5IJCC

The crystal structure of mouse tlr4/md-2/neoseptin-3 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
b'QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B chimera
publication title TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ijcC00
2E59A 3ULAB 2HKAA 5IJDC 3M7OA 1XWVA 2Z65C 2Z64C 3WEAA 1KTJA 3MTXA 1WRFA 2F08A 5IJCC 3MU3A 3T6QC 1AHMA 3VQ1C 3WEBA 1AHKA 5IJBC 1A9VA 1NEPA 2E56A 5KWYC 3VQ2C 3FXIC 3B2DC 3RG1C 4G8AC
chains in the Genus database with same CATH superfamily
2NDGA 4EN3A 4ZXBA 3RWEB 4HEME 3ZTEA 1YEIH 5HGGS 4YDVA 4Y9CA 1HZLA 3L9BA 5E51A 3BI9X 4Z7NF 2BSSB 2CHXA 3NIDB 4NERA 2W80C 4TMPA 3HG1B 5E08H 3UBXA 3BQVA 3LRLA 5EC1A 3L7EB 2CHZA 2ZJSL 2FWSA 5D5ME 4GKLA 2JK5B 4PJXA 1ZLVH 2KQMA 4IKJA 1AGDB 4QDGA 5H94B 5FA4B 4KHXH 1U8QA 5AW4B 2NT0A 5I9QB 5DJZB 1T1XA 3MJ9H 4QXTB 3PY9A 3JYBA 4JG1L 5LQBL 1SN0A 3QEQE 3ARBB 3QXWA 1YC7A 4MCZA 4M43H 4TVUA 2A9DA 5SWSD 5HGBB 2Z31D 1IAIM 1MJ8H 5DVMA 5TH2B 3DSNB 3EOYG 3Q6GL 4OLVH 1MNUL 1SFHA 1DBKL 4PJ5D 5IMLA 1A7PH 4PJBB 1HNFA 1SVBA 2G75B 1IE5A 2WQRA 5DZVA 1H9VA 1PLGL 2CM6A 3O3AA 5DK2A 4JQXA 4WWOA 4Y2LA 2VM9A 2W9DH 2UZYB 4JFED 5I76B 3HMWH 3S36H 3WUWG 1DN0B 2MWCA 5CSBA 3PHOB 5DJ0A 1WUNT 1H15A 2EEFA 2YAMA 4J4PA 1UJ3A 3PL6C 1OAXH 4JO1H 5JXED 3PL6B 4XP4L 4N6QA 3GSOB 4BH7A 2R8SL 3UMTA 5KYYB 2A2QT 3ISYA 3QJHA 4V33A 2DQEH 4YDNA 2GT9A 4OD1L 3NFNB 3VE0B 4NPKA 1NGZB 4G8GE 2O72A 2IBBA 2OYLA 3W0WD 4LLWB 2PXYD 4EEEA 5HGHA 1RSYA 4YFLF 4NZUL 5JNYA 3P9WB 1RU9L 1W9XA 4OZIA 3K7UA 5C6WH 2D7PA 3DETC 4QCIB 1FFTB 1FJ1A 1YY8A 4AQ8C 5F6IC 1TZGL 5F6IB 2R7EB 2UY7B 4HIHB 3Q48A 1IKNC 4C57C 1S5IL 4P46B 2BHUA 3UFIA 5KVDH 1DJYA 4IU2A 3TF4A 1TVDA 2JI3A 4HMEA 3A4DA 2FQDA 4LOVA 2IWEA 3G6DH 5CJBA 4YPJA 4C58B 4OVVA 4UQ9A 2CK0H 1TYJA 1X6LA 2Z9TA 2V6HA 3TNMA 5HD8C 1NAKH 4MA3B 4P2QD 4ZAKB 1WWWX 1QO3B 3HFML 1FAIL 1ZA3A 1OAYH 2WQUA 3EW3B 3U7YH 2Y2YA 1YEDB 1H6UA 2QVTA 3FH7A 5K1JA 5SWSA 2Z31A 4YGVB 4PP1C 5LAXA 5L8KB 3SDCC 4Y1AD 4ZYKA 3LIUA 4PJ5A 1IM3D 4OCXH 1EHKB 5HHXH 2YD3A 1NQBA 4PGDA 2WTOA 5CGYC 2YPLB 3W11D 4ZQTA 1G7MB 1B9KA 3EYUL 3NEEA 4JZNA 5I8EA 1CLOL 5D8JH 1WTGT 4JL2A 3VGHA 3WTTA 2GCYB 4JFEA 2J43A 1UD4A 4BBWA 2BLFA 3CU7A 4PJ8D 4S11A 1CDIA 3ELQA 5GIRB 2UX6A 3VFTB 2H41A 3P4OB 1YNTF 2BS9A 1DQQA 3CFDA 3TBSB 1RJLB 2ZXAA 1RZKL 2W91A 4LP5A 5JXEA 4OFPA 4AH2A 1H3VA 1JPTL 4PJEB 2Y72A 2NR6C 3EOBB 3NCCB 3ZVVA 4AQ1C 3W0WA 2PXYA 5AD0B 1YDPA 4A7TA 4MA8H 3WGVB 4N86A 5IOPA 5KTEL 4H25B 5ESVA 4H20H 5C0EB 2JE8A 3MZGB 2WAQA 1CFBA 5I6LA 3T0DA 4R8WH 4EO5A 1I3VA 1ZGLM 3KPNA 2YXVA 3PV6B 4N2KA 4AK1A 4FFZL 5D7IA 4DKTA 1I8IB 2JCCB 2XPGA 4KKAC 1SEQH 4M5YL 2NY7L 3VFMB 1NFDF 4B9YA 1QLEB 1A4CA 5I30H 4O58H 3O2VH 4E9XA 3MLZL 3B83A 2WQAA 2Z7WA 2GTQA 3EJCA 1AQKH 5E8PB 3QG7L 1F56A 3LEXA 4O02L 5GRJL 3CC5A 4BFIA 3LKRA 4FQ1L 1HZHL 4OFKA 2DV6A 4PS4H 1PPIA 1XH2A 3WCYA 3OAZK 4GJTB 4WEBH 4FC3E 1VFMA 2QPDB 5CGMA 3KNBB 5E2WH 3TONA 4MNGB 4L9LA 5CGBA 1A3RH 3IFOB 4HIIB 4X4ME 2YO3A 4HWBA 1YPZF 2L3BA 4MVBC 4M5TA 4OD3H 1JPGB 3HOGA 2H1PL 3MYZA 1T04A 1E0OB 2JV6A 4KBPA 5C86A 1CLZL 4YSRA 1T5KA 3C6EA 2R4RL 5AZUA 5DUBB 4N8UA 1OAZL 4I8DA 4FLQA 4AV4A 3D39E 4RFEB 4TQ8A 1D6VH 3S5LA 2HG5A 5I1GL 1KFGA 2WXKA 4PLKD 2X05A 1KF9B 4F7CB 1DR9A 4FHJA 5I66A 1ACZA 4MAUH 4MNHB 4CW1B 2R0KL 3B43A 1CICA 1TQTA 1YNKH 3GIZL 1F00I 3QDME 1HJBC 3AG2B 2G0KA 2AQQA 5C8JA 4KK5D 2R0ZH 5E1AA 2OJZH 4XP5L 2WZ5A 3RAJL 1PYWB 4WO4C 4MQ7B 5GS1B 2BC4A 2XV6B 4WO4B 4MXVF 3VRIB 3C09C 4JQIA 4HFUH 5CEXA 4GBXC 1HEZB 4OF6A 2XTJD 3Q2WA 2QPEB 4RZCA 2Z92A 3ZX1A 1SF5A 1QI4A 1XGUA 1UWEH 5IROC 5F9JB 2MEJB 4K8RH 1AR1D 3HRZA 1BBJA 3KG5A 3VXUD 4DJMA 4LLYA 2H0FA 2Z7ZA 4NUGL 3T3MF 5J0BA 1WQVT 3GUFA 5CD3A 2IADB 3U1SH 5L2JB 5DMKB 2B0SH 3MLYH 3T2LA 2ITCB 2ZP9A 4JHWL 1RJCA 4J8RB 2VZOA 1ADWA 4XMPL 3STLA 4WWKD 3FTXA 1NMAL 1HILB 3O0RH 2X70B 4MJHA 3ZDXF 2C9RA 3KBPA 1U2HA 5EZJA 1W72A 3CFMA 1AKJB 1S7RB 1TZIA 4DCQA 3STZA 5FDYA 4LCWB 1P4BL 5AG9A 1EUTA 3RKDD 3WIHA 2GBVA 2XA8L 1MFAH 3BO8B 4GLRH 2EQDA 2CCLA 4N2GA 3V10A 5IKCA 4GG8A 3L17A 2EO9A 3F84A 5C0AE 3BT2L 1C5BH 1CFTA 1IEHA 4LHJB 4Y9FA 2WQVA 2QPSA 3LQZA 1NMBL 4LVHB 3GB7B 2IH9A 1PD1A 1KYFA 3GI9L 4J12A 1MFNA 4ZSOB 4AENA 3GIVB 4MZRA 3X14A 2AJYH 1M56B 1UG9A 4JKLA 3BUPA 4KRMB 3KPOB 5DS1A 5ENWA 1II4E 4EDWL 2PTUA 4P2OA 1EGJL 1NEPA 2OTUA 1D5IH 2DIEA 3CHQA 4YAQA 4ZMNA 1MKFA 4AL8L 5BPPA 2W38A 2YD0A 3NJIA 4Q8BA 5I1AB 2KERA 3X13A 2DQIL 4KROC 4ODXA 1EJOL 2DWSA 2OJ1A 4L8BB 1T1WB 1HHKB 1SXBA 3PU7A 4MB5A 3O6KH 1E8XA 3WY4A 1MHHB 4Q4IA 3D3VB 2EDKA 2GITA 5MEOA 1LL1A 2ZOUA 3T1FB 3Q3GB 1ZS2A 1NCGA 3JVGA 2I24N 1G4RA 3SKJL 1P7KB 1GZHC 1JIBA 4I18A 4E41A 3SDXB 2K4WA 2UVFA 1J5DA 2V9RA 2V7NA 3ZMEA 4FQJL 1XIWA 3B7YA 3LRMA 1CK0H 2PCFB 3WNNA 1FG2B 5HI4C 1Z0MA 1CD9B 1MXDA 3IU4H 3VXUA 1T5XA 12E8L 1R3LB 3MFFB 1EAPB 3NIDE 2JJSC 4QXUL 2HB0A 3TCLB 3VB9A 1COBA 5AAPA 1BWMA 5IFJA 4FL4C 2AJZA 4X7TA 3ECBA 4H1LA 2WVUA 4BD4A 3L3JA 4M5ZH 1S9YA 3DUSB 2DD8H 3IDYC 3IDYB 1NJ9A 1WBZA 3L3IB 3LPWA 2GFBA 4RBPK 1VFBB 4MB4A 3V6FA 1QTPA 3O6LL 4PRIA 3MYJA 4E9VA 4BSWA 2VITA 2XWTA 5JQIB 4KDWA 4MJIB 4JFUA 4Z7VE 