 1N6KA 3UXMA 1AZSC 1QF9A 2J1LA 4DLVA 4G0NA 2CK3A 4KAXA 2MSDB 2ZM5A 1X1RA 3IHWA 5L3QB 1VTKA 3FDIA 3MLEA 3U3RA 4LJ8A 1N0WA 4PZYA 1GRQA 2CCKA 5EUQB 2ZROA 1NJFA 2OSBA 3LBIA 1F6BA 5JJIA 3KXLA 2YHSA 4V02A 5P21A 4UQOA 1TF7A 5FUXA 2FDCA 1S0UA 2Q3MA 4TL9A 3TLXA 1MO3A 3P20A 4Q4AA 3K70C 2CK3D 4QBFA 1DAIA 1VPLA 3NG1A 3CX7A 1T0HB 5J5CA 4LI0A 4PZLA 2R6CA 3CRW1 4KYUA 5JCZA 1E2FA 2C99A 3LAWA 3TSOA 1IXSB 1JJVA 2QPAA 3AP2A 1GOTA 4EKDA 2NGRA 2CDNA 3CBQA 1KK3A 1F48A 2FFHA 4JL6A 1R0YA 5KDLA 2A78A 2RGBA 1ODFA 1P6XA 4MRNA 2WWWA 2IYZA 1XMIA 1E0SA 2NO0A 1NKTA 4DLYA 1UKZA 1G291 4PPNA 1DAFA 1U9IC 3A1UA 2OHFA 2CLCX 3W90A 4C7OA 3DMDA 4G5QA 1UADA 1YJ5A 2VO1A 4URUR 1GRNA 1IBRA 5SZKB 1TU3A 1X3SA 1XRJA 2OBLA 3I8SA 2REOA 3FHOA 3D3QA 4R98A 4EIWA 3KJHA 1YR7A 1WXQA 4EPWA 1DAHA 1UFQA 3IBGA 2D4HA 1E69A 1DOAA 1PJRA 1QVRA 5TV2A 2P5SA 4OBEA 2GZAA 1DAGA 2O8FB 4TYQA 2W58A 1X8JA 4MGYR 4LSGA 4V0OA 4JT2A 4B76A 1G5TA 3K0AA 5TARA 3ZGXA 3SE0A 1XTQA 5L3SB 1W47A 1NJGA 4MKHA 1DS6A 3H0KA 4JVNA 1E9FA 4JLBA 4PPGA 2H17A 1M74A 3I5XA 1WP9A 1S9DA 2X1VA 3C8UA 3SI7A 4WAUA 1NIPA 2H57A 4R7ZA 1HEIA 4MYTA 4IKEA 3ZZUA 2GWHA 1NRJB 1N6NA 3PUWA 2AXNA 2QMUA 2ORWA 4B32A 4GL2A 3KXIA 4TYNA 3AKEA 3HPQA 3REGA 2QY9A 3GJ3A 4Q00A 4BWYA 3VU9A 1VYTA 1QHHA 1SVSA 4FI3C 1N0VC 4X8MA 4PQRA 4C3ZA 5J40A 2K5UA 3CPJB 2F43A 2OT3B 3Q72A 3REFA 2OCPA 2ORVA 2Z4SA 2W6ID 4UNQA 1IXZA 2IXGA 1ZC3A 4HEJA 3O8RA 5KNBA 2A5FA 4P4UA 2OESA 2VTKA 1SXJE 5J4VA 1Q21A 3I4LA 5FTKA 421PA 4IDNA 4UNPA 2CE2X 1II9A 4KBGA 2JLXA 2GJSA 2XAUA 4I1OA 4B3FX 4S35A 4TMKA 2N42A 2V1XA 3QIAA 5DI3B 5HTKA 2Q3HA 3L43A 1JALA 2ZQ5A 1M2OB 4I4LA 2GEDA 2G1JA 1Z0KA 3FMFA 5LDDC 1RC8A 4AIIA 5CB6A 2ZRBA 4IJMA 3BWDD 3BH7A 3SHWA 3ZVLA 2DHRA 2HDNB 1GITA 1E2LA 2WWXA 4WXPA 3TNFA 1E3MA 4AKEA 1ANKA 4YQFA 4XWOA 1OHHA 5G41A 2QORA 4UKDA 2CL6X 1FNMA 2QENA 1JNYA 3GLHE 4RVCA 4E09A 3DM5A 1SVKA 2EFCB 5FBLB 1XCMA 2BBSA 3CWZA 4NYIR 2IEZA 4GRAA 4UJ3A 2GEUA 4K8OA 3LBNA 4M1MA 4HSEA 1AK2A 2BJVA 4I81A 1NLFA 1IAQA 3MD0A 1OHHD 4P3YA 2FGJA 1TF2A 2AL7A 4V0ME 1YZUA 3RWMB 3QI2A 3K9NA 5CLQA 4JS0A 1GP2A 1XEWY 1GRRA 3AQ4A 4JBXA 3SJAA 2EFEB 4NTZA 3SOPA 1U0JA 5EZ6B 2XNSA 3MJHA 4KCGA 3UIEA 2OV2A 4UNNA 1CIPA 1LFDB 4ILEA 4JBYA 3EZ2A 4URWR 4M1TA 4RD4A 3X1YA 1OYYA 5FOVA 3I1FA 2YOHA 1NG9A 1RRGA 3A1VA 3ASYA 4EFNA 1J99A 1WBDA 3UK6A 2AFHE 2WPDA 4CGZA 5KDOA 1LTQA 2YWEA 3DO6A 4OQLA 2ATVA 3NBXX 3WNBA 3IO5A 2RGGA 1KY3A 2C98A 2P6UA 4WZBE 2IT1A 3AP3A 2IW3A 1FUUA 2EW1A 221PA 4Q66C 1VIYA 3KFXA 3K70D 4A2PA 2Z0MA 1LY1A 1UDWA 2WPDD 2DYKA 4TTPA 1ETUA 5DE3A 3LDAA 1EFUA 4DLSA 5K8TA 3RNLA 1MOZA 5DHAA 2J0UB 3TR0A 2ZEJA 5M04A 1CEEA 4PX9A 5E7JA 4Q9IA 1W5TA 1D2EA 1U9IA 3U3JA 2WAXA 3QKRA 4BGDA 3CO5A 2XZPA 3CB4A 2O0KA 2BEKA 3IQWA 1ZUNB 4DLRA 4Q4JB 3E1SA 2IHYA 2KB0A 4NU0A 4AK9A 5F2EA 1OFHA 2QM8A 3I32A 1E2MA 1WA5A 1XMVA 3QE0A 1CULC 4G01B 4FWTA 1KO7A 3BE4A 1Q57A 3QPVA 1W36C 1U90A 2X19A 4PC6A 4OI4A 2H18A 2OFWA 2FFBA 4LBVA 1CXZA 3A37A 3V9PA 2A5DA 2BM0A 3TJZA 4NCKA 4ZCLA 4MKFA 1E0KA 1QHGA 4PZZA 4JLPA 2FZ4A 4OHVA 1TQ6A 4QM7A 1CS4C 1OPXA 5L8VA 3TW4A 1MABB 2BBTA 4FIDA 3IKJA 5LD2C 1DPFA 4CEIA 4QHSA 2FA9A 3WYFA 2RKOA 2VQSA 3PITA 3BH0A 4ESVA 4M1YA 4NL4H 2GEVA 1ZCBA 2W2VA 1PZNA 4L16A 3QOFA 4EJSC 3ZS8A 3N5CA 3TRFA 1E79D 2UZIR 2FX3A 4MUBA 3U60B 2DWPA 1T6NA 1Z28A 3BH6A 2IYQA 2P65A 2RGCA 2ZI7A 2XTMA 3PQCA 2IS2A 1CRPA 1G7RA 4QRHA 3KJIA 4BFYA 1FP6A 3KUDA 4KITB 1MT0A 2ZRPA 4POAA 3TUIC 2P6RA 1W44A 3W5IA 4KFSA 4XOIA 5DLQC 5IDVA 3IQXA 3KDSE 5CYOA 1GILA 1T91A 4BRWA 2Q6TA 4HB0A 