5IJCC

The crystal structure of mouse tlr4/md-2/neoseptin-3 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B chimera
publication title TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 24
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ijcC00
1WRFA 2E56A 3B2DC 1NEPA 3VQ1C 2F08A 1AHKA 3M7OA 3VQ2C 5IJDC 1XWVA 3WEAA 3FXIC 3MTXA 5KWYC 5IJCC 2Z64C 3WEBA 2HKAA 3ULAB 2Z65C 3T6QC 3RG1C 3MU3A 4G8AC 1AHMA 2E59A 1KTJA 5IJBC 1A9VA
chains in the Genus database with same CATH superfamily
3US1A 2PNDA 4XPHH 1G5GA 3M46A 2F53B 1A7QH 1FSKC 2VB5A 2ZOKA 2BVOB 4XGZB 3L16A 2CIIB 3O6FA 1FLTX 2AQTA 3QBTB 2OR9H 5EU3A 2LHAA 2WLIA 2ZXCA 3BAEH 4KQ4H 5IKCA 1JPSH 1S9XA 2YO3A 1A4KA 1KBKA 1Q9WA 4GXVH 1DBAL 1WAEA 1ZT4A 5AKTA 5AVVB 4TVPE 1AY1L 2D3LA 4FMKA 4HD9A 2KYIA 2E6PA 3VTMA 1TQBC 32C2A 5CZXD 4Z23A 5CFHA 3P4LA 1K6QH 2ARJA 1OM3H 3GXDA 1KIUA 4PJEA 1AXTH 3HE6A 3LV3A 1VFAB 4PIRF 3S5LB 3N1FC 5D1ZB 1J18A 5J3HD 3HC3H 4Z0BL 2PP8A 3MLZH 3DIFA 3CIAA 1OZUA 3OXSB 5D7LB 3C09C 1ZTXE 5CLXA 4AQ1B 3O6MH 2VLRD 5FUZH 5TGBB 4UQAA 3LKNB 4ZNEE 5CIPA 1BPLB 1J1PL 4YDKL 5HHVH 4GUPA 3GJFB 1LE9A 3BOVA 4KJPD 3F58L 4RNRB 4EIGB 1UTDA 3P77B 3FKUS 3F7YA 5DD6A 1RZKH 4E0RA 3V5KB 2FBRA 4HCRA 5D1QA 5D55A 1F6AB 4QOKD 1K9TA 1S7WB 4FKEA 4BXVA 3FQYA 1MSPA 5T3ZE 4G5ZH 4BJLA 1A6UH 1ZTMA 5E9DB 3DURA 4M02A 3TBSB 4HIEA 1GHFH 1I7UA 3P2BA 4LLMB 1JGLH 2BVQA 2UXFA 2BOBA 2WINA 3ASOB 3B5HA 3F5WA 4TRPH 4AQAA 3LQAC 5EBMB 1GSMA 2O1AA 3AW5A 4U6YA 2ODIA 2HLAA 3QXAB 1Y6KR 4JB9H 4M00A 2ENSA 3WLWD 4U31A 1TTGA 2DQIH 2NX5D 5CP3H 5J9PB 5AW4B 4N8CH 1ADQL 3WTSA 5GZOC 2V2XB 3TLRA 5AENA 4JDZA 5AZ2H 3HAEA 3QZOA 1T22A 2A4EA 1Y1DA 2NXZC 4AMKH 5DJCA 3BWZA 5JPMC 4YC2B 4JO3L 4S1RL 5GJSL 3VXSE 2CXGA 3BO8B 3ILQD 4I4WA 4X0KA 3PP3H 3FBKA 2C26A 4IDJL 5TDPB 5IMMB 3WIHL 2Y6SC 3E38A 3A22A 4P04A 4LCWD 4IBUA 2QGCA 3S97C 2XN9D 4TUOB 4I3RH 1EQWA 4NN6C 1I3RB 4PW4A 4AK1A 2Y3AA 4F7CB 1X5FA 2BIOA 4RFOL 4WENB 1IEAA 1HL4A 3Q2LA 4GB9A 5E4OA 3C12A 2ADJA 2FX7L 2WQRA 1IKNA 4X6EB 3SGJA 2Y23A 4HG4J 1LK2B 5HY9B 1AHMA 4FXTA 1RK7A 3JSSA 1R3KB 1EDQA 4RCAA 2XWEA 5ACZA 1HOCB 3WIFB 3L3OB 3OLDA 2OMBA 4G8GD 3O9WD 4ZSOE 1ZVYA 3QH3B 3M8OH 3L1FA 4TMPA 1P7HL 5MI0C 3MMEA 5B1AB 1J10A 3BGFC 3P0VH 4YBLC 4JRYE 3X3FH 4XNZC 4GSDL 4WO4C 3RWDB 3V0VA 2I9TB 2EE6A 2IWFA 5HYQB 3KMDA 1H9DA 1U8MB 1MJJA 1G0XA 2VZ1A 2WVSA 5C0FA 2QPEB 5E8NA 4JEGB 1OT2A 1WFOA 2CXKA 4X6BA 3RX5A 3CVHL 4J6IA 3HW7A 3EFDH 4G8EB 4WFHD 4PHXA 3PQYB 2LFGA 2AMGA 3HHMA 4ZDHB 3MRHB 3SPGA 4ZUSA 2IALA 2DL9A 2B08A 1OLZA 5HDBB 5D6CB 3ME0B 4L8CA 5ANHA 4JY6B 4DVBA 2GK0B 3KG5A 4NZFA 1KG0A 3FUKA 5C09D 1PKQA 1QSED 2ZOLB 5EEWA 4LSSL 2NZ1A 3FO2A 3MPCA 3P40A 1S7RA 1E3ZA 1XGYH 1J8HB 5IB5B 3BI9X 4P2QA 4M6NH 4OLEA 2QSVA 2PP9A 3OL2A 4N6QA 4DK6A 4TQPA 4ZUVB 3IDNA 3Q05A 4FFZA 1TPXB 5TDNA 2XETA 1P1ZB 3VXQB 4F2FA 4OZHF 2A9BA 4OCRH 1NBVH 1JPST 1WGVA 3LNDA 1A4CA 1HSBB 4KGJA 5DRXA 7PAZA 1SLWA 3K71A 4DKFL 4PY7B 2XT1B 5EBGA 4FLHA 4AVIA 2ZUYA 3L08A 5DC4B 4ELKA 1NDTA 2H0JA 1KT2A 2HG5B 3OLEA 4JG0L 6PCYA 1JDDA 1UQSB 4K4KA 3ZGHA 1DBMH 3NFPA 1N0XL 3B7UX 4WJ5A 2H3NA 1EWHA 3EUUA 3VXRB 1Z9PA 3W11D 3OC5A 3KZ8A 3IFLH 3T0DA 1U3YA 1NEPA 1WV7T 1KDJA 2PCPA 5IFJB 4JG1H 3IFOA 1DDTA 2W07A 3VFVB 4G6JL 2KZ1B 1BP3B 4GINA 4HK3N 5KVDL 2YEZB 4ZTPL 4Q9RH 4XXWA 4PVLA 4FQIL 4G1EB 2JNZA 5GRUL 5TE4L 3GKWH 4OFVA 4RMTA 2XPGA 2ORBH 1CDJA 1KCRH 4HKJB 3CLWA 3IDXL 3N41B 4H8VA 4MDJB 1CR9L 2EO7A 3VVVA 2XZCL 4KUCF 4AV0A 3PWVB 5FXCH 2BX5A 4RRPG 3L5WB 1LK3L 1F4XL 4BKLB 1Q1JH 3VGFA 1KEML 1ECZA 4R7DA 4UT9A 5EU7C 2Y2YA 3W5NA 4MJ5B 4J8QA 1DFXA 5J6HA 1OT1A 2JSFA 4LMQE 3ZKXC 1DUYB 3T6WA 3A3YB 1YJDH 3VI4A 1VGEH 4RMWA 3K72B 2F5BL 1BF2A 2WK2A 1M2VA 4H20L 4M1DL 4Z8FL 3MGTA 2HFEB 3EOBA 1YEIL 2GTWA 5DEGB 1AJ7H 5B8CA 2Z1PA 3U4EA 3CLFH 4M03A 1CDGA 4AY0A 4AIXA 1G84A 2YA1A 1WAAE 1YSOA 5EULV 4JHAL 4P5MB 4W68A 4LSDA 4WI0B 5DI8A 1NCTA 2CIKA 3BKYH 4QT5B 5D7IE 3GMMA 4ZD3H 1U3ZA 2AABH 2EIKB 4K3JH 1G4MA 1BGXH 4JO1L 5D1XA 3GD1C 3APCA 3DV6A 1D6VL 5ETUB 5F2FA 4CA4A 1ZTXL 4KJWD 3FS9A 3QPQC 6CGTA 4JFXA 4QLWA 4X4YA 5CN3A 1R5IA 5EF3A 2J1KA 2FX9H 1WUZA 2YD6A 1KIRA 1MZYA 1YEKL 4OLZL 1KWGA 2QVKA 3SGEH 1TQUA 1TJHH 1AIZA 1BAFH 1WFUA 3IDIB 3OKEA 4LVEA 4YE0A 2R29A 3CHRA 2JKTM 4JGJA 4AJWA 2B59B 4Z78A 2Y6TE 1MCRA 3SOTA 4NQCA 5I74C 4ENED 1L4IA 4OLUL 3LEXA 1QSFE 3NQIA 3R4DA 1E90A 4K7FA 3TT1L 1S9WA 5CGTA 3TT3H 1PX3A 2FT7A 1PG7X 1JZ8A 1DQLH 2BK8A 3LOWA 3WAKA 1QPXA 2FJHA 2VYRE 1JP5A 4RMSA 3FH5A 2IFGA 4KV5F 5DWUH 5D6DA 4BEIA 2Q5BA 4IU3B 1DCEA 2H8PB 3G6JB 4TUJA 3T3PE 3AT8A 1IX2A 4WI4A 1UHVA 3AM8A 4FADA 4P9ML 3LB6C 1SNRA 4LQ1A 4R3SA 4C8XA 5IVXA 5B3JE 3SJVA 1SY6A 2ALWA 1S7TA 3ROLA 2NY3B 3NZUA 1OF2B 4I0PD 3L7FB 2B7DT 4D0CA 4CMMA 1DP0A 1IAIL 4ZZKA 3C5ZD 4DT2A 5F7YC 2WO3B 4A63A 3WN5C 1JVKA 2FYYA 2HT4D 1G1CA 5D2LB 1WSST 3QDGE 3MQIA 4HWBA 4JMNA 3MHZA 4PGEB 4UOJA 4XNBA 2WXKA 2DQ6A 3KJ6L 4B95C 1KIPB 4E9TA 3IGFA 3RGVC 4E68A 3WKQA 4G6AD 1BZ8A 5DGRA 1CFTA 5KBNC 1AIFA 5FO2A 3FOLA 3NT0A 1F97A 3CFMA 1EO7A 3DUUA 3P3UA 4Y5YB 4HBCH 5IHUL 1B9ZA 4Z0XB 5JOFB 1Q0XH 2PR4H 5HJ3B 3UABA 5C0AB 3U30B 