2XKNB 2FHCA 2ZG3A 4N2CA 3IJHA 4PJ6A 4A7GF 4JPVH 2GAZA 5JW4M 4MMZC 5AYUH 1PQZA 2XQYK 3R0MA 3L95A 3I3DA 1IKOP 1AOHA 2OSYA 3R4RA 3O6MH 4H8WH 4QXWA 4XO4A 3WIAA 5CR1A 4PJBE 5J1TC 5HHNA 2XZAH 3T6VA 1J5OH 3E8VA 4U33A 3B2UC 4AW7A 3ULUH 1IB5A 2XX1A 1T03L 1OAUH 1RUQL 3C5ZD 2DN7A 5JHDD 4HU8A 3TBYA 4WHYH 2C3VA 3WL9B 2E75C 2X5PA 5IV2A 4O5LH 2YGNA 1EZSA 3QIBC 4HKBA 4K73A 5IB3A 3GNML 3QIBB 4L37B 3FO0L 3O3DB 4UIKH 3MNVB 1CO1A 2ZXEB 2VR6A 4LF3B 3LIZL 1FN4A 1EJ8A 1JYXA 2LLGA 4N1CA 2Q7AA 1HH9B 4WI8A 3L1FA 2RA1A 1IC7H 2NY0D 2YEVB 4GRLC 1AI1L 4GRLB 3BOVA 2KLTA 1KEGL 3WXVH 2AI0L 2CIKB 4XCEA 1FWXA 2DI8A 1XB6A 4HFWA 1DLHA 3KGTA 5GGVL 4FLHA 2J57A 3ZYIA 1R9FA 1MWAA 4G1EA 1PU0A 3FT2B 3INUH 3LN5A 3E3QC 3LHPH 4NWTL 1L7TH 5HHOA 1OGAE 4ZPTB 3SYPA 1ZLVK 3GJFB 3N04A 5HDQH 4WFED 4OQTH 3WEOA 4JN1H 2M2DA 4WHTA 2CM5A 4GSUA 3RILA 2IGFH 1NWOA 3DV6A 4DEWA 1XVSA 3S37L 5B39A 5KJRL 1KIPB 4HDIB 3QZPA 4M9PA 3BN9D 4TVPE 2JIXA 3V5DB 1N6UA 5MI0B 4N0UB 4HUWA 2VT0A 1TNNA 3MUGA 4ODVL 1SDDA 4X5QA 2D31B 4Q6IA 3PWPB 5D7LD 4XPAH 1KSRA 3L4YA 5SWZB 1XSIA 2Q2LA 3MLVL 4ODHH 1T21B 5DI8B 3SKUD 2C3WA 3E6HA 1PJWA 4TTDD 1MF2H 4M7KL 2A6KA 3CFIC 3LMJH 4PCYA 1S3KL 3NJGA 3B2DC 1GGIL 5I17B 1AE6H 1O7DE 3ROLA 2DLFH 5DSCB 3T0XA 2YPLE 4KMTH 5ANMA 3GO1H 4HZAA 5T1MA 2NY1B 4L29B 1HXYB 3GHPA 3TEZA 1MAML 1CD1A 3NJJA 5K33A 3C5ZA 1TMQA 1FLRH 5D72H 3CXDL 4NO3B 1YEIL 5J1AA 3VRLF 2LQRA 2GTZA 3VB8A 5AKSA 1UURA 1OGTB 3PJNA 1P1ZA 1MJJB 4DPRA 3G5XB 2DJMA 5IB2B 1FA4A 3HNSL 5FHAH 4WNQA 3O4LA 4YDLC 4WFGE 5EBGA 4YDLB 5LN4A 5J4MA 1MPAH 1OAQH 1PKQB 3VGAB 4X4YB 2ZONA 1MDTA 1WH0A 2IDUA 3HG1D 4XCCH 2Z8RA 4XCYB 1ET7A 2APVA 4OKDA 4ZMYA 2HCZX 5E6IC 4N8CL 4R26H 3AXLB 1WIUA 3BUQA 5JW4N 1U8OB 3RUGF 4M43L 2PKDA 5F0LB 5IW1A 1UGNA 3FT0A 3FRUB 4LMQE 1Y18A 2F8OA 3FZUC 5D2NA 1Y1UA 3BZ4B 5BS0D 2CDFA 4NSKB 4QTIH 1UZGA 4X8CA 3WLWC 3NJFA 3IDXL 1P4IH 1EO5A 2AP2A 2ICWJ 3EJJX 3EYVB 4YFDB 2HRGA 2ZUXA 2W9DL 4BGLA 2BWIA 1UB6A 2G5RA 2LTQC 2MPVA 3HMWL 3S36L 1IGTB 4WW2F 4GW5B 3ZDZE 1HZKA 2NY6B 1LNUB 4X4XB 4KQ0A 1U8NB 5D7LA 4A2DA 2QADC 1LQBC 4R5TA 2QADB 1RFDL 1HOCA 1MREL 4ZMAT 1R5IB 2J4WH 4O00A 4R9HA 4S0SD 5K9JH 1DBBH 1D9KC 3JWNC 1D9KB 1T3FB 1I3GL 1L5GA 2QFRA 4BFEA 4G7VH 4DH2A 5E2UH 3A6CH 4LU5L 3PL6D 5HVWA 4IIQC 1HI6A 3BP6A 2QGCA 3N41B 4IIQB 5AAWA 1O75A 3QUHA 4H0LC 3P4LA 3UIZA 1DQLL 2DIJA 4I9WE 4KMLB 2W60A 2QLVB 4LEOB 1C1EH 2XA3A 2CAKA 2BP5M 1T6BX 5FGBC 2NY2B 3MREA 4ONHA 4ALAC 2WLLB 3B7UX 3DETD 3TH3T 4OCRH 5EIVA 1U8HA 4GT0A 1C08A 2FJSA 1ZOXA 3EGDA 4J1UA 3JZ7A 3MPCA 1HTYA 1FYTE 4LMQI 4TUOA 4P46D 4ZFOB 2XY2A 5J6GA 4KO6A 5TF1H 1TTRA 4X5LA 4UAHA 4NO0B 3J27A 4HJSA 2OLDA 1MRCL 5AQ0A 3N40P 2B1HH 1UKTA 2ZUTA 5FKAA 4F8OA 3Q2LA 1KYUA 5T1LB 2P47B 3Q13A 3WTSA 1H3WM 3M1BB 3TV3H 4GG6F 3U7YL 1S9WB 3SKOA 1T0PB 2V17H 4CJ1A 5HD8D 4ZAKD 1VADA 3BP4B 3LVEA 2P4AB 1XH3A 1W8NA 1BJMA 5BS0A 2NW3A 3QHFL 3EZJB 4ZFFA 1DJHA 1FFOB 1QACA 1XF3B 3KYNB 4W9IC 4XXDA 4C55A 1TTUA 5I1HH 4JO2H 4XVJL 5FW8A 5D8JL 4JG5A 4PJFE 1KYDA 3VYPA 2R1XB 4PP1D 1G7IA 1MFBL 3SDCD 1WCQA 2EECA 4ZNEA 2YPLD 1Z9SB 5CGYD 2K3HA 1XGZA 1QUNB 1Y0LB 2QQLH 3GPSA 1Y07A 1AC6A 1YNTA 1QEWB 3L9EA 3MLXH 2XICA 3HN5A 4LCWE 1TFPA 5KSAB 4I13B 4GXVL 4CVZA 4RMWA 4NJ9H 3QJQB 3BUBA 5LO7A 4NKOB 2Q76B 1K5NB 1XB3A 4IRSA 1KIQB 1P5VB 5CN1A 2ZAHA 1RULL 4PJHF 1RSFA 1SJVA 2COQA 5DZLA 4XX1G 4L5FH 3MRQB 3RL1B 1L9NA 5K1NA 1S9KC 2PMZA 1WPCA 2VAAA 3QR2A 4J3SA 4H0HB 4N3UA 4UUJB 1Z3GH 3VE0A 1SNRA 1LO0H 5HDBE 2XNAA 5EIIB 4S10A 4JK0D 2NR6D 3FQWA 1IAKA 2XYCA 4AEEA 4LCVA 1I9RH 2PYFB 3O9WA 3AG1B 4HXAL 3R06A 4WSKA 2F1EA 2MKLC 1MHEB 4QRQB 4PJAE 5CLZA 4FKEA 5BUGA 3QUMH 1F8TL 4QTFA 2L4OA 3SGKC 1MCPH 4O58L 3O2VL 4AQ8A 4HCRH 4YXLH 3TJHC 4AIOA 5FK9A 5G4NA 1J7VR 2WP3O 1S7UA 2JVUA 3NTCH 1D2PA 3BPLB 4K5MA 1EAOA 4OZHF 2W92A 3F85A 4KKAD 3EYQC 3OQRA 1AQDA 1NGPH 1NSNH 4LL4A 4JKKA 4DKAA 4Y5VC 1WWAX 3MR9B 2YFOA 4IMKA 3ZKMC 3HBQA 3Q1SH 4PRPB 1A3RL 3KPTA 4JFPA 3CHPA 4JE0A 5HHMB 4YGAB 4J27A 3TYFA 2WO4A 3PAZA 1CYGA 1QO3A 4L3CA 1MCWM 2I7SA 1ZGLP 1YPZA 3T0VA 4BQCA 3UAFA 2OYPA 1TEGA 4G70B 1MFDL 2E27L 2C5DC 5DS8A 1R4XA 3T8VA 5B38A 1V3KA 2CIIB 1MFVA 4Z7QE 4OM1H 4UTAA 5DHYB 1U92A 4JKPL 4MVBD 3WENA 1D6VL 3UTQB 4ADGA 5CJXC 3FO2B 1LXMA 3SDCA 4JN2B 2EIMB 3D1MC 4FQHB 4MMXB 5LB1A 3NIFB 5FB8B 5F8RC 5CZVL 5JUEH 4MJIE 3FFDB 3QCVH 1YNKL 4LVEA 1VCAA 2YMXH 5JXAH 2NNXA 1IEAA 2NYKA 4LCCC 5F3FA 5PAZA 3AU0A 3GSRB 4UZGA 1FL5B 2EE9A 2FYVA 4GQPH 4WKZB 5DJ2B 3BEVA 1GW6A 3FXIC 3U0TA 2E7LC 4N9GB 3D4ZA 3PIQA 3S96A 3BYYA 1A9EB 4JPKL 5IOKA 3SQRA 1LE9B 4PV8A 5HYQA 1W0WA 2FWOA 4YSSA 3OKEA 4XHJC 5FHBH 3V55A 1T7XA 3ZR6A 1YEGH 3QFDB 4U1SA 4WO4D 1SOXA 2VDRH 2NSMA 4AQ1A 1LK2A 1YJDL 4LSQH 4GQRA 4GBXD 1KJ2L 4K7FA 5EHFA 3K6SB 2ITDA 4EZJA 3EOTH 1U91A 2GK2A 1HQ4B 3KLSA 1P5UB 1NGWA 4WI2A 5IROD 4NQDA 4HK0B 1N59B 4KVCH 4LSTL 4B3VA 2JCCA 2VUKA 1FQ9C 3O0RL 3MJWA 4Y1SA 5CEZH 3VFMA 5CKAA 4WUUD 3BC9A 3RI5K 3DMMB 2Z93B 3RDTB 3TIEB 1K2DB 1BD2B 4RMQA 5D7EA 1DVFC 5D1QC 5EUKB 1FFNB 5E8PA 5D1QB 1A3ZA 3R19A 5H37A 5J8OA 1P84J 4P9HC 1ZTXL 3OWRA 3X11A 4DETA 5FYKL 4OT1L 4UILH 1AKJD 3BH9B 4P5KA 