5IJCC

The crystal structure of mouse tlr4/md-2/neoseptin-3 complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
136
structure length
136
Chain Sequence
QQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B chimera
total genus 24
structure length 136
sequence length 136
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02221 E1_DerP2_DerF2 ML domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.770 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5ijcC00
2F08A 3MTXA 5KWYC 4G8AC 2HKAA 1KTJA 2Z64C 1XWVA 3WEAA 3ULAB 5IJBC 5IJDC 3M7OA 3B2DC 2E56A 1NEPA 1WRFA 1AHKA 2Z65C 3T6QC 3FXIC 3WEBA 1A9VA 2E59A 3MU3A 3RG1C 3VQ1C 5IJCC 1AHMA 3VQ2C
chains in the Genus database with same CATH superfamily
1EVTC 2E7HA 2R29A 5HHNA 4ZNCD 4NJAL 1AMYA 4K7FB 1GR7A 2XZCH 2OZ4A 3I3DA 3L3DA 3EHBD 4FE9A 4XB7A 3LPOA 3WFDH 5D1XE 4LBEA 3GJFH 2NW3B 5L7XH 1N59B 1CU4H 1N8OE 4IOFD 2XY1A 3EYUH 1UWFA 2A6KB 3QQDB 1FNSH 1MG3C 1NL0H 3B8YA 4KK9C 4OKVB 4XP4L 2W0KA 3D05A 4YNYB 5IK3A 5I1EH 4QOKA 1MEXH 4IM8A 1I85C 1LO2L 4L4TE 3VMPA 3PWNB 2HG5A 3BWAB 1BBJB 3GEFA 1KZYA 2Z92B 1YEEH 2CA3A 2J1WA 4HV8B 4KAQH 5AUMB 1ML0A 2UY7A 2NNAA 4RLDA 1BXUA 1F3RB 5FKAB 3AU0A 4N0FA 5DWPA 4YGAB 3D2UD 4JN1H 3QIUA 5DDHB 4U3SB 2O1AA 2VZVA 3TYFB 1IKFL 2VIRB 2CO2A 4PY7A 4ONGL 2NUTB 2WBJB 1F6FB 2DLGA 2OMYA 4AL8H 3NCBB 2FGZA 1ZLSH 2CGRL 3M88A 4OCXH 4L1LA 2AK4B 3TA3D 3UJJH 5I73B 3QORA 4LDCA 3FN3A 1EZUA 1EAQA 3DGCR 4L3AA 4OZHE 1T89A 3WY2A 5IP4A 2MOGA 3PJSB 3UBHA 2WBWB 5IVXE 4LAQL 2IADA 1LE9A 3H42H 3OAYK 3NIFF 4BDVB 4N8PA 4UOW1 2ITEA 4HSAC 4LU5L 1NINA 4GO9A 4TULH 3MJ9L 1G7JB 3PWPE 4F3FA 2VLRE 1TQBC 1XIWD 2QR0A 4WY7L 3UOAB 4C56E 4BK5A 3GXDA 5CGBA 5SWZE 3IJYA 3TVMB 4X83A 1XGTA 4D9LH 3FO0H 3HE7B 1I3VA 2QQLH 3E9UA 3DX7A 3RJOA 5IV2A 4KZEL 1LGVA 4GUOA 3HC2A 5JOPE 2EKSA 3JTSA 1FBIL 1QRKA 