5IHZB

Crystal structure of anti-gliadin 1002-1e01 fab fragment
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
213
structure length
213
Chain Sequence
b'QLVLTQSPSASASLGASVRLTCTLSSGHSSYVIAWHQQQSEKGPRYLMKVNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGAGILVFGGGTKLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1E01 Fab fragment heavy chain
publication title Stereotyped antibody responses target posttranslationally modified gluten in celiac disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 49
structure length 213
sequence length 213
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2016-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihzB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ihzB01
2DLHA 1ZGLA 4PJCE 3BWAB 2DD8H 4EUPA 4CAGA 1JF5A 3P77A 3MGTA 3PXHA 4NSKB 1G9MC 3VFPA 4MB3A 3BDYL 5TDPA 3TCLB 3LKNB 4RMUA 1ZLSH 4Q2ZA 1IM9B 1EAPA 1NFKA 3WE6A 5DVNA 4FQQB 1GAFL 1RMFH 4JO3H 3W11C 4G80A 3HS0B 5T1KD 3VRIB 1LEKB 2YBRB 4WEUD 3PGCA 4PP1C 3BGFB 3GSXA 4FP8L 3NABL 3AY4A 3AS1A 1C1EL 4G8EA 1FAIH 2P5ED 1T7ZA 1JWUB 4FFVC 1NCDH 5HDQL 3HZMB 3PWPB 1A22B 2DQCH 4JG0L 5B8CB 2FBJL 1MPAH 4RNRA 1JF1B 4U1JA 4PJIE 4HUMB 1UKTA 2XG4A 5FDYA 4KV5F 2Z93A 4LIQE 2A9NL 4ZSOA 3G6JB 4RDQG 4CU8A 1CG9A 2X4NA 4OM1H 1CR9L 5DJ8B 4LPVA 5HI4C 3QPQC 5GRYA 2E6JA 1NBVL 2OBGA 4KI5D 2OJZL 4U1KB 5AD0A 2VUYA 1IL1A 3VWKB 2OQJA 2WWMC 3EGSB 4P3DB 1EERB 2Y07H 5FA3A 1KB5B 4QRPB 2VDKL 2NY3B 1RHHA 2I24N 1CLYL 2W0KA 5EZIH 3GSVB 4A2LA 5KTEL 1WICA 3BD5A 1TFHA 1DEEA 1H3GA 1OB1A 5BRZB 1IJ9A 3GSNB 1YY8A 3QDMA 3OJVC 5B3JF 4YHKH 3CK0H 2VB5A 4HC1A 3K1KC 5D7SL 5I1DB 1Z5LB 3FO0L 3OKMA 1SYVA 2ZJSL 2MCPH 3P4MB 1ZWIB 4ZOEA 2QQKL 2IG2H 4JM4H 4TVPL 2OCFD 5DHVA 1S7QB 4MD4A 2Q8BH 2NYYD 1UH3A 5C09D 3HLAB 2GT9A 4W81A 3RX8A 2EDTA 2FX7L 4ZFOB 5JHDA 4ODSH 5C86A 1RIHL 5KSAD 4M7KH 5IBLD 4JKKA 5CJBA 1SJEB 4HCRA 4HJ0C 1HSAA 2XI9A 1DR9A 5GGTL 4YFLI 1LK2B 4YPGA 2CIIA 4PRIB 2QR0B 4MA7L 4XVJL 4G7YH 1P6FA 5SV4A 3U9PL 3NA9H 2H2PD 3PWPE 3WUWG 1BZ9B 1EO5A 1KCRH 3SPVA 3A67H 3HNTL 4OZGE 3AGVA 1CD8A 3T0WA 2OTWA 4GRWF 2BCKB 1SBBA 5GGQH 2CUHA 1FN4B 5ITFA 5F7MC 1J1XH 4K2UL 1FC2D 5C0ND 3QDGD 2EE9A 1FAKT 4GSDL 3QXAB 4XVUC 4I0KA 4E0RB 3HI5L 1UJ3A 3H9SD 4KXZI 2R56L 4LASH 1OCWH 2J88H 3PABA 4I48A 1FORL 3ARGC 1IAIL 1FGVL 4GXVH 3EDFA 4MQ7A 4WHTB 4WHYG 4PJ7F 3E6HA 1HILB 1R5IA 3KPNB 5CIPA 1VGKB 1X4XA 2YPLD 1Q38A 3QZWB 4QXTB 1MRDH 1FFPB 3VRJA 4ZUSB 1E0OB 3FO2A 4M6NH 5FO9A 3HE7C 1HXMA 3DI2B 1BVKB 1ND0B 5K9QI 1A7RL 4HS6A 1U3ZA 2CDGA 4UV7H 4GG8B 3BJLA 5I8CB 5IHUL 2HAZA 1ZLSL 4ALAL 4JFQA 3CFCH 1J1OH 3B5TA 4EQ2A 1JN6B 2NTSP 1RMFL 4JO3L 3O4LE 1GL4B 4PLJD 1RZIA 5E2TH 3WLWD 4F33B 3QR2A 4L29A 2DQUL 4IOFC 4POUB 5F8RC 3PE9A 4U31A 1JMXA 1T83C 5H37G 3T8XB 3MBEA 1RZJC 1TNMA 1FAIL 1YY9C 2D03H 3B2UD 3E6FA 1GZQB 1KLFA 1OT1A 5T1KA 2X10A 1C7TA 3WHE1 4BH7A 4OLUH 1NCDL 1UYWH 1EFXD 1I7TA 5IW1B 4F7CB 4KQ4H 1C16A 2DQCL 5HYQA 5C0AD 2P5EA 1MPAL 2XWJB 5IIEB 3MMEA 4LLYA 5FOJA 4MAUH 1UGNA 3X12B 4BELD 4GXUN 4L3CA 4RBPH 4MXQD 2NW2A 1J0JA 1T7VA 3P9MA 3LEVH 4OM1L 1DFBH 1K5NA 5AZ2H 3NCYP 2FSEA 5SX4I 3NCMA 2EIBA 1ZHLB 3ARGB 4JVPA 4NOFA 5GPRA 5GXBB 5F9AC 2Y07L 2A73A 3C87A 2DWEA 4XAKE 2UYLA 2MPAH 1HSBA 1A6TA 3NMEA 1B0WA 5EZIL 1B2WH 3HE7B 4QRQA 3T4YA 4YDVA 4RMVA 4NBXB 1NCNA 3RVWD 5EUOF 2IBBA 3QEGL 4YHKL 3CK0L 3BYYA 3DRTA 3ULUD 2NLJB 4ISVB 5TPWH 2MCPL 1IGCH 3TBSA 4F8TA 2Y7QB 1RVFH 2IG2L 4JN2A 1NGYB 2NY5C 4NT6B 4Y0GA 1BD2D 3QUZD 3ESVF 5J3HD 4JPIB 3A6BH 3O2VH 4Q9RH 1QSZA 3N1FC 4NC1C 5TQ0H 5C7XL 1JZ6A 3BDBA 3MRRA 4M7KL 4L8BA 4GG6F 4GAYB 1J0KA 1I9JH 3VW3H 1DQTA 5C09A 2NNAA 4JDVA 2GY5A 2BVTA 4GUPB 3VDAA 4D8PB 1I1RA 4G7YL 2E7CA 3IFOB 3NA9L 5KSAA 2EXWC 2LFGA 3BP6B 1KCRL 4XNMB 1Q9OB 2E9JA 3A67L 3IGAA 1ITCA 3CJJA 1T0MA 4XXCC 5HPMA 4HWZA 4GW5B 5HHPB 4X4YA 2E27H 1AGDA 5GGQL 1WVZA 5FYKH 1JHTA 4RIRA 4HG4J 4EUPH 3RGHA 4RGOH 2L7JA 1NPUA 4LEXH 2AJYH 4G6AC 2FHCA 3FFCE 5CEZE 1R3JB 5DJDB 5IVXE 1QG3A 2J88L 3E2HC 4HFWA 1I1FB 2BJMH 2Z8RA 3QDGA 4KPHH 8CGTA 1I8KA 2HLFD 4NUJA 1FZMB 5EZOH 1CK0H 4M1CC 3H9SA 1RZ7H 4K23H 4PYHA 2IMNA 4YO0B 1MRDL 3MBXH 2VLRE 1HWGB 4M6NL 3RL2B 3FQXB 1FYTB 3ZYOA 4ESKA 1KJVB 1YN7B 1LO3L 4Z77B 4UV7L 2YPLA 5E2JA 5LG1A 1IAIM 5IEKA 1A6VL 2VLKD 3CFCL 4XTRC 1J1OL 4GMSH 3TA3D 5H2BA 1KIRB 2SEBB 1K4CB 1CLCA 2APFA 5E2TL 4HHAB 1HH6B 4RGNE 1TXKA 4DGYL 3MV7E 1OQOA 3ILPA 1GGYA 3ZHDA 5HVFB 2D03L 1JNLL 5D7IE 4RA0C 3MRQA 1BQHG 3T0EE 1AGEA 1LEIA 1HQRB 3L9RA 4OLUL 1UYWL 2YD2A 4AM0A 3UPRA 1Z9LA 2VITA 4KQ4L 4RCAA 3RJQB 3FMGH 2CK0H 4F9LA 3CZFA 2AJZA 4Z0XA 4POZD 1B4RA 4YX2H 4MAUL 1IGTA 3OX8B 1EFXA 1KJ2A 4CVUA 2IJ0C 5C0AA 4JFDB 4HF5H 1DFBL 4HC1H 4PP2B 5AZ2L 3FN0H 4JDZA 3E2HB 5FHBH 4C59B 1HH9A 4RFEA 5IFHH 3TV3H 2FCBA 3RU8L 3CUPA 3FRPA 5DHVH 4B7LA 3NOIA 2YD9A 5IB2A 4Y5VA 4FQHA 2X4SB 4PJXA 3HE6C 2VLME 1JZ2A 5EULV 2MPAL 5M7QA 2E8ZA 2C3VB 4HCRH 4PJEB 1B2WL 2XY2A 2JKXA 3P3YA 3VGAC 1JHKL 4PBXA 1TVBB 3R8QA 5HSFA 4LHJB 2ZSWB 5HHNA 3F5WA 5E6IC 3JV0A 4X5XB 1F90H 3S37L 1YQ2A 1AXSA 5DJZB 4HZLB 3RWJA 3UTTE 2PTVA 2ENYA 3K7UA 5TPWL 4HUUA 1IGCL 4K71C 3QO1B 4FN0A 1ZS8A 5IVNA 1WEJH 1RVFL 3LVEA 