2IBZY 3VGEA 4J3XA 4U6VL 3BZFB 4F7EB 1Q8MA 3N44F 4XR8C 1UADC 4XPGH 4DKEH 1A2YB 2HVBA 2ATAA 1U8OB 1E9OA 4AIOA 4JFYA 3N6YA 5HJBA 1YQVL 4G7YL 4KX7A 5HHMD 4KROB 2E8ZA 3FHEA 5C08E 4JPKL 1A3RH 2Y7MA 3SE4A 2UZXB 4QYOA 2CWRA 2JLLA 2GI0A 1NLBH 3GSRA 3MJ9L 3SDXA 3F83A 3ZUCA 4EI5C 4EUPH 4CW1A 5IEKA 1W91A 1QVOA 2IGLA 3I50L 4KK6C 2F7PA 1X4XA 1XF3A 2JTYA 3FU3A 4X5WB 5EU7E 4H0GA 4LOUD 1P69B 2JWYA 4PLNC 3KR3L 1RJLA 3LYRA 4F7TB 2BPBA 1RZJC 4MA1B 1WFMA 3FO0L 3P9WB 4UTBL 2B0SL 2D2CC 4NKMB 3B2PA 4CBPA 1MIEH 1CL7I 1N5AA 1QR1A 3QYMA 1UB6B 3VWKB 1I1AB 5LWYH 5EF1A 1GH7A 1X7QB 4LASH 5DJ8B 2R7EA 3VFUB 2BFVL 4X98B 1J0ZA 3IE9A 4JLRA 3QDJD 1GIGL 3AS3A 3C8KA 4O51A 2UZYB 2CGYA 3FQXA 4R0LC 4LF3B 3T65B 3V6ZB 3KPSA 2ZAHA 4ALAL 2APWA 4PSRA 1XAKA 5MEPB 4HOMA 2DTMH 5K9KA 4UBDD 2AJXH 5E0QA 2E4FA 3SDAA 1LEGB 2E9GA 5A7BA 4F20A 1DVFA 1NGXB 4K8RC 2OJEA 2AQNA 3NCCB 3ZGIA 4ODSL 4PJDB 1XO8A 2Q20A 3M07A 4EXKA 4JGNA 5EU4B 1JF5A 2WIIB 2CCVA 4QXWA 3HB3B 2AJ3B 3RDTC 3KYMB 4Y1AE 4BH7B 1DBKL 1F4WH 1HHIB 2RGSA 4N3TA 3MFFB 5DK2B 1XSJA 3CZKA 5IG7A 4B50A 4BQ9A 3PWJA 1ASOA 1DUZA 1F41A 2BNRB 2RFXB 4HALA 4U4IA 1YMHA 4HHAB 2J8UA 2F74B 1KXVC 3QIBB 3HRZC 2ZUQC 2ZUSA 1OAJA 5AVQB 5IUCA 5BMFH 3J2PA 1ZANH 4G5AA 2F15A 4EE2A 5I2IA 3BP4A 1DO6A 2WWMC 1QZNA 3TN0C 4ZG1A 3M1BA 2DB8A 4HF5L 4JJOA 4H0IA 2G0KA 5HPMB 3VRJA 5E08H 4PLOB 2WJ7A 4PCYA 4K3DH 1EJ8A 2DPKA 4NPJA 1VFMA 3V4VL 1NFDB 4F2ME 1NKRA 2YAMA 4PVNA 4WLCA 3OWEA 4NM4L 4W70A 4ZMOA 2XPZA 3UFIA 2X4TA 1LGVA 3WS6A 1L7IL 1HH9A 1BVKB 1FZJB 1P4UA 3IDMA 1E2ZA 3CC5B 3IJHA 4JDVA 1KCVH 4P48A 4ELMB 3L3JB 2QQKH 3SD2A 2NY4D 2IADB 1KUMA 3ZDYB 2XQYK 4PJGA 1MFMA 3LVTA 5CM1A 3PL6C 3OHXB 3BVWA 2H6OA 2XXMB 4MA8H 3WJLA 1MJ7H 4H26B 3NGBB 1TCMA 4LL4A 5DURB 3I9GL 4I88A 4J27A 4N5EC 3ZN6A 4PRIA 4EI5D 1KFAH 5C0JB 1S9YB 1EZUA 3D07A 4P3CH 3PIQB 2D7NA 3ARUA 3N5AA 3IB4A 3I75B 3UZQB 4EDXA 1I31A 3CLEH 4FNTA 4POZD 4IBYA 1P6FA 3MLPA 1ES0A 3WKYA 4OD1L 2YRZA 1WUNT 5IMKA 2FSEB 3NCJL 3BZ5A 5L0QB 4I5BA 2P43B 1E8ZA 4OU3A 2LW3A 2WCSA 3C6SB 2ADFH 3BSZA 3FB5A 1G7IA 2WB1A 1I3UA 3CJJA 1DE4B 4XC3H 2P5EA 3NABH 4KXZH 1AGFA 5E2TL 2MFNA 1OTUC 2A83A 4GBXB 4RFNC 5DZ9A 2E7HA 2H1PL 3EYQD 1SJHA 5AALA 4YHML 3E1ZA 4ATTA 2FK9A 1KGCD 3N42F 2BVUA 4V2CB 4UT6L 1G1YA 2VDQH 4PRBA 2DV6A 1IEBA 4P4KB 3QGVA 4XNQA 1YY9C 1NWOA 1PZDA 2IH1B 2PO6C 2YD3A 3D39D 3MRDB 2HKAA 5TH2A 1INEL 3ZE1E 3IJEA 1LMKA 5E8EA 3H7LA 4JQIL 3FCGA 2ZXQA 2DLIA 3PP3K 1D5RA 2ATPB 4XMVA 4OGXL 3OR7B 2I60H 2E59A 4L2LA 1ZEAL 1R3IH 1DBBH 3BIKA 2OJZL 4M8QA 4UQCA 2JJTC 2WM0A 3LRHA 1FAKT 4U4BA 2VXUH 4G8IA 3ZTDC 3SPVA 3QRLA 3ZTCC 2BIQA 3SBQA 2VDOB 3RY5A 3QNYA 2NUPA 3I3EA 1SXCA 1B2WL 1LVEA 4BZ2L 3G04A 1T83A 4L8SC 2VZOA 4URTB 4XMPL 4Y16D 4Z7NB 5J5EA 3FRPA 5CP7A 1BW8A 1SGKA 5BZDB 1HWGB 4GXUN 4YDZA 1FVDA 4QXGL 5MENA 2EDEA 2C7UB 3OZ9H 4Q2ZB 3T4YA 5DVKA 1SMOA 3MAWA 2OTUA 2F68X 2CO6A 4TNGA 1JUFA 1BD2A 4PJ7A 5T1DL 2DLGA 3ZBMA 3QUGA 5C0GA 1GPOL 4YLBA 4HWEH 1MFCH 2FEEI 4G9FE 1URIA 4UM8B 2HA1A 2AP2A 2QV4A 3RFRA 2AFNA 2XRAL 2K6YA 5L6YL 4JKPH 1XCTB 2BNQE 2VC2L 2QELA 3WIAA 3HBZA 3BT2H 1KB9J 5CJ8A 3IDJA 5EEYA 4PWKA 1HDMB 1CBVH 4Y7OC 5TFSH 4XRCA 2A7BA 3EO1B 3NFSL 4MXVF 4N8VG 4PEEA 2YGQA 3DBXB 4JFPA 3S35H 1RUML 2ZX5A 1FH2A 3DX7A 4JPSA 2LFEA 2CBTA 2WN2A 4KZEL 3LIZL 2ARWA 4RZKA 1WWAX 4WV1B 5FYJE 1W80A 3ALWA 4WK2B 3X3GH 3ZZQA 1P4LA 4GP5B 1E27A 2O5YH 3W0WB 1T3FB 5J6GA 3B83A 2EDQA 5DHDA 1W72H 2ZPKL 4OZFA 5C6TL 3FUEA 1SOKA 2BIHA 1NCHA 5FUOL 5E4EC 2AXGB 1QFWL 2OMYB 4X6DE 4AW4A 4O02B 1P7KA 1GGIL 1KIQA 3FO1A 4FTVE 3QFJE 2FB4L 3LXAA 5E6SB 1H5BB 3GSVB 1E5YA 2XV3A 1YUKB 3L5IA 3DSFL 5E1AB 3R06A 1NGYB 4ESKA 3MUZ1 5DCCA 5E8PB 3WYRA 3PV6B 1AQKH 4IU2B 4NXKA 1M1XB 3O4LE 3MUGA 1S7XB 1TYRA 2ZKXA 3CZEA 3PWPB 2O5NA 4LEEA 1H0DB 3RX7A 2Q0ZX 2H2SD 12E8H 4HUWB 5H4ZA 3QUML 4LSQL 3CE1A 2CDGB 2JMRA 2PO6D 5GSVA 5H37G 5ILTL 4WHCA 1KJ2L 2OX5B 2Z93A 4KK9C 3NK4A 5KW9L 2EYTB 4MXWH 2ZP8A 1ZLUK 5JXAH 2WKOA 1IIKA 1YNLL 4AL8C 1XCQB 2OZNA 2JE8A 3TVMD 1PY4A 4UV7L 5AW6B 5DRWB 3QJVB 1WVZA 2NY6B 3T2PA 2BSED 3MV9E 3R1GL 5DWPA 3X12A 1FO0A 4FXGB 4N2FA 1ZK5A 1PZAA 4L1TA 4GO6B 3ZRSA 4BRVA 1PSKH 4PREB 3KM2A 3H85A 1OGAA 4M5ZH 1FZMB 3ZE0F 5L2KD 1M7XA 5B1JC 4CSZA 3ZT5A 3U1SH 3AJ7A 3BDYH 4KVNL 3IT8D 5HHPB 2OA9A 5DVMA 3AU0A 2V17H 4JFED 4BE5A 4GIPD 4PRNA 4APQA 3KWWB 4YHZL 2VGLM 2NW2B 1JCVA 3B56A 3BXNB 3NCXA 1FI8C 5DHVA 1ZHBA 4GRLA 5GGQL 3SE9H 5CSGA 4JZOB 4E42A 5CILH 2WP3O 1AXSB 3OKOA 4HZLB 3CFKB 4XCFH 5AZUA 1G0DA 2VH5L 4FFWC 2IH8A 2JIXD 4BK4A 1J5OL 1E50A 2IPUG 2ED8A 4OGAC 2D4FA 5D5MB 3RDJA 3RU8L 5GS0L 3SPIA 2VDPL 3HPLA 4NRYB 1PY0A 4WUUA 3JWDL 1A47A 1NGWB 2YEQA 1MRDL 2YMXL 3RWCA 3HHRB 4YXLH 2X5PA 3HOGA 3QIUD 4LB8A 1JI1A 4ETQB 2WUCL 1ZT7A 3VDBA 1QW9A 1OSPL 1OAQL 1T7WA 1HQ4A 2R4SH 1T4KA 5EEUA 4TQEL 1ZWIA 2UWEA 4X6FA 1YNTB 1DL7H 2BDNL 4ZS6C 3RWHB 4JQVA 4NQXA 2GCYB 3U7AA 3KVDD 1G6RB 2ZG3A 3SGEI 5DMIL 3NA9H 4OQTL 5I26A 3AITA 3FF8A 5D1ZC 3B5TA 4C58B 3MRJB 3QE5A 4MAYB 4PJ9A 2YD4A 3FRUB 1RUAL 3F01A 5ITBH 3TURA 5FDYA 3ILPA 3CQQA 4AQ1C 4RMQA 1DQML 5KWYC 3VWJC 4WW2B 4KDTA 3UC2A 3EG9A 4AUYA 2P1YA 3CZSA 