4BCXA 4FG2A 3S3DB 4PREB 4WWKB 3F3HA 1MHCA 2PW2A 4WI8A 4XPBL 3U2JA 1U8NB 3FO1A 4LCWE 4Z0BH 3RTLA 1QUNA 2VZ3A 4OGZA 5TQ0H 4JY4B 3LZNA 3MRNA 4KH2A 1CICB 2VLJE 3RX8A 3BP7A 5HDBB 4PB0H 4LEXH 4GI8A 3MNZA 2R1YA 4IMKA 2WBJA 2NUTA 4G6AC 2ICEB 3ROLA 1CLCA 3I74A 1KTJA 1E65A 1JNLL 3IFPA 3MA9L 1CF1A 2HKHH 3HUJB 1SY6H 3IMTA 3MNWA 3GXFA 4UOZA 2I9TA 4XPFH 2IMNA 4KUCF 3V4UH 4DP7X 3K80A 4N0YL 3FB8A 5PCYA 3MRLB 1C16A 3DHPA 4H8WL 4OU3A 4XPTH 1E27B 2HLAB 4JFSA 1CLVA 4WEBH 2B59A 3KXFB 2JE8A 1U8JA 3NSYA 5TF1L 2ZUQC 3B2VL 4AM0B 2OV0A 2Z8WC 2XFGB 3HZKA 2GJ6A 3GSUA 4IRJC 5GZOD 5TDOA 1A6AA 2YUZA 3PHAA 5DK2B 1KN4L 43C9B 5HY9A 1LMIA 2UY6B 3MNWB 5E99L 4QDGA 4LB8A 2A6KA 3GMMA 2WLHA 2P80D 3JTTA 2D7MA 5D7JB 3MRHB 5CD5C 1GHFL 3L3GA 3SYQA 3IDMB 4LIQH 4MAYA 2Y3AA 3KWUA 5C71A 2AAVA 3I6LE 5LGHL 2WAHA 1XGYL 4DH2A 1S5HA 5D1ZD 1NIBA 5BXFA 1JUFA 4OTXH 5GRVK 3NABH 4EOWL 2IALB 3FONB 1QP1A 1CD1A 3ZW3A 3BUBA 4YSSA 1TZAA 5BS0B 1E50A 1OAQH 4ODWA 5E6IA 2V33A 1Q94B 5CN1A 5K9KA 5CLWA 4XRCA 1ZT1B 3S97C 3HAEB 4DOHB 1FGNH 2EKSB 5EWIL 1L0YA 4AQAB 1Y6KR 2ZG2A 3W9EA 1WITA 1JPEA 2MJWA 2NSQA 5EEWA 2CWRA 4E9WA 4P3WA 1T2QL 5ESVA 1BVKB 1IAKA 1P7QA 1YN7B 4N22A 3CFKA 4NQSB 3X3FH 3BKJL 4WI0A 3SPCA 4Z7VF 2F0CA 3CLFH 5ADOL 1YQVH 3SY0B 1NCNA 5BQ7A 2VC2L 2C9QA 1ZTXL 3G5ZA 4KKCC 3VXSB 4ZOEA 1QHOA 5CSBA 2HT4D 4HK0A 3SOBL 3VQ1C 5HYEA 3WN5C 4WLCA 3AREA 4GQRA 1KELL 4GBXB 4FKKA 3GS0A 1OE2A 4MYWB 3OMNB 4LOFA 3BW9A 1CFVH 5T5NG 4CMHB 4M9OA 5ENWA 2J88L 1JNNL 5CKGA 3TBYB 5ID0A 4E2OA 2OR7A 1DN2A 4N2NA 1N12A 4YXKL 4Z3FA 4OFVA 5AL0A 4E5XA 2CK0H 3S37H 2D0FA 5TGBB 2DN7A 1DANT 3QDGA 4UYPA 1DLHA 1BQHB 1SLVA 3CAFA 4D94A 2YAEA 3VU2A 2YFOA 4KK8D 4XMZA 2J8UF 4YHNA 4UTBA 1IFRA 2EDBA 3KJ4B 3B2VH 1Q9WB 2WQRA 3T65B 5JPMB 3B5HA 1X4YA 4H26A 2GY7B 5C3IA 1R33A 4X0KA 2EXWC 1QSFD 3DURA 5JXAL 1HL5A 3OLGA 4GRMB 4RMTA 4WEEA 