5IIPA

Staphylococcus aureus opuca
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
117
structure length
116
Chain Sequence
EGVMIKPITIQAEATLNDAVHIMRQKRVDTIFVVDSNNHLLGFLDIEDINQGIRGHKSLRDTMQQHIYTVQIDSKLQSVRTILKRNVRNVPVVDDQQRLVGLITRANVVDIVYDTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The second messenger c-di-AMP inhibits the osmolyte uptake system OpuC in Staphylococcus aureus.
pubmed doi rcsb
molecule keywords Glycine betaine/carnitine/choline ABC transporter%2C ATP-bin
molecule tags Transport protein
source organism Staphylococcus aureus
total genus 26
structure length 116
sequence length 117
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00571 CBS CBS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.580.10 Alpha Beta Roll CBS-domain CBS-domain 5iipA00
4L3VA 3TE5C 4IY2A 2YVXA 3DDJA 4P1GA 2YZQA 2QR1E 3OCOA 2UV6A 4L0DA 5K25C 2RC3A 2ZY9A 2OOYE 2QRDE 5K23C 1XKFA 4IY0A 3T4NC 2D4ZA 2RIHA 4HG0A 2UV7A 2OOXE 3KPDA 3LV9A 1PBJA 5IIPA 3GBYA 2UV5A 2EF7A 5KS7A 3LHHA 3FNAA 2RIFA 4GQVA 3PC2A 4GQYA 5K22B 4IYSA 4ESYA 3KPCA 1PVMA 4P1OA 4ESYB 1O50A 2OUXA 3KH5A 5K24C 3PC4A 3OCMA 1YAVA 2O16A 2PFIA 4PCUA 4FRYA 3OI8A 3FV6A 3FWSA 3K2VA 4UUUA 3FWRA 4FXSA 2YVZA 3KPBA 3LQNA 4IY3A 2P9MA 4IY4A 3L2BA 2QLVC 4O9KA 1Y5HA 3KXRA 4COOA 3L31A 3ORGA 5MMZA 2NYEA 4L28A 3HF7A 4NOCA 3I8NA 3K6EA 4L27A 3LFZA 2QH1A 2YZIA 3SL7A 2EMQA 2UV4A 3TDHC 2QRCE 2QREE 4DQWA 2YVYA 3PC3A 3FHMA 5LXQA 2NYCA 4GQWA
chains in the Genus database with same CATH superfamily
4L3VA 3TE5C 4IY2A 2YVXA 3DDJA 4P1GA 2YZQA 2QR1E 3OCOA 2UV6A 4L0DA 5K25C 2RC3A 2ZY9A 2OOYE 2QRDE 5K23C 1XKFA 4IY0A 3T4NC 2D4ZA 2RIHA 4HG0A 2UV7A 2OOXE 3KPDA 3LV9A 1PBJA 5IIPA 3GBYA 2UV5A 2EF7A 5KS7A 3LHHA 3FNAA 2RIFA 4GQVA 3PC2A 4GQYA 5K22B 4IYSA 4ESYA 3KPCA 1PVMA 4P1OA 4ESYB 1O50A 2OUXA 3KH5A 5K24C 3PC4A 3OCMA 1YAVA 2O16A 2PFIA 4PCUA 4FRYA 3OI8A 3FV6A 3FWSA 3K2VA 4UUUA 3FWRA 4FXSA 2YVZA 3KPBA 3LQNA 4IY3A 2P9MA 4IY4A 3L2BA 2QLVC 4O9KA 1Y5HA 3KXRA 4COOA 3L31A 3ORGA 5MMZA 2NYEA 4L28A 3HF7A 4NOCA 3I8NA 3K6EA 4L27A 3LFZA 2J9LA 2QH1A 2YZIA 3SL7A 2JA3A 2EMQA 2UV4A 3TDHC 2QRCE 2QREE 4DQWA 2YVYA 3PC3A 3FHMA 5LXQA 2NYCA 4GQWA
chains in the Genus database with same CATH topology
4L3VA 3TE5C 4IY2A 2YVXA 3DDJA 4P1GA 2YZQA 2QR1E 3OCOA 2UV6A 4L0DA 5K25C 2RC3A 2ZY9A 2OOYE 2QRDE 5K23C 1XKFA 4IY0A 3T4NC 2D4ZA 2RIHA 4HG0A 2UV7A 2OOXE 3KPDA 3LV9A 1PBJA 5IIPA 3GBYA 2UV5A 2EF7A 5KS7A 3LHHA 3FNAA 2RIFA 4GQVA 3PC2A 4GQYA 5K22B 4IYSA 4ESYA 3KPCA 1PVMA 4P1OA 4ESYB 1O50A 2OUXA 3KH5A 5K24C 3PC4A 3OCMA 1YAVA 2O16A 2PFIA 4PCUA 4FRYA 3OI8A 3FV6A 3FWSA 3K2VA 4UUUA 3FWRA 4FXSA 2YVZA 3KPBA 3LQNA 4IY3A 2P9MA 4IY4A 3L2BA 2QLVC 4O9KA 1Y5HA 3KXRA 4COOA 3L31A 3ORGA 5MMZA 2NYEA 4L28A 3HF7A 4NOCA 3I8NA 3K6EA 4L27A 3LFZA 2J9LA 2QH1A 2YZIA 3SL7A 2JA3A 2EMQA 2UV4A 3TDHC 2QRCE 2QREE 4DQWA 2YVYA 3PC3A 3FHMA 5LXQA 2NYCA 4GQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3V A;  3TE5 C;  4IY2 A;  2YVX A;  3DDJ A;  4P1G A;  2YZQ A;  2QR1 E;  