1N0LB 5ANMB 5I18H 1T1WA 3PXJA 3T6QC 2DN7A 5D7KE 5G4NA 4ZUTB 2YUXA 2YD5A 2VQ4A 3IEAA 4LARH 4ZS7H 1DBAH 1BFVH 3TNMA 5DHMC 1AY1H 2ICEB 4O58H 4U6HA 5CEYA 5GGSY 4PJCB 2I69A 2X1QA 2WYIA 3OX8B 1BFSA 3IF1A 2XWJB 3VDCA 4MCYB 3FTGA 1AG0A 4Z7UF 1I1FB 5I30H 4XWOD 1KBBA 5TQ2L 1FFNB 2E3VA 2J8OA 2OBGA 4XPAL 1FFTB 2P8PB 3S5LG 4ANVA 5IMLA 2MNWA 2C4FT 1AZUA 3K0WA 4HPYL 5CN1A 3TA3D 3DO7A 4PRPD 3EYSL 1XGTB 5EUOF 5SWZE 5ESQB 3RNKA 4M43H 4D8PA 5C3TA 1J1PH 4YDKH 3DXAE 3F58H 5EUKA 3QUYD 1Q90A 4QHMB 2YPLD 2VDRB 3GMNB 3KDPB 4NQSB 3T08A 2UYLA 4TL5A 1LWRA 4X4XA 1ZA6A 2YD7A 4Y19A 4W9KC 1U95A 2JELL 4KO9A 4NT6B 4RVBA 3DVNA 1V8HA 4LAQL 2WLYA 3MLRL 4HJEA 2OL3A 3HA0A 2Q76A 1QUNA 2XIIA 5M94B 2PPDA 3C08H 3QUXA 3RUGB 3O6FD 5CZVL 9PCYA 5KAQG 2FGZA 3BUDA 3BGMB 4A6YL 1QBML 1YEDB 4U1SB 4CN6A 2JKIS 4L8DA 2Z6FA 3KE0A 5DZJA 1I7RA 2W91A 4PD4K 4I18A 3RP1A 4I9WD 4CC4C 1SDYA 3DHJA 1IO4C 1C5DA 3MJ6A 2FECI 1XGUA 4J4PD 5E94A 5HDWA 3P9LA 2ZCHL 3LSOB 3KWUA 3GMRB 2AJZA 3L3OC 5E70A 1T0NB 1H8NA 2W88A 5C0CA 2HCZX 2MTPA 2VLME 2CUIA 1IL1A 1JGUL 3PJSB 5K39B 4L3CB 5ISZE 2IPTH 1A7OL 2CNYA 5JZ7D 2B9BA 1EJ6A 4R6UA 3RBGA 4IDJH 2BMKB 3WIHH 1P84K 3MO1A 1CFMA 2BCKB 4Y9CA 3BVXA 2X4RB 4TUKL 3KLAB 1U8HB 4L3AA 4XO3A 5TD4A 2ZXDA 1XBDA 3QHZH 1QI4A 1CZ8L 3HG1B 3NYKA 2WWOA 5EDXA 3M6DA 4NI6A 2OZ4L 4AM0Q 5I6OA 3HFML 4IOFD 2FX7H 2NY2B 1O6SB 2ZKHH 3EBAA 2IVFC 4YBQC 3QJSB 3PXLA 5BNXD 4G6FD 3VWJD 4J3OD 3IGUA 3LN5A 4JRXA 2ADGB 3LKRA 5F9WB 5K9QI 3V6OC 3WELA 3MV7A 1TNNA 2C1PA 1U2HA 3N3EA 2YWYA 1K5NA 3BZDA 3IJYA 2PWHA 5C3LD 3PWNA 2JCCF 3H3KA 4GSDH 2I9LB 1BZOA 5IBTL 1AHWA 3GXUB 5CGYD 2XBZA 2XFGB 4IOIA 5DJXA 2RHEA 4ACTA 1O6TA 1ZOXA 1NIBA 3FK3A 4H88L 1TPXC 2QR0B 3L1OL 3U82B 4QIRA 5JTWA 1O9VA 3VXMB 3QJTB 1OHQA 3CQFA 1SBBA 3CVHH 2QGEA 4OLVH 4PS7A 3THMH 4FQXD 2VDML 4JCLA 1QQDA 2FSDA 4DUXA 3WXVL 1A8ZA 1UZ6F 5BVJB 2EDOA 4QR7A 1GY1A 3TWYA 1LO4L 3E2HC 3DRTB 3U2SB 1J48A 4LKXA 5IQ7H 2AZUA 4BK5A 4PB9H 3LEYL 5J6SA 4ISVB 1PDKA 1PKOA 3WEBA 5DJDA 4H8HA 5E9DE 4HIIB 3BKJL 4NQQA 2Q86B 1JK9B 1IZKA 2DQCL 5D7JA 2YPKA 3H4HA 3ENEA 8FABA 3ZHKA 2Z91A 4M5SA 5JIDA 3CFDB 2LAAA 1FYTA 3IN2A 4Y2OB 4Z7WB 2GIYA 4HUMB 5LAXB 4X80L 5E6IC 4MBRA 5E1GA 1HHJA 4K71B 2YKLH 5I73B 1YMMD 1ETZB 4WRLA 5LBGA 5I6XC 2AJYL 4N5UA 3TBWA 1SEBA 2MKWA 4PMFA 3QJFA 3B2UC 5E1HB 1H8LA 2IIJA 4PRDB 4XX1G 5E23A 2PYED 2NOYA 5CD5D 3F65A 3FBQA 3QUZD 4EZKA 4L3ED 2M8XA 3CBKB 2VO8A 3MYJA 1U8IA 3ZZSA 1H6EA 1BPVA 1EEYA 3BFWA 1ZLSL 1Z5YD 2CR0A 4NPYA 4A7UA 5BO1L 4D9RD 4OM0L 5GGRB 1INQA 4P5KA 5FYKU 2V9UA 3ULUF 4CADB 1J12A 4LPYA 1U42A 2ERJB 4G6JH 5KVDH 5LLIC 5JUEL 2WLLB 2BY0A 3BAJA 1BLIA 2GY5A 4ONHA 5GRUH 1AGDB 1IM9A 4JDEA 3A67H 4QCIA 1SQMA 4IRSB 3IDXH 4X5LA 1EMTL 4HX1B 4WWPA 2XZCH 4OUUA 4U1HB 5F0MB 1JAEA 5F3HB 3SN6N 3KPOA 4KXZI 1SVZA 4JGUA 3UTQA 1F4XH 1A7RL 3ZDWA 4JO4H 4FCAA 5DSCA 4YHOL 4Y5VB 1I7ZB 3UTSB 1F56A 1F11A 2BINA 3QJHA 4X8CA 1UFUA 4TVPH 4M7JH 5IK3B 2Y07H 1O5PA 1YZZA 3QR2A 4H1LB 4OTXL 3UYPB 2X4OA 4NQEB 1R47A 2D7TH 4X9BA 1MI5B 3AT9A 5LJYH 1QFUL 4Z8FH 1G7MA 4OZHA 3LNEA 4BQ8A 5JA8B 1FL5A 4YLCA 3L48A 3EJZD 3GXIA 3MRIA 3SCMA 4HOZA 2V2TB 3PQYE 5F6HJ 3RZCC 2BP8A 4L8BA 3ELAT 1KACB 2DQEL 1ZTXH 2HT2C 3CMOL 5HDBE 2R9HD 2E7DA 3GMLB 1UXSA 5CBEB 3S96A 1OQXA 3UBFA 4DP6X 1JI2A 2CKBL 1YEKH 4OLZH 2BOCB 3P3YA 4QRSB 4NO0D 5JW4N 1J8HE 2W0KA 4QWWC 1HYSC 2J2ZB 4K2UH 3QZWG 2BXZA 5IIEA 5T3ZH 2GJZA 4JL1A 3I6SA 3LXUX 1BVNP 2NY3C 4RWYL 3CNKA 2A6JA 2X2YA 2OW7A 3STZA 3VACA 2Y24A 5GRVK 3UGEA 1UUNA 3ALXA 3JWOH 5CLWA 2ZP0T 2X87A 3TT1H 4PJ8B 2CPUA 4XX1E 5E6ID 1OAKL 2FL5A 3BUTA 3MLVL 4DETA 5HSFA 3VMPA 3NSDA 4N90E 3JWNE 2Z65C 5DVNA 5J11B 2TRYA 5E5MA 1JPTH 1G7HB 1Q72H 1FFOB 4PCKA 4B9KC 5KYYA 3UTZB 5IHWA 3OKDB 4ZMVA 4AQ8A 3ZTNH 3U36A 3VXRE 4NN7B 3ECUA 3FFCB 2AQQA 2VSMB 3GPSA 4Y5YC 3BUIA 4YSUA 3Q2WA 2WXJA 5BQ7B 5IR1B 2BOLA 3JV4A 2DYPB 1A6WL 3U30C 3UACA 2MPVA 3FN3A 3NVQA 3WUWA 1P5VA 3HE7B 2Z35A 3ARWA 4LDOB 4XXCC 3V6FB 4OZIF 3MROA 3Q9PA 5HHXH 2I24N 4NLHA 2ITDA 4BUQA 4KKBC 2Y5QA 1OLLA 1ZRUA 4AENA 3FCUB 4GKOA 1IAIH 2ITFA 3OSVA 4KROC 2IV8A 3D3VD 5TPWL 4IS6B 5E6YA 2XQYA 1CLVA 1EH9A 2UXVA 1JPGB 4HS3A 2O61B 2OPCA 1HZKA 3KYOB 1BVNT 3U0PB 4PWEA 5I1DA 3QORB 3CHSA 2N0MA 4CN4A 2PXYA 3NCYP 3MJ8A 4CUCA 5EO9A 4R4FL 5EB9A 4AYDC 4R7NB 2PP7A 1AD9A 4BWUA 1M2OA 1SEQL 5IHUH 2AEQL 4MA1C 5E2VH 3NUKA 2DQDL 1XGPB 4ZPVB 4F9LA 5EHFA 1MCPL 4M62L 3GZOA 3AU1A 5BRZB 3NIDB 1NCWL 2FJSA 3VWKC 4C47A 3U9PL 1JVLA 5AKRA 2H6PA 3TO4D 4PI2A 1Q9WB 4LQFL 1AE6L 1FBIL 4M61A 1Q0YL 1BBJA 1KB5B 4G7YH 5CN2A 3ULUL 3BPOC 1WRFA 1ZT4B 3V0FA 3MOBL 2Z31A 3NIFF 2IEPA 3BKML 1DSFL 3IK2A 3FSOA 2G4GA 3LEVH 3DGDA 1DVXA 32C2B 3FQ4A 3MJ9H 1GL4B 2WKGA 3SQOL 3MXWH 1ZLEA 3RZCD 2KUTA 1KIUB 1IC5L 3GDCA 3HE6B 4NKOB 4W81A 3V8CA 4MA7H 1RU9L 2EILB 3QRGH 1JWSA 4WI3A 3D0LA 1N3NA 3KM1A 2A6KA 9CGTA 5ID1A 3DIFB 3V52L 2K70A 2B0SH 1PTZA 5JW3L 1S5HB 1N7ML 3H1ZA 3RPBA 3ZKMC 3HB3C 5DS8A 5ITFA 2KDYA 5DK0A 5KS9E 5DD6B 1OTSD 1DSWA 3E0GA 3QIWA 1YUHA 5D1QB 3DOIA 1RJYB 1FE8H 2WB7A 2GK2A 1GIGH 4FI6A 5K1VA 3ZO0A 3QIBC 1WH0A 1E2WA 2B15A 5CKAA 2ZWZA 3OPZL 4ALAH 3GSUA 4YDIL 