3QYCA 2R1YA 4HUKB 2RFXB 4NC1E 3DMMD 2QKIA 2EDNA 4NQVA 3MLRH 2JTDA 1CTOA 2Z31D 3FQWB 1HE7A 1OGAD 3A6BL 3O2VL 4IMKC 4Q9RL 3D18A 3BZDA 1KIUA 5TQ0L 3WIIH 4RQQA 4ZPVA 1I9JL 3VW3L 4P2OD 4NKMB 4UDTA 2Z91A 1BD2A 3QUZA 1ZMYA 3T3ME 1C5DB 5T1LD 2ADIA 4NCC2 3G5XB 4AEHH 1HXYB 4OI7A 4Z6AT 5C0DB 1FE8L 1JUFB 1X7QB 4PYGA 4KY1L 3X11B 3L3OA 2E7LC 3L1OH 3S96A 5CIPH 3T1FB 4ETQA 3MXVL 4ZPTA 4J4PC 2E27L 1MCWW 3O6FC 5KG9A 5FYKL 2HFGH 4OF6A 4JY6A 4RGOL 4AQOA 4K7FA 4PREA 5HHOD 4WV1A 4LEXL 5B38A 1S7VA 2A77L 2AJYL 5BOZG 2DQTH 1CGVA 1D6EA 2EKJA 3HE6B 3QSKB 3W9DA 4XHJC 3QI9D 2Z9TA 3F7VB 4GAJL 2BJML 4KPHL 3VGAB 5BV7C 1TCRA 3O3BB 1V05A 3QFDA 3V6FA 25C8H 5EZOL 1CK0L 3HZYB 4PJEE 5E6IB 4KMQA 4W6YB 1BBJA 1H3UA 1RZ7L 4LLVA 4K23L 2EYSA 4MXVF 4B0MM 3D48R 1U95B 3CXHJ 3MBXL 2WBJC 4K71B 4TVPE 2PW1A 1M4KA 3MRJA 3V6OE 3SBWA 1MAKA 1I9IH 1WGOA 2W0PA 3C6SB 2D2OA 2XPGB 4XCYA 4DWHA 1JI2A 1M71A 1JYNA 4GMSL 4NUGH 5E8OA 3VJ6B 1MCRA 1Q9LA 4KJQC 3N9GH 1MCBA 2VLKA 1U8QA 3RDTD 1H3XA 3TA3A 5IR1A 5DQ9A 3L3GA 2FDBP 1UXSB 4E5XB 1F3JA 4KTYA 2AJ3A 4MZ2A 4ZTOL 5CWSB 3RIAK 2I07A 2NY7H 3IU4H 3O6FB 5DUBA 1A3RH 5J9PA 3CLFH 3GI8H 4U3XA 5IT2L 4YX2L 5D2NA 4Z7QF 1AIFA 5JO5B 4U05A 3ZSTA 4HF5L 2JB6A 5IMOB 1PQZA 4HC1L 4LNRB 1BFVH 3MJ9A 4YDIH 4ELKB 4HAFA 3FB7B 3FN0L 5JOPD 1S5HB 4X6DE 3FRUA 5FHBL 1J5OH 5IFHL 3TV3L 1KCKA 4L4VB 1MVUB 2EH8H 1QRNE 2VQ1B 3LEXA 5BV7B 5I66B 1K8DB 4UUJA 2FR4A 3ALWA 1LP9A 1PD6A 1JGEB 2VIRA 3BAEH 1O7VA 2I5YH 3O8XD 3LZFH 3EOTH 3QJFA 2CH8A 3QDJE 4HCRL 5HDLA 2WBJB 1I1CA 1FG2B 3TVMD 5JXED 1DZBA 1KLUA 1AO7B 1GVIA 4UDUB 1F90L 4JN1H 3VFUB 4NRZB 5EU7C 3L7FB 1UVQB 3KPPA 5CKAA 5F71A 5ANMA 2IH3B 3SKOA 4X98B 2D4DA 1WEJL 1JWMB 1KTLB 3CCHA 4TSCH 1AQDA 3VXMD 4YHMH 2WUBH 4U1NB 5K59F 3WIIL 4Z7UE 1A1MA 5DRNA 1ADQA 2X4QB 5ICXA 3DMMA 1QSFD 3ES6A 3R06A 1HOCA 4MXWH 4U1LA 4QHNB 1JK8A 3EFFB 4P4KC 1WZMA 4Y88A 2PTUA 4U2ZA 2Z31A 2EDDA 1OGAA 1KULA 3PV7A 2P42B 4AEHL 2FIKA 4NQDB 4RMSA 4DN4H 1QSVA 1EEYB 4P2OA 5HGDB 3TNNB 3MRKB 3JUZA 3L1OL 5IHLB 3GHBH 1FGNH 5T1LA 2BFVH 2Z92B 5HJ3B 3PDDA 1R3IH 5HI5C 2WQ8A 2E9IA 3IRPX 1Q9WB 4GKOA 1BWWA 1ORSB 5I1HH 3QUKB 4Z5RB 1E6OL 2PTTA 2DQTL 4X7TB 3EYQC 4LFHG 1QNZH 4GRMA 1NDMA 2JELH 4HIIA 4LKXA 2D4FA 4AEEA 3FZUC 3VH8B 3L3JB 5HHOA 1H8NA 5D8JH 4BKLA 5SX4H 1MJJB 1TNNA 4Y4KD 2Q76B 5JDJA 1U8NB 3VWJD 4NCC1 3QI9A 1AO7E 3PNWB 5DJCB 1S7SA 4WI4A 4PJFB 5DI8A 3N1PC 4GMTH 1VCAA 1A5FH 3NFPA 2HJKA 4UQ2B 3P0VH 4JHAH 1G6RA 2BY2A 4LMQI 4ORZC 4ZS7H 3LQZA 2NW3A 1JYXA 2QHRH 2E9BA 3TEUA 2V2XA 2X89D 1QD0A 2GI7A 1KJ2H 4NUGL 4ODUA 4G5ZL 5DR5H 1I3GL 4L4TB 4P4KB 4XZUB 3MLUH 1CFSA 4M7ZC 1ETZB 1UM6H 4F80A 3EYUH 1LDSA 2ZPKH 5FGCE 2CIKA 1JNJA 1NGXB 2FGWH 4NQXB 4P2RB 4NN6C 5FK9B 3GGWB 1QEWA 2NY7L 3IU4L 5I74C 3OR6B 1ZT4A 3RDTA 3CLFL 5SWQB 3QIWC 3GI8L 4G8IA 4LCWB 4KTDL 5C92A 3TT3H 1VFAA 1U92A 3M17A 1ZA6A 3GMRA 3WJJA 2HJFA 4AT6B 1BFVL 3QQ9D 3CU1A 4YDIL 1PSKH 4J3SA 4F9PA 1SYSB 4OGXH 1J5OL 1NANH 5KBNC 1GGUA 5F88B 1T2JA 1IT9H 3LKPA 5CCKH 3LEYH 3ULUH 4ZUUB 3BAEL 1P5UA 3LZFL 3EOTL 1QFWH 5DRWA 5I1IH 3I9GH 1OL0A 3W0WE 4L8DB 2H8PB 3SDDD 3AY4C 3WDJA 4ZNEA 5IB5A 1H8OA 4JE4B 3MQIA 1S7TB 5T5FH 1T04A 3QCTH 4PLKD 5F7DA 3QIBC 4PJFE 1A6UH 4MDJB 1F11B 3O8XA 5DGQA 1N7MH 4JN1L 2RGSA 4OZIF 2VDRH 2WSKA 1JPGB 4XP1H 3VRLE 2R2HA 5M95B 3NAAH 4HZAA 4BUGA 3GIVB 3TVMA 2YD4A 5JXEA 3DV4A 2EKSB 2WINA 3RNQB 1WAAF 3STZA 1NEUA 4M7ZB 3VD3A 4L4TE 4JRXE 4M03A 2D7PA 2YD1A 3JWDC 2WUBL 3SHSA 2E7BA 1H0DB 3LAFA 3FCTB 3VXMA 2Q6WB 4MXWL 4NN6B 1QOKA 4OGAC 1M7XA 1B9ZA 1A6ZB 4G6KH 3INUH 1SMOA 5I74B 3D39B 4KZEH 3QIWB 2Z35B 4DN4L 5BOPA 1A8JH 2DMCA 2DWDA 1KJMA 3D3VB 1QSFA 3VGGA 1IZKA 3GHBL 1FGNL 2BFVL 5DC0A 1FNSH 5DHYA 3UTSE 4ZOAA 2XWBA 1R3IL 2QBWA 1DUZB 3QO0A 3IU3B 2P24B 2C26A 2XFXB 4G9FE 1MCNA 1EAPB 5I1HL 3MNWA 3UP1A 5ALBH 4G80B 2BVYA 3MUZ1 1QNZL 5AUMB 2JELL 3BE1H 4FHBD 3OL2A 1UWGL 2QSQA 1ZA3A 2NMSA 5EO1B 2YWZA 3GSXB 5D8JL 3KPOA 4I18C 1YEDB 3MREB 3BWUC 4G8EB 1DSFH 3QIBB 1U8IA 1X5YA 1H15A 4P5MB 2HP4A 4KJYA 2V5TA 4GMTL 4Y4KA 1A5FL 4X4ME 4D0CA 4NNXB 3VWJA 3P0VL 4JHAL 2Z93B 3D2UB 4ZS7L 3SE3A 1EHXA 2QHRL 1YECH 1CG9B 1Y6KR 2FATH 4XCFH 2X4NB 1I7RA 1RI8A 3KG5A 1KJ2L 3KLHD 5DR5L 4U1SA 1YNTA 4KGJA 4NKQB 4BUHA 5LGJA 4OF8A 2DICA 5AD0B 4UNTA 3MJ9H 3S35H 5L9DH 2X89A 4NQEB 2R9HD 5ESQB 1UM6L 2KQNA 3EYUL 3HUJE 1S7XA 2ZPKL 4OQTA 4UQ3B 1YEKH 1UJ3C 2HG5B 2R1XA 2FGWL 4MS8D 3QEHB 3VG0L 3MROB 5MHSD 2D9QB 3ULVD 5FYKE 1YY8B 3E0GA 4UU9B 2DM2A 4CNIB 4Q97A 3TT3L 3OKMB 4H0IA 1SYVB 5E24E 3WIFA 2WWKO 4DOHB 5EIIA 1XF4B 4NFCA 4I1NB 3SKUD 1HHGA 2OTUA 2BOCB 4MD4B 1VADA 2E5EA 4OGXL 2NX5B 1ZVSA 4OCMC 1F3DH 5DYOA 4BFIB 2GT9B 3BPCA 4JJHA 4I18B 5C6WH 5JHDB 3OG4B 4L8SC 1IT9L 5J1AB 3L3HA 2X1OA 3LEYL 3ULUL 2ZZUT 1KTKE 1QFWL 3V8CA 1IM3B 2CLVB 2FLRT 4M3KB 4LPXA 5I1IL 1FL3A 3I9GL 1ADQH 2G2RA 4K9EH 4R4FH 3U82B 1ZHNA 3CX2A 2VH5H 5I75B 3GUTA 1VHPA 3MBEC 5T5FL 43C9A 3QCTL 2XA3A 3SPVB 1A6UL 4X4XB 1Z0MA 1NGQH 2MJWA 1N7ML 1PZ5B 2VDRL 2WMPA 3D0VB 2R29H 1G7IA 4XP1L 5FDWB 5I16A 3U6RB 1F5WA 2NCMA 3NAAL 1NLDH 4YXLL 3SDDA 1NJ9A 4ZSOE 4TTGA 4OQ1A 4U6VH 3RTQD 3VFTA 2BXZA 3RUGA 4MNGB 3FQRA 1PFCA 2H32A 4RDQF 4D9LH 1UJ3B 4WI6A 2VZ1A 3WNMA 