5D9SA 3OPZL 4ONOA 5H2BB 4G8IA 3KNBA 1DLFH 4LLMB 3FU6A 3V52H 3GS7A 2WXIA 5IEHB 4JHUA 4PCSA 5DFWH 4N0UE 4ES8A 2BJMH 4ABUA 7FABH 1A22B 3ES6A 4PJCE 3PWPE 2Y6SC 3QRBA 4W4OA 3T3PB 5SWZE 3HG0A 5B8CA 5E8EA 3G6AA 2WQSA 4HZLB 4H13C 2O6CA 2JTDA 3ECUA 3O6KL 3K4AA 4BKTC 4CGUB 4XH2B 2ADJB 4F7CA 1TJIL 1ZPUA 4MNHA 4ELKA 5MENE 3T4AC 4W6WB 1FVDB 4PEEA 3T4AB 2YMOA 4KROD 4DGWC 1BFOB 1FVEB 4BH8A 5C0IB 1WC7B 3CDZA 4BA8A 1I8MA 3D3VD 2ARWA 3IJSA 4WUKL 2X6AA 1UVQB 5MEQB 1G9EA 1CK0L 2P8PB 3NJHA 2EE6A 4GBXA 3VSVA 4YHML 4RMTA 1G6RB 3P3SA 1HWWA 4FEMA 3E1F1 4LSVH 4W1TA 4KQ3L 2R2CA 3T2QA 4NQEA 1YSOA 4JMXA 5IWLA 3L48A 4M5ZL 1BLIA 2DD8L 3BKCH 4KUCD 4PJGB 4UV7L 5BCAA 3MV9A 5EG6C 5HI4D 1PKQE 4H26B 3QS3A 4UU9B 4ZUUA 4WUUA 3UP6A 2IADA 3T2NL 2MTAA 3MLWH 1N4XH 2AK1L 4MXQC 4TSAH 3KXFB 4PJIB 4MWFB 1SJXA 4J8RA 3UTZB 5AG8A 1C16A 3K8MA 4P07A 3LKOB 2FGWL 5KZCB 2FD6H 4XGZB 4QLWA 3WFBH 4K4KA 3UO1H 43C9A 4K55A 4TS6A 4XN7A 3WEBA 3DXAD 4A7GA 5AFAA 3EFDH 3LKSB 5J6HB 3WFCH 2VXUH 2X2YA 5CIPA 2VDOH 5FUZH 5JW5A 3OMNB 2R27A 4CA4A 5DMIH 1DQMH 2BX5A 1BFTA 4F58H 5HYSG 3K5SA 5L4MA 2FWLB 3PGCA 3DRTA 3B2UD 3NCYS 3PP4L 2FO8A 5I1JH 3BHBA 1JK9A 4XCNA 5J3HC 4PW9A 2YC1B 3BVDB 1BZ9A 1QRNB 3F00A 4G9DB 2CDGA 4GNKB 1TTAA 1RZFH 1XO8A 3TNNA 4U3SA 3QZWG 4A6YH 3QIBD 3ALPA 2QHRL 3MJGX 4CC4C 3VXNB 4FG4A 1MCRA 3C60B 3MLUL 2WPGA 3ME0A 1DQJA 4FTVD 3REVB 1E6OH 1QBLL 1XMEB 2F6AA 3AABA 3G04B 3INUL 4GRLD 3D3VA 3LHPL 4OZFB 5IVXF 3KPSB 3U9PL 1U95A 3H2PA 2N7BA 4IKNA 5AB9A 2X4OB 4BFFA 4G7YH 5AVYB 5HDQL 3LH9A 4OQTL 4JN1L 1FI8C 2NPLX 4TF4A 4AG4H 4F7TB 5KUMA 3L2NA 2OX5B 3O2WH 3BZEA 1GZHA 5EEVA 1UA6L 1GVIA 2ZUUA 3S8GB 1UOLA 5FM8A 3D33A 2DQDH 1WFOA 2CR3A 3WN5C 1CQKA 2G4EA 1OT4A 5FYLH 1EAPA 3ZW3A 2R15A 1OO2A 4ACPA 2AF2A 1L0XA 3BWZA 3DBXB 1UTDA 4S0HA 3FQUA 2BNQD 3BD5A 3QNYA 5KANG 3U4AA 3UL4A 9CGTA 1MF2L 1T66C 2XXMB 1UOVA 2IG2L 3LMJL 3FNKA 5A2FA 2EIDA 1R5WA 2DLFL 1X5XA 3DXAA 3FTSA 1KLGA 2YR3A 4A7VA 4AVJA 1BBDH 3CZFA 4PB9H 4HJJL 1N6QH 1ZHBB 5E5LA 2WUBH 3QJFA 5E23A 3FT9A 1CZ8H 4OAWB 3TBVB 1QNZH 2YPVH 4MMZA 1S7SA 3F65A 2QQKH 1ES0A 3FSZA 3UROR 4PR5B 3FRPG 2VW6A 1ULVA 3C75A 5TQ2H 1P53A 2NY1D 3LDBC 3VW3H 3MRKB 5EN2B 3NAAL 5K1VA 2EIZA 5CUSL 4NIKB 3MBEB 3B5GA 1MCCA 1TEFA 1T0MB 3DDGA 2NXZB 2E7CA 4JZOB 4U6XB 4GQZA 1SOKA 4RSYA 1A4BA 3GSVB 4FTDA 3QIBA 1NCDH 4LIQH 3E6FA 2WB1A 4W9LC 4KK6C 2R59A 3NZHL 3T2OA 3ZE1B 2XG5B 2UZXA 2VMJA 3BT0A 4L8SA 4FTVA 3FN0H 1MDAA 3P77A 5IB4B 4LPUA 4R26L 1T7YA 4X0KA 3GRWA 2AITA 3D69A 3V79C 4FXGA 1JGLL 1I8LC 2IVFC 3VTMA 4EBQL 3KPPA 4NQSA 1E27A 3ARWA 4NQCB 4TNEA 1I7TB 2JKRM 2CIKA 3KR3L 4QGYA 1TMCB 1B2WH 1C8PA 1KIRB 4H8WC 5E6ID 1KN2H 2XPYA 2EP6A 3HG3A 1S7XB 2ZTBA 1UD5A 1P4IL 5CJ8A 4PJXE 3SDDC 2QSQA 1NCOA 3HMXL 5DVOA 3SDDB 1WTLA 2ID5A 4HUUA 4OGZA 4UNTA 2JLPA 4X6DB 1CFQA 3FZUD 1LO2L 1AD0A 2XY1A 4JBSA 1XQ4A 4XNUH 3NRQA 1ZPLA 2X4RB 3WLWD 1DUYA 1FL6A 3UTSB 4J3VA 4XCFH 2IALB 4WW2A 4KHTL 3RWFA 3WJJC 3ZJAA 3LNGA 3H4FA 3LQAC 4JAMA 5BZWB 2BNQA 2CO1A 3D0LB 5EU4A 4J6RH 1Q94A 1LO4H 4BE6A 2O5NA 4ZMVA 1DBBL 3CVHA 5HHME 4ODTL 3UTTA 4HQQL 2AVGA 3VFNA 5LNGA 1RY7B 1JV2B 3IU3A 4G7VL 5E2UL 1ND0B 5FYJE 2E47A 2QADD 3NPZB 4AQAA 1BSIA 3ULSB 4FA7B 4G9FA 1GJWA 3TGXA 1FV1A 4YX2L 1NWPA 3ROOB 1Q4NX 1D9KD 3UOAB 2JQAA 4A04A 1VHPA 2NZ9C 1M1XB 3IVKB 1BHGA 4PSRA 5FA3B 5GJTH 4Z18A 1YNLL 1LP9A 3PFQA 4CU6A 2OTWB 5DSCA 4WJ5A 3IXTA 1C1EL 3E7JA 4M6NL 4U1LB 3RWJA 1Z5YD 3VSTA 4BIKA 5KVGL 3CN3A 4MB3A 3U36A 3GBLA 1CL7I 3G5ZA 2P5PA 4OCYH 5FUOH 2P7TA 2FX7L 4I5BB 4ZRGA 3AU1B 1VZHA 1XR8B 1YEFL 1YMHB 2NY2D 2IMMA 3RI5F 1MQ8A 4PJ9A 2VXTL 2B1HL 2K6WA 3A4AA 3IJ9A 2D2OA 5IG7B 4HT1H 4PU2A 1O5DT 1IC5H 1DQTA 1P0SE 4XPFL 4OZGB 1HVXA 2V2XA 4WHDA 2BPBA 3F7YB 4UM8B 1WCBB 3OWEA 1KBGL 1VRSA 3KYKH 1F58L 4NO0D 2BFVL 2Y2TA 4LNRB 5DURB 1R5VA 5T1LD 1H3UA 3D0VB 5KG9B 1XSOA 4HBCH 5EH1A 3S35X 5E6IA 3RU8H 1BQHA 4LLVA 1T1YB 5HHPB 1QLFB 3NIGF 4WJKB 1CTOA 1U6AL 1GC1L 3QQXA 4M4RA 3V4VB 2R4SH 2ZKHL 4M61B 2J20A 4GKSB 3ULUF 2QQLL 4MD5A 4WENB 3US9A 4DN3L 3ORJA 5D1XC 4JQVC 1RZJC 3DYMA 3QQNA 4XPTL 2YSSA 4NJ9L 3EJZC 1XF5B 2EDQA 4JRYA 4XXCA 3HA0A 1HE7A 1L0YA 2P49B 4APQC 2YKLH 3OKLB 2YOAA 2I26N 4LPTA 4HH9B 4CADA 4BQ9A 5E5RB 3T8MA 4PJHA 4OFYA 1OPGL 2XWXA 5KSAD 1MCQA 2DWDA 3BFWA 2VXQL 4P57A 1E4JA 4QRSA 1A65A 1JFQL 1LO0L 3R4DA 1VGEH 2CNYA 2X0VA 4YVNA 2DLEA 3BDYH 3LKQB 3BGAA 3RYMA 5GRXG 1RUKH 4PB0H 4Z7NB 5ALCL 1C7SA 1Z3RA 4BEIA 4ADIA 3QUML 3T3PE 5AVUB 4D9QE 5BV7H 2GY7B 3IKKA 4E68A 2F18A 5FR3A 1KCUH 3FUNA 3X1GA 3IFNH 2AMUA 3I50L 4NKDB 4YXLL 3ZXAC 3W39A 3TJEH 5IFAH 5IJCC 1QA9A 3NTCL 2ICES 3CVDA 4DK3A 1JXFA 1BGXL 3BWUC 5AKRA 4U6VH 3U2IA 1J1XH 3HG2A 2IANB 1NGPL 4OZHA 4GKZA 1XCQB 25C8H 3MJ7B 3TJHD 2EEXA 1LDSA 2WN2A 5D7IE 2FL5A 3PWJA 3VI3F 4M7ZC 3R18A 5ICZA 1EIBA 5JOPE 2E0PA 3D9AH 1EHLH 5CSZA 4ZG1A 3EYQD 4QHUB 1FH5L 2Y0SA 1DVTA 1FL3A 1OHZA 3OAYH 3UBXG 4N2MA 3JV5A 2EC9T 1LEIA 4PRPD 3ZKMD 4KV5F 1S9WA 2NTFB 5AZ2L 5F7MC 2ADFL 3O8XA 1CU4L 4F24A 4PJGE 5F7EL 5LXGH 1M6OB 2BNUB 2W0KA 3RWGA 3C5JB 4BXSV 1I8AA 3R8BB 3SIKA 1UKQA 4Z7UF 4O4YH 4TPRH 1E30A 5JUEL 3QCVL 2FAUA 4QRPB 3FAXA 