2YIHA 2AQ2A 3QJZA 2F8XC 4HIEB 3JUZA 2Y7OA 2OSYA 3ZY7A 5K9JL 1J9QA 1Z3GL 3G6JE 5GRJL 1JF6A 2BC4A 3ABGA 2BVQB 3QXDA 2BOBB 4XWGL 4KKCC 1THCA 3MSPA 4GMSH 3MJ7A 4OIAA 2IXQA 3ARTA 1Y6NR 2HLAB 2JB6A 1HCFX 3HI1B 3B7YA 5FS5A 4L4VD 4NZRH 1SDDA 1X7TA 2VM3A 5DJ6B 1EUUA 1DQQA 2DMBA 4GW5A 4ZT1A 5GJTH 1T6WA 3D4ZA 3QEHA 4X7SH 3UJTH 3HAEB 2MCPL 4HGKC 1A9BA 1T22B 4RH4A 5D2LE 5DJCB 1V54B 3MUJA 1G7PA 4BHUI 3SO3B 1SM3L 1HU8A 1DEEA 2ARJQ 3OHXC 3FTZA 5FW6A 3F6IA 3BAIA 3HPJB 4LRIA 1I1CA 5BO0D 5GGSA 2FHFA 1UZ8B 3NGBC 3MTXA 4HKZA 4BQ6A 4J3UA 4ODVL 2GTQA 5J1AA 3QI9D 2GBVA 2JF1A 4YXKH 5C92A 4P46B 2O6DA 5DEFA 4AG4H 3V4VH 1FVCB 2MNUA 3ARBD 2ADJB 5L0QC 3NZ8A 5I6KA 2SODB 4NQDB 3QQ4A 1UKTA 2VIRA 3KPSD 5KBDA 3GBMH 5ACZB 2X9ZA 2ROYA 2WZ5A 2MQCA 3IETA 3SDAD 1N9PA 2YC1A 1DVFD 4LVOB 3O0RL 4XVTL 1WHOA 3BQUA 3VD9A 3HIZA 2CQVA 5FLUA 4ZTEA 3KXFB 3MMEB 1N5YL 5FKPA 1UT9A 3DX9A 3IFPA 3QJUB 1K4DA 1YEWA 3MLYH 1BMZA 4QHUA 4P4KC 4HGMA 4Y2DD 2DWTA 1B4RA 3VW3H 1MJJB 4UDUB 5C0FB 2EVGA 1LP9B 4G11A 3K8KA 1IFRA 4HAFA 4JPQA 3SDCA 3D8MA 3MCG1 2F7IA 4OD1H 4BELD 5D71L 4A55A 2Y69B 3NCJH 5IWLA 5L7XL 2XN9E 3IGKA 5JO5A 1ZGLB 5ECGA 5A7EA 3KL3A 4B9ZA 3QNZB 4Z7VB 5I0YA 1YEEH 5B7MA 1CLYL 3CFNA 3DX0A 4L8CB 1B4LA 4Y9BA 4QRRA 1KG0B 2YSSB 2KC0A 3SIKA 5LDUA 4HLZH 4OZ4A 1RMFL 5E2TH 1GVIA 1X9UA 1MFNA 2NNXA 1TEYA 2J73A 3C6LA 1PKQB 2XZAL 2H1PH 3FO2B 2E7CA 4YHMH 3JZ7A 2YPVA 3WS3A 4R26H 4P2QB 4YX2L 3UAEA 1BF5A 3CFQA 4ODTL 4UT6H 5ICYA 3LIZA 3KLHC 5AW1B 4OFKA 1BECA 4P3WA 1QA9A 3B1UA 2ZYIA 3U7WL 5ESVA 5I76B 1G9HA 1JF1A 4F57H 2EVFA 4JQIH 4NERA 4YAQA 1IJ9A 1PZCA 3MA7A 3ULSA 3K71B 5KSBF 1QRNB 3M17B 2R1YA 2BNRE 4DP2X 2FR4A 3GS0A 3O4OB 2XZQL 4WFHE 3GEFA 4S1DD 3NFPB 3V5HA 1T21A 2ALAA 3UTPD 1YEGH 4PRID 4F5CA 1YLBB 4K5OA 4AYFA 1BV8A 3D2UB 5AAWC 1KXQA 1E3FA 2DKMA 5FO7B 3SKJL 3CGTA 1OB0A 3JTSB 4XMPH 1E5UI 1G5AA 1L9QA 4N6RA 4NJAL 5C09E 1QSEE 1GOHA 3IFOB 4UZSA 4IHOA 1K8DB 1QBBA 1QASA 1UOLA 1A6ZA 1R9FA 4DAGL 4ANXA 3WSQH 4F9PA 3ZIYA 2IFFL 1NFDE 3I74A 3VXUA 1U8LA 3ZRFC 3EGSA 4M7KH 2P5ED 2VXQL 3LKOA 1PCXA 2BHZA 4WV1C 1FORL 2B1OA 4IBSA 5T1DH 2WWKT 5FW8A 1H3TA 1KTLA 1GPOH 4PJXF 3VA6A 1LQBC 4ELME 4UOW0 4NC0B 5IV2A 1BZDA 3CU1A 1MW0A 4MB4A 1H3UA 2R69A 4XCYA 2XRAH 4HJUA 1KTRL 5KJRL 5L6YH 3WAJA 1R0AH 2VC2H 3ZDYE 4R7DB 2WBJA 3O3UN 3O2VL 5DTFA 5J6HB 3APDA 4G72B 3W38A 3WGVB 2J1XA 2XSKA 5HHOA 3VI4B 1H8SA 2DMHA 4YUEH 3KHOA 1H5BC 4KTEL 1M2VB 1L6ZA 3MGTB 1AC6A 4WKZB 4U1GC 4FNSA 2F61A 1TQWA 2GTWB 4EIZC 3NFSH 4GKLA 4NOFA 2EDTA 3GC3A 1PZ5A 4GUCA 3DHPA 1RUMH 3GWJA 3MC0A 1DVUA 3H56A 1P0SE 2CIKB 4G6MH 3QYCA 5FHBL 4KZEH 5LDSA 4QRTB 3QNXB 5H2BA 3ARDA 5D1XB 4FNRA 1OCWH 3LPGA 3V2AR 2XKNA 1YAIA 4JY4A 3BSHA 3ZDXB 2PPAA 1OGSA 1PNCA 2R1WA 3GK8L 5C6TH 5K59E 3B9KA 5I75B 5MEND 4K94L 1VENA 1BZ7A 4K3GA 5DLMH 1QFWH 5F6IB 1RSFA 3OKEB 3T8VA 4AK2A 4IRJA 1VDGA 4AYID 4GNKB 3WY4A 1JTOA 3FUMA 4OV5A 2EZ0D 4FHBD 5CLTA 2NY6C 2WD0A 1BD2D 5FA4A 5C9KA 3JXAA 4KJQC 4NQCB 5C2BH 2AEPL 2ZWKA 3MV11 5BJTA 4NUPA 1T7YA 15C8L 3N43B 5L88H 4K7FB 4E9YA 2QADD 2X4UA 4YSDA 4TULL 3FCBA 4QMEA 3NJMA 1L0PA 3IDUA 3QUMH 5GGUA 1EZVX 5FYLD 2AAVA 3K4AA 1RUPL 1VHPA 3K1KC 1H6UA 1EBPA 1JWMB 2M2DA 3KW8A 1NCBL 5IBLC 4PB0H 2JKNA 2KQNA 2HRGA 1K72A 1YYMH 1RULL 1LM8V 4H0HB 5GZNC 3UROR 4V11A 5HI5D 3FQRA 3MRMA 4Q6IB 2HKFL 2W0FB 3RVVC 4EUPA 2A73B 2D0FA 4UV7H 4BH8A 4Z7NE 4R3SB 5FGCE 2CA4A 1XCXA 5F1OB 3SJVB 1S7TB 3ROLB 4YSAA 3R1GH 2EJ1A 3VNZA 4R90L 4CMMB 4APXA 4H2CA 1MNUL 2N3JA 4LEOA 1DVSA 1K85A 1YN6A 3DSNB 1JRHL 2FYYB 4R2GB 1CQKA 4PYGA 1OHZA 1FFPA 4GQPH 1U8NA 2WZ0A 3RNQA 1TQVA 3INUL 4YHZH 3FUFA 3RAJH 3MZGB 4MRBA 1Z32X 4WW1A 3I3DA 1CFTB 1X9LA 4MNGA 1UFGA 4L4JA 5GGQH 1AO7A 2BWDA 4MAYC 1I8UA 2Z4QB 4R5TA 3ARGA 4U3CA 4XBMA 1WAAF 4Y4HB 1WS7A 5HVWA 4Y4FD 4OKVA 2V9QA 1J5OH 3LJ3A 3AWFA 3S34H 4MNQA 3RU8H 1CBJA 1L9MA 2O6PA 3LPOA 5DJAB 5IB4A 3JWDH 1YPZA 1MRDH 4JFYB 4ODUB 4LHUB 1PCSA 1UVQB 4NGHL 5CJQL 1PYWB 1XSKA 5LBSL 2WUCH 3OXRA 1OSEA 4QYOB 3ESNA 1OAQH 3RTLA 1BXXA 4FQQA 4Z95L 3SDXB 4WNJA 4Y4KB 4CW1B 2YN3A 4MVBC 4NI3A 5F88A 1JJUA 3G5XA 4UIKH 1IGCL 2BDNH 1SN2A 5F7HA 4OH2A 2EDLA 1IARB 5DMIH 4OQTH 2P7TB 2ODHA 2ITCB 3FU9A 1EFXA 3P54A 4YHLH 3SO5A 1RUAH 3QEQA 1N6UA 3ABZA 3H9HA 4LPWA 4OVVA 5FYKD 3TASA 4DQAA 1AR1D 1CIUA 1DQMH 1JXKA 1N5AB 4GAJH 5FKAA 1A6VL 5KG9A 2OI9C 3HNVH 2GTZA 2WPGA 1VEOA 1T0MB 4JFSA 2R7EB 3HVNA 3PWPE 4KHTL 5T1MB 4APQD 2A99A 5LN8A 4PJFA 2GHWB 3FQUB 1QAWA 3AWEA 1RZJH 1SBSH 3H7BA 2EYRA 2D7OA 4TVUA 3FQXB 2J4WH 4TQ8A 4GRLD 1SXZA 3J27A 5C0BD 3V0WL 1FZOB 2XVBA 1D9KA 3FF7A 3CN0A 1EK3A 3KYKH 4OI7A 3L9YA 2CRMA 1G9NL 3VFPB 3GBNL 3BLBA 3KHQA 1K5WA 3U48A 2ZKWA 4KU1A 3DMMA 2VM4A 5TQ2H 5JLZA 1ZK9A 5JW4M 2FJGB 3QJQB 2OZ4A 3HNSL 3TV3L 3B8YA 3ARFA 1JE6A 4ZAKB 4HH9A 4KUZH 2OMWA 5GZND 4HPYH 5K33A 2DWDA 3EH5B 1WFNA 1N64L 2IAMA 1WCBB 2WLMA 2WXFA 5JDJA 2UX7A 3AG4B 4K8RH 1L6PA 1IAII 3TFKC 3VFRA 4DGUA 1Z9NA 1AANA 2F58L 3O3EA 3EYFA 3V0AC 1R1CA 4POYA 2J8UB 1MHEA 2QVMA 5DF0A 4P5RA 2XBDA 2TSBA 3PCYA 5AVTB 5MP6L 2HJLA 3KDMA 4BGDA 2VDQB 4LAQH 2OMNA 3MLRH 3FHAA 1SLUA 2FBJL 3BP4B 4ZFGH 3REVA 4E5XA 3M1BB 