3AF4A 2R44A 5LB4A 3SYNA 1W46A 2J5XA 1XEXB 2CE7A 4XVQA 2H1LA 4RD3A 1N5KA 3MG9A 3KZ1E 2VP0A 5CM9C 3B78A 2BMFA 3H4MA 1RRPA 4DVGA 2ZVQX 3THXA 2X77A 3I61A 1VIAA 2ZYTX 2GJ8A 1VG1A 4I99A 3EC2A 3GLIE 3O8DA 2G6BA 4NDZA 5UKDA 1AKEA 1W0JA 2C8VA 4E07A 4A2QA 3T5GA 5IF9A 4IVRA 3AKYA 3TKLA 1N6HA 2FZLA 2VSXA 4OJKA 1G6OA 3AGPA 5FTNA 4N0EA 5G40A 2F3RA 1S3SA 2YC4C 4CVNA 1R8QA 3P4YA 5EP4A 2ZI9A 1KI4A 2GF9A 1KMQA 3BK7A 4ZI2A 5IT5A 1W0JD 4P4SA 2PEZA 2ZJ2A 2WIBA 1KMHB 3GPLA 4PHTA 4LDJA 2WMOB 3GCGA 3JZAA 1ZBDA 2QTVB 2V9PA 4QJ5A 4PAOA 4Y0AA 1XCPA 4A15A 5AUNB 3QBTA 1XTIA 3L2OB 2EFGA 2H5EA 3RRMA 3TIFA 2WKQA 2O0JA 3SJBA 1JR3D 1P4SA 4HUQA 2ZJYA 1R2QA 3GMTA 3BS4A 5TMPA 5FOSA 1N5LA 1VCMA 1DAKA 2TMKA 3QKSA 2QRNA 2FPKA 4NKRA 1AS0A 2A7QA 2VP5A 1IJEA 2IYRA 3I62A 5KDDA 1YR9A 4A36A 4TLEA 2I1QA 2QM7A 4TZ0A 3NDPA 1T0JB 2QU8A 1EFTA 2GBLC 2WWHA 1CR1A 1KI7A 3WY9A 1DTSA 4LBWA 2ZS9A 1KDOA 1XX6A 3C5HA 5B58C 1FP7A 1X8KA 1RKBA 3CPEA 4MRRA 4R71A 2JLUA 1MO4A 2VH5R 4BZPA 4C0BA 2FFAA 5FFMA 3K0CA 1N25A 1TEVA 1ZM2A 2ZREA 4NCJA 3U7EB 4D80A 2PZGA 2GXAA 2QUZA 4IHQA 5BXQC 3K9LA 1SGWA 3OEHA 2KBEA 2HXSA 4XTCS 3QVUA 2YYZA 2ERYA 1ZM7A 2ZUCA 1EESA 1YHNA 3B9PA 2RGNA 4O25A 1G8HA 4MYCA 3GLGB 6Q21A 4FW9A 2VIIA 2YOFA 2ZSEA 2ZJZA 4KFTA 4EFLA 5HPYB 2JIZA 1XPRA 2QQEA 1YKSA 3OEHD 2ZIAA 2CCGA 3O8BA 1AJEA 2XGJA 2C78A 3FMOB 3KB1A 1FMLA 1E1QA 2FFQA 2OBMA 1Q20A 2IA5A 1NBME 4P32A 1OJLA 1KSFX 1HT1E 2Y8EA 3M6AA 1TMKA 3N2IA 3N70A 3ND9A 5FPKA 2VF8A 1KI2A 3FFAA 4PC3A 5E7MA 4DLWA 3EPKA 1XD9A 3QY0A 4US0R 2VHUA 3WNCA 2GTPA 2JIZD 2C03A 1EK0A 2ZS8A 3CH5A 4D0LB 5FI0B 2NO6A 4NONA 4Q1EA 5AJWA 3MGCA 3U4QB 5D3QA 3S1AB 3VR3A 5JHHB 3RYTC 2N46A 1ESMA 1E1QD 4CRWB 3NBZC 1E0JA 3UATA 2CBZA 3QXJA 4Y0VA 4GMDA 2QNRA 5DGXA 3DDCA 4RD1A 1W36D 3FYHA 4A8JB 5BYKA 4O2RA 3ND8A 1U94A 4FWIB 4US1R 1Z08A 5TVKA 4LHYA 2ZU0C 1TU4A 4AKIA 1RE0A 4KSBA 3LQQA 2RGDA 3THWA 2OBNA 3LW7A 4RKFA 1LB1B 1ZD1A 2IF2A 1FL9A 4PC2A 4DWJA 3QPUA 3WYGA 1WE2A 3OF5A 4JMPA 2BMDA 3NDBB 3DL0A 4GOKA 1LF0A 3L8ZA 2V8OA 4HB2A 1OFTA 3WMEA 4CEJB 3CZPA 2QBYB 1CJVC 1GNRA 1OFUX 5CYPA 4A4DA 4DUGA 5KPJA 3SU8A 2PJRA 3Q9LA 3LLUA 4IEIA 2JAQA 1GFIA 4L9WA 3A1WA 3MRSA 2H7VA 3NBYC 1BO6A 1Z0AA 3RS0A 1KK2A 5JZVA 1KI9A 4G5RA 1OXUA 4RD0A 3NXSA 4GDFA 3P32A 4TQ9A 3RS4A 4DUGD 3SQWA 1HYQA 3UWOA 1IJFA 3C7KA 2IYVA 3GEHA 2BOVA 1XCGB 5KUTA 1SKYB 2PMDA 4BFWA 4E5UA 4M1OA 2FMXA 2OILA 2P5TB 5ANRB 4FCWA 3FB4A 4JJZA 4JJKA 4IXMA 4D6PA 3VMFA 4DKXA 4P33A 1TADA 4QL3A 3SEAA 3DVLA 2RMKA 4DT1A 1OH6A 1HA3A 3OIVA 2YWHA 3TVTA 1WQ1R 3GLFB 2FWRA 2QE7A 4QBGB 3ONWA 1SXJA 3WMFA 3DHWC 2GXSA 1G3MA 2QTFA 4GT1A 3TH5A 1D8TA 1FX0B 1VG0B 4Q4LA 3X1XA 2BBWA 2O8EB 4C0AC 5HZHA 2CLSA 4CW7A 4XWAA 4ITRC 3A4NA 1KK1A 1WCV1 2QE7D 3AVOA 3EASA 2YV5A 1RJ9A 1W4CA 1SXJD 3B1XA 4MUAA 2ZR9A 2PCJA 1G5RA 3U3OA 2PBRA 1NL3A 2VP2A 1DARA 3DZ8A 4DHEA 3VAAA 1OXTA 1QDEA 2OCBA 5HCNA 3NC1C 3GLHA 1XEFA 1M7BA 2XJ4A 1E2EA 3C16C 4GOXA 3WHKA 4ZIRB 4A0HA 5CDFE 1S2MA 1SZPA 3EZ6A 2ZJBA 1BMFA 5JWHA 5A0FA 3DZDA 1UJ2A 1PUIA 2WTUA 1RRFA 2OAP1 1BYUA 1G7TA 5KSZA 1UEIA 4TQAA 4EQ6B 1KKLA 1KI6B 1JR3E 2FPMA 4MRVA 3CRRA 4F7WA 3O8CA 2QROA 1Z47A 3BFXA 3SQXA 1ZIOA 5IRCD 3HP1A 2FSFA 3OFNA 4MQBA 1LVGA 1BMFD 3A36A 3PIRA 5AJZA 5FOUA 1GVNB 4AWXA 4BFZA 1NN5A 4LGMA 2OM2A 2ZYUX 1ZUHA 2JEOA 2BMJA 1AGRA 2E1RA 3KX2A 5BQ5A 5GVRA 4GZLA 1Y3AA 2ZUBA 2ONJA 3EIQA 4IDHA 1ZINA 4GP7A 3OFND 3PUVA 1NN0A 4A0RA 2WJYA 2FSIA 2BCGY 3KB2A 2REXB 1OXVA 3LV8A 2AX4A 2G1KA 2QT0A 3KQUA 1VDZA 4AYWA 4W5WA 2NO9A 3B1YA 1A4RA 3PEVA 2B6HA 