4A68A 1IU1A 3HNTL 5IB1A 4D8OA 1NCAH 3WMSA 4P5RA 3BSZA 1IRAY 4NDMA 5FV2A 3UMNA 1G0XA 1I3RA 2ZWNA 4C56D 2E8ZA 1DJSA 5KYWB 3FB5A 2GJZA 3DO7B 2JKLA 3FB6B 4UOZA 2AEQH 4NKIH 1NDGB 2J56A 4WW1B 2QT6A 1Q72L 3ZE2F 3OGOE 2A6JB 5I1LB 5KVFH 1X7QA 2Q76A 4X5RA 1IBBA 2E7HA 2XZCH 4UQCA 1YEGL 2O5ZH 3W1ZA 3VXRB 4XMLH 5E94B 2ZF8A 1ERNA 4JO4L 4LSQL 4NKQB 2ED6A 1CFVH 3HE7C 5T33H 4PRAA 5C9JA 3HE7B 5EU6D 2HWZH 2J6EL 2EH7L 3MJ9A 1IGIH 4DQOH 2BZCA 1U8LA 2PYFA 3O2DH 1ZT1B 4KVCL 5DGQA 3ZPDA 5CSGA 4X7CC 5D2LB 4PY8I 4UV4H 1N70A 4XP9H 5EA0H 3FT1A 4ZUVB 4NPYB 2DQJH 2OL3L 4IU3B 2WINB 3RGBA 4MRCA 2VC2L 1AD9A 3AXHA 3KPSE 1TO4A 4HVBA 3OZ9L 4UILL 2IBGA 5CLTA 1BD2D 5I1CL 2ICWA 5C2BL 1OF0A 3FL7A 4Y5VA 3VQMA 1DVFD 1N3NA 2EKSB 4G8EB 1BPLB 1J1OH 5D1QD 1MLCA 2LABA 1ORSA 1DLFL 3AWFA 3LNDA 4MDIB 4QRAA 4BRJA 1R3KA 3V52L 1AGFB 3VFOB 4N8PA 3FT3A 2L7EA 3S8WA 4URTB 2LHAA 2UUDH 3QDAA 3UABA 4U6YB 4LCYB 3D85D 4JJ5B 7FABL 3AS3A 3GZPA 5HJ3B 4AWJC 1DO6A 5C0DB 4WFHE 3ULVH 3DO3A 1S5HA 3L13A 1U58B 2X2IA 2ZOKA 1SM3H 5DHYA 3KLAA 4RX4A 3VA6A 3TA3C 4UM9B 3N85L 5IW6A 4YJZL 4RH4A 4TNGA 2HYMA 3PWUB 3U9UA 1K8IA 5CJXA 1HAWA 1I7ZB 3HKZA 4FQHA 4M48L 5AW7B 4OV5A 1KCVH 2Y07H 4FQXC 1CGXA 1F4HA 2OJEB 2Y6SD 5C9KA 3P30L 1M71B 3AROA 2K6ZA 4C56A 1UA7A 1QLRA 5CCGE 1N12A 5AUMA 4OIBA 5LDSA 2EE2A 1Q9KA 4LCCA 2FECL 5FAAA 3UYRH 4MGXA 5BVJA 3HZVB 3TX4A 2BP0B 4ZO8A 2E7LA 2AC0A 1IKFH 4F2MB 4HUXB 1A6AA 1IT9L 1AZNA 1D3CA 5BVPH 1CCZA 1E28B 1UD2A 5EU7C 2C1OB 4PGEB 4KTEH 3FQTA 5LDUA 1GYUA 1QFWI 3ZZQA 5EU6A 4N2EA 2X89D 4XNYH 3L6FA 3JZYA 1MIML 1HHJB 2DLTA 2ZXQA 1KBVA 2JXMA 4ZFGH 4XE5B 1J9TA 3BKCL 3QR1A 1QR4A 4JFOB 4QWWC 4WTXA 1D5MA 1UA3A 1AHMA 3I9GL 1W0VA 1KXTA 5KSBE 1JHLL 2EDXA 1CXFA 2XBTA 2VXSL 3ZE1E 1IEBB 2I9LB 4KI5D 5AOZA 3QXAA 4E41E 1OAKL 1UWXH 4TSAL 3RL2B 4LASH 1MWOA 3LRKA 1OM3H 2X4PA 3H2WA 3GMRB 3ARPA 1CLYH 1HHGA 3QORC 4L3AA 2FD6L 3MXVL 4NO2A 4NQCE 3U1PA 3QORB 3WFBL 4Z7AA 2HFEB 8FABA 1CVSC 4E0RB 4YBLB 2VXUL 1GYCA 1SXAA 3KXFD 2Z64C 1LGVA 3GS4A 2HT4C 4MXQD 5EOTA 4KH9A 4ZX5A 4FA8A 3L3GB 2V5MA 2G4GA 1DVFA 4F7EB 1N19A 2B4CH 4XN5A 3UJJL 2PP9A 2W07B 3DURB 1DQML 3CE1A 3FQYA 1GPOH 3NQKA 4PRIE 5DMIL 1HL4A 5IQ7H 1DQDH 2LT9A 3H7BB 3U2SA 3GPEA 4EUPG 3L5WA 1RERA 1JUFA 4BA0A 1CDUA 1GMEA 3D85A 2OCCB 4AM0A 4JFDD 1AGCB 5ICYA 1T4KB 4HHAA 5IEHA 2BCKA 1KZQA 4G5ZH 1AHWA 3ZRFC 4I77L 2XBZA 4GI9A 1IQDA 4JJOA 4A6YL 1HHHB 2P24B 1R33A 4YXKL 3ZK0A 3Q2VA 2FJFB 5BUAA 4HZLA 5J3HD 1YEWA 1QRND 1ACXA 2JMRA 3F05A 4OGXH 3S5LG 3MV7B 3TT1L 1E6OL 5B3NA 4MJ6B 5I1IL 1AACA 4HV8A 3QJXA 4CDGC 3DTDA 4N28A 5GRYA 3QXVA 3FQXA 1ILSA 5F3BB 1FNEB 4G7YL 4U1MB 3T3MB 1CTNA 3U25A 3FO1B 4M93B 2WO2B 2B14A 1A6UL 4Y4HC 4K2UH 1SYSA 3CFJB 5FM5O 2X89A 3SYOA 4JNXA 5I0XA 1JZEA 3PGDA 4LOFA 1G94A 3ZDXB 3BH8A 1CLVA 4GKNB 1I8KA 1G7HB 1WS7A 3HHMA 3SBWC 3KWVA 4GUQA 2VLLB 1UASA 2L7JA 4GW1A 1OEZW 3VRJB 4HU2A 1SJEB 1KTLB 3OD3A 3P9LA 3RFZC 3RFZB 5HHOE 4ZNCD 4FKKA 4OZGE 5TTRA 2RD0A 3N0PB 5E0QA 1AXSB 4GS7C 5CM1A 5ERWA 3SE8L 5F6HJ 5JOEA 5IHWA 2GC4C 4R7NA 2QZQA 2X2HA 3TO4C 1KEML 3TO4B 3CFBB 3BPNC 4FP8L 2ADIA 2WLKA 4Y1TA 5K9OA 4FQCL 4XAWH 4ZFZB 2B15A 4NCC2 1QWNA 3MBWB 2IPTH 1T66D 4K3JL 2QQKL 5LBSH 3WJMB 2VDQL 5K9QI 4BXVA 2YQ3A 4G3YH 3NH7H 4EIGB 4Z8FH 1MI5D 1FZJB 1RUPH 1ILUA 3P02A 5IBLC 3WJLA 5BXFB 3VCLB 1GIGH 1A4JB 1F4AA 2ZCLH 4JFDA 5DVKA 4AE0A 3KDMA 3SKMB 3WYRA 4XNQB 5T3ZD 1IL1B 4UQEA 4CU8A 1V5JA 1J0IA 5ANME 4ZUSB 2EE0A 5M95B 5DS2A 1JMXA 1NCDL 2IDQA 1VSCA 1RV6X 3P2DA 1ZLSH 5HGAB 3MNZA 2VRQA 3GJEB 3MBED 5D4HA 1FRGH 1PF3A 4YDMA 1I1AA 2DL2A 5I2IA 1KOAA 4UI2A 5FO2A 5I16B 3SCMC 1RQ5A 2BIOA 4LSUH 3IRZA 2EVFA 4KK6D 4Z7NE 2RB8A 1B2WL 3MLSH 3O4LE 2XACC 4EN2A 4UOJA 4A39A 4XX5A 5C0JB 3FH8A 4L4TA 3QJSB 3FU7A 1FFPB 1GGCH 1KZYA 2AJXH 4LHUB 5E9DD 1B88A 4NM4H 3QXDB 1X4YA 2VDKH 2BSDA 4X6CA 3K4DA 3NYKA 2MSPA 4XNUL 2P5WB 1WBYB 2Q5BA 3HHRB 5EOCH 4XCFL 1I1YB 2IANE 1MJ7H 3SDDD 3G5YB 4HX1A 5E6ZA 1AR2A 3GXNA 5D2NE 2F54D 5CLYA 3DUHA 2BRRL 4J6RL 1LO4L 1B9ZA 5JHLH 4MHHI 3V0WH 1OTTC 3WN5A 3HR6A 3UTSD 1RZKC 3OHXC 4PG9A 3TFKC 3EO1A 3OHXB 2G0LA 3LZQA 4IK7A 4MNQA 2BSCA 4H1LG 5DFTA 3PWNB 2FGZA 4XNBA 1PEZA 1EK3A 1RIHL 2YMTA 3E8UL 4XC3H 4OCWL 4AYDC 3MFGB 3AGWA 2X3CA 5C7XH 1MI5A 2ZZUT 2N56A 5HYEA 1OSPH 4QYOA 2AXFB 2RQEA 3TBVA 1NUNB 2DICA 3NJXA 2OI9C 1Z32X 5DMGC 3RE0A 3RLSA 3RPIB 2OI9B 2G9HA 2JKWA 5FUOL 2FSEA 4IDJL 4GUOA 3QUZB 5DFVC 1YN7B 2YRBA 1I31A 2DMKA 3UPAA 3ZO0A 3Q8AA 3AJ7A 1ETZB 4U6HA 1KYOK 4KNQA 2WD0A 2BOBB 2OMUA 3UZVA 1JZGA 1IC5L 4DUVA 1Y6MR 4XVSH 3A6BH 4O02B 4IBUA 3HCVA 3S34H 2JI2A 3KYKL 3AGVA 3MV8D 3TO2B 1VEPA 3FFCA 1JK8B 3QDJD 2V5SA 2N7SA 1SY6L 3IBOA 5BZZA 3CZLA 1WUZA 1AIFB 3L3KB 3OXSA 4JDVB 2P8MA 2VISA 1JAEA 3ARGA 2D7NA 4MFHA 3H9SB 3RU8L 3BP5A 1SOQA 5AW0B 3EHBB 1A1NB 4WTZA 5EORL 4NEHB 3UADA 4FZ8L 3SY6A 3AQXA 1FPTH 4U3XA 5E9DA 1HWGB 2BP3A 2W0FB 4ANXA 3F7VB 2R4SL 1LK3H 3OAYK 1WJ3A 1EXUA 2J12B 4U3HA 5AL0A 1JI2A 3GBNH 3G6JB 4XN9A 5DD1L 3SDDA 2FBJL 2Z4TA 3UCRA 2B7DT 3NZSA 1QEXA 4GYBA 2F54A 3BVUA 1O7SA 5TD4A 3D51A 3FO9B 1KWKA 2J88H 3UTSA 2OMNA 2NX5B 2I25N 3JTSA 5B39G 4DW2H 5F0PB 1PLAA 