5CZVH 1ZVSA 4JO5A 3DIDA 4NCC1 2VN4A 3U46A 1MQKL 2VDNB 4AX3A 3OB0H 3VRJB 1LD9A 2OQJB 5I1GL 2FT6A 3ARZA 5IJBC 3A6CL 1KFGA 1FRGL 4OGYH 2NCMA 2OMTB 2PW2A 5D5ME 4OF5A 2CBOA 3V7AG 2H1XA 1NCAH 4M7ZB 2X4TB 2NY2C 4FABL 2UUDH 5L4IA 4WVRA 2FJFA 3KPQA 3HN3A 2XTSA 3IDMB 5E9AA 3IJHB 5I19L 4JDVB 1ZGLM 4XCNB 2Z8WC 2FT8A 5DJ2A 3X17A 4NHCH 2ZQKA 5F9WC 1PEWA 2PKDA 2OTPA 4PJAE 4OT1L 4PJGB 1MF2L 5AUMA 1KYOJ 5FYJH 4Z7UA 2IO5A 5EZIH 1A7OH 1OM9A 1F86A 2M83A 3RWGB 2DLFL 5AQ0A 1BJ8A 4P06A 5HTSA 1EVTC 1UKSA 2J1YA 3C2AL 4QGYA 4JFDB 1RZ7L 4X4MA 5HYIA 4MVBD 4EI0A 5IM7A 4LPUA 3ZDZE 4EDXB 2ZUVA 3CX5K 4ODHH 3RWJA 5EUOA 1ES0B 3TJHD 3RVXC 2HFGL 4LOEA 2VW4A 1FPTL 3HFMH 4I5BB 4OCXL 3S8FB 4NKIL 1A1OB 2JI3A 4FFYL 3FQTA 2APTA 1G7IB 3ETBJ 2EINB 3L45A 3MRRA 2DLTA 4IIZA 2VXVL 4PJCE 3KLSA 3V9CA 4XOCA 5EZOH 3ZQ9A 2XY2A 1S3KH 4HUUB 4OZGB 2D03L 3RVUD 1ZS8A 3EBIA 3C5XA 1F6FB 4F58L 4HPHA 5IBTH 4HV8A 1IEBB 2NNFA 4B5ZA 2VLJB 1N6QH 1A6AB 4YHKH 4M9PA 1AGEA 3VCLA 1N8ZA 3NEEA 2VZUA 4H88H 4KKAC 3L1OH 2IQ9L 3RJOA 2VDOL 4GSRA 1QABA 4HEPG 5TH2B 5I73C 3IJEB 5E8EB 1R4XA 1S8DA 2QTEA 1C1EH 1H15B 4XB8A 4Q4IA 2IBBA 4KY1H 3WXVH 1CXIA 2HFTA 3AZUA 3BIKB 4LU5L 3OKKA 4XCCH 4XVJH 3LXBA 3SPVB 3LEYH 2ICES 5EF0A 5KSVB 1IAMA 2H45A 2EDWA 2CMRL 1B3JA 2A9CA 1HS6A 3BKJH 1BMWA 4G7VH 2A6IA 4X5RA 3LQMA 4J6RL 2ILLA 4OD2A 4C59B 4DO6A 4GYBA 3FRPB 1U3NA 3QQ3A 1QP1A 1UURA 5IHLB 4IBLT 2ZIDA 5IQLA 3UCRA 4Z3IA 3TV8A 1QD0A 3GZQA 4JN2A 3SPJA 1HESA 2BP3A 5ICZA 5JNYA 1KGCE 2XQ0A 4OCSH 2ERJC 2X6MA 5C0EA 1QHOA 2YFNA 3EJSA 5AAMC 4H4NA 3K4DA 4JRXD 4LMQI 2AW2A 2AJYH 4BA0A 3DTXB 1OWRM 1JWUA 3MV7D 1TLMA 5CFAA 4PJ5B 4IRSC 2GIXA 3D39E 4GXFA 1JZEA 1Q38A 3QEGL 5I9QB 4ZQTA 3N1GC 2YUZA 3QWOB 1ZIAA 2R2HB 5IW3A 2F9BT 4Y5VC 4DZBB 2JCCA 3IDJB 2AXWA 1M57B 5HYEA 3ULVC 4Q6KA 3L4YA 4GG6E 2EP6A 4R5VA 3W39A 5I0ZA 1PG7W 2XYBA 1E8YA 5JOPE 3HC0A 1DJZA 3DX7B 1MLCA 5DZVA 1AGBA 1CQYA 4MAUH 3HG1E 5H94B 1GJWA 2W60B 5T1KB 2GJRA 1XV8A 1XH3A 1ITCA 2DBLL 4JJ5A 2CGZA 1L9RA 3MCYA 3DX3A 2UVEA 3MR9A 4FMFA 5HI3C 1RKRA 2DTSA 2F19L 1E27B 2ID5A 2DWEA 1HWHB 4WY7H 4FZEL 3HS8A 3CN1A 3UBXA 2YS4A 5D7JD 5CJ5A 1P7QB 1XD1A 4BIKA 1DJYA 4N1CA 2KZBA 4AQEA 5H37H 1A7RH 4LCCB 3Q8BA 4YHOH 1FGVL 3M86A 3WHXB 1I4FB 4HLEA 3CFEB 4P49A 2OM5A 5GHWL 5ICXA 3CSYA 3FO1B 5LQBH 4F37K 2GJ6A 4YNYA 4OTXH 4XNDA 1MCOL 5FO9A 1A3LL 3WI9A 2Q1EA 1CE1L 1XMEB 5HVGB 3EJJX 4RGND 5DHYA 3RA7L 2P5WA 1AFVH 4H1LG 4CRPA 1DTUA 1CFQA 2HMID 3VXME 5HI4D 4WI7A 4DN4H 4DPAX 3S88H 3FTYA 3MKKA 5CMAA 4QRPB 5F7AA 3T2NL 4ERSL 1INDL 1KBPA 2WXMA 4JFTA 5KYWB 1IC0A 4GAAA 4PJ8C 4YL4A 3V79C 3AY4A 5GSVB 3G6AA 2FX8L 3CAFA 2PWFA 5J11C 3VFNB 2DQEH 4ABQA 4N2OA 3NSCA 3WFBH 4F33A 5IJVB 2R23A 5TK4A 1E9QA 2ICWA 5HDQH 2VNCA 4UOW1 3MX0A 3BAWA 3VB9A 4FXKB 4FG2A 3MLWL 5KJ7E 3FMGH 3KBFA 3LH2L 3IN0A 2JI2A 1EX0A 1T04B 4EIUA 3HUJF 1IM3D 3RY6A 4LGSB 1UD4A 4U6XA 2NNAA 3SODB 1HTYA 2MEJB 4Z7WE 2EDJA 1RZKC 4JZNB 4Y1SA 3HE7C 5DGQA 1IM9D 2IMNA 4WGKA 1FO0B 3EDDA 3EBHA 4RWYH 2AXFA 1E43A 4IMLB 3SYCA 4LSRH 1OGAB 3QEUB 2UZPA 4JE0A 2JKRM 4YPGA 1RURL 2OXGB 1OAKH 4POUB 3F8UB 1BXUA 3MLVH 3I6KA 2IANA 5LCVL 3ESVF 4LSTL 2E74C 3UERA 5AB1A 2JI1A 3QORC 3VU2A 4TLTA 1RCYA 5DHVB 2QFPA 5AYUL 1ZHBB 2WXHA 1X44A 2CA3A 1MFBL 4A7QA 4E42B 4U1MB 3LS5L 2H7WA 1WIUA 1NC2A 2HX7A 2XACC 3OB8A 4WGVB 5D7SH 4OAWA 2QV2A 3KH3A 5FCUL 4H5SA 3HPLB 4WUUB 3QDMD 4QAMB 1F1GA 4AQZA 4W6WB 1HHKA 2OYPA 3IVKA 4C56A 1ZT7B 3ILDA 1WTGT 2GSIA 3FUIA 4WUKH 2ZSWA 1P4BH 1WFTA 2JTDA 1JYVA 1DBJL 5L2KE 4EI6A 4F24A 3U4BH 3LKPA 4Z3JA 2UWEB 4X6FB 1PU0A 2EDDA 1TQCB 3IAPA 5DD5L 3HE6C 4F8PA 4MS8C 3UTSE 4Q9BA 1CF8H 4OLWH 4YDJA 1QFWI 3QC5X 4MYWB 4Q4EA 4F93B 1CGYA 3H9ZA 4PJ9B 3ULVE 2DM7A 2LR4A 4LPTA 2AEQH 4NQEE 4FMVA 1RZIA 2DQDH 5AYTA 1MI5E 1MCPH 3LN4A 5BZWA 1NCWH 1MDTA 4KUCD 4P4RB 1UGKA 1T1WB 4JM4L 2XA8L 3QXVA 1OARH 4WSGA 4LQFH 5HYSB 4XNMA 1AE6H 4XZ4A 3M1OA 4TSBL 3FT0A 3TNMB 2GUOB 4LCYB 5GGVH 3MOBH 4HFUL 5EPMA 3ML8A 2VLKD 1DSFH 4U6HB 3SBWA 3T77A 5CEYB 2BRRL 3LS4H 5EU5B 4E9LA 4WF7A 1ORSA 3K5SA 3TZVB 5GQBA 2J71A 1OCOB 2QLVB 3GJFH 1JZDC 3IRCA 3D48R 4U3XA 3FTGB 2H0FA 2VDRL 1IC5H 2NY5C 4KRPB 1YA5A 2K3HA 3FUHA 1J0HA 2EC9T 2VUOA 5C07D 2R0WL 3BVUA 4DP8X 3S7GA 1MWAL 3LH9A 3DVIA 3TNNA 4NP9A 3EADA 3GGWA 4OZIA 5IMLB 1OZTG 2WYZA 3H8NA 1MY7A 3ZYJA 4OVUA 1U8KB 4X7TA 3ECQA 2W80C 5EUKB 1X4ZA 4CC1A 1NDMA 4D3CL 2G2RA 2UYLB 3ILEA 1IKOP 1F3JB 2PXYD 4X4XB 3H9YA 1DLHA 1NUDA 1ZA6B 3QJOA 4Y19B 3SO3C 1R46A 2EH7L 4HJGA 1GR7A 2Q76B 1L0QA 1OOAA 1ACYL 5DUML 3NZSA 3QUXB 4BZ1L 3BP5B 4PP2A 5K9JH 1Z3GH 5GRJH 2ZTBA 3CVHB 3FFCE 2WCGA 4FNUA 3NH7H 3ZHNA 1BIIB 4L9DA 2NT1A 2X10A 5AOLA 4L8DB 4NCC2 3TFBA 1AS7A 4P46C 4KQ0A 2C4FU 4KPHL 5C2UB 1TEGA 1FNLA 2Z31D 4RIRA 2DDQH 3BP7A 3VD5A 2ZE0A 4MKMA 1C5DB 1P2CA 3SGJC 1OEZW 2H6UA 4OI9A 1IMHC 5BRZD 2K1MA 3HMXA 2EYSB 2VDKL 4LNRB 3MXVL 4P5TB 3IJSB 2MCPH 3R0NA 4LVOC 4K9EL 3KJ4B 1GZQB 2A77H 2ENQA 5C0CB 4UQ9A 1HK6A 1SM3H 5I1EL 1IL1B 3HAEG 3EH2A 1CXKA 2MRYA 2V2WA 4PJIB 1X3DA 1T0OA 2QBWA 5ACLA 1Z0NA 4GY4A 4MKTA 2H47C 3MO1B 5T1LA 3KPPA 5KZCD 5AFAA 1UJTA 2KERA 3NIDE 3VI3A 5BUPA 1I8LA 5SWQA 