3OCO A;  2UV6 A;  4L0D A;  5K25 C;  2RC3 A;  2ZY9 A;  2OOY E;  2QRD E;  5K23 C;  1XKF A;  4IY0 A;  3T4N C;  2D4Z A;  2RIH A;  4HG0 A;  2UV7 A;  2OOX E;  3KPD A;  3LV9 A;  1PBJ A;  5IIP A;  3GBY A;  2UV5 A;  2EF7 A;  5KS7 A;  3LHH A;  3FNA A;  2RIF A;  4GQV A;  3PC2 A;  4GQY A;  5K22 B;  4IYS A;  4ESY A;  3KPC A;  1PVM A;  4P1O A;  4ESY B;  1O50 A;  2OUX A;  3KH5 A;  5K24 C;  3PC4 A;  3OCM A;  1YAV A;  2O16 A;  2PFI A;  4PCU A;  4FRY A;  3OI8 A;  3FV6 A;  3FWS A;  3K2V A;  4UUU A;  3FWR A;  4FXS A;  2YVZ A;  3KPB A;  3LQN A;  4IY3 A;  2P9M A;  4IY4 A;  3L2B A;  2QLV C;  4O9K A;  1Y5H A;  3KXR A;  4COO A;  3L31 A;  3ORG A;  5MMZ A;  2NYE A;  4L28 A;  3HF7 A;  4NOC A;  3I8N A;  3K6E A;  4L27 A;  3LFZ A;  2QH1 A;  2YZI A;  3SL7 A;  2EMQ A;  2UV4 A;  3TDH C;  2QRC E;  2QRE E;  4DQW A;  2YVY A;  3PC3 A;  3FHM A;  5LXQ A;  2NYC A;  4GQW A; 
#chains in the Genus database with same CATH topology
 4L3V A;  3TE5 C;  4IY2 A;  2YVX A;  3DDJ A;  4P1G A;  2YZQ A;  2QR1 E;  3OCO A;  2UV6 A;  4L0D A;  5K25 C;  2RC3 A;  2ZY9 A;  2OOY E;  2QRD E;  5K23 C;  1XKF A;  4IY0 A;  3T4N C;  2D4Z A;  2RIH A;  4HG0 A;  2UV7 A;  2OOX E;  3KPD A;  3LV9 A;  1PBJ A;  5IIP A;  3GBY A;  2UV5 A;  2EF7 A;  5KS7 A;  3LHH A;  3FNA A;  2RIF A;  4GQV A;  3PC2 A;  4GQY A;  5K22 B;  4IYS A;  4ESY A;  3KPC A;  1PVM A;  4P1O A;  4ESY B;  1O50 A;  2OUX A;  3KH5 A;  5K24 C;  3PC4 A;  3OCM A;  1YAV A;  2O16 A;  2PFI A;  4PCU A;  4FRY A;  3OI8 A;  3FV6 A;  3FWS A;  3K2V A;  4UUU A;  3FWR A;  4FXS A;  2YVZ A;  3KPB A;  3LQN A;  4IY3 A;  2P9M A;  4IY4 A;  3L2B A;  2QLV C;  4O9K A;  1Y5H A;  3KXR A;  4COO A;  3L31 A;  3ORG A;  5MMZ A;  2NYE A;  4L28 A;  3HF7 A;  4NOC A;  3I8N A;  3K6E A;  4L27 A;  3LFZ A;  2J9L A;  2QH1 A;  2YZI A;  3SL7 A;  2JA3 A;  2EMQ A;  2UV4 A;  3TDH C;  2QRC E;  2QRE E;  4DQW A;  2YVY A;  3PC3 A;  3FHM A;  5LXQ A;  2NYC A;  4GQW A; 
#chains in the Genus database with same CATH homology
 4L3V A;  3TE5 C;  4IY2 A;  2YVX A;  3DDJ A;  4P1G A;  2YZQ A;  2QR1 E;  3OCO A;  2UV6 A;  4L0D A;  5K25 C;  2RC3 A;  2ZY9 A;  2OOY E;  2QRD E;  5K23 C;  1XKF A;  4IY0 A;  3T4N C;  2D4Z A;  2RIH A;  4HG0 A;  2UV7 A;  2OOX E;  3KPD A;  3LV9 A;  1PBJ A;  5IIP A;  3GBY A;  2UV5 A;  2EF7 A;  5KS7 A;  3LHH A;  3FNA A;  2RIF A;  4GQV A;  3PC2 A;  4GQY A;  5K22 B;  4IYS A;  4ESY A;  3KPC A;  1PVM A;  4P1O A;  4ESY B;  1O50 A;  2OUX A;  3KH5 A;  5K24 C;  3PC4 A;  3OCM A;  1YAV A;  2O16 A;  2PFI A;  4PCU A;  4FRY A;  3OI8 A;  3FV6 A;  3FWS A;  3K2V A;  4UUU A;  3FWR A;  4FXS A;  2YVZ A;  3KPB A;  3LQN A;  4IY3 A;  2P9M A;  4IY4 A;  3L2B A;  2QLV C;  4O9K A;  1Y5H A;  3KXR A;  4COO A;  3L31 A;  3ORG A;  5MMZ A;  2NYE A;  4L28 A;  3HF7 A;  4NOC A;  3I8N A;  3K6E A;  4L27 A;  3LFZ A;  2J9L A;  2QH1 A;  2YZI A;  3SL7 A;  2JA3 A;  2EMQ A;  2UV4 A;  3TDH C;  2QRC E;  2QRE E;  4DQW A;  2YVY A;  3PC3 A;  3FHM A;  5LXQ A;  2NYC A;  4GQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...