3CAFA 1N59B 2Y5TA 3RI5F 5IJKC 1HHJA 3QB7C 3PABB 1KUMA 1P2CA 4M8QB 1FJ1B 4G6KL 3INUL 1U58A 4MQ7B 3WS3A 4N0YH 3RAJH 4KZEL 1R5IB 1ZT1A 3MRHA 1FFOB 1OVZA 5CD3A 1PKOA 3QDME 1CU4H 1NC2B 4E42A 3FO2B 3QNZB 4K3HA 2CUMA 4CW1A 1FNSL 4HSQA 5CSZA 1DDHA 4DOHE 2CDGB 3ULSB 2EIZA 4XWOD 3QCUH 4OLYH 1FZKA 2JK5A 4JCLA 3ILQC 1NFDF 1B6DA 4ONFL 1H9VA 1G6RH 4L8SB 3LKSA 5TDNA 5ALBL 1OLZA 5JHDE 1LNUA 4CL7A 2RR3A 4V1DD 4L29B 3S3SA 1W72A 4E41D 1M1SA 2AABH 1XF2A 3MBEB 1DSFL 5DFTA 5FYLD 4JFED 1OWWA 3HN3A 2QQLH 4IM8A 4WU5A 32C2A 4BH7B 4XXDA 4EIGB 3KYOB 1RV6X 3ESUF 3SGJA 2P5EB 4X8XA 4PY7A 5KSAC 4ORGB 2APTA 1WCQA 3EOAA 3MMEB 5IW6B 4LLYB 4UV4H 1B6UA 1RD6A 1RJYB 1YECL 2FATL 4XCFL 3P9MB 1K5NB 2EDKA 3VXUB 1RK0B 1E4WH 3QEUA 2P46B 3U83A 2VKXA 4QTHA 1PAMA 4X9FA 3S35L 1KOAA 5L9DL 3ME0A 5DD3H 5FCSH 3DGCR 1T21A 4GW4A 4TOYH 1YEKL 5C3TA 1RUKH 2P1YA 3VGFA 5C0NC 1A6TB 4J8RA 2X44D 3QA3A 1XCQA 1HN1A 1UZ8A 3MFFB 3AREC 4QRQB 4Z7NF 1HWHB 3RX5A 4YDVB 1KT2A 4Y16C 1KG0B 3DARA 4FTVD 3FB5A 2IFGA 3GO1H 4OZHF 4HBCH 1AD9B 1Y18A 4XNQB 3DRTB 4F7PB 1QHPA 2YPVH 2YD5A 1XZ0B 3TBSB 5FKPB 2ADJB 3FONA 5BQ7A 2CMRH 4KUZH 4N8CH 2E9WA 2HTKC 1AGFB 5CUSH 1MJUL 3W82A 5I1EH 3DX7B 3MRRB 4R2GD 4L8BB 5D70H 4F37K 1NUDA 1WCBA 5C09B 2NNAB 1G7PA 3W5MA 4PPTA 3VMNA 2HWZH 1ADQL 4K9EL 4OCLC 4R4FL 4I9WD 2JE8A 2VH5L 5KSAB 1XGRA 3IGAB 4U6YA 1NGQL 3WLWC 4JZNB 1XF1A 2P5EE 4YHIA 3CH1A 1RZFH 1I3RA 2GFBA 3QUMA 2R29L 1I3UA 1NLDL 1P4LA 1AGDB 2DL9A 4JY4A 3RWCB 4U6VL 1JHTB 3MX0A 4MLIA 1JHLH 4KRPD 4H1LA 4PIRF 5KOVC 4TUOB 2O26U 3THMH 3TGXA 1KPUA 1PYWA 1SY6H 3RTQA 3ARDC 3KYKH 4HFWB 4P5TD 1CFVL 1ONQB 2F9BT 3AREB 1I8KB 4MAYD 5DJ0A 5HGBA 2JIXD 4Y16B 4JM2C 4N0YL 3RAJL 3VFGH 1WT5C 1C12A 2C4FT 4XH2A 3K8KA 5BW7A 1CU4L 3TZVC 3LKRA 3TO4D 3UBXA 1LHZA 4ZO7A 4LK4A 3GMQA 4R3SA 5C2UB 3HMWH 4OLZH 3UZQA 5I9QC 3QCUL 4OLYL 4KVCH 4L1DA 3KPSB 3LV3B 1G6RL 1JV5A 2R2BA 4BYHA 5H2BB 3QXTA 2H9GA 4YNYA 1H3PH 5CMAA 3O3AA 4R9HA 2F8OA 4R96B 3ILPB 4KQ3H 4APQC 5FYJU 5C09E 3FAWA 3PF2A 2OYPA 2W60B 1T89C 3HC0B 2IPTH 4V1DA 2QQLL 3MRQB 1LEGA 4QRSA 5F44A 5JQ6H 3L9RB 5E8PB 2IPUG 5IMKA 4OQTH 4ZQKB 5GHWL 3BO8A 4E41A 2X7LB 3UPRB 3EKCA 4UTAH 3HCVB 4JFEA 4Q74A 3NFNA 4P9HH 4UV4L 1UB6B 1IGTB 4HGWA 1BBDL 2QTEA 3Q5YA 2W1NA 2PYED 5KS9A 1N26A 5IOPB 2YD3A 3ARDB 4JDZB 5EOQH 1E4WL 4XPAH 2EECA 1HH9B 3NA4A 4M3JA 3GMMA 4WV1C 1T5WB 4HLJA 1D5ZB 2XKSA 2EDJA 2E6QA 4JM2B 5DD3L 3S36H 3QFJB 3RGVC 3QDGE 4OFPA 4TOYL 3CSBA 4LQ1A 1RUKL 4U1HA 3FQNB 3H9SE 3FB8A 2W0FA 4HIHB 4HG4K 2IPKB 3TZVB 2BERA 1BFTA 5HHNB 3F5WB 4O2EB 2WP3O 3RRQA 1X4YA 2WWKT 1CQKA 4RZCA 4HBCL 4OM0H 5I9QB 3RWJB 5IVZA 3UJTH 3FO9A 2VLJD 3KLAB 4EOWL 3TBTA 4UBDC 2F54D 2YPLE 1S7RA 1N6QH 4HUUB 1A1OA 1AC6A 1T7WA 2VAJA 4FTVA 3VI4E 4YH6A 5ESVB 2CMRL 2BC4A 4NQVB 1X4ZA 3QAZC 3DVFA 2EEDA 5CUSL 1KC5H 3ZL4H 1UT9A 4DUWA 2JJVA 4X7EC 4APQB 4J2XA 5D5MA 3P2TA 3MLXH 4RQQB 4ZPVB 5MP6H 4JY5H 4OFVA 2H32H 2OXGA 4HS3A 2Z91B 3I6LD 4G6FB 3ZDYF 2O93L 4LQFH 4LKCA 2ADIB 2HWZL 4HGMA 5D4QA 2DL2A 5HDBE 4QHUA 4HKXB 1RZFL 2FEDD 4NKDA 1U8PB 3VD9A 3DIFA 4ETQB 2HT4D 2ERJC 3MV8B 5DSCA 4PRHB 1JHLL 5C0AE 1RJZA 3MRBB 3VGHA 1UXWA 2NY4C 5D2NC 4WV1B 1X6LA 4C57C 1S7VB 3BN9C 3RGVB 2V2WB 5JR1L 1D6EB 3OAYH 3THML 1MCLA 1CD9B 1KENL 3DGGA 3KYKL 5CGYC 4PJXE 1HK6A 3QULB 1EPFA 3V4UH 4L5FH 2Q8AH 1X5XA 2YUVA 4QHKJ 4I0PC 3CNKA 3ROLA 1W72H 2B1AH 3VFGL 4OSUH 1D6VH 1BBJB 4PV9B 2EYSB 4P5TA 4XMPH 3KXFD 5DS8B 4MAYA 2DTMH 4HUWB 4PJHA 1S9VB 2JIXA 4O2FA 5LWYL 3MRJB 4I0CC 3H6JA 3QAZB 1MIMH 4RA3A 3WNPA 4KVCL 3VFVB 4FQCH 1FNEB 1M71B 2N7BA 5GSVA 5ICYB 3ULUE 1F6AA 2ARJB 2A6IA 2P8LA 5E8OB 1BJ1H 3TO4A 3QQ4A 1Q9LB 1H3PL 3PHOA 4KQ3L 3MRIA 1XGQA 2X05A 2V2TA 1BD2E 1G7HA 1QFUH 5GGSB 2IPTL 3L3GB 4K9EC 5JQ6L 1WISA 4M5ZH 4OQTL 5DVOA 3U4BH 2I07B 1F13A 1JGLH 2Z31C 5JW5B 5GRJH 3JTTA 5IHZB 2ERJB 2YKLH 3SQBA 3T2PA 4UTAL 5KW9H 4P9HL 1MH5A 5DEFB 4NRXB 1OF2B 2HMID 2NY4B 5D2NB 4WFGD 1OD9A 2BRQA 4HK0B 1OW0C 1QQDB 1A0QH 1DE4B 3MOQA 4FFZH 1CF8H 1IC5H 2JB6B 3HR5A 5FM5O 1YJDH 3IFPA 8FABA 4N90D 4OFYA 4XPAL 3ULVH 2ICWJ 3RVXC 3MA9L 3T0AA 1UENA 3VXSA 4I0PB 4OD3L 3U48A 1IKFH 3BD4A 3RWIB 5HHXH 2PYEA 3S36L 1LP9B 1S3KH 2VIRB 2H2SC 1DJSA 2R0ZH 1T20B 3UZEA 4D94A 1U3HC 4Z78B 5C07D 5CP7A 1KXQE 4Q6IA 4DCQA 1HZHL 3EO9H 3WFEH 1KLUB 5KSBA 4F7TB 1OTSC 4GW1A 3WDIA 4EQ3A 4OM0L 3DYMA 4KMTH 4ZD3L 2EDHA 4NIKB 1TETH 4LF3A 1N6QL 3SKOB 2VXSH 3QUMH 1RJLA 3CCHB 5K33A 4OCSH 3OMZA 4BFBD 2VLJA 1KC5L 3ZL4L 3DVIA 2F54A 2CKBA 3OKEB 5D93C 4YZFE 3MLXL 3NCCB 4J3OC 2VLKE 1BX2B 3CXHK 4H1LH 3KPRD 5ICXB 3ES6B 4OCNC 1HOCB 1KLGA 4AY0A 4LQFL 4U1LB 1JK8B 4JAMA 4HQQH 1KTDB 5CINH 2Z31B 1BQSA 2FIKB 2VWEC 3RKPA 3TN0D 1T80A 3NCBB 2V5RA 2VISA 2P47B 1EIBA 3G6AA 3IJHA 5AZEL 3VXRB 4NC0B 3OAYK 5T1LB 5CJ8A 5D2NE 2VRAA 4Y2DD 1ZSDA 1HDMA 4HK3J 3AXLA 1I4FB 1HEZA 5DZLA 2FX8H 2Y6SD 2VZTA 3Q3GA 3WFCH 4DGVH 4HIIB 2BMKA 2R0KL 4LKXB 1U3HB 4WIQA 2UZYB 1LP9E 2XZAL 1CGXA 5HHOB 3V4UL 1M7DA 4L5FL 1P6AB 1R6VA 3U2SA 1CE6A 1D5XB 1L4IA 4O4YH 4BKLB 5E9DB 1K85A 5ACMA 1W72L 2B1AL 1VFOA 1A1NB 4FXKA 2XYCA 1OARH 3TYGH 1D6VL 4Y2OA 4IHOB 4NHCH 4XMPL 1S7SB 4JQVA 2DTML 2J4WH 5IFAH 2B7DT 2GEEA 1T1ZB 1T4KB 1AR1C 5ANME 1LDPH 3OSKA 