2J9RA 2ECKA 4DCSA 1OT3A 3FGNA 4Q19A 5GJVC 1G20E 4LJAA 1HV8A 1CR2A 1GSIA 4DLTA 5KO2A 2QEQA 2Q3FA 4NMMA 5DN6A 2LKCA 2ZTSA 2JLRA 4YMTA 3T1VA 1N2CE 5FUYA 1V43A 1G8YA 1D2MA 1A2BA 2I4IA 3VKWA 3OESA 3W8RA 3THYB 4IXNA 5A5GA 1ELOA 1M34E 1NSTA 1JR6A 4HAWA 1BS1A 2IK8A 3UG7A 1DO2A 1KAOA 2ZJAA 2QZ4A 5B64A 3K0FA 1YZLA 3U44A 4ESHA 2J0QA 2QAJA 1AQUA 1MKYA 4ARZB 2GCNA 1ZRHA 1HH4A 2RHDA 2XB4A 1NN1A 2KBFA 5HE8A 5C1BA 5DN6D 3I5YA 2XXAB 4IVQA 1WDTA 2PJZA 2YOGA 4WZAE 4ZDWA 3R8FA 5ELXA 2JGNA 3FHCB 3CR8A 4OHZA 3LD9A 3VKGA 1W2HA 4Q02A 1VECA 1G8GA 2GZDA 1YVDA 3OE7D 4Z8XA 2I3BA 3DPUA 3HDTA 2ODBA 1KZ7B 3NIBA 1XEWX 1IN7A 3L82B 4G5OA 4OQNA 4PHGA 1P2TA 4G3XA 5AUPB 4XSHA 1F2UB 4JT4A 2CVHA 2HCBA 1KSHA 3SR0A 1G3IA 3MWKA 5JLJA 1Z06A 3QF4B 5JFGA 2QAGA 1IY2A 3IIMA 5D3MB 2V6JA 3ASZA 2PT5A 1Z0IA 1G3RA 1ZD9A 4H1UA 1IM2A 1UBGA 3W34A 1ZCAA 3EX7C 4LYHA 1XJQA 2WWFA 3B9QA 2FSGA 3QBVA 4NE2A 4RFSA 3U3MA 1ZUIA 1TAGA 3VR4A 3LFUA 1FTSA 4KFRA 3QXHA 5DIFA 4MDFA 1PVOA 1RYFA 1SVIA 3EAQA 4I1UA 2Q9BA 4U00A 4B6EA 4RJLA 3KQNA 1QG2A 1XTKA 1YZGA 4DCVA 4Q4AB 1JPJA 3IUYA 3Q5EA 4PANA 1QHXA 4LCBA 4RCYA 3T34A 3AUXA 1M7GA 3TQCA 3G0HA 4B43A 5JWRA 3CKLA 1ZNWA 3VX4A 3HYRA 1YE8A 1AZTA 2D62A 2HLDA 1OB5A 1EXMA 3AVWA 2BEJA 4UNSA 1OH7A 1U8AA 1U98A 1P9WA 2JLVA 1XB2A 1IY0A 2ZPTX 3U7GA 3R20A 3RSLA 3R9WA 1J2JA 4D4KA 3I73A 4Z8YA 4RD2A 4KU4A 4B2IA 3GLIA 5GVSA 4URVR 2VSFA 4Q21A 2PMKA 1U8ZA 1UDXA 2HLDD 2LCFA 2R2AA 4HI0E 1ZM3A 4M9SA 1HURA 3SBDA 4XVRA 2GCPA 3U6BA 2C95A 1JEEA 2QMHA 2ZAMA 3KTAA 3BD9A 1FOEB 4KVGA 3QVVA 4C7OB 3SDZA 2VSOA 4HLUC 3GQBA 4NYIQ 3IEVA 1Y63A 2W6IA 2C5LA 3BXZA 1WBBA 1D6JA 4IOMA 1Q3TA 3CNOA 3NHAA 3QKTA 1G6HA 1CRQA 4M4SA 2VP4A 4YDHB 5K8IA 3C4JA 4NP6A 1NMXA 1OSNA 1XDBA 4KXFB 2ZSAA 1HUQA 3BFVA 4CYMA 4B3GA 3VNUA 1R4AA 2D7CA 1X8LA 3NHBA 3WBJA 5HCIA 3TUJC 3UWKA 3QF7A 3QXXA 3KKMA 2VF7A 1IQPA 2F1RA 5DYGA 3RABA 2DPXA 4LBZA 4N1AA 4OK5A 3RS2A 1Z83A 4KBFA 1U8YA 5EZ5A 1EWQA 3FWYA 4PO1A 2GDJA 2O5VA 1S1MA 4M22A 5GJBA 3TQFA 2IYUA 4DZZA 4LHWA 5CJPA 3KKNA 4NHOA 3VR1A 3Q5DA 3EA0A 4V0LA 4CEHA 1NLYA 1AKYA 3HPRA 3WP1B 3VHLB 4TZ6A 1JQLB 4NH0A 2CCJA 2PZEA 2HYIC 4Q7JB 2IX3A 4NPHA 2DFKB 1XXHE 1AM4D 1CLUA 2JLQA 3AVVA 2IYLD 3T1QA 1R8SA 3VU9B 4X8OA 1GKIA 1QHHB 1GDDA 2QPTA 4OQMA 1Q0UA 1E9CA 2F43B 4MKIA 3R9XA 1E98A 3R7WA 3LA6A 4PPFA 4QGHA 5GJWC 4DJTA 2R6FA 2VHQA 3B7GA 1CTQA 5DH9A 5C46F 2OXRA 2G0NA 1E9BA 4KYIB 1JXMA 1KHTA 4DSTA 4ZV4A 1TL7C 3I3SR 3IPXA 2NPFA 1UEJA 2YZ2A 5EP1A 3KJEA 5KOYA 4HATA 3DOEA 1DADA 1E2HA 4DIDA 5KNDA 3TSWA 2J7KA 2IBMA 4EPTA 3A4MA 2Q9CA 4JYBA 1NNEA 1RFLA 2VL7A 3ZH9B 2VBCA 4A9AA 2DY1A 2ZE5A 4PSAA 3A4LA 1N0UA 4TMZA 2G3YA 1NBMA 3C41J 3EPLA 2QG6A 3I92A 4M53A 2C2HA 2EVWX 1XBTA 1K6MA 3ZZ0A 2MSEB 1LS1A 2CXXA 1AS3A 4KFUA 4DLXA 4B2LA 4C30A 2ZRNA 2ZXUA 3K9GA 4QGFA 1A2KC 5FR1A 2OEPA 2VYFA 3AF3A 1ZC4A 3X2SA 5KHOC 3B5JA 1JBKA 2REBA 4MYHA 1NBMD 2H16A 1VCOA 1XFAA 2J0UA 1F60A 3BORA 4NCHA 1LW7A 5FBWB 4AYTA 4BZQA 4C2UA 3OEEA 3HU2A 1QVAA 2V55B 5LBIA 2OLKA 4QHTA 4URZR 5DI9A 5HR5A 5AUOB 1E9AA 4JLNA 5DHFA 4RZXA 2PEYA 1KKMA 4HLCA 1OF1A 4HZIA 1UM8A 3BGWA 3PG5A 4P0TA 3M1IA 2GRJA 2ATXA 1DBSA 1U99A 2A30A 2DWOA 3BB4A 3LX8A
chains in the Genus database with same CATH superfamily