1D6EA 3BVDB 1KY7A 1QTPA 1HCVA 2ZSVA 4B3VA 2MCMA 3X1BA 1NIFA 2AZAA 3TOPA 3TYGH 2X2IA 3CN4A 4HISA 4P2OB 1JNHA 1PPIA 1MRFH 3VD3A 2IH9A 3KPRD 1DFBH 3VQ1C 4W6YB 2EEBA 3ZIMA 2RB8A 3LN5B 4I9WE 5KBMA 3LKRB 4ONFL 2C1PB 2EEFA 4XVTH 5I5IA 2XFXB 4K23H 2BVPA 3SYAA 1K5NB 4Z77A 5EF2A 5E5UB 3GQFA 1N5YH 3L1EA 1E28A 1X6NA 4HSAC 2FATH 1MCSA 4PJEE 1JHTA 3I9IA 2R39A 2HN7B 3ISWA 1UWXH 1U2CA 1KYDA 5DJXB 2VXQA 1T66C 3EIFA 1D5BA 1D5ZA 1SJEA 2DLEA 3L3GA 4LGPB 4ELDA 5DFAA 4PBXA 3T6ZA 5C8JA 4R7VA 1XF2A 1OPOA 1RJZB 1JGVL 2OCCB 1M05B 2D7MA 4WJKB 3S2CA 5D1QE 3MBEA 2WLJA 3OB0K 3O4OC 1CLYH 5BS0D 4QJ3B 4DK3A 1IFHL 3WO4B 3KYAA 3WY1A 5EA0L 5A6MA 4G82A 2DQHL 2XV2A 1NINA 1RMFH 1Y6MR 5DJDB 3H6JA 2XZAH 4B9GA 3W82A 4LLQA 1EIBA 3VE0A 1HQRA 4WTQA 1JL8A 1TETH 4GT7A 3AREB 2DQFA 3K1DA 1FYTB 3E3QE 4ODTH 4WDIA 4NSKB 2GEQA 3D0VA 4LVHB 3BEWA 1DJGA 4UMSA 1KELL 1MCWW 1CFSB 3U7WH 2BW4A 1PS3A 3QHFH 1KOAA 1H3PH 3O11B 4E9SA 4IKJA 3RWEB 1RVFL 4B0MB 1SEBB 4JUSA 3OGOE 1SYSB 4U2ZA 1DHKA 3A6OA 3QAZC 3QJFB 4U1KA 5A2BA 2Z7UA 1VGKB 4M6AA 2XZQH 5BUGA 3VQMA 1R75A 1WE5A 1UM6H 4X6CB 2HLFC 1I53A 2WTRB 4YWGL 1ED3B 1K3IA 3MYJB 4LESA 1OCRB 1UXLA 3SKMB 3I9AA 3SDCD 5DLLA 4NPYB 3SKJH 4XHQA 2L04A 3ZVVA 1EXGA 3QXUA 1FC2D 1RD6A 4NJAH 1AP2B 2BZ7A 4H8UA 1INQB 4P5KB 1VEPA 2DQGL 2VXTL 4DAGH 2BIPA 3NJVA 4YSRA 2XZZA 1GW6A 2A6DB 1T2XA 3SYOA 1FHGA 1ZMYA 1ZVHA 4JX0A 2Q3XA 4ONHB 2A2QT 3AB0B 4QRRD 5E2JA 3VFGL 3BE1L 4BCYA 4JDEB 4QCIB 3IU4L 3CFJB 2DH3A 3C6LD 3UZVB 1ETJA 2VMFA 2VLRA 3D30A 3KPOB 1DZBA 5TK2A 1J0IA 3QA3B 5IJKA 4KH9A 1UYWL 5KJRH 1FAIL 3PNRB 2V5SA 5I75C 2CJ3A 1HZLA 5EH1A 5JHDA 1T7ZA 4QXVA 5F6IC 3VXSB 4FJZA 3BW9A 1P6AB 3CDYA 3O3AA 5CCHE 2X4OB 2B1HH 1I3GL 4QOKA 3UYRH 5E00A 4NWUL 4R9HA 4OZHB 5E95B 4RBPH 4S0TD 5H35B 2BVYA 3NPSB 4PTTB 1DQJA 3DPBA 1FL5B 3MRGA 5FOBA 3MLSL 3Q43A 3MRIB 1F8TL 5EOTA 4AITA 4D0DA 3SCMB 5J4MA 5KSBA 2RH0A 1JZ3A 3WLBB 4UT7L 3DO3A 3MVSA 4R4BB 4S1QH 5KAQF 4L8BB 4OB5L 3SEPA 5JIMA 3HCVB 5FFOA 1V10A 2B39A 4QLRA 5ESAA 3V95A 3RL2A 4ODBD 3S96B 4TNEA 3GK8H 2V7HB 2Z92A 4ZSOB 2NX5A 4NZTL 4L4TD 1PKQE 5JHBA 2G9KA 1HEHC 3PAVA 4DQOL 1OAZL 2J6EL 2VJXA 4Q6IC 5D72H 2YOAA 5J8OA 3VXUD 3VD1A 2HWZL 4P2QE 3VGAC 4PPTA 4I3GA 1VCBC 1CE6A 5SWSD 4KTDL 3NZHL 3LZOA 4GSUA 2HT3C 3GXTA 1C5BH 2A6JB 3STZB 2AEPH 4CNIA 4PI0A 4N0UA 4Y7MA 5FGBC 2GIMA 2O26U 4PMEA 1LQSR 1ZHKB 5BVPH 4QHLA 4R2GC 3E8UH 4PJXA 3BUYA 1QRNE 5HYJD 5CO1A 4ZFOA 3SGKA 4FS0A 1KPRA 5IUSA 5JORA 1NANH 3LHPL 3WE6A 4LGRB 4OIIL 1L3NA 3D08A 1WC7B 4ZMXA 3L3IB 4FG6C 5ID0A 3QZPA 1JNNL 1FZKA 1RULH 1XB8A 1XF5A 4QJ5B 5DJZA 5DFVC 4EBQL 2HKFH 3PAYA 4UINL 2HLFD 3DV4A 3JV4B 4G8GA 5E8DL 5I17A 1GC1L 2V8MA 4Y4HC 3WUWB 3GMOB 1MDAA 3MROB 3FQ2A 2WC7A 2H3KA 5I16B 4JR9L 4R90H 3KGTA 1MNUH 1FDLL 3W9DA 1OK0A 2C9VA 4LLDA 1TZGL 1NBYB 1Q9OA 2F1BA 3B9KD 4HS3B 1LDPL 5IVZA 1CICD 5IHBA 5K9QG 1RPKA 1V7NH 5F7UA 1TO5A 1WIOA 4KK5D 5I8CA 3EO9L 1B4JH 5DZLA 4UTAL 4Y4KC 4RQQA 1ZJBA 4IRJD 3D85D 5I1DB 4WWOA 1FNFA 4KAQL 1CFNA 5C0RL 3DO4A 2WWNA 4NBZB 3R8BB 1QHQA 5FC9A 4F7PB 2Z4TA 3AS2A 2WHVA 4LDCA 2YD2A 5I0WA 4ZXBD 3VI4E 4OW6A 3CHOA 3WD5L 2YBGA 4X2UA 3WENA 4N2HA 3MRBA 5BV7L 2NMSA 4HFWB 2GT9A 4OLXL 3TIDB 4M1GH 1MHHB 1OCCB 1DYZA 1N67A 5DRNA 1ZV5A 2XWDA 5F1NB 4M61B 2JQMA 4NGHH 5D1XE 5FFGA 3S5YA 4F8QA 1JNLL 3FN0L 4LHUG 4D0BB 1OF0A 3CFBB 3DLQR 4Z95H 5HGHA 1S6NA 5DQJA 3W3BA 1JSYA 2GHZA 1H19A 2VW7A 3TIEA 1BMGA 5DQDL 3RVWC 4WIQA 1CYWA 1IGCH 3JTTA 5A2AA 4GKSA 2F54A 4HCRL 4MXQC 4XP4H 4CVZB 1QBLL 1SLXA 2HH0H 3D0LB 2A6KB 1OANA 1UACL 1T5XA 4GFXA 5EIIB 2GJJA 1WEJH 4X42A 4ZAKC 1RIUL 3O6KH 4HGWB 4LRNL 4HPOL 4KH2A 1E5BA 2HUEA 3BAKA 3IGAA 4NQCE 1BQLH 4Q89A 1A6VH 3PGDB 4MB5A 2CLZB 2ZUXA 2IPKA 3EOAB 3QIWB 1YUHB 4KY2A 5D7IB 1MLBB 5F71A 5HHNA 3IU3B 5I8KH 4LBEB 1QLFB 2Q7YB 2DF3A 1AXIB 3V0WH 1RPUA 1URZA 2F8IA 4ZOAA 2XBTA 3ARGD 1CGWA 4FI8A 2IH3B 4CVXA 4XC1L 1TMCB 1J0JA 1IGTA 2NPLX 2YXFA 4RZCA 4GPVA 4IKIA 2PYFB 4MNQD 4XE5B 4JHZA 2G4EA 1A7NL 2XN0A 3QXDB 1E7VA 5SX5H 1NJ9A 3N44B 4Q0XH 5E4AA 3R4RA 1A22B 3MJ7B 1MG2C 4FG6D 2P52A 4XVSL 3SJVE 4NO5B 1GS7A 1RZFH 4FFYA 5BZXA 3MRNA 5I0VA 2E86A 4HIXL 4PQXA 4MFHA 1LEKA 4AOFA 5EN3A 1HJBC 4LT7A 5DMGC 1JYXA 3GLEA 4YFLF 4M93C 3N41F 4HKBB 4RLDA 2VITB 3FPYA 1DQQB 1QSFB 2C3WA 2J5LB 3GLDA 4K7PH 4LEXH 3TWCH 4Q9QL 1NTDA 4XT1C 5IGXL 5HPOA 4WFED 5MP6H 1J05B 3V6BR 3WL9A 1KGUA 1EZLA 2R0KH 3GIVB 1EFXD 4FD0A 1ESOA 3VH8A 5GGSB 3O3DB 1CU4L 2DQUL 2XIDA 3O45B 3QEQD 4HKZB 3T6XA 3X14B 4DZ8A 2Q3AA 1CD8A 1RZQA 4UB0L 3T6VA 3T3PB 5J0BA 4GUQA 5I1GH 3DI3B 1UATA 1S7SA 4MMXC 4WEBH 3QRBA 2CU9A 1FRGH 1OAXL 2X41A 4BFEA 5DEFB 5CINL 1Z2KA 3SY6A 3GLAA 1YEHL 3GJFK 3NZ8B 3Q8EA 1KLGA 5L8KB 5D8JL 2YBRB 4OBRA 4Q14A 3IXTA 4JRLA 4DGIL 4FABH 5D1ZI 1FH5L 1GKOA 1KPVA 4N2GA 1W8EA 1MFDH 1UM4L 1Y0LB 5I19H 3IETB 2DH2A 1XGQA 1U92A 3BQUB 3SDXE 1I9EA 1A5FL 1W9XA 1KJVA 1MF2H 1CI5A 3N1QC 3V4PA 3DX9B 3FSAA 5EIVA 1TQTA 3N1PC 1LO0L 1FLRH 4MMZC 4NZUH 1XFPA 4Y8AA 2DLFH 1VAHA 3Q8FA 1U33A 1ZD6A 1ZPUA 2C3HA 4N2KA 3C2AH 2Y2TA 4GAYA 4RRPA 3TCTA 2EADA 3VD7A 1EANA 1E4XH 2OCJA 3BFQG 4XMWA 4PS3A 1FFRA 4FE9A 4IBQA 4R96A 5JO5B 