1LHZA 2PYEB 2X2UA 4YR6A 4P4KA 1IGFL 2G3XA 5D1XD 1QKZH 5J11B 1O6TA 3HI1B 3LN9A 3VXTB 3CFEB 4ZNEE 5T3XD 1RPUA 5DQ9B 2FJGA 1JXDA 3EJZD 1KYOJ 4M7JH 4DFIA 4NIYE 1AGBA 4DESA 4W6YB 2EYRA 5M94B 3QFJA 2BNRB 1RZGB 3I02A 3TVMC 5E9AA 1BW8A 3TVMB 3QK0A 1CBVH 3S7GA 4YFLI 5FO8B 32C2B 5E0FA 4P5MA 4W9EC 5DR5L 1ZV2A 3R1GH 1KCUL 3BIKA 5DTFB 2WQ8A 4IRJA 4O2FB 1MVUB 2W0PA 5DXWA 2XWJB 5JIMA 5IM7B 5TJWK 3U79A 3GXPA 5CD5C 3WAJA 1J8HD 4F7KA 3W9EA 4BZ2A 1J1XL 4YVUA 3SDYL 3T0BA 5EF3A 2QVIA 3KYAA 2LV4A 1EHLL 2DLIA 3I6GA 3D9AL 4CN1A 3CVIL 4YBHA 2FQGA 3MV8A 3UZQB 1RHFA 1E4HA 1W16A 3QDJA 4L8DB 1INEH 1NFDE 1JF1A 3QW9A 1OB0A 2ATPA 5GGSB 4R4BA 2MQ3A 2YRLA 4XWGH 4ZW3A 2H2PC 1RZ7H 3F7YA 2DQMA 3QCUH 4PTTB 3UP1A 4JKWA 4XP6L 3ZL4H 1JWMB 4B9FA 2Y06L 4MJ2A 3C87A 4K23H 3WIIH 1M7DB 3F7QA 5HYIA 2HN7A 1NLDH 3B3IB 4L9DA 4P4RA 5IBUB 3O4OC 1J5CA 4XVUC 4V1DB 5EBLB 3IMBA 1NC4B 2HXAA 3O4OB 3FU9A 3NRFA 4Z7UA 2PWHA 5TE6H 2OR9L 3FYIB 3ARFB 1YPZE 1XGPB 2A6DA 1SN2A 4AL8C 1JGDB 2Y7QA 4LLUA 1CGUA 1NCAL 1F13A 1U3HA 1FG9C 2UUDK 3OJVC 4R97C 5ICXB 4UCFA 2RHEA 1CF8L 1H9DA 2E59A 4QRPD 1XF2A 3F6LA 1NGYB 3Q1EA 4H0IA 5IQ9B 1BMWA 1AZRA 1E4XH 2ZKMX 5D1XA 3EDKA 4JQVA 4FXKA 4ZO9A 4C4UA 4L2YA 2CO6A 4ZUTA 1LEKA 5L9DH 3V4PL 1JZ2A 1VJSA 5AWNH 4DIXA 4JFQA 3PHQA 4W6XB 1OE3A 2P45B 3CH1A 3X3FH 4APQA 3QCTL 2CHDA 3ZRCC 1RHHA 3WTXA 4GMTH 4KK9C 1YA5A 3DX3A 5BO1H 4KTDH 2QEJA 1EEUA 1UFUA 4X7FC 2H6PA 2HWZL 1I4FB 4DERA 3DVFA 1X6NA 4PRHB 2OZ4L 4JPWL 2HX8A 2HRPL 2DLHA 1T5WB 1RJYB 1TJXA 1ZHKA 1ZK9A 3O2DL 3VXRD 4ESKA 4HIJA 3IMSA 2Y3AA 1M3JA 5DRWA 3GHBH 3C6LC 4BSVA 4MXVE 1S78C 1USZA 2BIMA 3C6LB 3HE7D 1M7IB 4ANKA 1K4DA 1J8HA 2H3NB 3KGSA 4XP9L 4GG6B 1B3IA 1E4WL 3MV7E 3C8KA 4RRPM 4NQXB 1EVUA 1GHFL 1KNOA 1PZ5B 1JZIA 3PF2A 3T3ME 4TLUA 4YO0B 3RNQA 1UM6L 4NQDE 5EEWA 1UWXK 3ZL1A 4HWZB 7PAZA 2GKIA 3PNRB 1DFXA 3V9EA 3ZDXE 2ZCKH 2DTMH 4JPIA 4YL9A 4YHYB 4BGDA 1AQMA 2VLRB 4HIEB 3GMMB 3ULVL 3IGKA 2APWA 4LL1A 2J21A 2O4EA 5INCB 3Q43A 3S48A 1U8IB 1UJTA 4WRLA 1UB5A 2BIHA 1HSBA 5I6KA 5IGXL 2CGZA 1VFAB 1NL0H 2K4AA 4NRYB 4XMVA 3DX7B 2VO5A 3Q06A 1EMTL 4F7MB 1TOXA 3RZCC 3GDBA 3O41A 3CIAA 3RZCB 4UM9D 5GJSL 1T80A 4FHKA 5E8OA 2PUQT 3TA3D 4YSEA 3NBNA 4H7VA 1N5AB 4FQXD 4NCC1 5J1SC 2D73A 3C2AL 1I7UA 1KPRA 1HXMA 3NEOA 4F15C 3E38A 3V6OA 1MY5A 1MHPH 2JKIS 2WXGA 4MAZA 5IMMB 2BVQA 1J87A 3S37X 1CWVA 1BEYH 1ZTMA 4DGIL 1UXMA 1OQOA 4LE8A 3GZQA 3IJEB 5C0CA 5JLZA 2HRLA 2LU5A 2JKXA 3D18B 3HLAB 4MYPA 1KGWA 2YGOA 1KLFB 1WZMA 1J9SA 3QG6A 3BE1H 1YHPA 3V95A 1A6WL 2C9XA 3SKNA 3RNKB 1EX0A 1A4KA 4M8QB 4QWWD 2Q8AL 3UC0L 3VVWA 3Q6FA 3HJEA 3BX7C 4JM2C 1NIAA 4NQEE 5DLML 3MMEB 3BJLA 3MCKB 5FCUL 1YMMB 3MOQA 5E8NA 5ALBL 2XJKA 3MV9E 2NZ1A 2W81C 4Z77B 2B4CL 3VFPA 3F62A 3QORD 1GPOL 3WAKA 1DQDL 3QEUA 2OZNA 3AQDA 3RX8A 4N0FB 4ABQA 2HT4D 3CVCA 1FVCA 1TUPA 4TVPL 3N1PC 5JW4R 3QDHA 4PREB 5TGBB 1AO7B 3EJQA 2B3IA 1WIOA 5EUOF 1THAA 5E7BA 5HY9A 1UACL 4DF9A 1OZUA 4JREC 4W4NA 4MA1C 1LYQA 2V5RA 4JREB 1A1OA 1B6UA 1ONQB 4GRMB 4DK6A 1EXGA 2XOTA 4N1EA 2UXVA 4QHLB 5HI3C 4N6RB 3MA7B 5B38G 1NFIB 3FQRA 1JFHA 1MG3C 4Z76A 4FXTA 4M1DH 1SYVB 2E9WA 1ZVHA 3UGUA 3TA3A 3VGDA 1MW2A 5DA0B 5DQJB 5LXVA 1XTLA 4GAJL 4K3EH 5TQ0H 2HTLC 3MBXH 4FQXA 3VH8A 3QPQC 4HCRA 4ODUB 2J1KA 4QOKB 3BPOC 1PVHA 2DYPD 4YC2C 4YC2B 4PGJA 1FIEA 2IWFA 4AEHH 1D5ZA 1VF5C 4K2UL 2B3RA 5EIQA 2IFFL 5I73C 4XPBH 1NEUA 1KN4H 1MHCB 5I73B 5FW7A 4F2MA 2J1ZA 1NBCA 3TT3H 1HS6A 1YEJH 1FBIL 1T7WA 4AYSA 5AYQA 1N0LB 1YUHB 1THCA 1RPKA 1A3LH 3S36X 4Y4HD 2X4QB 4ZBJA 1G9NH 1LMIA 4ONGH 3D48R 1B4LA 4HBQA 4L1DA 4RIRA 3SZ6A 5FECB 5JZ7C 3LNFA 4QF1B 3QEHB 4MYWB 3EAKA 4U1KB 4KAQL 4CC1A 4UT6L 5FCSH 2QMKA 3L2LA 1FO0H 2J1XA 3FKUS 4UTCA 5ETUB 1IEBA 1LE5B 2ENPA 4RMVA 3HZMA 5IIEA 1MRFH 1EO8H 1XGTA 4IEFB 3KPQB 3KVDD 1D5XA 4CSTA 1WFNA 5HXMA 4I1NB 5LBSL 2W9LA 5G2NA 3MOAL 4YHZH 3TO4D 4G3YL 3NH7L 5E99H 2NXYC 4PV1C 1AP2B 3AWGA 3TN0C 4X9GA 2C9PA 3OKKB 4PPTA 5H37G 4BCZA 3NZ8A 5ID1A 1L9RA 5ITFA 4IHOA 4LBAA 4FCAA 1QSFA 4CN6A 4DOHE 2IH8A 2BOCA 2WWKO 5JHMA 2WK2A 5IHBA 4JRFA 5BOJA 4PJDF 5I74B 1JPFB 5GXBB 2NX5E 5JPNA 5IBLD 2DQHH 2X9XA 4PRBB 2ZUQC 4W93A 1FIGH 2ZUQB 3L3OB 2ADGB 2WCGA 2KUTA 4UQ3A 1B4JH 2PR9A 3D4CA 1SDYA 1HHHA 1MCDA 3KPMA 3VRLE 2P24A 2DYPA 5IMKA 3HPJB 3AREC 4XB7A 1FNSH 3S4SA 5ESAA 5BMFH 1K6QH 2A9BA 1KB3A 1KPVB 1ZT7A 3VXPA 2VL5A 3SCMD 3RB5A 2JSFA 2R29A 3BAWA 5I6NA 2HVBA 5KEZA 3UBHA 4NPJA 4Y4HA 2IAMC 4DN4L 3TURA 3TPUA 2BO0A 2IAMB 3JWDL 4N2NA 4PGCB 1UUNA 1QFPA 3RUGE 2L7UA 4LHUD 3MRCB 1DBJL 5JHLL 3VAEA 3BKYL 5GRZA 5GGUB 2DM4A 2P5WD 4BINA 1MUJB 5CJQL 5JIHA 1F4XL 3T6QC 1G7JA 1ZEAH 3HZKA 1IGYB 3LH2H 3H9ZA 3ULVF 3GMNB 2ZXWB 3OKOB 4KY1H 3SB3A 4J23A 4LPXA 2DI9A 2KDYA 5GISH 5CP7A 2RCSL 1OGPA 4FNSA 1A2YB 1OTTD 4JDEB 4XMZA 3SPIA 1QASA 2DQUH 1HEJC 3FTGB 3NSXA 3Q01A 3TFKD 3ASNB 3VWKB 4YDJA 2GJJA 5EO1B 4MCNA 3ILPA 5C7XL 3BESR 1KPUB 2AJSH 3DROA 4LRIC 1KMGA 3RWIA 1BZOA 1QSVA 2XI9A 3KLLA 1A6VH 3UTTE 4TULH 4V1DE 1GS8A 3ZTCC 3H8NA 3QEGH 3VD0A 4W9JC 5D7SL 2QDVA 4G9FE 2GUYA 2EUWA 4HIXL 3SE3A 3HE6B 1FZJA 2FNWA 4FFWC 1GGBH 3VCLA 2D0HA 1WZLA 3DVNA 3FOMA 1BYNA 