3EH2A 1RI2A 2BM1A 1YDHA 1RI5A 5JDCC 4CIWA 2P1ZA 3O74A 4E30A 3N8GA 5DYWA 3E3AA 1R5BA 2E18A 4UUNA 2P9BA 1E7QA 1WTAA 1FTQA 3UKOA 2R65A 4M9ZA 3JR7A 3ZK7A 4DYHA 4MWSA 4N5NA 2RC6A 2PUHA 3PNMA 4YLEA 3Q12A 5F73A 3U7FB 5D84A 5REQA 6ADHA 2A5GA 3ADDA 3DEIA 3NGXA 1GAEO 3AKDA 2P9YA 5CLGA 4UTRA 3JD2A 4NV3A 3F3YA 1E3EA 1J7KA 4R69A 5HQJA 3QA9A 2D5AA 4IUCS 4MV8A 1Q74A 2HMUA 1P4GA 2J8ZA 1QQ7A 4CODB 2NXCA 1WUIS 2BKEA 1DMRA 1YZFA 3HYSA 3U37A 1S5PA 3QM1A 5IKOA 2XYGA 1V1MB 1K6IA 1TYZA 1VRCA 2J48A 2OTCA 5EJGA 5D87A 2MINA 4NV1A 3KLOA 4L4RA 4PQGA 2VZLA 1EWRA 1OFIA 3UMCA 1IXRC 1GUBA 2XE8A 2YWBA 4EJ0A 2FWAA 4OOEA 2FZKA 2NACA 1Y42X 4LJ5A 5H1YA 2VAMA 3VR0A 5JXJA 1II8A 4YRTA 2B8JA 1QO0A 2CV2A 2HI0A 4R2IA 1JPNA 1U2GC 4JCOA 1E2JA 1P2SA 1DL5A 1QG4A 2JS7A 1Q7EA 3NUGA 4IDEA 4Q6WA 3O9VA 1GFZA 4DIKA 2YX1A 3IXQA 1G6Q1 1BXRB 3AKCA 5DDIP 1M8KA 4AW9A 1H2WA 2C9YA 2JIRA 3K9WA 3FCSB 1L7OA 3LCRA 1BFUA 4UULA 5A9TA 1SHZA 3LK6A 4R1MA 2BZ0A 4F1WA 4MYUA 3U80A 5BPHA 3KR2A 1JHZA 5AICA 2IPXA 4AVYA 1VJRA 1FRZA 5EE9A 3NTVA 3GHHA 5AVVA 4DA9A 2VNSA 1G7SA 2QRVA 2JD2A 2VBFA 3GUCA 2FW7A 1K1EA 1N2JA 4XGKA 5AXDA 1YQTA 1P6UA 1LQUA 4PLVA 5CB4A 1JA0A 3GEIA 2Z08A 2QR2A 1P2VA 2HSWA 3A1SA 3HKDB 3PFWO 4P8RA 5EWLB 1U8XX 2AFRA 3HJFA 1YRBA 1XA0A 1KBZA 1T10A 3RS5A 4CEIB 1NHGA 4XWKA 1Z7WA 2WAMA 4ABTA 4LYAA 4MMZB 2F1HA 1PBTA 3EDMA 3PFHA 3T99A 3A2LA 5JAPA 4C9BA 1CETA 4UFOA 1KC1A 1CQZA 4EX7A 5KNDH 1HE1C 1T4GA 1ULSA 4KQCA 1ODSA 1R6BX 1ZMRA 3PDWA 3GCXA 4TLBA 5B1SA 1QVZA 4XIIA 2HK8A 2CVOA 4NBVA 4MAAA 1TLLA 2WVAA 4LJYA 4MO2A 1RYHA 4QNNA 1GKYA 3VSBA 4O2BA 1AKTA 1T29A 2NU7A 3H2YA 1TK2A 4NBRA 5AJVB 1P5ZB 1Y9ZA 3LQ2A 2OPHA 4CM5A 2ZZMA 4YRMA 4QUEA 1V5WA 3WHPA 2C2OA 1N6LA 1I2CA 5TQVA 5LKRA 3IUNA 3T7DA 3VR5A 2BZ1A 2HPZA 4WZ6A 5KSYA 1JR3A 3ZG6A 1QWSA 2H2AA 2PXHA 4B33A 2XKJE 4BGEA 1FSZA 4FS3A 3MIZA 3BXEA 3DD5A 5ENZA 5J4KA 3PPYA 2KMLA 2NTNA 4PVDA 2NNLD 4RE5A 3MTGA 3NW9A 2AYXA 3LS2A 4NAVA 4NC9A 1TYBE 2CFCA 3OOJA 4HAUA 4IWYA 4LNHA 4Z4GA 5TDHA 1VFPA 4DABA 4EY7A 1H8HA 4ZCPA 1C0IA 3N87A 2NV0A 2CJXA 2V59A 4W5RA 3WKBA 2CLDX 2I29A 3RFUA 4PSDA 1F5NA 2IYYA 4YBRA 3THXB 1OH8A 2P8SA 4WGFA 3JAWA 3QW4B 3L0OA 4QQRA 4REQA 4HDKA 3WGKA 2NTVA 4EBBA 1LQTA 4OF4A 2VYVA 4YONB 3EIEA 3I9KA 4LRTB 1O5TA 2XADA 5JMOA 2YJZA 4JBGA 3TQRA 1EJ2A 2VPIA 3W9SA 5FH9A 2VJQA 3OU7A 4OP1A 3SEQA 3HFSA 3WB0A 4DBVO 3WYEA 3FTNA 3GJ8A 4BFTA 2GHRA 1NR1A 3CGGA 1NQAO 1P9LA 3F2IA 4KAAA 3HZZA 4PSUA 4YMGA 1FPQA 2IYTA 3P19A 4AZ3A 2WTNA 2Q1SA 3DQQA 2LCQA 5EJ9A 2B4KA 2X42A 3CC8A 5AI9A 3SQNA 1W5EA 2D2EA 1VI5A 2E4YA 2HIGA 2ORED 3NORA 1TJNA 3SIRA 1GCAA 2OA0A 2R87A 5DGDA 4OFXA 4XDYA 3HBMA 2ZRMA 4RKRA 4EJ6A 4LZAA 4IV0A 2XTNA 5DBGA 3O73A 2BUAA 2Y2UA 2V7QD 4FCCA 1V5GA 1ORIA 2IF0A 4IMRA 4TS1A 3BRCA 1CNFA 1B0ZA 1QGZA 1OIXA 2QP9X 5A6SB 1P33A 4BASA 2C5AA 4LWQA 5B4UA 3T3GA 2BFEB 2CVPA 1PW5A 3A6LA 1HMYA 4X61A 4F4IA 3D8BA 2W6NA 4G09A 4Y6RA 1YTUA 4TX1A 5BPFA 1LSJA 1MP0A 3HBFA 5E3IA 3FMPB 3ZWWA 1IB6A 2O14A 1E2BA 1XI2A 1KJNA 1FB5A 1PCXA 3IEXA 3NH6A 4U8GA 5B57C 2MOKA 4GQBA 1Z5WA 2AN5A 4A23A 1BEEA 3Q6MA 2EGUA 3T9FA 4B3DA 2Z95A 1FZQA 1JR2A 3ECCA 5FL7D 4WPGA 1P73A 1QH9A 2FCRA 3N58A 3S27A 4UUOA 3KXPA 2PKQP 3SLKA 1S4QA 1SK8A 2FTKE 2ZYWX 1JMYA 5DNVA 3STUA 3PNPA 4EW6A 1M73E 4MO9A 1JJBA 1SOMA 1P0IA 3PD0A 4UTXA 5KWEA 5ED0A 3V1UA 1SH7A 2C2ZA 1XL1A 1EP1B 4J1SA 1SBYA 3GV0A 4X5OA 1BMTA 2JGMA 4P93A 2Q8QA 1R6UA 3PNQA 2HHAA 5CLJA 3TLZA 1NW4A 3UB4A 3LW8A 2VHYA 2GZ3A 4WLEA 3OZRA 3LHIA 3INYA 3DL7A 1HQYE 4QDUA 2ZBPA 4EBFA 4W82A 3ZQ4A 3LLSA 1XJ5A 3WK9A 1LPBB 3UTCA 2C3PA 2WG0A 1NP6A 4RCVA 5F3WB 5HJEA 5AESA 2BKXA 2GBPA 5J4LA 1JEYB 2A9FA 1T8UA 2C92A 1VHWA 2D2IA 4JHLA 5ALHA 4BXOB 1H4TA 1KEEB 4KLAA 4ND8A 3S28A 3W4JA 1W36B 1Z2CA 3DXXA 4FNMA 4MKGA 3SJCA 2WUGA 5GGXA 3NXKA 4X64B 4C5CA 2I7VA 2OGWA 3LY5A 4LISA 2WE8A 1XXLA 3MOIA 