3O8XC 4WGWB 1MIML 5FYLH 1UWEL 1JRHH 2YZ8A 3KXFA 3RWFA 2V2XB 4FQCL 2PCPB 5D93B 2O61B 4M61A 1LE5B 3O3EB 4GBXC 5JHLL 4M8VA 3VDBA 4CADB 1CI5A 2HLAA 2XN9A 5J7CC 1ZANH 4G8GB 5I8EB 1RU9H 4GKSA 4F2MA 1CFSB 1IILE 4NRYA 5E03A 1QFUL 5IGXH 1TVDA 2PW2B 1OGAE 4ODWB 3B6SA 4OKVA 4FFWC 3QUXD 1UB5A 1MCFA 4M5ZL 3VXQA 3LCYA 4I77H 4ZAKD 4PJGA 3U4BL 4PGBB 1CWVA 4IMLA 1JGLL 5I2IA 5CEXA 4LHUD 1QR1A 5GRJL 4PG9A 3L3DB 1AFVL 4TNWK 2VUOA 4MD5A 3IETA 1A4KB 4WVRA 1A0QL 3GZKA 3M17B 4FFZL 3GIZH 1ZA6B 4NKIH 1CF8L 2YC1A 1IC5L 1FPTH 2HJFB 3QJHA 1YJDL 2O5ZL 3CXDH 3PL6D 1D9KC 3BX7C 2VDMH 2IEPA 5I1AB 3ULVL 3FKUS 4WU7B 1IKFL 3UTQA 4CVXA 5HHXL 3W39B 5HHOE 4J1UB 4H20H 5I1CL 2R0ZL 1IAOB 3JV6B 3LKQA 2VDQH 4G3YL 5TGBA 1B3JA 5C0JB 1CDUA 3EO9L 5F7DB 1B4JH 3O8XB 1XCTB 4PTTA 5EOCJ 5C07A 3F58H 4KMTL 3T2NH 2R2HB 3IF1B 5T1MB 1TETL 1T22A 2X9YA 3LMJH 2VXSL 2NY6C 3QUML 3DV4B 4GBXB 3MRMA 1NFIA 4P3CH 2A1WH 2NY0D 2JJWA 1JZ5A 3GI9H 4OCSL 3STZB 4OGYH 1CGYA 2WM0A 3SE3C 1MY7A 5D1ZC 4DGIH 2I27N 1RZ8B 3GJEB 1BLNA 3TPUA 3N0PB 4QYOB 4D9QE 3TBVB 4RRPA 4HQQL 5ERWB 5CINL 4HH9B 2Z4QB 4MSWB 3V52H 3ZTJG 1FV1A 5CJXA 4YHNB 5C0GA 3PWNB 2C7UB 3KPRA 3IJSA 3T0XA 1KJMB 2YSSB 2R0LH 2NTFA 3B2VL 5DHYB 3F7PC 3TN0A 5KAQG 2XWBB 1D9KB 1AR2A 3TIDA 1DQQA 3SDAC 2DIBA 3AU1A 2FX9H 3W5NA 3K81A 2D3VA 3BRDA 2NY2D 2FX8L 4C4KO 5I18H 1YEJL 4QHKI 2OXHA 3WFCL 1H3WM 1K2DB 4Y2DA 4DGVL 4BSWA 5D2LF 3QWRD 5JOPE 3OPZH 4TULH 1TQCC 4O4YL 4HPOH 4K7PY 2GKIA 2D7MA 1OARL 3TYGL 2Y06H 3QQ9C 3UO1H 4ZNEE 4U4BA 1I7UB 3RA7H 2E7MA 2QADC 4NHCL 4PBWD 5FA4B 4IOIB 2VZUA 5EBLB 1T3FA 2J4WL 2NY6B 5TF1H 4D0CB 4IRSC 3ROOB 2A6DA 3QUYC 1XH3A 4NHUA 3VG9C 5D1ZB 5EORL 4PG2C 4NJ9L 1IM9D 3DXAD 1AXIB 4PLKC 6FABH 4JKWA 1KPRA 4KHXH 4PRNB 1QBBA 4G9DA 2X2YA 2V9TA 3GRWA 4N8PA 1OY3B 1ORQA 3FO1B 5IB3A 1ZANL 3OXSB 4NWUL 1RU9L 5HD8D 3VXME 1YUHA 1HIMH 1MCHA 5GGSY 5IGXL 1BF8A 5E99H 4XNYL 3DVGB 3Q6FA 2XKUA 1QSFE 3PGFH 5K9JH 1OSZA 3C9NA 4X9GA 3QG6A 3QWQB 4XNUH 1V7NH 2W65B 3QUXA 3SDAB 2YD7A 3WO4C 4ZAKA 3EYVA 5CD5D 2F5AH 1CTNA 4LHUA 3GIZL 4LMQE 4NKIL 3V5HA 1HHGB 1KPVA 1FPTL 2IQAB 2OTUB 2AVGA 3CXDL 2VDML 5HY9A 3MV11 4BSVA 3O41A 4PD4K 4F15C 1NUFA 2GSIB 1TQCB 5J6HA 4Z7VF 3L3HB 4BFEA 3EUUA 2BP3A 4H20L 3PL6A 3VWKD 5KJRH 3RIAF 2CKBH 4QRPD 1MREH 2NY3D 2QADB 4PB9H 4XBPB 5EU5B 2BVPB 2VDQL 4ZG1A 4LL9A 5I0ZA 4MMZC 4IRSB 4GJTB 1GRWA 3IDGB 4LBEB 1B4JL 4QNPF 3QUYB 3T04D 5BRZD 1GXEA 3F58L 3VG9B 1NGZB 1NGWB 1G7IB 3T2NL 3BRGC 2G75B 1MCKA 3ZE1E 3LMJL 4G43A 2AV7B 1JYWA 3FT4B 4P3CL 2A1WL 3W11D 3WV0A 4LSVL 4YHPA 2LQRA 4XI5C 4HX1A 1WFNA 2ENSA 4PP1D 3HRPA 3QG7H 1ZLWH 5JA8B 4UAOC 3OKLA 4FQLL 2Y5TB 4U6HB 4PJ9D 5DDHA 3VMOA 4FFVD 3U1SL 3V52L 3AVEA 2BNUB 4EBQH 2C1OB 4PRID 1QR4A 1P9MA 1GIGH 1ZT1B 2V9QA 2P8PA 5CD3B 4BZ2H 1SBSH 3LB6C 2R0LL 4E42B 5BZDA 3MZTA 5GGVL 4L4JA 4R7DB 3FTGB 5KSUB 4JFOB 4MS8C 4KK5D 3QPQD 4NZRH 2FX9L 4F15B 2JK5B 2H3NB 4KFZC 3LKSB 1I7ZB 3BVNA 5TDNB 5I18L 5K9OB 1CXKA 4HIEA 5E8NA 3ULVC 2WWMD 2PO6C 3BZ4A 1V8HA 2O5YH 4WO4D 3GSUA 3GMOA 1UM5H 4M62H 1U2HA 3KPLA 4PBVC 4TULL 4C58B 4HPOL 4QXGH 3U0PA 1BM3H 1U93B 3QH3A 2Y06L 3UO1L 4DZ8B 4WU5B 32C2B 2M26A 5GS0C 3C5ZC 3H7BB 3RA7L 1D5BB 3JV4B 1P4IH 4ONOA 2D7TL 1DQJA 2ADGB 3L3IB 5GRVK 4PY7B 5TF1L 3EOAB 2FH8A 2EIDA 2YWYA 5I15L 2AEQH 4YE4H 5DURB 4HWEL 5JW3H 2EZ0C 3OZ9H 3UYRL 3RUGE 1HCVA 2ICWA 4HWUA 2VDOH 6FABL 4UAOB 3BWAA 4KHXL 3QIUC 5GRVL 3RVVD 3QEUB 5E8DH 1T1XB 4QTHB 4HJ0D 3I3DA 4J3UA 5DZNA 3KDMB 5D2LB 1HIML 2VDNH 2XTLA 1OLLA 3LKNA 4GW4B 4TNVK 1IM9A 1WBXA 3DXAA 2E3VA 2OR9H 2CXGA 4TSAL 1JJUA 5E99L 3CMOH 3IXTB 1U41A 4J8RB 3HS0A 4J3XA 5BJTB 4JKMA 3VRIA 3U79A 1UZ8B 1LEKA 4QO1A 3CC5B 4A6YA 1L0QA 2YBRA 5DJAB 5C6TH 5K9JL 1HHIB 2XQYG 3WSQH 1NH6A 2CGRH 5JMOC 2VL5A 5DJXA 3FB5B 4XNUL 4F7EA 1V7NL 4EI6B 5GRWA 2PKDA 2VZOA 1MF2H 1JWUA 1A02N 2F5AL 3HZMA 4DJMA 4NO5B 3N1MC 4KI5F 4XVUD 2PO6B 1SEBA 5BQ7B 2F58H 2QQQA 4WUUB 5B8CA 1P69B 1JF1A 3WFBH 4XPFH 1OAZH 4XX1E 3UBXG 1E4KA 2I60H 1UFUA 4ENED 1LK3H 3ARGD 3G6JA 3C5ZB 3O45A 2CKBL 3ARTA 1MREL 4XWOC 1WCBB 1G7PB 5DJ8A 4PB9L 3ZKMD 1ITBB 4U1KA 4HKBA 4X6CF 3ARWA 4HD9A 3HE7D 3VWKA 3EGSA 3B5GA 4P3DA 3TM6A 3CH1B 3DO7A 4QRPA 2GW5A 4KC3B 2VABB 1E4JA 3QUMB 2LAGB 5F7HA 5HYEA 5A1AA 1ZLWK 3ETBF 1RSFA 1CLOH 1HHHB 4FXLA 3GSVA 4GRLC 3QIUB 4QKXB 2BOBB 1KB9K 4H8WH 4WWKD 5C9JB 2YUXA 1X5IA 5BRZA 2WK2A 4PGEA 2CDFB 3BYTA 5GRZA 3PG2A 1S9YB 4IOFD 3GEWB 4WW2A 3O6LH 3QG7L 4Z7VB 5DRXA 4O9HH 3SDXA 3P4MA 1ZWIA 3EDKA 4XVSH 3QHFH 4WI3A 5BXFA 5IK3B 1II4E 3OAZK 3CVHA 4EBQL 5FF6B 3K4ZA 4ZFOA 1S8DA 2R1WB 1GIGL 1C12B 4PJ9A 2ATKA 1SBSL 3DX6B 1SJEA 1I1YB 2Z8WC 4NBZB 2E7HA 4X9BA 4A2MA 4OFKA 3LKRB 5EPMB 2DJUA 5MHSE 1LK2A 4PRIA 2QR0A 3B9VA 5DMGD 4C4KT 3WL9B 1I85C 2WQRA 3ULVE 1BZ9A 4NZRL 4OBSA 4WCYH 2WBKA 4ZMAT 1VESA 4OD1L 2O5YL 2BCKA 1FN4A 4M62L 1UM5L 4I3RL 2V7NA 1FIEA 1HINH 4QXGL 3GRWH 2EYTB 3MO1B 3GB7B 3QEQB 1BM3L 3MLVH 1F2QA 4V1DB 3QXAA 1LEGB 4QRSB 4WO4A 5GZNC 3BO8B 1P4IL 1UACH 4CBPA 5A40E 4GRLB 3D0LA 3NFNB 1NEZG 1YPZF 5HGHB 5D7LA 5D9SB 2AEQL 2OL3B 1FYTD 4HGWB 4YE4L 4LHQB 5JW3L 1HILA 3OZ9L 3KPNA 4KGLA 1VGKA 3VI3F 2K7QA 1SEQH 2WNGA 2VXUH 3QZWA 4QXTA 2VDOL 5FECB 1CD0A 1FFPA 4ZUSA 