2VR3A 5DMGD 4PJ7A 1FZMB 3FCSA 5IVXB 2Z1PA 5DFVD 4XVSL 3A6BL 3Q7JA 4L3ED 3S34L 1G7PA 4ZUSA 2JB6B 4OJFH 1ZWIA 3AAZB 3P1VA 3SQBB 2ROYA 3OC8A 4MD0A 3QDGD 4OJCA 5L7XH 3WO4B 2EDLA 2VR7A 4XOAA 1P4LB 3I75B 1RPQA 2OR8A 2WBXA 5ACLA 3DJZA 3MGOA 1N2RA 3NA4A 3SCMA 5JR1L 1ZLUH 3IYLW 1GS6X 2ZCHH 1QTYT 1RP8A 4KNUA 1BVNT 1CFNA 4AYBA 3GSXB 4JFTA 3H9SD 3B56A 1LK3L 3AADB 4AEIL 2FDBP 4AIZB 2K78A 4POZD 4DNLA 1JF6A 4GG6E 3D25B 3BQUA 3W9DB 4ORGB 2H5UA 2AANA 2ZWKA 5HDWA 2AQRA 1Q0XH 4JFZH 3INOA 4ETQA 2J88L 1XT5A 1FAKT 5IJVA 5C92A 3EF4A 5J7CC 4JDTL 4D3CH 5L0QC 4M29A 5DRNA 4DW2L 1CIDA 1F18A 3LRHA 3VGFA 5DHVA 3IAQA 3WNMA 3PDDA 1KC5H 3LRSA 2CKBA 4WF7A 4M7JL 4KKPA 2P44B 2VWEE 2F1AA 3A3YB 3EJTA 1N10A 2PYED 1AKPA 4G71B 2XWBA 4EUPH 2IQ9H 4QHMA 1CFSA 4JRYE 1INDH 4WI9A 3TEUA 3EBAA 1KY6A 2L04A 1XR9B 4Y19B 5JTWA 1YJDC 5HI5C 2YFNA 2BNRD 1KB5H 1J48A 4PCKA 4PJHE 3UBGA 2FH6A 3TVMD 1KJ2B 3NCMA 1KJMB 3AG3B 5E56A 3GXIA 2P48B 3KH3A 5JIIA 3FPYA 2B9AA 4FQLL 2H3XC 3B1TA 1UHVA 2MOGA 3QULA 2B5IC 3UAJA 2VMDA 4MS6A 3WFHA 5CZKA 2B5IB 2FHBA 3EFOA 3QO1B 1QVOB 4L3EA 3DTXB 2GK0A 1SEBB 2AQ3A 5CD5D 1URZA 2DIBA 2SEBB 3P0YL 1U8PB 2A74A 1INEL 1OQXA 1ROWA 3BXNA 4XP1L 4ES9A 1JN6B 3QDGA 3GTVA 4DVBA 3EF7A 1HDMA 3N44B 3IFPB 5BW7C 5KVEH 4WU5A 2MTPA 3KW7A 4OZHE 3K81A 1MN4A 4OVUA 1EHAA 1A1MB 2VE6A 3DV4B 4QT5B 2WXJA 1P2CB 4ODWB 4NKMA 1DYZA 5HYFA 4HLJA 3T9WA 2H2PD 4PP2B 1DEDA 4G43B 4PLNC 3AFLA 3ARYA 3WE6A 4P5TC 1I1FB 4I0KA 4P5TB 3W2DH 2YRZA 3RGVA 1FFRA 2YPVA 3UZEC 2W0FA 2EIKB 2HJLA 5EU5B 5ILTL 1DQIA 2EADA 4P49A 1W2KT 2DQGH 2PTTA 3U83A 1NC4D 2FEJA 1NUFA 1LO5B 1YMME 4K94L 3ARFD 3B3BA 1E4XL 3PUCA 1XCWA 4WDIB 1BECA 1ORQA 2VO8A 4PHZA 3RTLA 4K7PL 3TL5A 3C5SB 4D9RD 5L9DL 3UC2A 4TL5A 1CE1H 3OX8A 4GSQA 2XN9B 4MMYA 1WD8A 3KBEA 2VJ0A 1R24B 2I32A 5E2JA 3I2CH 4GRWH 3GLAA 3KYOA 2IO5A 5F96H 3FF7A 4X98A 4ELMB 4X80H 5JMRA 3OR6A 2R1WB 4FFYH 4TN9A 3PRZA 5LCVA 3LSOA 2FO1A 1NGQL 4FQIL 1QBML 1B0GB 3IE4A 4NNPL 5EN3A 4KK9D 1GYVA 4LQFH 3WHXA 3DVGB 3VFRB 3H1ZA 2G60H 3DK2A 3PLYA 3O3BA 4PRHD 1B4RA 2WV3A 2PCPB 2ADYA 5I18H 4LKCA 7PCYA 3JTTB 4QY8A 1BQ5A 4GSDH 4N2DA 4WNJA 4XNDA 4AK2A 1MCLA 3C6LD 1KJVB 1S78D 2Y1ZA 2XVLA 2CU9A 5TDOA 1PW3A 1F11A 1VACA 1X44A 2L7QA 3QRFM 1QW8A 3EH3B 1XZ0B 5DJXB 1JXGA 6CGTA 5KSUA 3PWLB 4FD0A 1SBSH 3P0GB 2QPUA 2DTML 3PABA 1A7BA 1V7ML 4Z7WA 4AJWA 4ZUWB 4WV1A 1MNNA 1KXQA 2I7OA 4HGWA 5GRUH 5JO5A 5KS9B 7CGTA 4K9EH 1U9KA 2BSRA 3LPGA 4XC1L 4YXHL 1A7OH 3WTWA 2VXVH 2HFFB 3FOLB 1E8ZA 4XPHH 2BZDA 2N01B 2VLRD 4Y16B 3VGGA 1BQSA 3UYOD 3CIQA 1SOSA 2YUVA 4J8QA 1A02N 1OOWA 1U8JB 4CILA 2O93L 2UWEB 1AZZC 1BQHG 3VFSA 4HYTB 1JCVA 4HF5L 2ISDA 1X5IA 2KT6A 1C12B 1XH0A 1WAAF 4UNIA 5FDWB 4H1LH 4RDQF 4LCIH 1JWUB 5SX4H 1HSAB 2NY5H 3RZCD 2CGRL 2YA2A 4Z0XA 4JFYB 4OJAA 4F7PB 1Z5LB 4A7SA 1KCSH 4MZ3A 4YBQC 3BRFA 2AGJH 3L45A 4M62H 4NOFA 2HJFA 1SMOA 2K8QA 1OLLA 3CC1A 3BISA 3EIFA 3V5KB 5ID0B 5KVMC 3HB3B 2WMPB 3L54A 5E1IA 3BLPX 1BEYL 2GUOB 5D1ZC 1BIIA 4IJTA 2UXGA 5FO9A 2WKOA 3L4ZA 4X9FA 5ITBH 3TCXA 4LAQH 5L4FA 2DEYX 3L1OL 4GXUM 4Y4KB 3V6ZB 4XNAA 1XDTT 5KVDE 1OCZB 1H3TA 1S2EA 2OKMA 1DSWA 3BIBX 3HHSB 4FYSA 3L3DB 5E70A 2BHFA 1UT1A 1YYLL 2ORBH 2X4NA 2X4UA 1QR1B 2H32B 2P42B 3JWNG 2VM3A 4PRHA 4C54A 3VI3B 1PSKH 1NCCH 1ZGLA 1X5MA 2D7TH 2NNFA 4PS3A 2NNAA 4F20A 1NDMB 3C6LA 2PW1A 1S9XA 3DX9A 3VI4F 3ERXA 1EEZB 2Z65C 3H6JA 1IZKA 4M00A 2N3JA 1AYOA 3OKMB 2FLBT 4TLKA 2BFGA 2EXYC 1TCRB 3ATDA 1LDPL 2N0MA 2R51A 4XBPB 2AXGB 2ICWI 3UPCA 2YN3A 4ZZKA 3IGLA 4JM2D 3V7AE 1OF2A 2JKSA 5IB5B 2D7MA 2UY6B 1ZVYA 2LLNA 4NQUA 3FSAA 1MZYA 5IK3B 5BRZB 2B1AL 3FB8A 4HJ0C 3M1OA 4AIXA 3GKWL 1J5IA 4DKEH 5DJCA 5EU3B 4RGMC 2R39A 2EACA 3HS8A 4BDVB 1N64H 2WWOA 2Q8BL 3E9TA 3NCXA 1AO7D 3OPUA 3ZE2B 1U8IA 4YDIH 1TQBB 2PO6A 2BWQA 3SYCA 1BLNB 1OP4A 5L4IA 1MQKH 1YC8A 1SLXA 2YQGA 1RLBA 4AQEB 5HI3D 4I3RH 2F2HA 5C0FA 3HAEA 5DC9B 2VLJB 4AEHL 2QQQA 3I84A 4R3SB 4V11A 1GL4B 4BFOA 1TZHA 3PREA 4L1SA 4ODSH 2HTLD 4QOKD 3SGJA 2W65B 3QPQD 3TT3L 4G5AA 1YEJL 3HC4L 4F8PA 3LPFA 4UMGA 1KT2A 3VD9A 3U6XA 4HK3N 2EE3A 2XLLA 3V4UH 4R0LB 1IGJB 1UM4H 4UNVA 2EYSA 3SQOH 3P4NA 3WEMA 4GQQA 2NY4C 3I6LE 3N43F 3AM8A 5AALA 5IVXE 5IHUH 3K80A 1U2YA 1P7QB 4X8GA 4BSJA 1W6LA 1CL7L 2QV4A 1E7UA 4RETB 2Q6WA 1AMYA 3MCLH 5C0BD 5JZ7D 4TQPA 2EDHA 3V5HA 1QFUL 1MRFL 4WTWA 5GGRB 1M2VB 2O6FA 3HVNA 5I6XB 3VG9C 4AW4A 2Z3FA 4P3CL 3QJUB 1JRHH 4C4KT 3VG9B 3WXWH 2WVVA 4YHZL 1TTFA 4GSXA 4JM2A 4NHUA 3SGEH 1GZQA 2UZPA 2WLIA 2OMWB 3DGGA 2ZUVA 1DQKA 1EEYA 1QBAA 1JHKH 3FYEB 4U1HB 3VD7A 3OKDB 4PBXA 1KUMA 4KZ0A 4PRNA 5DJYB 2G5BA 2RH0A 2NXYD 1MIEL 1TQUA 2M26A 2VH5L 3TN0D 5JIDA 1VGKB 2QJDA 3KM1A 2VLMD 4EOWL 3TZVC 3KHOA 4AMKL 4YSAA 5ACMA 3TZVB 1GYWA 1FIGL 1DE4A 4J2XA 1DZBA 1OCOB 1IARB 3V8CA 4OCLC 4C8XA 4QEGA 2AEPL 4WWPA 4YNYB 5FYJL 3S5YA 3IJYA 3IM1A 4A2GA 4HUNB 2IPKB 4PYGA 6TAAA 2DY2A 2C1PB 4I2XE 1NFIA 4JM4L 3QJZA 4IMLA 5EWIL 3QUKB 4NNYA 1CS6A 5DD0H 1NANH 3GSNH 4DGUA 3HC0B 2HUEA 3WE1A 1N5YH 5KYXA 2M1KA 1HCZA 3MRIA 2ICEB 3OXRB 5FFGA 3F7RA 1R75A 3ARED 3DX1A 2YEZB 3NACH 1F45A 1FZOB 1V7NH 3P3RA 4LXFA 3KWUA 5HYJA 3EJSA 4RFNC 