3NBQA 3OHSX 4M0MA 4DBZA 5JR3A 5GADl 5KOIA 3LWZA 4P7GA 2K87A 4TTJA 2HK9A 4LYGA 3C6MA 5T4FA 2VHJA 3WJAA 3VR5H 1TM7E 4CF7A 5KTNA 1IQRA 1QYRA 3MT7A 3GB9A 3HVKA 1O7JA 4OTZA 2IJGX 2WU8A 1PL6A 4PQEA 2CJWA 3MYYA 3HJNA 2H1CA 2HOQA 1Y89A 4NBUA 1SXQA 1MC4A 5JNRA 2DTDA 2YWCA 1UINA 3F4KA 1QO7A 2UVQA 2QUBA 1P0MA 4CQLA 4E33A 4D4MA 3PUXA 3QUSA 2LWIA 4D3SA 1ZMTA 3P2EA 4TV9A 5B30A 1L9KA 3H9GA 2ODWA 2YMQA 3QYJA 4KX3A 4MA4A 3THWB 3L8GA 1R0CA 5L4SA 3ISVA 3CLTD 1E9SA 2WI8A 2J31A 4KPGA 4NYJR 4HDAA 2BYTA 3EBLA 1MZPA 1VI2A 2YNMD 1G9XA 3CNLA 2D00A 2F7SA 2BN4A 3N2GB 4G9BA 4Z1MA 3PK0A 1L5HA 2OXIA 3UA3A 3ESDA 3T5PA 2A14A 1XROA 1TU0A 2R8BA 2JFOA 3R4CA 4Y2PA 2ZSDA 1QGDA 5T4BA 4F91B 2OD2A 4BE9A 3BRSA 1OKKA 4DM7A 4GI5A 5JTUA 5JNVA 1E4EA 1FTNA 2JFUA 5B58C 2VHCA 3D7RA 1NVVR 3IVXA 5BN3A 3H5TA 1GG8A 1BKSB 2PFGA 4AY5A 5CA1F 4U3JA 3O4JA 4CKEA 1KY2A 4F46A 5EJFA 1LFAA 2BEUA 2G1UA 3NEYA 4GM0A 4RZSA 5FBQB 5D85A 3IO3A 5MGNA 5GONA 1BVRA 1FFCA 3U3XA 4RSRA 5TQ2A 1ETHA 3L6CA 4CF4A 1CEQA 4X90A 4XSGA 4A2WA 1LDNA 1Z17A 1ZAYA 3GT0A 4ZPJA 3T61A 4BZXA 5A6VA 3A05A 4K3VA 2A5JA 3HLYA 4R84A 3UV7A 3EOBI 3H5IA 4ZIRA 4XEUA 3TXXA 1PL7A 4DCTA 1YZQA 3BDIA 4KXXA 2PMFA 3GAZA 3NHRA 1BVUA 1RS0A 4NFHA 3IC5A 2QMQA 3BKXA 1Z4LA 2JCGA 4FMDB 3FSJX 4JXZA 1PDOA 2E5WA 3GBVA 4M1QA 2GBLA 2FEXA 4P5PA 3HLKA 3LT2A 1UANA 2H00A 4BFSA 1GGVA 3DFIA 3BE5A 4CHTA 5DFAA 5IW8A 4DLBA 4TMTA 4NU8X 4XI9A 2X2PA 1FQWA 4ZO4A 1MB3A 4FYWA 1SXJB 4G8CA 3I5UA 4D82A 4K9DA 3GNTA 3K92A 1GA1A 2AWOA 2YZNA 1U65A 2JGRA 1AHPA 2EZTA 1GEGA 1W9HA 4INZA 4KK4A 3JQBA 2DAPA 1RQ2A 3J7TA 5MN5A 1EP3B 3U31A 3WFJA 2ZRHA 3HKEA 3RHFA 3U61B 1FC0A 2Z04A 1ZD3A 1QU2A 1VKNA 1IZYA 3KOZA 5KCZA 4WXHA 2GT1A 4QJ3A 1P6QA 1QYVA 1Y6RA 4NATA 1VPWA 3DVAB 1RBZA 1XRMA 4Q5IA 3RSSA 2J85A 1J22A 1V4VA 3W5AA 1E99A 3GWGA 3B70A 3NOQA 5JAUA 4GECA 2Z56A 1G3UA 1YB7A 3I42A 1TW2A 2X1LA 4ZZIA 3QJ5A 2CJFA 2IITA 2FFRA 2JBAA 1YJ8A 2OB1A 2JJ1A 1XD2A 1TLTA 3CURA 2O8NA 1MEOA 3FNEA 4FDAA 4AD8A 5EIFA 4B6SA 4EW1A 2Z3VA 1QORA 3KU4A 3AI2A 3MSXA 4IUBS 2PWAA 3IHTA 1D6MA 5LJIA 3GRYA 4MWGA 2A1TS 2Z2XA 2XMSA 5M3BA 4ZEVA 3W5HA 2DX7A 2FGKA 1UWKA 1LK0A 5L3RA 3ZW7A 3E9RA 3LRXA 3QLVA 1PFYA 2WWIA 3VYSB 1K3TA 1QGUB 4JP3A 3SC2B 1I2MA 2DQYA 1E64A 1B1AA 1LSUA 3P52A 4ARZA 2I6QA 3UK2A 3W05A 4NOKA 4Z9YA 3HCDA 1E18A 3VV2A 3WL5A 5CLLA 4BU1A 5HWSA 3GLGE 1DO8A 4RO0A 4TYPA 1LLDA 3W3AD 2ZYAA 3OZXA 5KOJA 3F96A 1YR8A 4OFZA 3OE7A 5TPZA 4XYLA 3GUHA 5JSZB 3VNAA 1D5CA 5EP3A 1K7SN 3WL6A 2XPCA 4ENUA 5KU7A 1NY5A 3RSCA 5IJZA 1V9LA 4IIEA 3NETA 2HEGA 2QN3A 3A6JA 2AFIE 1NXTA 1KO1A 1ORRA 2FUG1 4I1RA 1HLPA 4IHAA 4KQJA 4QODA 5FA8A 1KAHA 1YRQA 3O38A 1KYIA 4WADA 3A4TA 3GIWA 4Z51A 3R8CA 1J7JA 4BLSA 1C7ZA 3R74A 4QUHA 5SICE 5CVUA 4AJ1A 1LJUA 3TECE 3KVRA 4PZ0A 1GN9A 2WC1A 4HDQB 4C4PA 2ZJ8A 4CKYA 4LY6A 3N6XA 2VPPA 3KSBC 1E62A 3D31A 5B3JA 2BCJQ 3BBPA 2O0MA 3GFRA 3L40A 4K9NA 1SUSA 5J4YA 3UICA 2DZDA 4D4LA 1P0FA 2O59A 3RTDA 1TAUA 2XRFA 3AHGA 3P26A 1P1IA 3KQMA 4GX0A 4RVNA 3PGKA 1SULA 2C5HA 1SIWA 2WWGA 2VP6A 1WBJB 4XB1A 4YAIA 1EX9A 3H2ZA 2YRFA 1B16A 1L7VC 2WF8A 2G4LA 2ZYVX 1UDBA 2YW9A 1UKCA 3GEDA 1GUAA 3JQ9C 1N6RA 2OBYA 1VHJA 4UD2A 5C1DA 4US2R 1PK7A 3ZCRA 2RHLA 4LFAB 3HUUA 1VJDA 4IO1A 4HNSA 4PZEA 1GZ6A 4P1ZA 5KJEA 3TGPA 3JATB 4XQCA 1AVTA 2ZE8A 1A71A 3D3NA 1RXYA 2IZ6A 3EG5A 5KTTA 1W34A 3KFLA 3CLHA 4WCDA 4KQIA 5K8IA 2YASA 2EFDB 3M81A 4JMLA 3GLUA 4CMIB 1C2YA 4BNHA 4P58A 2H0RA 1U7WA 2JLSA 4YHHB 5CCBA 4EP1A 2ORYA 3IPYA 5JALA 1I2BA 1H2FA 2BEVB 2HNKA 3PL1A 5L6LB 1VLLA 3P97A 