3H3KA 3IXAA 3JV5A 2N1KA 4CDHA 4PJDF 5E6ZA 3U4EB 3IS1X 5I8CA 3SN6N 3WHXB 4JHWH 2VDNL 4U0RC 4OCRL 1T0PB 2XKNB 2OR9L 3PJSB 4UTBH 4U1HB 5I1JH 3CMOL 5TDOB 4OF0A 3TP4A 5CAYB 3RPIB 5C6TL 4ZTPH 4W6XB 4R6UA 1QTYT 3WSQL 4EEEA 1BREA 2CGRL 5KVFL 4RZCB 3BPOC 3EO1B 4PJ5A 3T8XA 3O11B 1GC1H 5JTWA 3TBTB 3HZVB 3WMSA 2AQ2A 4MAYC 3GMLA 43CAB 4AIZA 1NAMA 5DMJB 5IW1A 2AXJA 4G6AD 2AK4B 1R5WB 2RBLA 3HFMH 2F58L 4JFDD 5F9OH 3MRGB 2XWJA 4P5KB 5IIEA 3MOBL 2VO5A 4XPFL 1OAZL 4XPBL 2I60L 3X12A 3I50H 5HHVH 5IKCA 4HT1H 1LK3L 1HKFA 4XPGH 4LPUA 2X41A 4HS3B 1BVZA 1BEYH 1A4JA 4WNQB 4M1CD 4JFXB 4V1DE 4WUKH 3D87B 3PWVB 3S7GA 4E41E 1ZHLA 3ARGA 1F4XH 2Y72A 1LO0H 3LPWA 4LVEA 4LPCA 5FYLE 1OM3H 3HC4H 4JFEE 3TNMA 4NKDB 4UNUA 4NNPH 3MSPA 4JRWA 5TQ2H 1P4BH 1CLOL 5EUKB 4TVPD 4XTRD 4DTGH 4CU7A 5IUSA 3HE7A 5F89B 2DLTA 5KS9E 4H8WL 5LQBH 4K94H 1DBKL 4M6OH 1HCFX 2GSGA 1GH7A 1EZVX 1CYGA 4PS4H 2CRZA 1F00I 4PJ8D 4U0RB 3O6LL 2GAZB 4N1EA 2DQGH 3DGGB 3OG6B 4WWKA 3SE9L 2ZCHL 3QHFL 4X5WA 3G9AB 1NGYA 4NT6A 5GISH 4JPIA 3B3IB 3BPOB 1T83A 3NCJH 4X6CB 3WXWH 1FNAA 4K3EH 1PLGH 3O2WH 3NIGF 5F1KC 4GAYA 1JZ8A 1M05B 3EHBC 4R4NC 4MAYB 5GIRB 1DN2A 4PJHB 5F72S 5EO9A 4MLSA 3RNKB 1EDQA 4M6ML 4PJAF 4GUPA 3AMKA 4D8PA 4OZFA 4FTVE 4LSPH 3BP6A 1Q9OA 4WCYL 5JNYB 4KI1A 4GT7A 1F6AB 2A6IB 4NQSA 3QQ4B 4BK5A 4GW5A 5D5ME 3PHOB 3HE6D 5LVEA 4XB7A 2W92A 4WDIB 1NC4B 4QEGA 2V2TB 1HINL 2VXQH 3GRWL 4N9GB 1G7HB 3P4NB 4QTIH 5DHXB 2I9TB 4LLWB 3MLVL 1OD7A 2D31B 5E6ID 1R3JA 1IAKA 1L0XA 4MQSB 5DF0A 5F7FA 1UACL 5EZJB 3VE0A 3Q2CA 2DQHL 3M1BB 4A6YH 1MH5B 3G5YB 4I9WE 4PRAA 3BGMB 4HH8A 1DVFC 1TPXC 3DLQR 1SEQL 4XHQA 2VXUL 3MZGB 2XACC 2AERT 4DKEH 3RL2A 3FQXA 3HZKA 1BAFL 1FYTA 1KJVA 1YN7A 4Z77A 3VXSB 5I30L 1GYAA 4MCZB 3CFKB 4JHWL 1OTUC 2HT4C 4WJ5A 3SE4C 4UTBL 5I1JL 4W70A 2MCG1 3B83A 1MCWM 1KIRA 2SEBA 5CP7B 4HHAA 5BS0D 3MV9B 5BZWA 1HH6A 4ZTPL 3NTCH 5T5NG 2YUWA 4PJHE 2AGJH 4J4PD 3O6FD 5JOFB 4JGJA 1A7PH 1GC1L 1CIUA 5KANG 1HQRA 2GHWB 3H3BC 4LF3B 4XXCA 1KB5H 2AEIT 1I1AD 3HB3D 2IALA 1TENA 2KKQA 3C8KA 3KWWB 3UJIH 3VFWA 4XHJD 2VLJB 1R3LB 3V4VL 5EFIB 3I50L 3OX8A 5D1XC 4PJDB 4HT1L 5CHNA 5HHVL 5IESH 1G9MH 4L4VD 3RIFK 4XPGL 3NVQA 1IEAB 4JO4H 4JFDA 3SEPA 2UZXB 3GSWB 3G6DH 4PP2A 2JJTA 4WUKL 5FB8B 4J7RA 1QLEL 4HMCA 2WBJD 3K2MC 1LO0L 1DBMH 4DFIA 1OM3L 3CVHH 1AO7D 4GKNA 1XGPB 4L8CB 1DVFB 1TPXB 4NNPL 2CJUH 2G9HB 5TQ2L 1P4BL 2MOVA 2PR4L 4DTGL 1CL7H 5J11C 3I3BA 3O2DA 2ZSWA 4KWUA 1EUUA 1G1CA 4YGAB 3DX8B 5LQBL 1MJ8H 3BKYH 4M6OL 4X5XA 1H8SA 4KJQD 4PS4L 1HEZB 2BSSB 5DJZA 5SV3A 1T66C 1VFUA 4HZLA 4RFOH 4LGRB 5T3XD 3VXSE 2BMKB 2DQGL 2PYEE 1UQSA 3QO1A 3UAJC 1M7DB 2RFXA 1CFBA 4PJ8A 5BVPH 2AJSL 4FXKB 2ITDB 4M9OA 5GISL 3S6CA 3FQWA 3MNVA 1RURH 3NCJL 3WXWL 4K3EL 4G42A 2P48B 1PLGL 4NQDD 3O2WL 4XVTH 5KSBE 2YPKB 4NC2B 5AWNH 5LGHL 1X6NA 5EU6B 1C5DA 1QPPA 3T65B 3TBYA 3G5XA 1HXYA 5FUCC 3BP7A 1ES0B 4CMMB 4LSPL 1RZKH 3KXFB 3V6ZA 4OI9A 3X11A 4JRYB 5D1XB 2BXYA 5EUOA 5J8OA 2VLJE 2HRLA 4UIMB 1YEGH 2GK2A 3WUZA 2F54E 1TJHH 5INDA 3U0TB 3T1FA 5E6YA 2XN9B 2VR9A 1UEMA 5LBSH 3ALPA 4GKSB 4JJ5A 1DLHB 4NRYB 2VXQL 2Q3AA 2GYSA 4QTIL 1UJTA 1JZ3A 3MC0A 3B6SB 2CLZB 2HJLB 1RAMA 4S1DC 1ZLVH 3VXQB 1WWWX 3ZMRA 3OR7B 2WLZA 3HE6A 3QRFM 4IMLB 3PP4H 3I6LE 5CEXB 4GG6A 4YDKL 3F7VA 5CJXC 1WFUA 4M6AA 5J11B 3G5ZB 4A6YL 3GHEH 1TTUA 1LE9B 1Z3GH 4O00A 4Z95L 4H0HB 1AP2B 3HZYA 5E6IA 4PJAB 2OI9C 3IETB 5DD6A 2HVJA 4NYLB 2XZZA 3FN3A 1DBAH 5HI3C 1Q72H 2EDBA 5EBWB 1L6ZA 4H8WC 3WFDH 2YC1B 1IKNA 4NBYB 3ZE0E 4DKEL 1LILA 1NCBH 1NAMH 3S34L 1WSST 1NMAH 4MWFB 3UTQB 3UX9B 2GQHA 3C6SA 3HKFA 2R4RH 1ZXQA 4IMKA 4ZOBA 4Y2DC 1YMMD 2Q3ZA 4M1DL 4EZMA 2AEPH 2ID5A 1NGPH 3VXTB 3LKQB 3VJ6A 5C2BH 2N4IA 4P2RD 5DXWA 2FZ3B 1CXFA 1CFNB 2AGJL 4X7FC 4Z7OE 5HI5D 5C07B 4CN4A 4LCWD 1UXSA 4E5XA 5BS0A 3RZCD 2E7LA 5IJVA 3KJ4C 2FEEI 5KANI 1ZE3C 3KXFE 3MRMB 3CSGA 4ZFGH 3HAEG 1NCCH 4MA1C 3EYQD 4J4PA 4UOW0 3O6FA 3MFGB 5ISZD 4AH2B 3WDHA 3UJIL 4M43H 5GRXG 3FZUD 1CDIA 2XN9E 1CZ8H 3MJ8B 5A16A 5T33L 2CR3A 5IESL 1ZTXL 1G9ML 1I1AA 3SY0B 3TPUB 3HPLB 4JO4L 2LABA 4PGCA 4JPKH 4NQTA 5IMOA 4LNRA 3G6DL 4EXKA 4ELKA 3FB7A 1LO4L 4PJGE 2AKRB 4L4VA 1MVUA 5I66A 1K8DA 2YK1H 1DBML 2OI9B 4YHLH 2W9DH 3CVHL 5IB1B 2H1PH 3EZ8A 2NTFB 2WLYA 4ZFOL 3IT8D 1RZJH 3GM8A 4CN6A 3IKCA 1CL7L 2WBJA 1CFQB 2DKMA 5MEPB 3MNZB 1MJ8L 3BKYL 4KK6D 2A74B 1T5XA 5E7BA 3LRHA 4NFDA 1YZZA 3VFUA 4RMTA 4NRZA 4OZFH 4D3CH 4WFGE 4RFOL 2BNRB 1UVQA 4HUXB 1UKSA 5B39A 4Y2DB 3RWGB 4BSWB 2IH3A 4N90E 1KTLA 2VJXA 2IAMD 1VACA 5E70A 4HEPG 5BVPL 2JCCF 5L0QC 3PL6C 1EA9C 3D39D 4U1NA 4R0LC 4DN3H 5F8QC 2AJVL 4XVTL 1KBGH 3QIWD 1WIPA 2X4QA 1BVLB 3D3VD 5AWNL 3KJ4B 5C07E 1IQWH 4QHNA 3EFFA 5CBEB 3E8UH 4MA1B 1UWXK 4N1HB 1W8NA 4NQDA 2YZ1A 4NHUB 1RZKL 4L9LC 5HGDA 3TNNA 5CZKA 2WZPD 2EDXA 1YEGL 4JDTH 1TJHL 5HHMD 3O9WC 1AD0B 2C3GA 5HJ3A 2AXGB 1AHWC 4P46B 1AY1H 3BDYH 3O3DB 1Q9WA 1WC7B 3ZDZF 5KVMC 2H41A 4Z5RA 1MCQA 2NY5H 2D7QA 4X7TA 2XXMB 4TRPH 5JA9A 3QIBD 4U1MA 1Q0YH 3KPRE 3PP4L 4H0GA 2W59A 4KKLC 1OSZB 3VH8A 3C9NB 3L3JA 4XRCA 4HULB 3QG6B 4N8VB 2HT3D 4FP8H 3GHEL 4MYWB 1MJJA 4G6MH 1C1EH 1Z3GL 2Q76A 2K1MA 1WBYA 1J18A 3P4LA 1HI6B 3ARBD 5FXCH 4KDTA 4CKVX 1X9QA 