1WITA 1R3JA 3FYIB 4OCXH 1A4AA 5TJWK 2VC2B 3QFDB 5DVLA 1OY3B 4AI7A 2BRQA 3AG1B 4Z1PA 1M42A 4M7LL 1CVSC 4OZ4B 3G6JF 3KPSE 4WGWB 5EO1B 3CZFA 1GCYA 4ZUUA 1WZ1L 5KSAB 2D03H 3OHMB 4O2FB 1GGBH 1HAWA 4XBPA 4XNUH 4GLRH 4Y89A 4F58H 2CDFA 2ZX6A 4F7KA 2G30A 2MMXA 2J88L 2OW6A 3T2QA 3N85H 4V1DA 4CVWA 2EKSB 2PPCA 2ZG1A 3HJEA 2IQ9H 3FL7A 2ATKA 2VDOH 4IMKC 5ESVB 1CTOA 3QUKB 1YEJL 4ZW6A 1JF1B 3FQWB 4P05A 1FIGL 2EO1A 3L8QA 3P3SA 4OM1L 2WXQA 5D2LF 5JIKA 2G75A 1R5WA 3L4TA 4EPSA 1I9RH 4YK4B 3I6GA 4E41B 2R1YB 2DYSB 4Z9KB 3VFTB 2IV9A 2Y0SA 2J8UE 4LU5H 1WT5C 4FFVC 3QT2A 4MD4B 3V5HB 1T21B 4YBHA 2CLRB 1IC4H 4G80A 1RQ5A 1PAMA 3F64A 4AYFB 4ANKA 5K1JA 2X4PA 2EDFA 1NGQL 4FZ8H 3WXWH 2CO7B 5I8EA 3P73A 3T2LA 2P24A 2RAMA 2QQQA 5K9OB 4A37A 1A1NA 4NUJA 4N6RB 4KVCL 1NCDH 1U8CB 5DZNA 5JYLA 1BM3H 1GGYA 2HRPL 3K74B 1Q1PA 1NBCA 1JXJA 4IHOB 2BFGA 4EN3D 3DOHA 4P9HL 4G3YL 1IAIM 1AZCA 4UT9L 2IGFH 4WNSA 4QO1A 1U8LB 4WEMB 3RTQB 3EGSB 5JHLH 1KJ2B 3BZEA 3WIIL 1JFQL 3C2SA 2O4EA 3KBEA 5I1HL 1UWXK 2FAUA 3QEGH 1GTFA 5IV2B 3QG7L 3SBRA 1MZZA 4XCYB 2WOYA 5BOPA 1NMBL 1YC7A 3PUCA 3OKYA 4LCCC 1KZQA 3G5VA 4O9HL 4PJGE 2Q6WA 7PCYA 1M71A 2WBJB 1G43A 3L9BA 1CS6A 4UZUA 1MFAL 4GG8B 4TVSa 3FTUA 3ZR6A 5I23A 3QDJA 2NSQA 5HHOB 1QYGL 4P2RD 3Q1EA 5E6RB 3DVGA 1DR9A 1SRDA 4QRAA 3SDDB 4PRIE 2MHAA 3IS0X 5C7XL 1IBFA 4KI5C 4YSTA 4M6OH 1YYLL 5CSZA 1PZ5B 2Q8AH 4N68A 2NUTB 4JY5L 3MRKA 4NO2A 1EHKB 3LRKA 4XP6L 3B37A 1OAYL 3DKHA 4O02H 1HI6A 4PRAA 5H2BB 3ARDB 2R29L 5IQ9A 3EYUH 4ACPA 3BZ4A 1U3HD 2XKNB 2F19H 2XWXA 3QB7C 4FZEH 3EDKA 2P5EE 2HXAA 2YAEA 3V0IA 1IKFH 1T20A 4I77L 2RA1A 2R1WB 4MMYA 2RD0A 4PGBB 3KLDA 2DQTL 4OZGE 4HS8L 1NLDL 4FXKC 4XBEL 2P8MA 5DD3L 5LG1A 4F2MA 4PJDF 3Q13A 3AS0A 1KLFA 5IJCC 2VDPB 4ZO7A 3EF4A 3BX7C 4HC1H 1JD9A 4OV5B 1MCOH 1A3LH 1CD1A 2VLJE 4XPFL 5INDA 5SV3A 5FA4B 3GSNL 3FH7A 3C5SA 3U9UA 1I8IB 5F7LB 1YCSA 3UEQA 3SY0B 3AFLA 5BJTB 1KEGH 1A21A 2VL5A 1Z1WA 3D9AL 5AB0A 4LZKA 4KBPA 5FGSA 2X4UB 3ZO9A 4B3EA 4KMTH 3OAWA 2QHLA 4DO4A 3NG5A 4BWTA 5I8OL 1QSZA 4JANA 2X9WA 3RGVA 3LKSB 3KBHE 3MGOA 5F9DC 5EOCH 4MNHA 5PCYA 4N1HB 2QGDA 4XOBA 5ALBH 3RWFA 1BOGA 2AK4A 3O6LL 3O3BA 4W9CC 1AQDB 3WFDL 5F9OH 5EBWB 3LH2H 3ESPA 5CF3A 3QULB 5MENE 1TVBA 5IFHL 2XTJD 3QXTA 1BYNA 2BSDA 5A2CA 3CPLA 5CAYB 2A3TA 3T0WA 6FABL 1L7TL 4APXB 4YO0A 3S3JA 2A4ZA 2Y3NA 3ZE1B 1IZJA 4HS6A 1XMWA 5B4MC 1BD2E 1EEZB 4PJ7E 4PP1C 5DXWA 4EI5A 5DMKA 4NENA 4G2AA 2G5RA 4PJ5E 2FQEA 3PFUA 3ZDYF 1FFPB 2X1OA 3K80A 2ITEA 5LCVH 1ZAGA 1U8NB 4P57A 5GGTH 3ALPA 3EGDA 2RCSH 3RX8A 4RBPK 3CXDL 25C8L 1TVDA 3F00A 5E9NA 2GJ6D 1TQCC 1NQBA 4WW1B 1KJMB 5AYUH 4MNGB 1E4KC 1MFBH 1WBXB 1AO7B 3NK3A 1UT2A 4ODWA 2J8HA 5FECA 1CXHA 1YYCA 2VQ1A 4NB7A 5KJ4A 2EVIA 2CD0A 3WNLA 2F7OA 4R4NC 1SJVA 1RAMA 2X89A 4KDTC 1QG3A 3DRQB 4GH7B 3SPCA 1QNIA 2OSXA 1YPZB 3K6SA 1TLKA 1RZ8A 4KZDL 5F6HI 1JPFA 1XF1A 4R0LA 4GKNA 2HVJA 4LCUB 4KI5D 1Q9KB 3KNBA 4Y5XC 3BIBX 3IDGB 1GSKA 2ZYHA 3RGBA 1NUFA 2W0PA 4IOSD 1IQDB 1VCAA 1M56B 1ZKAA 4GQQA 4U0RB 3PHQB 2AVFA 3WGUB 2Y22A 4BZ1A 1SMAA 3W56A 4G9FB 3TZVC 5DD0L 2XCMC 1DJHA 2NY1D 3KCPA 4HDIB 4YSQA 4FQHB 1EO8L 3G5XB 5F88B 4A6YB 1E30A 3HHSA 1PL3A 1CGVA 2BNQB 3IRPX 4PRHB 4Y2NA 4KRPC 3IAGC 2LE9A 4AKPA 3ZZ1A 3HUJA 1AGCA 2DWYA 2XWTB 3LZNA 3RDTA 4WAFA 3DETD 4PTUA 3EDJA 3TBTA 4QF1A 4OCWL 2Y1YA 3I3BA 3H9HB 3H3PL 3M7FB 4Z7QB 5FKAB 3WDJA 4U7KA 1ULVA 3ZE0B 4PS4L 2IAND 4Q56A 5ADPH 2WUBL 4N9GA 4JM4H 1VFOA 2XA8H 4G7RB 2C9AA 3WBDA 3DDGA 4PGZA 4G1MB 1TTCA 4PJFB 4QRUA 1KGIA 2W59A 4GO9A 2ZOUA 4TSBH 4GMTH 3H7BB 4HFUH 1V05A 3FTSA 3UTTB 1MUJA 2OV0A 3L9RA 5HYSG 4PUBL 1NANI 4N25A 1ZDSA 1SLVA 4TOYL 1D9KB 3GEWB 4NM8L 1QLEB 3S5ZA 1HILA 1JZ7A 4Z7NF 1ZDQA 3O8XC 3QUXC 1XZ0B 2D31A 2WNKA 2XX1A 4FP8L 2VDRH 4YEEA 3DMMB 3ABMB 5EO0A 5JLZB 3LXCA 2ESVD 2CM5A 1G7QA 2V5YA 1KTCA 2NW3A 3WJJA 3ARFB 1LHZA 3QFJB 3T0EC 4J1UB 3S36H 2FZ3A 2DEXX 2DWDB 4U1IA 2OCFD 4HWZB 5EFIA 2IAMB 1DQKA 4PV9A 2O5XH 2Y36L 3ZU8A 2HYMA 4ANUA 5B39A 1OGAE 5GS2H 4B9JA 4CDHA 3IPFA 4N0RA 4TYUA 5F89B 1IUZA 3BC9A 3IMVA 3UAJC 2ZCKL 3H42L 4JO8A 3PL6A 4P5TC 1EXHA 3MRFA 2X7LA 4XPTH 1VADB 4YFEA 3KJ4C 2HFFB 3FU7A 2HJLB 3KDMB 5KVEE 3TJEH 5C9JB 1MW3A 2EH7H 4LKCA 4W9EC 3MGAA 8PAZA 2HVKA 3AC0A 3QQ9D 4NUGH 4CN1A 3HG0A 1ACYH 1S5IL 4ZFFA 3CK0L 4D7PA 1ZVSB 5I6MA 3U46B 3O4LA 2Z34A 3UEZA 2EVHA 1OSZB 3LVEA 5A40E 4AEIH 1TENA 2VDMB 3JTBA 3L3DB 2PW2B 3DI2B 1VFBB 4NHUB 4KPHH 3MV9B 4WUUE 5H4YA 3MZTA 3UG3A 4OD3H 4S2SA 2XV0A 1FJ1B 4M4RB 3S0PA 5EEXA 5LBVA 43C9A 4GOSA 5HHQA 4JN1H 4P2OC 1E4JA 2FJFB 3VYOA 4J2XA 3L4VA 4FULA 3GSOB 1JZ4A 5D2NA 4Z76A 1ORQB 3MXVH 1T7XA 4BKSC 5DJ2B 2YUWA 3EFFA 4L5FH 2F6AA 2N01B 2FO4B 2YGPA 1RI8A 3KWVA 4QKXB 1DQTA 1M7UA 2UWEE 4FQLL 3LRLA 4KXBA 1WZLA 3BSZL 2PO6A 2KQMA 5A3IC 4KHXL 4TF4A 3H9SB 4TS6A 5DD1H 2HJFB 3UPAA 4GAFB 3QZNA 1CLZL 4XH2A 3HNTL 5CBAB 3P11L 1PZUB 3QK0A 3ZYZA 1XIWD 3VM5A 4G59C 4YHIA 1GYUA 3ZSSA 5DJYA 1XQ4A 4MZ2A 4DN3L 3HZKA 4R8WH 5C7ZA 1CG9B 3FQTB 4HIHB 2JV6A 5JR1L 3CDGA 3MYZA 2L4OA 1QEWB 2BSEA 3MRRB 3N9GL 4XN1A 3ARPA 5SX5K 5I66A 3WO4C 4BK5C 4N8VA 1RHHA 3MTRA 3OLGA 4U05A 3DROB 1QFWM 4DGVH 4E36A 