3C7CB 3GP8A 1B8NA 2GAJA 3KT0A 4RQUA 1THTA 1OBHA 2BFOA 3FPLA 4YXWA 3R7FA 5BYAA 3H2HA 4EY4A 5LQAA 1Z07A 1Z34A 1BWQA 1E6MA 2JL1A 1X1BA 3C3PA 4LV6A 2B7BA 2VNIA 2CJPA 3HZOA 4MQ4A 4Z4EA 2EU8A 1CHDA 1NC3A 1E8DA 2HSDA 1XZDA 4Q3BA 2M6LA 4BLQA 1ENPA 3GEEA 3QMPA 3ZJ5A 3A8TA 4IOKA 1NIJA 4R0NA 4Q3NA 4BLUA 4RFSB 5K0ZA 4X0EA 4MRPA 1F14A 1U7XA 1Y1TA 3SZUA 2O2SA 1P62B 2WKRA 1YQDA 2YINC 4N7RA 1EVZA 1SKYE 3NOXA 1W93A 6AT1A 1HT2E 1ZSNA 5K0TA 2WHXA 3I0ZA 4A8HA 2X0JA 2WJJA 3MWFA 5EQTA 1E5VA 4ZQEA 5CAEB 1L2TA 3L05A 3SICE 4BWVA 4XR4A 1OCEA 1N7HA 2AJDA 2WU1A 2I0FA 2WDPA 5FTJA 5F9HA 3WIVA 5IZ4A 5E4FA 2C9CA 2XQVA 2G1AA 1VJ0A 2OM6A 2V54A 2A0FA 2XWBF 4PO3X 2WSSA 4ZU1X 4C4YA 4P3OA 2NZVG 4CCYB 1XVLA 3M2PA 1TJPB 4P2GA 1RXCA 1CUZA 1W73A 2DR0A 4L9SA 4X8LA 3ADBA 2OXFA 2HJVA 3DUFB 2P9ZA 4WMLA 4EMTA 3ZDAA 2YWDA 4JL5A 2JLYA 1H93A 2G76A 2MDTA 3MJSA 5DGHA 2HLNA 2OFXA 1DIBA 1WU8A 3MMPA 4IIVA 2Q1UA 3RT7A 1AQYA 1U0LA 3Q3VA 1UBSB 2P3LA 4ER5A 5E95A 3PD7A 1XAHA 3AIIA 1Z45A 3CUUA 3O4RA 3UT5B 3K4HA 4YAGA 2OHHA 1PE0A 5IK2D 5DM70 2YXPX 4JI4B 1JJ7A 1JI0A 1J8YF 1KJIA 1M2OA 1QNFA 2YBDA 2QIPA 3EZFA 2HQBA 3PQ6A 4KXYA 4WFQA 3W2GA 1HDCA 1ZA1A 3RBZA 3ZDYB 4CM8B 2ZTUA 1I13A 1FNBA 2R8XA 2R7LA 2JARA 5HUHA 3AL3A 1HZZC 5DISB 4LK2A 1OYWA 1DMSA 1O03A 2QZ9A 2A86A 3GQBB 2A33A 1TQ2A 1EJ6A 2QQ0A 2JAOA 4HRXA 4EB3A 1DG3A 4HDRA 1MV8A 4XCXA 2ID4A 4RVHA 1E7WA 3P0RA 3QEMA 3JPWA 4BLVA 4E6PA 4MIEA 5ITVA 3LC1O 2PQMA 3VQTA 4O3MA 2JJMA 2PTHA 3B8HA 3BEDA 4ZT5A 3FPSA 1OU4A 3I2KA 3OZFA 5KYKA 2NU9A 3P0HA 1HTTA 2P91A 5AOCA 3PKJA 3PT9A 4GPAA 4I50F 4NE7A 5BVHB 5K1ZA 3ZHTA 1TIBA 4OA8A 1C41A 1DWUA 2WNSA 2V58A 3H86A 3AHDA 2C3YA 4MRSA 2N3ZA 1JSXA 2BRUA 4J43A 1YI0A 4OBBA 2ZULA 4P82A 4Q7LA 4W7HA 5ENDA 2GGSA 1AGNA 1JQBA 1PNQA 2GPJA 2W6JA 3AM3A 3HADA 3KE9A 3QWIA 1PV4A 3LRPA 4QU8A 5KNBD 1GIAA 2PSHA 2C0QA 4RX1A 4DAEA 5C8VA 4QKQA 4FI3F 2EP8A 5AI5A 3ANYB 4CL0A 2GZ1A 3DM9B 1MH9A 3RJ5A 4LJLA 5KC9A 3PHLA 3F6CA 1H69A 4F93B 3TMKA 4AU1A 1FZTA 4Y1RB 1ZK1A 2R4TA 2HPHA 3I1IA 4MKZA 4U2DA 2FW9A 4JI2B 3F7NA 1MX5A 3E8SA 4CEHB 1OWPA 4AG3A 5L9AA 3CTMA 2X4DA 3BXPA 4Q9DA 4D9GA 4EY6A 4KQWA 1UPFA 5LIPA 1N1GA 2JJ2A 1P91A 3GZJA 4PCLA 2JK0A 2WW8A 1PVDA 5EIOA 3U09A 4EUFA 2GZRA 1DIGA 1H0SA 2RI0A 4CR8A 1BROA 2VF5X 4ASUA 4CDRA 1C7QA 1FLDA 1GZSA 3C5CA 2F3TA 5AHWA 5LUAA 2ZRQA 2W2NA 3R7WB 2V7WA 1ZSVA 4DJEC 4H2DA 1E2DA 3MMXA 5K8UA 5JE8A 1SC9A 5T8KC 1WOMA 5EUMA 2F1IA 2OORC 1CQIA 4RQBA 4NBTA 2GKGA 5I9TA 3KQTA 4BYMA 4OUDA 4D0NA 2GTHA 2ZSBA 1HNXB 1T3SA 4Y9UA 2Y66A 2ZBDA 5FUQA 3GFQA 4JLKA 5IDQA 4JGGA 2VNKA 2P2ZA 2QJOA 4QLBA 2NTEA 3D2AA 1OX6A 4P2BA 5EINA 4C0KA 4E03A 2E4AA 3CG4A 2GPNA 1M6EX 2NQ2C 2EKPA 4REMA 3TTTA 1CDZA 4J1NA 4L0DA 4KOAA 1JG1A 3WS7A 1BFKA 1XP5A 1TMOA 1IYZA 4EG6A 4E2ZA 4EAAA 1GPNA 3F6BX 4L4YA 4RD6A 5BWBA 3BF8A 1WHSB 1PYGA 2A9PA 3EEQA 1OIVA 1ZJYA 1IC6A 4KR0A 3VH3A 3E2PA 1C30B 3UJ8A 1T3LA 4EHDA 3OTHA 3HCNA 1YUMA 3LUGA 1V8DA 2B0JA 5BNFA 1I7SB 5JAOA 1AA6A 2WJ3A 2IQIA 3ZGVA 3CZ4A 1WXGA 3Q7EA 2Q41A 2ROQA 4GBMA 2ZGVA 1UJCA 5ALSA 2RGNC 5BN5A 1R9NA 1EUDA 3O6VA 1P7PA 1U9YA 4BECA 2X3FA 3K4PA 2N47A 5HX7A 1MRZA 2C4TA 4TMVA 2XBMA 3KL4A 4KQEA 2O57A 4R1TA 5KYWB 1Z0SA 3FLEA 4LJ7A 4ZK2A 4MYDA 1NU8A 4UBKA 4CL8A 4MJLA 4KDRA 2P6NA 3KXDA 3VU8A 3ICCA 5EE0A 2ANBA 2JJYA 3DOIA 5FA6A 2QZPA 5FPHA 4BO6A 3UA4A 4EMSA 2VHTA 2EJWA 4JKYA 5K3SA 3CSSA 1TUBA 2H1IA 3CKMA 1I2DA 1R9MA 3GT4A 3G2LA 3ITNA 3OO1A 4MW2A 4UARA 2O8DB 4DQXA 3GRVA 4FJ2A 3L9WA 2JA2A 3ZWOA 1KAGA 3B2EA 3F4LA 3PKZA 2CLIB 3T3EA 5ECWA 2JANA 