3QWNA 1HQRB 4W9HC 3UG5A 2XWZA 3CV5A 2HKHH 5G55A 1GC1C 2AK4B 2CRMA 2HRHA 4RLDA 1UENA 3UYPA 5EZLB 1ZLUK 1QFWM 1RIVH 2IOMA 3VXQB 1FCGA 2WSPA 2IAMD 4Q9RH 1UCTA 1UWFA 2JJTC 4L4TE 4L4VB 4X7SL 1HHIA 3V4LA 1AS6A 5AAMC 2D2CC 2RALA 4MB1A 1TVHB 5C0BA 4Q9QH 3HN8A 3MJ8B 4KY1L 5HHQA 3BUIA 2RAMA 4KZDH 3LD8B 3JV6B 4XI5C 3LVTA 4XNXL 4H8VA 5DWUL 5DK0B 1JGEB 2DQUL 5CN2A 2WKGA 1HU8A 3T2PA 3P11H 4WGVB 1FYHB 1NCBL 4G72B 1KELH 2WIIA 1VAHA 3V7AG 4J39A 1NC2B 4TULL 5KOVC 3CNKA 1Q90A 3D8MA 2WXNA 3OL2A 3QEGL 5EF0A 4DKDC 5JW3L 1UM5L 3WNLA 4MNQE 4F92B 4O9HH 1L9SA 5EZOL 3TN0A 3L9RA 3QUMB 4FEIA 3WEAA 1D7FA 1GGBL 2P5ED 4G1MA 4OZ4B 4QRRB 5CCKH 3DRQB 4M1GL 2Q86A 4R7LA 5EDSA 2WZ0A 1KGYE 2WLMA 2FYYB 4FDWA 3S5ZA 5DD3H 4FFWD 4CJ0A 3L5IA 2YZ1A 4ISVB 4Z3IA 1DVYA 3FCUB 2I60H 5DEZA 2H9GA 5DJAA 3VXMD 4JB9H 1RUMH 4KITB 1KTCA 5K93A 4MCYB 3T8XA 3CUPA 4PTUB 1INQB 2A83B 4FFTA 2V9QA 4O2CA 1A9BB 1NBZA 3C5XA 4Z7OF 5BRQA 3TU6A 2JQZA 4IOIB 3AREA 1UCBH 2OS7A 3MRRA 4QNPF 4HA1A 1NMCB 2APTA 1PDKB 2NCEA 3FFCE 5DEGB 4GLRI 4OKVA 3F83A 2DZEA 1HT6A 3ZQXA 2ZXCA 2QTVA 4P05A 2J72A 4D0CA 2VQ1A 4JFZL 4RFOH 2DJSA 3ZQWA 4NP4L 3X3GH 5F1NA 3MACL 3MO1B 4AZ8B 3N9GH 2ARJA 3IJ7A 3LKPB 1D7BA 1OTUD 4Z0BL 1MJUH 2KZ1B 3NIGE 2DMBA 2W9EH 1URLA 5DFAA 1JERA 4RMSA 3ATFA 4I3GA 1RKRA 5KYUB 2WLHA 1XF4B 4KXBA 4GY4A 3ZKXC 1KENH 1SN5A 3ZKXB 4TOYH 3VFWB 3ULUE 1N68A 4KPHH 2HH0H 4JCLA 4PH8A 3UPRB 1JVLA 1U3YA 3CLFL 2IQ9L 2PETA 5CS7A 2CRYA 4U4IA 2AKRB 4NZ8A 2CLRB 1JHTA 2M83A 2IC2A 4HD9A 4P2RB 1CYXA 2G2RB 2LFEA 1XL6A 2OSXA 4HWBL 2V9TA 4Y8DC 3ZE0B 5KOMC 4CSSA 1KJ3L 4LRIA 2J8UA 2P5EA 4F57L 1GA2A 3FB7A 4KKNA 2GSIA 4NJAL 2EDTA 4NRZA 4Y19D 5LGYA 1OWRM 2X88A 1WK0A 2G9KA 15C8H 3JT0A 3QFJE 5HI5D 4S2SA 1F90L 2Y4SA 4DEPB 1TSHA 3S3DB 2VLKB 5L2KB 1OSYA 1DHKA 3A67L 1SMDA 2GJRA 1T0NB 3F5WA 1OT1A 5C08B 4N2OA 3G5VB 4LNVA 3DPBB 5E6YA 2OL3B 1BQKA 4WCYH 3VXMA 2AS5M 2EC9U 3P40A 2VC2B 3IDMB 5C6TH 2WNKA 3N42F 1ZANH 1CT8B 1OLZA 3KJ6L 3OBAA 4N2IA 3BVNA 3N91A 2P3YA 5DRXA 3U9WA 1OP3H 1RZ8B 4N2LA 4Q0XH 2NUPA 4LVOB 3EH4B 3DHPA 4MBRA 3C08L 3GSUA 3T0EC 3MNWB 4JQIL 3T0EB 2H8PB 3WIFA 5E00A 5FYKD 1MH5B 5F7YC 2Y7OA 3VI3E 3LNHA 2F19L 3DARA 3MLRL 5AZEH 3UAAA 2EO1A 3MHZA 3DHMA 5DJDA 5EO9A 1QFWL 5D6DC 2LU7A 4FS0A 3QA3B 3WUWB 1CB4A 4ZQKB 2DQGL 4KV5E 3H3PH 3FTWA 4U49A 3WFDH 4G7RB 1NGXA 1G7QA 4P5TD 3W9DA 3W37A 1SXNA 3OGCB 1SHXA 2HVKA 3C9NA 3OJ2C 1DEEB 4KI1A 5AW9B 5BJTA 3RVXC 3P73B 1WDAA 1E6JL 4RAUA 2VR4A 3QUXA 3NSFA 2QGEA 3UDWA 4Z7UE 3BAIA 3CPLA 4B9GA 1G7LA 1CGSH 4ZX6A 3H42H 4XMTA 1QLEH 4QIRA 1DBMH 1W72L 1L9MA 1D6EB 1BXAA 5BRZE 5FUCE 2XN9D 2BXYA 3WIHL 5H37H 3QNZB 2OA9A 2CE6A 2WBJC 3MVSA 4UAOB 2WBJB 2VZSA 3CHOA 1HOEA 2ROXA 4LQFL 1IMHC 4Z5RA 4FF9A 1IBDA 3MA9H 3VA2C 2QQNH 3ZE2E 1XGQB 2G60L 4Z3HA 4JRXD 1DFBH 1TO5A 4A2HA 1AOZA 3QC5X 2YA0A 5JPMA 2D4FA 2K6YA 3UACA 4OR1A 5MEPB 2KDGA 3G9AB 3ET9F 3PG2A 4OTXH 5IHZA 1J9CT 1DVUA 1EDYA 2XFXB 5CFHA 4QJ4B 3NCBB 2X7LB 5E6RB 4OZIF 5CILL 4HULB 1BM3H 3M17B 2VN7A 5SV4A 1K4CB 4XRCB 3GWJA 2DRUA 2OMYB 3CFCL 3HUJB 4NBYB 4MDJB 4WFFE 3T4YA 2C4XA 5KYNA 3IKCA 2F15A 3SO5A 4RAVA 5KSVA 3LS5H 3SY0A 1UZ6F 5GRUL 5K39A 4UINH 5BRPA 4M6OL 3GMPA 1OTSD 5MHSE 4XN4A 5BW7A 5D96B 4LLDB 4XPHL 3LXBA 1I9IH 3KPLA 4HSCX 4HS3B 5HDLA 5C07A 4NBXB 3ARVA 5C09B 4G43A 2A3TA 4HPYH 5TDNB 2QV2A 1A6TA 4Y5XC 3CZNA 4Y5XB 3MRFB 2GJ6B 4P5TA 5F9AC 5FEBA 4KY2A 3ZHFA 4A6YB 3IXAB 2C7UB 4B7LA 4ZOEA 4NM8L 1WAAA 1NPJA 1I85C 3UZEA 4UMSA 1QYGH 3IS1X 4BCXA 2BS8A 4KNSA 2EINB 1AG0A 2J3SA 1IV8A 1KIUA 2V8MA 4QHNB 4N25A 5F1KC 1BF5A 1T1ZA 5C0GA 3FC8A 1ZHNB 4G6AC 4HKXB 3U6RB 1SXCA 3MNMA 1OKEA 4P23B 4PJ8C 2XKSA 4BKLA 1UOWA 4I48B 1RMFL 2A1WH 4POUB 3OKNB 3QWOB 2XN9A 5D55A 4RGNE 2HT2C 2B9BA 3Q44A 2DMCA 4HPOH 4YBQD 1TT6A 2WTRB 5CIPH 3L4TA 4K5NA 3GXFA 4NNXB 3B8SA 4UDUA 5CN3A 1RZIA 2DWTA 4JRXA 5D1ZD 4G7SB 5KBMA 2CO3A 3CFKA 2OCJA 2VR8A 3H9HB 1B0GA 3V6OE 1KCBA 3NSYA 3VQ1C 2ZX8A 5E8DL 2O5YH 3CMOL 5I6PA 5FM5M 4YDZA 5D5MB 4FKHA 5CBEB 4DVRH 5DUML 3UGEA 3NFSL 3EOAA 1CR9L 5C0CE 5AB0A 2OK0L 3SPHA 1KTBA 1JTOA 2E9BA 4HS8H 2WYIA 1W8OA 3BVTA 5TK2A 1IGML 5DWPA 4LPVA 1PIGA 3KWWB 4HMDA 2AJUL 3M7FB 4NC1E 3EUUA 5FLUA 4YDKH 2EXYD 2ZSVB 1KBBA 1BIHA 2W0LA 3MRPB 2VDQB 2AK4E 3FCTA 3CH8A 1MWAL 4S1SL 2WANA 1D5BB 3NJKA 4JFHD 4QGTA 1CLCA 2XRAL 2PP8A 4L4VE 1VKXB 1P7BA 5D7HA 4HLZG 1GMIA 5K9KB 2GSGB 1MCOH 4HJ0D 4AQOA 3D4GA 2FJHB 3BWAB 3DJ9A 5F2FA 2X4TA 2XV2A 2IQAA 2VRKA 1OARL 3B9KB 3CFUA 2R2BA 4HUVB 1U4FA 4L5FE 2F5AH 3I3BA 4I3RL 3X17A 4G8GB 4EVNA 1A5FL 2E6JA 2YK1H 3JVFC 2QDWA 4J5VA 2FHFA 3RQ3A 2YBRB 5FDWA 3WY1A 4Y2DC 1QZNA 3ZTNH 4Y2DB 1HH6B 4A7UA 1MRDL 1FGVL 1NCWH 4PRDA 2VLJD 5F7AA 2CLVA 1N7MH 2X28A 4FNQA 4R96B 4YSTA 3TBWB 3H2QA 4QRRE 3CX2A 4TVSa 5T1DH 1KGUA 4UYPA 4L8CB 5D1ZA 3O6FC 1EBPA 3O6FB 2A77H 4O51B 3MKKA 4EI0A 1IJ9A 4X6FA 4TRPL 2Q9OA 3CDGB 1WF5A 3MCLL 3I74A 4LFHD 2H32A 2GJPA 1OALA 2XQ0A 2WSKA 2NY4D 3RWHB 3EO0B 3MGTB 4KJYA 3LYRA 1HINH 2BIQA 4Y2OB 1NDMA 1ZD6A 3Q5OA 1F4WH 1JRHL 2WW8A 5AEAA 3FT4A 1RK0B 4K5LA 4YL4A 4E5XA 5AW1B 1K8DA 4YIQB 4M3JA 2NY5C 4Z78A 4HHWA 4U1IB 2B16A 1ED3A 4E42B 1Q9LB 1DCLA 