3EYVB 1F4AA 1DBAL 3D2UD 1Q72L 2HH0H 3WFDL 3V5HB 4RWYL 5DJCA 2F74A 3UC0L 2MKLC 5KAQF 1Z2KA 1IGJB 4BSVB 3O41B 1NCBL 1NAML 2OM5A 4UQ2A 1D5IH 2L4OA 1NMAL 3HI1A 2K7PA 4OGAD 3SKMB 5L0QB 1CGSH 2R4RL 1OAUH 3PL6B 4NQED 4R0LB 4OZ4A 2AEPL 1NGPL 5HGAB 5C2BL 4GLRI 1NBVH 1T0NA 2NY2C 1EUTA 4HIJB 4XZUA 1ETZA 1YMMA 3RX7A 3NCYS 2AJUH 4Q58C 4RFNC 5EH1A 2XOTA 5IROC 1DN0B 2DI7A 5IBUG 5EA0H 4L9LB 1NGXA 4NQXA 4P2RA 2FO4B 4G43B 2UVFA 1CVRA 5I17A 3O9WB 1NCCL 3OR6A 1AHWB 2EEAA 3P4OB 1HYSD 4YHPB 2BVQB 5SWQA 2X9WA 3BP5B 3O2DH 4HX1B 4LCWA 1CZ8L 3RZCA 1HHKA 2NX5D 1N8ZB 3DUHA 3FO0H 5GS3A 3QPXH 5JHDD 5I73C 5JW4Q 1LO5A 1MRCL 4JPKL 1QKZH 5ISZA 4AT6A 4TVPH 4TYUA 4LLUA 2DQFB 5A2FA 3EJYD 5DUMH 1SYSA 1GGCH 1TZGH 4ELMF 1V3JA 2YK1L 1ED3B 5EBMB 1RIHH 4YHLL 2W9DL 2H1PL 4NWTH 3DROA 5BZDB 1RZJL 1TCMA 3AC0A 1FQ9C 1S9WB 1T6WA 1N0LA 1P1ZA 4L8DA 3PQYB 4MA7H 2H8PA 1S7TA 1BJ8A 4MDJA 2HRPH 1F11A 1P7KA 4MZ3A 1V5JA 4AEIH 4D3CL 2MMXA 1JPGA 5E8NB 2FBOJ 1AI1H 3GIVA 5B8CC 4Y4FC 3VFOB 3KYMB 3MRFB 2EKSA 1E4KC 2NY2B 4JGMA 3FHQA 3RNQA 3U0PB 5CD5C 1YN6B 1BQLH 4F57L 4M7LT 3AMLA 4RFNB 3HI5H 1KBGL 1H0DA 1DQJB 3FCTA 2IAMA 3G08A 2Q6WA 5ITBH 1IQWL 5SWZB 1BOGB 1A6ZA 3PUCA 1NC2D 1IAIH 1FGVH 3E8UL 4ZOCA 2XRAL 3D39A 2GJZB 3QIWA 1N0XH 4HLZG 3X13B 3D3VA 3EFDH 5EN2B 4Y7MA 1QFPA 5I73B 4JDTL 2KL6A 1OWRM 1A7RH 1AY1L 1DUZA 3IU3A 3DO3A 2P24A 2XFXA 2VE6A 4LLDA 4PJBF 5D7JD 5IHUH 4B41A 4WW2C 4Z7WF 3RY5A 4ALAH 1WBXB 3DXAB 2NY5L 4PTUA 2JCCB 3MBED 3DRQB 4TRPL 5AUMA 1Q0YL 4A6YB 2DQUH 4I2XB 3BMVA 5EO1A 2VL5B 5DJXB 4F7EB 2R8SH 1YEDA 3MREA 4G6ML 3QIBA 4PJ9C 2BSED 2X4TB 2HH0L 1N6VA 1NMBL 2ARWA 4P5MA 5I1KH 2JB5H 3MPCA 4OUUB 4KROC 4LCCC 1CT8B 1SEBB 1WITA 5JDSB 2EYRB 4Y4FB 3ARBA 2ED7A 3STLB 3VXUD 1HQ4B 3LDBC 4NNXA 1D5IL 5ID1A 3D2UA 4YBLC 5AYUL 5HYSG 4PRBA 1TDQA 3MRDA 2H6PA 1CGSL 35C8H 1OAUL 3ORJA 1CLZH 2QSVA 2AQ1A 2VL4A 3O45B 3SKNB 2MTPA 5FKAB 4KK5C 3RJDA 4MJ6B 3ZO0A 3PIQB 4HKBB 3BEVB 1MFBH 4NQEA 5ESQA 3DO7B 4WO4C 2AJUL 4UQ3A 4XWGH 5BV7H 5EA0L 4LGPB 2HG5A 4GH7B 5I19H 3QEHA 2CLRB 3ILQD 3MROA 4L3ED 1RZKC 4P4RB 1UM4H 3BDXA 4PGEB 5IFJB 1KV3A 4GQPH 3V0AC 4UU9A 3DOSA 2VMFA 2EDLA 3O2DL 4CNIA 3QEGH 1E4XH 4MCYB 4Y19D 1YYLH 2IMMA 4WW2B 5DRXB 3GMPB 3QPXL 3SDXB 4KKAD 1XF4A 1QKZL 3DXAE 2BOCA 4XPHH 1AQKL 1Q1JH 5DUML 5BXFB 4OF7A 2NX5A 1GGCL 1CDBA 4BFIA 3CVHB 1TZGL 1GGIH 4I18A 4F3FB 1S8DB 5J1AA 5C7XH 4PJ9B 4YAQA 3RVVC 2ATKB 5ACZA 3B8YA 5ECJE 5T3XH 2CRIA 4NWTL 4FRWA 1IM3A 4KROB 2CLVA 4LCCB 4TN9A 2FNBA 1FFNB 4HV8A 5AEAA 4B7IA 1XF5B 3LDBB 5DWUH 1KF9B 2HRPL 4X4XA 5EIVA 4UMGA 1PZ5A 5EOTB 4YBLB 3H42L 3UTPD 4AEIL 4DK3A 3D0VA 4XCCL 2IANB 5FDWA 1XF3B 1REIA 2P43B 3U6RA 1AI1L 2VDLL 3G6JE 4W68A 5FUZH 2EDYA 3BD3A 2V7NB 3LPGA 4MNGA 3ARED 1BQLL 3MYJA 4NZTH 4Y16D 4WO4B 4ELMB 3RQ3A 2M8XA 4NJAH 1AJ7H 2GCYB 4JFZH 3OJMB 4ODXA 1N59A 5ITBL 2IH1B 2WANA 4MD0A 3L95A 4QRPE 4M8QA 4ENEC 1FJ1A 2DF3A 2CQVA 3D0LB 2YEZB 5D7LB 1KYOK 3ZDXE 2ICEB 3VFRB 1ZOXA 1N0XL 5BRZE 4HS8H 3S97C 4WEBH 3ZKMC 1MHPH 2HTKD 1FFOA 3EFDL 4OZIA 2R69H 3KPSD 1NC2A 1DANT 3IXAB 3DUSB 3QNZA 1PG7H 5HPOA 4DK6A 3SDXE 1LO3H 3ULSA 1PZUB 4CUCA 2RAMA 1VEPA 1QO3A 2N7AA 2AEWA 5CZVH 1JPTL 1A6VH 1JIBA 1WAAA 2YD8A 3CFBA 4L8SA 3K8MA 4WWKC 1NUGA 3MRPB 2ITCB 1SJHB 3S5LG 2DBJA 5D7JA 4DGYH 1PDKA 3CFEB 5LKNA 5LAXB 1MCCA 2QSCL 2R8SL 4PJ5B 1WUNT 1JNLH 4KTEH 4PRIE 1VKXB 3GMLB 5I1KL 4AIZB 4UNVA 2JB5L 3OTTA 4W6WB 1NAMB 3KYOA 4ETYA 4UOJA 4ORGA 4X6BB 3ARDD 5IW6A 1YA5A 4ACPA 1T1YB 1MHHA 2BDNL 5IKCB 1JTTA 4R90H 4PJBB 1RJYA 35C8L 4W4OA 4G8FB 4JM2D 5DMGC 1CLZL 3QFJD 1A4JB 3RVTC 2NZ9D 2EXYC 4MJ2A 3VXUA 4LRNH 1RK0A 4PGZA 3LRSA 5IJKA 2DBLH 1O7SA 3MLTB 3RU8H 1MFBL 3EJZD 1IEBA 3TZVD 3C60D 3HG1B 4HPYL 3DUUB 3V7MA 4XWGL 3TNMB 3BXNB 5BV7L 5TH2B 2PXYC 5D7LE 3BIKA 5I19L 1KIQB 4ZYKA 1AGBB 3MFFA 1JHKH 3QXWA 1UM4L 3F7YB 4MA3A 4Q6YA 1KG0A 2FIRT 5FUOH 4DKDC 2GSGB 3S37H 5KZCB 2LU3A 4M4RA 4LSDA 1E4XL 1AD9A 1R5VB 1FNHA 1YYLL 3K4DA 3L6FB 4XNQA 4F7PA 4WFFD 1JFQH 1YNLL 3OXRB 4L3EA 3R0NA 1XZ0A 4APQD 4WWKB 2HN7A 5FKPA 2AQ3A 1UZ6E 2ADJA 3DVNA 4UIKL 4X5WB 4XPHL 4DFHA 2YRPA 1Q1JL 4G6FD 3IDXH 4OFIA 4Y19A 5DLMH 3QWOB 5L8LB 1MIEH 4J3TA 3UYPA 1AGFA 3ZE2F 1GGIL 5DK3A 5EO0B 3CZJA 2XNAA 2FGZA 3ARVA 3DX7A 4FXGB 4GAFB 3PDOB 5T3XL 3X3FL 5A2IH 4I4WB 4PJ5E 5HYIA 4JKPH 5EO9B 2AI0H 5ETUB 3V7AE 3ZKSD 5JW4N 4TPRL 2HFFB 1BIIB 4FMKA 4OZFB 5DWUL 1FE8H 3MV8D 3VXNA 4PGDA 4PRHD 4JZNA 1FVDB 4KY1H 4NO2B 3KHOA 1XGYH 4NQSB 5DFWH 2JF1A 5ACLA 5FM5M 3OAUH 2IADA 3MXVH 3RGVD 1T7XA 1FBIH 5FUZL 5D6CB 3RWCA 1HNGA 1VDGA 1QLRA 1FH5L 3WFHA 3TESA 5EC1B 2BHZA 4C54A 5I6XC 2A77H 1L6XA 4NGHL 4NZTL 1X5ZA 4BH8B 4JO1L 2FECI 4TUOA 1EX0A 1IAKB 2PXYB 1FNGB 4NJAL 4ZFFA 1AJ7L 4JFZL 2JJTC 4FQIH 4OLWH 2XTJD 3E3QC 3VE0B 4KUCF 3GNMH 4GAJH 1ONQA 1T7YA 3AREA 2R2CA 4UBDD 3VA6A 7CGTA 1JTOA 4GLRH 2VAAA 4PRAB 4S10A 4Y16A 3RVUC 4LOUC 4Y4HC 4HS8L 4WEBL 1MHPL 3S4SG 3SDCA 4FABH 2R69L 1PG7L 4YBQD 3HZKB 4KV5E 1IRAY 2BSTB 4GRWB 2FEEL 4MJIB 1FIGH 3HPJA 3D69A 6CGTA 1CBVL 3F6LA 1F97A 5CZVL 3KPSA 4WJ5B 3G9VA 3LV3A 3MODH 3JWDH 2VLLB 5BZWB 3LN9A 4R96A 2V5MA 3OKYA 2X4OB 4PJ8C 3U9UB 1CQYA 3WIHA 4KRNA 4LLAA 1E6JH 2W60A 4YDJA 1JGVL 3HC0A 4KTEL 