1UCBL 3PU7A 4YIQB 1ZS8B 5C70A 4LPCA 4YZFE 1SHMA 5FFLA 3C87A 5AOZA 3H2PA 5DC0A 5EU6B 1FG9C 4HV8B 3AREC 1WG3A 1ZJAA 3NN8A 1AGEB 1KN4L 1Z3RA 4LVHC 1N8ZB 3VCLB 2XKUA 3O8XD 5DRZA 3VXNA 1TZHA 3H0TB 3IRZA 3MV8B 3NAAL 4BCXA 4KTGA 4KKQA 3CHPA 3NACL 4JFFD 4AE1A 1CDYA 1A14H 3T0ED 2EE2A 4L1SA 3JYCA 5ERWA 1YRKA 1NL0H 3O41A 4AXWB 5C6PB 5D7EA 1CDHA 4CJ0A 4Y19E 1ROCA 2B77A 2H9GB 2J3SA 2D3JA 3UPRA 4XO8A 5T1LD 3T1WA 1IQWH 3UL4A 3ZT7A 3MLUL 5IB3B 4HBQA 4U1LA 5D5MF 1IE5A 2CK2A 4OI8A 5H37A 3BKCL 1FNSL 2NY7L 2BP5M 2ZCZA 3FCTA 3WJMB 5EBLA 1M6UA 3RPIA 5ICZB 3GSWB 2BWIA 3A6BL 2BSSB 4IEFA 5D70H 2PTVA 1PMYA 4MTMA 2FO1A 3T8MA 3RQ3A 1OW0C 1JWUB 5SWZB 3B2XA 4JG5A 1FV1A 1U8QA 5GISH 3EHBD 4HMCA 3K6FA 3T9WA 3C8DA 5KTEL 2CKBB 1YNTF 1HVXA 1TYEB 1AS6A 5F3BB 2BHUA 5C0CE 5EZJA 2X2JA 1IT9H 5I1AB 3MBWA 2A9NL 1GGUA 4L1BA 4U3SA 2JCWA 1W16A 5FF6A 3AG2B 3TBVB 3GRWL 3NEOA 1U91A 3LZPA 1SJMA 4OY9A 3L3HB 3MODL 1P7BA 5LB1A 3W39B 1U58A 3GO1L 3NPSC 3NP3A 4JK0D 2R2BA 1MREL 3BPCA 4DCQA 1VA9A 1XH3B 3A4FA 3CUPA 4BUHA 1E4XI 2FHCA 1LNUB 3US0A 3SCMC 1S7UB 4WNQA 3L7EA 1QFPA 4QGTA 4H1LH 4PJCF 3VFGH 1I9IL 3ULVH 5B7FA 1SHSA 2FWLB 5AD0A 1HL5A 1URLA 4RGOL 3FO9A 4J3WA 5TE7L 3UBXB 2R1XB 4JRXE 1TVHB 4UNTA 3F6JA 4HP5A 4PRPA 5GS1B 2K45A 1E6OL 4M3HA 2YD8A 3QO0A 3MV7E 1NAMA 2ZNWA 3FQNA 3NCFB 2YSTA 3CHXA 4EDWL 1WO2A 2XVLA 3C60B 4CC0A 5EIQA 2YPLA 3PREA 3QUHA 5ICXB 4LDEB 1MHPL 4GLRI 1NCGA 3CSYB 1CT8B 4TVPD 4YNYB 3KLQA 3NFNA 5IROC 1TTAA 5GSRB 2P5WB 5H8DA 1VFUA 5AWNL 4XZUB 2EIEA 4ZX3A 1CFQB 3QPXH 1OTTD 1RLBA 5CMAB 1A4JA 4E9QA 2BERA 3MCKA 4J3BA 4B5EA 4UTAA 1F8TH 5EEVA 1RUQL 5LGHL 1M9WA 3ZTJH 4UT7H 1F58L 1BZ9A 3NCEB 2GAZA 3CZNA 4TSCL 3MCLH 5FWQA 4ZW7A 3WDHA 3G6AB 3RHWK 5KYXB 3ZE2B 1N18A 4OB5H 2A0LC 2B5IB 1FO0L 3TJPA 4ZMQA 3MBXL 2CDEB 2QJDA 2AC0A 4X8GA 3RUGF 2CO3A 2F53A 3Q5TA 2R23B 1E9QB 4M6ML 1MAMH 1PJ9A 1WGOA 2HKHL 2NXYD 3Q1SH 4J4PA 5DUJA 1L9SA 2CIIA 1BX2A 2O72A 5AZEL 3J07A 2AK1H 4DQOH 3UADA 2J6EH 1CTNA 1G6VK 2C4XA 2VUKA 3BUQA 3QG6B 2HWZH 3MNZA 1F00I 4ZUWB 2WXIA 4U6XB 5KVEL 1FYTE 5T3ZD 4JM0A 4LCIH 4XCEB 5CJOL 3EDEA 1AZZC 2GYSA 2P5PA 2YA2A 4RGMB 4Y0GA 4HSQA 5B38B 2DIAA 4YPGB 5GPRA 2QQNH 4PLJD 1THAA 2D7PA 3GHBL 4ALAC 4AKOA 2V6HA 3NJKA 4K7PY 4NQVB 3MUHL 5JHDD 5T33H 3GIZL 3WHE0 3LHPH 4I1PA 1OIOA 4X6CE 3TO2B 1M3IA 4R84A 4XHJC 5A6LA 1KSRA 5FYJU 1JNNH 4ZNCD 2NQ3A 3DJTA 3OXSA 5D7LA 4OSUL 1U8JA 1HYRC 1NC2B 3LKNA 3VWJA 5CU5A 4EQ3A 1RFDL 4UINH 5IF0A 3GJFA 2UY7A 3P77A 2Z0BA 2CSPA 1F0LA 2OS7A 2VKWA 3OG4B 4ABVA 2VAAB 4ZW8A 4KKPA 3QCUL 4TN9A 2MJWA 1V3KA 1H6FA 3F7RA 2XICA 3WUWG 4HZAA 3IVKB 4C56B 5DYFA 4GEJA 3BD5A 2H2PD 4NP4L 1ID5I 1P4IL 3CDFA 3I02A 4G8FB 1AS8A 2O93L 2ZSWB 2WKLA 3OJVC 3PPEA 3TBSA 4MJIB 2NY0D 2VDLL 3CBJB 4LLMA 3SQBB 4N87A 1TTBA 1D5XA 4JQXA 3ATFA 3BAXA 3QS2A 3CCHB 1IGFL 3GMQA 1SN5A 4FQXA 1JNJA 1ZHNA 5DYOB 3G5WA 4WI5A 1KB5H 1IFGA 3LCYA 4YDJB 4GFTB 4FQJL 1CIDA 3PABB 2BCMA 3WFCL 5BRPA 4Y2LA 3DX2A 3DJ9A 4TV3A 1BQKA 3WD5H 1RZIB 5J9PA 1HT6A 3QZLA 4NKDB 5T3XE 4OZHE 2ZOTA 2WVTA 3LN4B 5BZWB 4K55A 3GBDA 3VFWB 4OLXH 5BV7H 1UD5A 3C8HA 3ZOAA 4JRYD 1HIML 3D2TA 1FL6B 4ZPTA 2IDUA 4JFHE 3OBAA 4XNMB 5LGKA 3GNML 4P5SA 3KPLB 3T77B 1MW1A 5EPMB 3BO8A 1CXLA 1NEZG 1JNLH 3DYMA 4OIBA 4QHKJ 1S78C 5B3SB 2MTAA 1JZGA 1NCOA 5L8LB 5TDPA 5IMMA 1ORSB 3D06A 4QI3A 1YMMA 2EXYC 4BSJA 1Y07A 2PCYA 4ORGB 4TUOA 2GSMB 3MN8A 1J8RA 3WG7B 1I3RA 4RA0C 4JFZL 2VW6A 1O7VA 1QBLH 3P2TA 3VDAA 2J21A 2PYEA 3TNNB 4CC4A 5F9JA 4EZMA 4X6EA 1RUKH 2OL3L 3EZJB 2DAVA 3QUZA 5HY9A 4L3EA 4UF7C 3T5WA 4LRNH 4J3OH 1HOCA 5EIIG 4ZZFA 5L4JA 5LHDA 1LYQA 2WSDA 3L3OA 2NY5H 4MBOA 2J5LC 1NDMB 3QZBA 2CNZA 2R0ZL 1QNZH 1BZEA 1WQVT 1MJUL 3VAEA 3VU1A 3RWDA 3GS7A 2BS71 4GAGL 1E9PB 1CI3M 4M9OA 1ODAA 3EDFA 4P23B 1HNYA 4HUXB 4MLSA 1N26A 1WAPA 3K81A 1WICA 5DS2A 4A04A 4DK5A 4XE0A 5F21B 2B9AA 1A7PL 3HAEH 2EC9U 4FQ1L 4PV8A 3GB7B 3NJGA 2XJKA 4G8EA 4K7PX 3F05A 1HXYB 3VFSA 5DDHB 4XVSH 3MRHA 4M1CC 1D5MB 4HIXH 4EOWL 3BN9C 1DLFH 5D6CA 4F7MA 5CEXB 3ME0A 2BY1A 1IB5A 4ZMPA 4JY6A 2FUQA 1F4HA 1P2CB 4R7XA 4CILA 1TDQA 4G9DB 3V6OA 2MIZA 1PLGL 2FEDC 3UTOA 3MOAH 4B60A 2W65A 1E3XA 3O2DA 3STLA 1K2DA 4ZMZA 1DQDL 5IGXH 1MVUA 1HZHL 2ZXBA 2KKQA 4HLZG 1J8HA 1I85C 2DI9A 2F54D 3MA9L 5CCGE 3BQUC 5IMOB 4OBSA 1CMOA 3ULVF 4X8XA 2OKMA 1YEFH 4Z3FA 3W5MA 3ASWA 1CU4H 2A74A 1P1ZA 3FT4A 1HINH 3I6LD 3OGCA 3T4AC 1A65A 3VXQA 4AGOA 5GZOD 1X4YA 4UB0H 2O5ZL 1DN0A 1XF4A 3GUTB 3SDYH 3GSQB 2QVFB 2NXZD 1F90H 2VN5A 3LX9A 2L0DA 3AVEA 4KFZC 2WQSA 1KCSL 3VI3B 3PJNA 2Q2EB 1MAKA 5CINH 4AZUA 2UV3A 2ZSVB 3SOBL 4NO0A 1SZNA 1YEHH 3GBEA 5D8JH 1UQSA 3ATDA 4LEBA 2PWGA 3RFZB 2Y6SD 5HDRA 2EECA 1F4YH 1FH5H 2UZIH 1NAKH 1UM4H 1FVEA 1AYRA 1A9EB 1L6XA 1OXYA 1VPOH 1MJ8H 4FNPA 4ZX6A 4KV5E 3Q44A 2PWDA 1W8OA 4PFEA 2BVPB 5KSAC 1E28B 2P46B 4YS4A 1UH3A 3VFVA 5E6IA 1LO0H 1S78D 2FQFA 1TJIL 2TAAA 4JJHA 5F96H 3LZRA 2FQDA 3RKPA 4IKLA 2VLLA 4G1EA 1D5BB 3L3GB 2DJSA 2AV7B 5C0IA 5C8JB 3VGAB 1PFCA 4HKJA 4MDJA 3A23A 2H32A 4HJJL 2HRLA 1HHGB 3F84A 3PWVA 4WO4D 2NSMA 3L5WA 4I0CC 2VQTA 4BKLA 5CUSL 1JV5A 4HCFA 5I15H 3VSTA 2BWQA 3MBEB 1HXMB 3VM7A