1ZNQO 3GRPA 4PNHA 3NTUA 4X84A 3D0KA 4PIMA 1Q6YA 1RMQA 1SC6A 2VJMB 3IIKA 4B87A 3G9QA 4L07A 3EMVA 1MJ5A 3OZ7A 4PZCA 3A1TA 2BC9A 1UF9A 2I76A 2ZVDA 2FPWA 4MQ5A 4N40A 3W2IA 4EAQA 1GG9A 2NPOA 3H6GA 3OH8A 2Q28A 3OPMA 3RB8A 1CUYA 1AQ6A 3GY0A 5FD8A 1CRWG 4PYIA 4CLRA 1JWLA 3WYNA 2X7JA 4AWBA 3CT4A 4G26A 5F78A 2ZUDA 5EIAA 1E96A 5TJ9A 1BIFA 3MXTA 2IDMA 4IVPA 4JU9A 5LA6B 1PFVA 1EX6A 2VP3A 1FDUA 1IMJA 5CGZA 3C1AA 4PF1A 4U8HA 3U3KA 2F8TA 2VDNB 4GKKB 2OV3A 3WBBA 2RJ3A 1IOLA 1JHQA 4O4LF 4F1KA 2YCBA 2PX3A 2ZRKA 3BC1A 3UTDA 4XM0A 2IBTA 3GJYA 3RHTA 4G4JA 3P9KA 1FFHA 1Y6GA 1OH5A 5ADWA 3IPCA 1G4UR 1WHTA 3AWDA 1OAOC 2WB4A 3GFVA 3GUZA 2H4YA 4ACBA 4DMUB 5JOQA 1JKJB 3KIPA 3SF8A 4BUJA 3ZD6A 2HR1A 3CSUA 4I50B 4CF6A 2NTJA 3RFCA 3RRZA 3VZBA 1AB6A 4M99A 4EUSA 5LYJF 1II0A 2SKEA 4IGEA 1UFKA 3ZYCA 4TL7A 1DOZA 3Q0TA 1Z7BA 3GMSA 4NJOA 2PG3A 1RIFA 2D1YA 4B84A 3OF3A 3C3MA 2P4EA 3UFBA 4A92A 3JQFA 3W4KA 5BW4A 4C6TB 5TIIA 1IQ0A 2JFXA 4KNWA 5KTRA 5JWOA 2FSVA 4W1PA 4EFDA 4G24A 1LBTA 2J0VA 1E32A 4BE7B 4P86A 2QTHA 4XAQA 4YQEA 1LC0A 3IJRA 4E4YA 2XOXA 3AJ8A 4QYMA 4CFZA 3Q8LA 5J4HA 5ARBA 1D0SA 5F3DA 4YMVA 4EPRA 3JASB 2V4ZA 1N5IA 3K6JA 2GLUA 2WVJA 3L4BC 5E6UB 1NTOA 2NO7A 4EA8A 3I39X 5JS2A 3EVZA 1OFUA 4NFSA 1SJ9A 1UM9A 4XFJA 4ZHSA 3GLGB 1HSZA 3RUEA 1Y3BE 3U5ZB 1Q83A 3WZ2A 2BDEA 2V9ZA 1CPYA 2YJ3A 1OW3B 4QUBA 4XPZA 3IV7A 4OQFA 3QXCA 1AA9A 4OFBA 1EX7A 2HT6A 3G6KA 2FB9A 1Z56C 1POWA 1G59A 4FWBA 1NKVA 3W2EA 4B3HA 3GMDA 4H1VA 2QN8A 2VQDA 3LSTA 1L1QA 2NO4A 3UH0A 1V6AA 2HC9A 5BVGA 1SXJC 2IPLA 2M6SA 3PGVA 2RE8A 5A4JA 3DNMA 2AYYA 2ASVA 5CVDA 4NMWA 2CLMB 2GJ9A 4HZUA 4XVUA 3QEJA 4DNPA 3UMRA 2OAGA 2JGKA 1AHIA 1QGED 3QMMA 4OOFA 4D3FA 4EVSA 3M6VA 3HVIA 3ZY2A 4KGXA 2I7XA 2ZB2A 5E6RB 3LHSA 4Y2YA 3RVNA 2ZXEA 3ZXIA 5BW6B 3T06B 4YAUA 2ZZKA 3OTQA 2PSSA 1H3FA 1M33A 4Y2UA 3H3FA 4AMBA 4JEUA 1SXPA 4V0SA 2XOKD 3LVQE 3N53A 5JH7F 2VXBA 3HG7A 2BKLA 1US8B 1HDIA 4TLLB 2D0OB 1T2DA 4XW2A 5B1EA 1QF6A 3UWMA 1ZNXA 2ZPUA 4JI1B 4RCZA 3RTEA 1ONPA 3TW8B 1KORA 1MB2A 2W8BA 1JECA 3OI7A 4ZI3A 4JFAA 4HRVA 4MEJA 2GCGA 4OK3A 3B1WA 4PCUA 4QFMA 4HUQB 3USZA 1CZOA 4BVAA 3WGGA 2F55A 1W96A 3TNDA 2CLKB 1VL6A 1U3VA 1KYVA 2C9OA 5CITA 1AKVA 3EGXB 3EAGA 2RGYA 4PAQA 1CJCA 1ZKMA 2BI7A 3NHPA 3QVKA 3TOSA 5AVQA 1NV8A 2EJVA 5KKCA 2X3YA 4IZOA 4L22A 2CV0A 3FVQA 4F0JA 5I45A 1I1OA 4C4ZA 1L4HA 5LB2A 3FDZB 1ZIDA 1GKKA 2VRBA 1WPXA 4E14A 3B8EA 2F17A 4F86A 4ZDKA 3D7SA 4EUNA 2DB3A 1Q1QA 2FVXA 4DNFA 1EGVB 1VLZA 2Z1NA 4RZ2A 5CA0A 3WWZA 1IY8A 4BX2A 5ES3A 1KAEA 3LX5A 2I7DA 2A57A 2H1VA 4WKCA 1PNVA 2SKCA 4FSDA 5EUBA 2P77A 2W2PA 3HDGA 4RZUA 1PI3A 1KI3A 1QZ3A 1EXNA 1GGFA 3R77A 4UMVA 1NXQA 3RC8A 3Q2OA 2NU8A 4L0CA 1KZGB 4DSNA 4EO7A 2IDZA 1P72A 1T2CA 3GT7A 1VP3A 1ZJ4A 3AT1A 1KJZA 1QLJA 4WZAB 4QPJC 1NOIA 4OB8A 5F2OA 3WKDA 4EY5A 3OSZA 3S2FA 2ANCA 4Y9SA 1U2GA 3QU7A 4ZVSA 4Y6GB 2HA6A 3FSGA 3I0MA 1TC2A 2QF7A 1B6GA 3FLAA 3N8IA 1PLKA 3ETDA 3FH0A 4Z54A 3E9NA 3D7NA 2B4QA 4MUEA 4QDTA 1UQTA 1C8VB 3I37X 5E6SB 1T3ZA 4IYJA 4XXHA 1U1CA 3PYMA 3GGCA 4HDOB 5C4MA 2BSXA 1BG6A 1QP4A 4O4LB 4EVQA 2RH5A 3BWEA 3FE2A 5AK0A 521PA 1GKUB 1OXMA 1AMNA 3H87A 4QU5A 4ZTZB 1QFMA 2NG1A 5BMVA 2QM3A 2PX2A 3QVGB 3AF5A 1SUWA 4UCWA 2VZEA 3AI3A 2ZYHA 4O0MA 5LMUB 1A76A 5IX8A 2GBCA 4BNIA 4Q1AA 1D7OA 4LWZA 2Y2VA 5L4LA 5LPNA 4I4IA 1XCOA 3C39A 4HJRA 4PU0A 4UUMA 3HO1A 1SPBS 1PZEA 4BVLA 1SBTA 2QMOA 5GZ3A 2P3SA 1GU1A 1NW7A 5CX1A 4B3JA 1RHJA 5IAGA 3MT9A 3EK2A 1XIVA 3D1JA 4IRUB 2ZT5A 4Q9LA 3SNHA 3PDUA 3DVQX 1JHDA 2WM3A 3LNCA 3HP7A 3FPAA 2I1WA 