1PKQB 1X5GA 5DJ6A 1VA9A 4PJ7B 1EHLL 4RBPK 5E8PA 2NY4D 2QJDA 4JO2H 4ZTOH 4ZQKA 5IB4B 1NCTA 3BN9D 3ZYIA 2IALB 2X7LA 4QOKD 3C8KB 5B3JE 1N3NB 3VFWB 3HCVA 1XIWC 4NO3A 1R3KA 5CGYD 5IT2H 1UB6A 5JORB 1T1WA 2XXCB 5CHNB 5I6XB 4R90L 4I0PD 5DC4B 4JFFB 5IOPA 1NFDA 1G7MB 1Q9KB 4LRNL 3ARDA 2DBLL 1NBQA 4OI8A 4NZUH 1T5WA 2ZUSA 1D5ZA 4RAVA 4JM2A 2UUDH 3QFJA 1TIUA 3T3PF 4GKNB 4Y89A 4Y4HB 3DV6B 1WT5A 1ERNA 3FQNA 5IMMB 1U3JA 4U7MA 4HIHA 2FRGP 4QHLB 2IPKA 3KAAA 3TZVA 2CDEA 3C60A 3QHTC 1MQ8A 1WWCA 4MNQD 4S2SA 4O2EA 5FUOL 3RL1B 2X9XA 1FYTE 2APWA 1FFRA 1IKNC 3KLAA 1JFQL 2Z8SA 4U1IB 4LEOA 4MB5A 1UQSB 2DM3A 5KVEH 1MRFH 3OJ2C 5ESVA 5DLML 1GZPA 3IDXL 4PJ8B 1MIEL 4WW1A 1JGDB 2DM7A 2X4PB 3MNVB 3C8DA 2XZCH 1QLFB 4APQA 4D0DB 4G42B 1M6OA 1T89A 5C0CB 3IS0X 3BPNC 5F1IA 3OQ3B 3U36B 4M1GL 3BIAX 4JKPL 2AI0L 1PKQE 3BP4B 3VXRD 3TBYB 2N56A 5T5NF 3LIZH 2UVEA 3BP7B 3I3EA 4P48A 1XIWB 2YA0A 1NEZB 4HKXA 2APXA 3V6ZB 2ZWLT 5L2KA 5EUOB 3RVXD 1XGYL 4OZHA 3GSRA 5INDB 3OAUL 1U8PA 1S78D 4XBEH 4R7NA 1FBIL 2H2SD 2W91A 3QQ3B 3MV8A 4JJ5B 1U3HD 4PRHA 4JFDE 1GCFA 4PFEA 3MRBA 1X3DA 2J8UF 5F9WC 1I1AC 4OB5L 3HB3C 5E9DD 1VFBB 1E6OH 1U3YA 1X5FA 2V2WA 5F1NB 3RGVA 4N0CC 2YR3A 2C1PB 4OD2B 3RWEB 2YMXH 1OTSD 3HC3H 4P2YA 4FQIL 4OLWL 3ARXA 4GG6B 3F7QA 3GNML 3QULA 4P57B 5EC2B 4NKOB 4WWID 4ZXBC 4Z0BH 5DD6B 5T3ZD 2HVJB 4PV9A 5GGRY 5DA4A 3LD8C 4FABL 5DS8A 3DTXA 1KN4H 2P5WB 1EO8H 4HUWA 1S9VA 5IP4A 1GJIA 2ZOLB 1VEOA 5D6DA 1FIGL 3CSPA 1U8JA 1NL0H 3IDYC 4N0UB 4G8GD 3VFVA 4HJJH 3QNYB 4HJGA 1FNEA 5ICYA 4D9QD 3MODL 4P2QB 5F3HB 4Q9QH 2ARJA 1J05B 3BPNB 1U6AL 4G5ZH 4NPYA 3JWDL 1I3GH 2UWEF 4D0BB 3QXDB 1A14H 1EMTH 3KR3H 4QWWC 3WNKA 4QGYA 3GSOB 5GGSA 1E6JL 4DKFH 2VKWA 5BS0B 5IJVB 1F58H 4JO2L 3EO0B 1MI5B 3SDYH 5EUOE 5JW5A 4MA8L 3VGDA 5IHZA 1INEH 3CVIH 4LGSB 5DEFA 4NRXA 1OF2A 4KTDH 5A16B 5HHQB 4P59H 1C7SA 5F9WB 3WS6C 4HK0A 2UUDK 1I1AB 4GQ9H 1KCLA 1QQDA 3EYOB 3PWJB 1DE4A 1NBYA 4JPWH 1F6LL 4PGCB 4QOKA 4WTZG 4R97B 1P53A 5B22A 2YN5A 1M7IB 1L9NA 4NZUL 4I0PA 4GG6E 4ZXBB 3RWIA 1AR1D 3OF6D 1T20A 4Z78A 3LD8B 4L1HA 1OTTC 4O2CA 4MNHA 3O6MH 3IKCB 4NFBA 4KXZH 2X70B 1FDLH 3ARYA 4GBXD 2NR6C 4KDTC 1T5XB 2C3HA 4F7TA 4BQCA 3IDYB 3ISWA 3CPLB 4DZBA 5B39B 3NIDF 3REVB 4MNQA 5KVEL 3N1GC 1MRFL 4FFWD 2Z0BA 2HA1A 4IDLA 4P2QE 2M2DA 3FQUB 1VACB 1Q0XH 2MFNA 1IBGH 2XZCL 2BY0A 3OKEA 5IWLA 2D0FA 3L5IA 1BX2A 1E27B 3VU2A 2EE6A 3C5JB 5F7YC 1KTDA 5BS0E 5IQ9A 3LIZL 1J8KA 1D9KD 4HKJB 3K0WA 1OW0A 3T09A 3VXRA 4XBEL 3BUYB 2DTSA 2OR7A 3U30C 1KNOB 3NIFF 3RZCC 3LN5A 3IFLH 1I4FA 4IDJL 3IAQA 1CN4A 4L4VE 4U1MB 5B21A 2YMXL 1U3HA 3HC3L 3VFMA 1ZV5A 1J0HA 4U6XA 1UWGH 5JUEH 3NCEB 3I84A 4XRCB 4LCIH 1D5XA 5E9DA 5L2JB 1WBYB 1XGTB 4R4BB 1A1NA 2NY6D 4Z0BL 1MNUH 1TZIB 3QHZH 3RKDD 1QACA 3WIHH 3ARFC 4IHOA 5D1ZD 2F74B 4YHZL 3BEWA 4LAJH 1KN4L 1LD9A 1EO8L 4Z9KB 3RWDB 4S1SH 4CDGC 5J6GB 1T1ZA 1T4KA 4YQXH 2XWTB 3AAZB 1BPVA 3HI1B 4D2NA 1NL0L 4I8DA 5CSGA 1KACB 2AP2A 5EU4B 4HJJL 4Q9QL 2PCPA 2O61A 4OZ4B 1LE5A 1YEEH 5T3XE 3O3EA 4KK6C 3KLDA 5L8JB 2ARJQ 4CADA 1A14L 1B0RB 1T0NB 5D96C 4G8GA 5I8EA 5CGTA 3P40A 1EMTL 3KR3L 1YMMB 3H9HA 5ABDE 1XR9B 3ARSA 2PW2A 4ODWA 4DKFL 3SDAD 5F1OB 4NQDE 2IAMC 4OUOA 3VG0H 1F58L 1ACYH 4PGBA 5I17B 3SDYL 1IARB 3FB6B 2GJ6B 3TC9A 3SE8H 4LSSH 1INEL 5F70A 3CVIL 1T03H 3L3DA 3U30B 3RZCB 5I1LB 1HHKB 4P59L 2IBZX 5DEGB 4QGTA 1A4KA 4X0KB 1PY4A 4GQ9L 4JPWL 3F7RA 2ESVB 1LO5B 5ISZB 4LLUB 4RMWA 5I1AA 4PRPB 3X3GH 4EUPG 2A9MH 2C3XA 2QADD 4WU7A 3OGOE 3W39A 4J1UA 4IRSD 1JWSA 2Y1VA 4PJCF 4UI2A 5SWSD 3B9KD 3QUYD 3DROB 4QRTA 1IAOA 3JV6A 4XC1H 3ARFB 1J7VR 2EDFA 5B4MD 3O6ML 1P1ZB 5EU7E 4XP5H 5TFSH 4LAQL 5C0JA 1FDLL 3OF6A 4I3SH 4HXBL 3WJLC 3X14B 1WIOA 1P7KB 3N1QC 4CMHC 3RIFF 1XCTA 2EDWA 2UZIH 1JVKA 2DQDH 4YXLH 2HT3C 3IF1A 5T1MA 4WHYH 3JVGC 4GBXA 3ARBC 4PRDB 5D96B 5JOEA 5GJTH 1Q0XL 4LFHD 2V17L 5IHBA 3V5KA 4YXKH 1IBGL 4YHOH 1RZ8A 3GJEA 1YMME 4QYOA 3TBVA 3G08B 2IAMB 4PJIF 5ERWA 3TYFB 4HH9A 2Z4QA 4UT9H 4MSWA 4P2RE 2YA1A 4YHNA 5CBAB 1AGCA 3HMXL 5FGSA 3PWNA 4MXVE 2C7UA 2DOCA 3I02B 4K7PH 3BI9X 3P11H 2YSSA 1HNFA 4YK4C 4LCWE 3CFJA 5H37H 3V9FA 5C9KA 4CN1A 5JZ7D 1BQUA 1D9KA 3LN4A 5ISZE 2VE6B 4LLDB 3U46B 1FNFA 2RJMA 3IFLL 2IF7A 4ONFH 4HGKC 1A64A 1J88A 4PTUB 5HHMB 1JP5A 1HYSC 1K2DA 4HKZA 5JUEL 1WK0A 4LCIL 4CJ1A 4IIQC 3MCG1 1NCWH 5F7KC 1MNUL 4CMHB 3QHZL 1IQDA 5DRZB 2IQ9H 3TT1H 3WIHL 4XB8A 3EJYC 4GKZB 5DURD 3EYSH 1I7UA 4XI5D 2PF6A 5FA4A 4IOIA 5EBLA 4S1SL 2OJEA 5I75C 4P0DA 3ARBB 1MHCA 4AQ1B 4YQXL 2BNQB 3FQTB 4Z7QE 3LSOB 3HAEB 5ID1B 3ROOA 4PRBB 3MRDB 2H6PB 3NGBC 5D1ZA 3LQMA 1TTGA 4XP4H 5JXAH 3RBSA 1FO0B 5IG7B 1YEEL 1XAUA 4KK9C 4PRNA 3FO1A 3LB6D 5DJYB 3EDDA 1CE1H 3I85A 3OXSA 5BCAA 3WNLA 4S0SD 2FJFB 2X4UA 4OZGF 4C56D 3C5SB 3TBWA 4NQCD 1H3VA 1MVFA 5CP3A 3UJJH 3D39E 3DVGA 4YK4B 2FO1A 1ACYL 2ICCA 1JZ4A 3D3VE 5MERB 1PEWA 3SE8L 4LSSL 2BSRB 1T03L 2PO6D 2W65A 4WUUD 3BH8B 4LLQB 3SDAA 1P5VA 1GHFL 3HNSH 1OPGH 5DQJB 2IQAA 3HA0A 4LU5H 5HHME 1P7HL 5GS0D 1I3VA 3C5ZD 4MJ5B 3X3GL 3B43A 2A9ML 1BFSA 4JPVL 4EDXB 5J56B 1MJUH 5K59E 2GSIA 1DQDL 5EZLB 4IIQB 1EH9A 1LVEA 3PV6A 4YEFA 4YAQB 5ACZB 1CVSC 1MCPH 4KVNH 5BO1H 4TSBH 4XC1L 2EZ0D 3VCLB 5D7JC 3ZKQD 