1Z2KA 3L81A 4I3SH 4H5SB 5IR1A 1JHKL 1R46A 5I15L 3RWDB 1WWBX 4DGVL 3GRWH 1FSKC 4JY6A 4TUJA 5EBWB 1FSKB 1JPSH 2BMKA 4BM7A 3OR7B 5C97A 3FUDA 2HLAB 1FGNH 1WSST 5FO7A 1QNIA 4GRWF 4C83B 4JCMA 4YHOH 1FZKB 5FKPA 3RTQC 3RTQB 3BGMA 5JA8B 3VYOA 2XDHA 4HUKB 1I7RB 3OV6A 3GEFA 3RIKA 4BDVA 3W81A 1S9VB 2FB4H 3HPLA 3O3EA 3CCHB 4FLRA 3TZVD 4ZTPH 4OUUA 1OCWH 2WB7A 3AQZA 1T6WA 1KTKE 2IPUK 2ZYRA 1JD9A 2MOQA 4P2RE 4P59L 5DJ8A 1HNGA 5IJKC 1GY2A 4XTRC 1JPEA 5ACZA 3JV4B 5GHWL 1GGYA 4OF5A 1O9ZA 4K3DL 3N0AA 4AC2A 2HKHL 2DQCH 5F89B 4POYA 4YH6A 4WI0B 3ETBF 4OCMC 3D2UB 4X6EA 3E80A 5CEZE 3PGFH 4R4NC 3UAEA 3SODB 4PIBA 5C08E 1IGJA 2PW2A 3B7RL 1UZ8B 4I0PB 4ZPVB 4B53A 2P80D 5KBNC 5IMOA 1XF1A 5DA4A 1YEHH 3FONB 4CNIB 3CSYB 3MRNB 4Q9QL 4R5XA 3MROB 4IS6A 2H0JA 3BAEL 2XBDA 5E2TH 5F9OL 4WY7H 1GCYA 4OLXH 3WKPA 1FNHA 2CJ3A 5IFHH 3FU3A 5EUOB 2WZPA 4A2MA 4F9PA 3U1QA 3K2UH 4XI5D 1PZUB 1M7XA 5LN8A 2R9HC 2V2WB 3DGDA 1UH3A 3B9EA 2JJVA 5SWQB 3K72A 3VXSD 4AXWA 5EB9A 1Y6KR 5DO8A 1PZBA 3D39B 5I5IA 3WMQA 1BFSA 5F7KC 5LAPA 3CQFA 1WFUA 3BD3A 3PWVA 4G42A 4ZS7L 5C2UB 3GMQB 5DRZB 1DDHA 2HMIC 3O11B 1N8ZB 5E5MA 1BZDA 1UYWH 5I0YA 1DTUA 4RGOH 5HPOA 1J9QA 4UIMB 1U8MA 3IE9A 4XOBA 3QDMB 3OVUB 1IO4C 4AIEA 1IFHL 3BN3B 4R7XA 3ZZSA 2N1KA 1RURL 4H88L 4OD2A 1OVZA 2VSKB 2CQVA 2TAAA 1A21A 5DDHB 3UTPE 2CO7B 1ZHLA 2MIZA 3QHZH 3QIUB 3HLKA 3OC5A 3MSPA 1ZK5A 4KJQD 3MRGB 5FV1L 1GZPB 2I9TB 3WS3B 4B0MB 3O45A 2X41A 3TOPA 1IGCH 3IRPX 4NLHA 2DYRB 5IEKB 2OMVB 2RBLA 2AJVH 3TC9A 1KXVA 5DQDL 5IF0A 3VH8G 4P9ML 1LEGA 5I8CA 2AJ3B 4NENA 3DIVA 2XTSA 3JWNH 3QNXA 1OP3K 4GAGL 2Q3XA 3OF6D 2VERA 1HWHB 1IFGA 4PG2C 5JDSA 3X3GL 4I4WA 3UJIH 2QSCL 2IH1A 4Y4FA 1OP5H 4NXSA 1DJZA 1JGUH 1QSEA 1WGVA 4O2EA 4KUZH 2Y5EA 3IEAA 3WMPA 4HXBH 5CZRA 2XQBH 4R7DB 2C9QA 1IC0A 4TOYL 5EZIL 2I5YH 4ZX3A 3KBHE 2JJTA 2IWGA 3ATBA 2WJ7A 5A16A 1XCTA 4PBWD 3AB0B 1DN2A 2DWYA 5FOBA 3S6CA 4ALAH 2CG9X 3HZYB 4TSCH 2KMWA 1S7VA 2D7OA 4LSDA 3UBFA 3V4PB 2DI7A 4OUOA 4HS6A 2FK9A 3LOWA 3HNVL 2DQ6A 5DC4B 3VXSA 1KBKA 1R3JB 4FGMA 5A43C 3I6SA 1Q1JL 4IBZA 4NFCA 2H26B 1N26A 3IN0A 1U33A 4ZK8A 3U4EB 1EEQA 2NLJA 2HZHA 3QIWA 1ACCA 1C5DA 1KG0B 2XTLA 4PD4J 2Q7YA 4JFFB 4S1RL 4X8JB 4YUEH 2WO3B 2GJ6E 3DWTA 3T71A 1R19A 4A2FA 1GKOA 3H53A 2O61B 3F12B 3CDYA 2AQSA 3ZTJG 1JZ6A 4UTAL 4MD4A 1T4WA 2NY3B 3T77B 1UUSA 5AB2A 2COVD 5JOFA 2ESVA 1MFCL 1JGVH 4OLYL 3GBDA 3C8HA 1Q9OA 3VACA 4FZEH 4D0BB 4LKXA 3SJVB 3MU3A 5GSVB 4EI5A 4JANB 1H8SA 1UXSB 2VLKD 4JPSA 5C6TL 5L2KD 3MUY1 4CMHC 3GMOA 2G3NA 4ISVA 1C5CH 3B2VH 5I1DB 1FO0A 2HPOA 5C0NC 3MRLA 4XBEL 3HJ0A 4JFWA 3HI5H 3GK8L 4JHBA 3KPRD 5JORB 2X87A 4G6JH 5HJDA 4WU7A 3BCFA 4HKZB 4APXB 4CL7A 4HZ1A 1XSJA 2R0WL 1R3IH 3NFPA 4LLAA 4EDXB 3RURA 4F33B 1TJGL 5PCYA 3IRCA 5FYLE 3OF6A 2A6IA 4CUCA 3S4SG 1PDKA 3T0ED 4H44C 1F02I 4YWGL 5I26A 5IBTH 3ZGHA 3WELA 3RVUD 5L6YL 3B34A 1IM9B 4H8PA 1HL9A 2BK8A 5F1SA 5I9QC 3HG5A 4KO7A 4XXWC 2WHVA 4YSOA 3ARBC 4XBMA 4Z7VB 3QI9C 4FMKA 4L0YA 3QI9B 3HR5A 1HEHC 5F7WC 3LV3A 3NJLA 4CDHA 3V0GA 4BUHA 4OFIA 1NBYB 2J55A 4Y9BA 4CVXB 3O81A 3PNWB 3BEWA 1GAFL 3H42L 3DA0A 3A24A 5DUPH 1IQWL 2JELH 3RVXD 4M8UA 1FUNA 4ZMZA 4KZEL 4X5XB 5ADPH 4PS7A 1BZ7B 1MCNA 4EI6B 3ARUA 1WHPA 1AMXA 3FW6A 1B0RA 4MSWB 5D70H 3S88H 2H2SC 4OBRA 2YD1A 5DYOB 4Z1PA 1T7ZA 2GTWB 3MA9L 4JUTA 2AKRA 4U1JA 3FMGH 4GUPB 4F5CE 1ZT4B 3MRHA 2WBJD 5F88A 2OSLA 1DO5A 1V55B 5I1KH 4JY4B 1D2OA 4LIQE 3UX9B 1E50A 4Q6YA 1KLUA 4KRPB 5D6CB 1S3RA 4UWQB 5ES4B 4R4FL 1ZA6B 2V7HB 5AOJA 1TETL 2B2XH 2JJWA 2Q7NA 1V3LA 2DWEB 2P46B 3K91A 5CJOL 2FATH 1AGEA 3B9AA 2HVJA 3BVWA 1OY3B 1HC1A 1UKSA 3WO3B 1OB1A 1NM9A 4FAAB 1FLTX 1JTPA 3CDFA 1BVKA 4G6KL 5GGTH 1A25A 4RMRA 3REWB 1OGAB 4QRTB 3HC3H 1T89C 3U7WH 2WLNA 3WLBA 2IXQB 2RACA 4P46C 2F58H 1FNGA 3KPRA 2KS0A 4YPGA 4QXGH 3SOBH 3TWCL 4N2FA 4RA0C 1F4YL 4PV9B 3BZFB 3ALWA 4WHCA 2DQFB 2H8PA 4ZAKC 5IESH 2XX0A 3BRGC 1TU2B 4RWYH 4Y5YA 1J12A 3CLWA 1G5AA 4IBSA 35C8L 1J1PH 1BAFH 1RUAL 2P9RA 3LXUX 4LCUB 3FUIA 3IMWA 4ZOCA 1JYVA 5C09D 4TQHA 1IAOA 4OLZL 5DEFB 3DC0A 4E9WA 1SQMA 3CSGA 3MV01 4B96A 1IJNA 1O7DC 3BKJH 4PSPA 5K5YA 3SYQA 4GFTB 3UJTH 1DEEA 2NW2B 1T22B 4LSSH 3FQNB 43CAA 5T5FH 3WV0A 1JI1A 4OLWH 4YHIA 5I1EL 4LVNC 2YD2A 4D8PA 2HJKB 1EFXB 4LVNB 2F53B 3H9YA 4UT7H 1QPPA 3V6BR 2J5WA 4G6AD 1LLAA 2R56L 1D6EA 4XNMB 3LRGA 4D94A 1PAZA 2VZ3A 3SN6N 3TXAA 2BCMA 5TE7L 1NIDA 4Q56A 1M05B 2O26U 2HT2D 5FWRA 1WFJA 3VD5A 2IDTA 4P9HH 4PI0A 2WWMC 2CK2A 2KKQA 4F8LA 1J05B 2O5YL 1EHXA 3G08B 4TKWA 1HCVA 2D3VA 4HC1H 5F97E 4DZ8A 5CP3H 5I23A 2XG4A 4LK4A 5CMAA 2R0LH 1T20A 5MEPA 3DX8A 2BVOB 4IHBA 4U1GB 4ATWA 1VEMA 3EYSH 3NESA 2VZVA 4GQ9L 3LS4L 2CMRH 5LNDA 2CH8A 5CWSA 1H5BC 1Q9WA 2JKTM 4FI7A 1H5BB 1E7VA 4NYLA 1F1GA 1TKWA 3QEQD 2WUCL 1LILA 4HKJB 1HKLL 2OMYA 3HUJA 4OW6A 1L9PA 3L7FA 1RZPA 1A6ZB 1BREA 3VFUA 2OW6A 5JYLA 4U1NA 3GS0A 3TESA 4XMXA 5CBAA 3ARDC 5I6OA 4I88A 3ZDZB 4P2QA 1MCOL 3ARDB 2R2EB 4JJHA 4LSRL 2Z0BA 4EUPA 3AT8A 3BDXA 4G8FA 4KTYA 2VR9A 4N3TA 2K3TA 5LGJB 2B1OA 5ABDE 3PJLA 1RVFL 2VIRA 1G0DA 1KDIA 1KB5A 1LD9A 2Y5TA 4PGBA 2FZ3A 4XMWA 1CI5A 4Y5XA 1AZBA 3I9AA 4H8HA 1JNNH