4EUHA 3D64A 1X7GA 3TINA 1KWKA 4HGPA 1XHEA 4AF7A 4BMVA 4ZRNA 1V35A 3FW1A 2I4TA 4AMYA 3GLFA 1S2DA 3AUYA 4D6XA 5HQTA 1IRXA 1Y4AE 4CLOB 5B12A 4JBWA 4PFKA 4CE6A 4BLTA 4XTRA 2QW0X 3RFTA 3HI4A 1E8MA 2B1RA 3QU9A 1F0YA 1OROA 5H02A 1N0IA 5LQRA 4N6GA 1QE0A 5KNCH 1V6CA 1J0XO 3GJ7A 4OI2A 3ZK9A 3M1YA 4E5SA 2JKVA 3COSA 3F6EX 4RSGA 4XPIB 1REQB 1W4AA 2P35A 3RUPA 3ZLBA 1DE0A 5FHRA 1WVIA 2A58A 3MAJA 3OBBA 4WXYB 2FRDA 1EB9A 3LT0A 3HV0A 1RXVA 1U1FA 2DPGA 4HLDA 2INGX 3WQSB 4IM7A 2CUTA 2AOWA 2DFNA 1PGNA 2OKGA 2AQHA 5JDIA 3EPJA 1E9RA 2EDAA 3ICQB 4WVFA 4X7PA 3AUJB 3E6AA 4ANFA 1F8YA 5AXAA 2PX5A 4MV6A 2WF5A 4HAYA 5CFRA 1VSTA 1S3IA 5THXA 1O6BA 1NNSA 1KU6A 3CLUD 3L1HA 2OZLA 5C4GB 3FCYA 3REQA 4YFYA 4EFMA 2O8VA 3LT5A 4Y7DA 2EWMA 5HFAA 2FNAA 2Q1YA 1UKYA 3U13A 4QPDA 5MGBA 4LIPD 2B8NA 1W19A 2I3GA 1SIUA 4GWKA 3H4IA 3KEQA 4L8VA 3S2IA 4A7PA 1W76A 5JH7B 5KYTA 4XD7A 2UYOA 2QVBA 4CXMA 1V3VA 5H9VA 4HYYA 1CCWA 4DDTA 1GSAA 1NVFA 4BP9A 4AXBA 3VZCA 4CU5A 2PIAA 2YXEA 4DIUA 1N4AA 3T5BA 3AUAA 3W5SA 4UBOA 4RETA 2JEZA 2Z6VA 3GG2A 1GAJA 5K3OA 1P7CA 3VH2A 3GFGA 3FKJA 1ND6A 2PRIA 1KS2A 5K51A 2D5LA 1N7IA 4RV5A 1XUOA 2N75A 1RAFA 4FOTA 1N5DA 1Z5VA 2MYUA 3PVZA 4Q4HB 4FOLA 4Y30A 4MH0R 1E66A 4CDNA 4PLPA 3WIEA 3TLEA 1OLXA 2HXYA 3ECSA 2OWDA 4IV8A 3WLMA 2XVYA 2IOYA 2CB9A 5EERA 5EJAA 4V3CA 3OLYA 4YMLA 3CMMA 1B0AA 4MI3A 2Q1XA 4XX0A 4AJ4A 1RWBA 1IBSA 4UEOA 4YUYA 3NBKA 2YVUA 1TIKA 4QWMA 3AR9A 3UMSA 5JEEA 2XLBA 1COWA 3H84A 1CIJA 1XF9A 2QTCA 4YMUA 5INTA 2XTAA 1DHRA 1GR0A 1PWXA 4Q9HA 4YMWA 3GJQA 3BFJA 3A1EA 3NHMA 2C7PA 4JLAA 2O1SA 2DLCX 5IJ0B 2W2KB 2EG9A 2V7VA 4V0MA 5JNSA 4JROA 1YKFA 2A0WA 2FOLA 4PM4A 5J2UA 3ZDXB 2Q5OA 1NWHA 2BEWB 3NB0A 4BKUA 3P96A 1SCQA 1U0RA 2CXOA 2RFLA 2VF4X 4DR1B 4HDNA 1ZNYA 4NHEA 4JI0B 2PH3A 2J5RA 4WESB 5EG5A 4EYSA 2YRWA 3QFFA 3DBIA 1J24A 4G81A 4DCJA 1U7TA 4GMGA 1AQJA 5HZMA 2R5FA 5AXBA 1VMDA 3EXFA 5KWSA 3HQ4O 4X63A 3QLTA 3HBNA 1CYDA 3LRTA 1AKRA 4J16A 1I6MA 4ERXA 3QBEA 4V39A 1YNOA 3OM0A 1WCYA 1L5QA 3VI4B 2VEDA 1EVQA 3KO8A 4EY8A 2OZEA 1MRSA 3NT2A 3SYKA 3DW1X 2DY0A 3ETGA 4N0PA 1Z5UA 1WD5A 1OWLA 4GPIB 1QS0B 2V45A 4WQMA 5G1OA 4LRUA 5DF1A 3WAKA 4R2JA 4E46A 5F33A 4ESEA 5BSHA 2QMEA 1OGIA 5EVJA 1KR5A 4ARCA 4DLUA 2PRSA 2I1LA 2Y0BA 2PLRA 4FT4A 3ACDA 3TJMA 3T9AA 2EP7A 3PR3A 2NUPB 4YJKA 4BJ3A 4KQGA 4GXTA 1DGQA 1FU8A 3TPFA 5JCOA 2I8LA 1GLNA 3G02A 1PJAA 4QREA 3RUCA 3V2IA 3ZHBA 1KYYA 4A6PA 4ER3A 3ZYZA 4ENTA 3RIYA 1W5SA 4IXDA 2H1FA 4R1QA 3PPIA 1AZSC 3E7XA 4HGOA 2J6CA 1RAHA 4HGRA 4G0NA 4DLVA 2CK3A 2FWJA 1MAVA 1X1RA 4L51A 5B37A 3L1IA 3IIEA 1H4QA 1QIEA 3U3RA 4PZYA 4E6EA 1QM5A 1AQIA 1GRQA 4GKVA 4B3RB 1OTYA 4K26A 1SCUB 2ZROA 1AOXA 1E3WB 2CNBA 2VNAA 1EFPA 1Q50A 3SC6A 2F3PA 4XIFA 2Q3MA 3TLXA 5K0JA 5D6OA 4ND4A 5HRUA 2IEIA 3OCZA 4JJEA 4Q4AA 3SK0A 1X7XB 5A04A 4B80A 1FFGA 3JQEA 4WN9A 5J5CA 1VJCA 1X15A 4E15A 3CZ9A 3LUPA 4PZLA 5IT0A 2V3WA 4WK6A 2R6CA 2VATA 2P4SA 3V46A 1KYZA 1BOOA 2G40A 3BKWA 5CBPB 4CKXA 3QI7A 4RHEA 5JCZA 1U2TA 3TSOA 5ER6A 2WG1A 1ZI8A 2JK1A 2PZ8A 3CBGA 1GOTA 5IM4A 1RAAA 2P7HA 3NDJA 5EJIA 3FRIA 2AUMA 4JC8A 5CD9A 3CBQA 2AMJA 1L9XA 2J5BA 1VE7A 3DXZA 3GOQA 4JL6A 2NW6A 4OSPA 5ALYA 3VPGA 3ZY4A 1R0YA 5COQA 1FUIA 4B7ZA 1KZYC 4PZAA 1TZCA 2IYZA 3WO0A 1SCBA 2VKTA 2PA0A 1GZ3A 4HWTA 4OMDA 3N2LA 4H4EA 5CCEA 1QQAA 1ORVA 3H65A 1I2ZA 1TVKA 3K9QO 4M1EA 3TNYA 3E9CA 2H4JA 3A1UA 4XA8A 3W7VA 3GRRA 2OHFA 2OR3A 1K4YA 3EJ6A 1HRDA 3SOZA 2QX8A 3D6HA 1UADA 2FPGB 3R3HA 1I80A 4HRAA 3PB3A 5KVQA 3DV0B 3FHOA 4W5TA 3H2KA 1OASA 3KJHA 3IESA 2IYNA