4OV6F 1CICC 3T0BA 4XBPA 5EU5A 1QHOA 5B3NA 2BVPA 4HV8B 5DO2C 4XP5L 3ZKNC 3AFLA 5TFSL 3K74B 4JANB 4I3SL 4IRSA 3IDGA 3Q5OA 3L3KB 4LBEA 3QIUD 5SWSA 3B9KA 3QUYA 2UZIL 4G6JH 1K8IA 1NGZA 1NGWA 3NGBB 2G75A 2DQDL 4PG2A 3P73A 3LHPH 2KDGA 5DMKB 1QA9B 4MDIB 4OCXH 2AV7A 1A9EB 3FT4A 1EJ6A 5GJTL 1CS6A 3MYJB 1IC4L 4YXKL 4W4OC 2CO7B 4YIQA 4YHOL 3WNNA 5GGUB 5JIPA 2MQCA 3JWOC 4NQEE 4ODXB 4MD0B 4U6HA 3TPKA 3L95B 4PJCB 4XGZB 1CFVH 2R15A 3Q6GL 1WQVT 4UT9L 4H25B 4IEFB 3CD4A 1XT5A 2BNUA 3S35X 5E7FA 4O58H 1JNNH 2C1OA 5F1SA 4K7PL 3P11L 1A2YB 4OZIB 4XP6H 2IWGA 4R7DA 3FTGA 5DZOA 5KSUA 4JFOA 5ENWB 4CJ0A 1QO3B 2OP4L 4K07A 3B9DA 5EU3B 5T3ZH 2A0LC 3CFBB 4O02H 2H3NA 2NX5E 1L7TH 5DA0B 3VGBA 1I7ZA 3IDNA 3QEQD 3JTSB 5K9OA 1CFTA 1GOGA 3VXOB 5IEHB 5M94B 5D7JB 1CICB 2Y9RT 2AAVA 2VQTA 4Y8AA 2ZUXA 1FL6B 4PJIB 4KKAC 1NCWL 1U93A 3TJEL 4GRLD 5FO7B 5E1AA 3QDAA 3D85B 4DZ8A 2IQ9L 3TT1L 5GHWH 1XEDA 3EYSL 3H7BA 5IBUB 1D5BA 3JV4A 3BQUC 1F4HA 2ADGA 3L3IA 2JJSC 3G5VA 3BHBA 1MHHB 3EW3B 4XCNA 3V0VA 1BBDH 2EE3A 5IV2A 2QHLA 4PB0H 4XP4L 5JXAL 4MNGE 3RFZC 4GAGH 2X1WL 3LRSB 5FAAA 2XZQH 1T1XA 1CE1L 1IEBB 4UOW1 4ZNCD 3KDMA 4MJ4A 5D2LA 5K9QG 3MRCB 3GBLA 1FVCA 1S7UB 3BIKB 2HYMA 4OLVH 3UJJL 3IXTA 3KYNA 5F93C 3PWUB 5BJTA 1ZHBA 1EGJA 3CDFA 4X9IA 3KPQA 4ZYKB 3CC5A 5DJAA 3NZHH 1INQA 4MA3B 1HHIA 4C56A 4OZIE 4NQCA 5I76B 4N0RA 2AK4D 2DQEH 4EI6A 3WN5C 3CDGB 3SDCC 4UINH 5EIQA 4EOWH 4L3EB 5IVXF 3VD5A 1PBYA 5ICZB 3HNSL 4WI9A 2HN7B 1OPGL 4N1CA 4NO5A 1WAAE 3DVNB 3WXVL 2PO6A 5GZND 4LU5L 3DETC 4WUUA 4Y19B 3T08A 1EK3A 2XNAB 1BJMA 2KUTA 1MLCB 4OZGB 2BY3A 1MCPL 4KVNL 3C5ZA 4TSBL 5BO1L 3D25A 1VGEH 3BQUB 1QZ1A 1AXTH 4QXWA 3VXNB 4PGDB 1EO7A 5ADOH 4G6JL 1PEZA 4JHZA 1FNLA 1P84J 2VABA 4S1RH 2IADB 3LHPL 3V8OA 1UA6H 1HHHA 3TJHD 4OCXL 3VFNB 5HYJA 2XIDA 1QLRB 2FD6H 3QIUA 1KCUH 3LQAH 5KN5B 2BOBA 3WFHB 5C9JA 3ECBB 2CDFA 4QRUB 2P45B 5D7IF 3VXUE 1S9YA 3FOLB 3MA7A 4YFEA 3IAGC 5JR1H 4K8RC 1A3LL 5JW4R 4Z7VA 5CSBA 4ZFFB 1KENH 5I1GH 1RIUH 4XBGB 1L7IH 3IJYA 3OWEA 2VAAB 3JBG7 1OOAA 5IK3A 4O58L 1JNNL 2FJHB 2NZ9C 3CU7A 4LDEB 5FF6A 4KKBD 3FRPG 3WN5B 1CDYA 2R1WA 1MELA 3MUY1 3SDCB 3DX6A 1I1YA 4LCYB 4BJLA 3O4LB 4KJPC 4XP6L 3BRFA 3EJZC 3C60C 5EPMA 2VZVA 1ZEAH 4L3EE 1D3CA 4CVWA 5LWYH 3WL9A 3HPJB 3D69B 2W07A 5T3ZL 1NC4D 4Y19E 4O02L 3ZHKA 1L7TL 5HYSB 3EOYG 3AM8C 3KPMA 2DI8A 3IRZA 5GQBA 3SGKC 5GS2D 1J10A 3T2QA 4OKDA 1K9TA 5INCA 3TLRA 5E00B 4FG6C 3WKMH 3CFDA 4EN3C 3MO1A 2EYTA 3GB7A 3QEQA 3VFSB 2NY1C 1WTLA 4YDJB 3ZSSA 5DJ6B 1R0AH 3DNKA 1KEMH 5CJ5A 5IF0B 5CP3H 4JQIH 1F3DJ 2CKNA 4LARH 4AENB 4GRLA 2B4CC 5HGHA 4NO3B 3O4OC 1R3KB 5D9SA 4OFYD 1WWAX 2OL3A 1A6AA 1T1WB 3VXSD 4PB0L 3KS0J 1V3LA 2IFFH 3UTPE 4GAGL 1NFDB 5FECA 3T3MF 3ALXA 1D5MA 2XZQL 5EB9A 2AV1B 3EHBD 3MA9H 4R4ND 3U4EA 4OD3H 3I6GB 3MV9D 3IDUA 2G5BA 4RAVB 3WHXA 1MWAA 2DD8L 5J13C 3NPZB 2XKNA 2DLIA 4OLVL 3PJSA 5B38G 5TDOA 3B4NA 2OS7A 2Q7YB 5A2JH 1G84A 3RPIA 1RJCA 3ARRA 5DQDH 1HZHH 2CDEB 3C60B 3NZHL 4QLRA 4S2SB 5H35B 4X6FB 3C2AH 1A6WH 1J8HD 1I85A 2DQEL 3EO1A 4ODTH 2XTJC 3WUWB 3O11A 3ZT6A 1EZVY 1Q94B 4TUJA 4UINL 3MV01 4ZD3H 3HZVA 3U0WH 1SJXA 4LEOB 3IVKB 43CAA 5E0QA 2GUOA 3KPSE 1B88A 4RGNC 2AK4A 1R5WA 5D6DC 1GZPB 4PJEF 3MRGA 4P5KA 4WW1B 4EN3B 2NY1B 4YBQC 1M6OB 3H0TB 1KCVH 3T0EC 5F1IB 5DMYA 3J8F7 1U8KB 3GJFB 2ZG3A 4WNQA 5JPMB 4JFXA 5TJWK 4ZODA 4U33A 1VGEL 1DVFD 5MEQA 3PWVA 3TH2T 2GK0B 1AXTL 5C0FA 5FIEA 1IMHC 2VSCA 1SQ2N 2ZSVB 3O4OB 5L2KB 5ADOL 3DSNA 4JLRA 3RP1A 5AZEH 4OZHB 4QHMB 3FFCB 4S1RL 3GSRB 1OTUD 5IVXB 5EUKA 4R7NB 1UA6L 5F89A 2FD6L 1QRKA 1KCUL 3LQAL 1NFDE 2JJUA 1G7LB 1R3HA 3IAPA 3AB0C 5J13B 3DBXB 4XCEA 2GAZA 2R0KH 5I1GL 5C0EB 3QFJE 1VB9A 4DEPC 2XZAH 2VLRB 2EDEA 1RIUL 1X5KA 1L7IL 3OKOB 1B0GB 5GZOC 3S5LB 2Y23A 1I9RH 3RBGA 2J2ZA 5EU6D 3B3IA 1FLRH 3S36X 2YD6A 4JM4L 4X6CA 2XTJB 4P99A 2Q8BL 5L7XH 1M05A 2VSDA 3DTXB 5GIRA 5D72H 3OKDA 4JRYD 1HKLH 4X6DF 5D1XD 2HT2C 5F97E 4ODSL 1ZEAL 4RGNB 3RNKA 4HUVB 3MV7B 4LCUB 2XN9D 2CO6B 1U8JB 2FLBT 4LSRH 1KELH 1UWEH 4Z8FH 4Z76A 3H7LA 4HJGB 5D7IB 1GGBH 5JNYA 4WFFE 3I75B 3T0EB 5JHLH 4K3JH 4NPYB 4U3CA 5L8KB 4WDIA 4Q9CA 1NC4A 3T4AB 3WKML 4N9GA 3P4NA 1NANI 4EJ1C 2EH7H 1NBZB 4LLWA 3UTZA 5IWLC 2I9TA 1R0AL 2D31A 1J1XL 3REWA 1KEML 2ZP0T 4Z7NE 4QF1A 1WIUA 2A6JB 5L2KE 4JQIL 1T66D 5EZJA 4S1QH 1QFWI 4LARL 4OZHE 1EGJH 2HVKB 3M1BA 1EBAA 3V0WH 1AFVH 3G5YA 3BGMA 4LASL 1OCWL 1RK1B 3UAJD 4Z7UF 3MV8E 4MQXC 4B5EA 4IJ3C 4PRHE 5DVKA 1NBYB 3AB0B 4NNYA 2IFFL 4QOKB 4GXVL 2O5ZH 2CUIA 1GOFA 1PW3A 4LDLB 4DEPB 1ZT7B 1FL5A 4U0QB 1V3MA 2KH2B 4EVNA 1NCUA 4MCZA 1S78C 3LKOB 2P49B 3CFKA 4DUVA 5I1CH 4X80H 4TVSa 2B2XH 2VXVH 3UTTB 4JFHD 4BZ1H 4JZJC 5A2LH 4O2CB 5C8JA 4MNHB 4YBHA 2FWOA 2XTJE 4G3YH 4NM4H 5DQDL 5GS0H 3MV9A 1XGUA 4GXUM 4K3GA 4FOMA 1C08A 3V6OC 1E28B 2KBGA 1H5BC 3C2AL 3QBTB 1A6WL 5JOFA 4N68A 4ODTL 4DZBB 1YPZA 4OAWA 3WFZA 3U0WL 4KKCD 4MNQB 4UT6H 3MJ7A 4R8WH 1FHGA 4KJWC 2DQJH 2GTWA 1QSED 4S1DD 3SKJH 1J8HA 5JPNA 3IDIB 4WTWA 5KSVB 3KWWA 1JE6A 1BP3B 1AE6H 1R3LA 5F3BB 3RHWK 5EFIA 4PJDA 2B8OT 1KCVL 1N64H 1IEAA 2F5BH 2EC9U 2MHAB 2ZG1A 3GSWA 5J12C 3DECA 5HI3D 5IQ9B 5DFVD 4AIXA 2ZUUA 4NO0B 5FB8A 4BQ6A 3KVQA 3LEVL 2DS4A