3D18A 5CWSA 4BFBD 5HBBA 2OAAA 1Y0LA 2DQDL 4WW2A 2MPVA 2QADC 1RUML 4OLZL 3TH3T 2MHAA 4ZUTA 1ZS8B 5L7XL 2B08A 3MA9H 3MI6A 4HWBL 3IDXH 5H94B 1DVYA 1N5AB 3MRQA 4GG8B 2CGYA 1ED3A 3QC5X 5E7BA 2H9GB 4A7UA 3ES6B 3MUJA 4RFEA 2E7DA 4HH9B 1W8NA 4X5RA 3OZ9H 4V1DD 1CFNB 1YYLH 2QMKA 5ACLA 5FYLE 8FABB 2AV7B 5B1AB 3WLBB 4AIEA 5GSVA 3EYVB 4P5KB 4AZ8A 3U2SA 4WGVB 4DKAA 4CILA 4L8BB 4Q56A 4IKNA 3BDXA 1IM3B 3DBXA 5C0AB 1GGIL 2FATH 3HS0B 4YDJB 5J1AB 2XV6B 3WNMA 5CCKH 2CMRH 3NT0A 4LGPB 3MRIA 2BMKA 1DJHA 3Q2WA 4NOFA 4XVTH 3KLSA 1HL4A 4N86A 4TUJB 3LY6A 3T0VA 1AE6L 3GFUA 1FH5H 4XO3A 3VXQA 4KPHL 1S5IL 3QUGA 1T7XA 5IB4A 1KTLA 5HVHB 1NCWL 4ABUA 4I0KA 5F9AC 3MACL 3MRMB 3NVQA 3X3GH 4KK9D 5LWYH 4PM1A 1JJUA 3DTDA 4MHHI 1OPGH 3ZQWA 1OD9A 1JV5A 2W0LA 5SX5K 1CD8A 2FBRA 1RUKH 4YZFF 1TZGH 1G0DA 1CD0A 1F5WA 2PO6D 4P0DA 3MGTA 1E3ZA 4QTHB 4PJBB 5F96L 5C0BD 3BDBA 3UO1L 1MFDH 1P9MA 4IBZA 2XN9E 1U8OA 2AQTA 3BE1L 2DM3A 1SXSA 1UOWA 4LZKA 1WYJA 4AI7A 4JFOB 1X9RA 2A3TA 4B96A 5CIPB 2DI7A 1XGUA 3EOAB 4JG1L 4FQXA 2DYPB 4B9CA 4HX1B 3BAYA 1KC5H 4PD4K 1D2PA 2X0UA 2GTWB 1XGQB 1F4XH 2VRKA 3HRPA 1M1XB 2EO7A 3ARDB 1IQWH 1MIEH 3H9HB 3GK8H 4JRYB 3VXUA 5I6XB 2VSKB 2ZP0T 4RGMC 5DTFB 1ETZA 5TD4A 4CN1A 5HYQA 2IWKA 4GBXD 3ILEA 2WBJC 4LCIL 2ZD0A 4GMTH 2W95A 1CFQB 3ATFA 4PLJC 5EU6A 4A2LA 1VCBC 5I8OH 2JFCA 1ET5A 3O0RH 3KLKA 5E5LA 3CH1A 4K3HA 1VAHA 2EH8H 1SUJA 2WUCL 5C09B 2VDPL 1P84K 1T1WA 3GSNB 1F45A 2KLTA 5DYFA 1TTBA 3VFNA 3FT2A 1T22A 4L37A 1HCVA 1MFUA 3C5ZC 4M7KH 3VRLF 4ZPTA 3RNQA 2P7TA 1EXUA 1S7UB 4XH2A 4XCFH 2PCFA 3HG1E 1RP8A 3S5LB 1KIRA 1KGCD 1FRGH 5F1KC 1FC1A 2VR7A 3RL1A 3RVVC 1VPOL 4RBPK 3DRQB 3Q44A 5CZXD 1JPSL 5F21B 5G2NA 3Q13A 3CCHA 1T5WA 5C0RL 4FFTA 2R29L 1ZTMA 3CHPA 5FUZL 4L8SA 5F6IC 1TR7A 1I7UB 5I1DB 1KPRA 2J21A 4S1DD 3CE1A 4BUQA 2PCPB 4GP8B 3DBSA 1HHHA 1DBBL 1AP2B 3K0WA 3D0AA 5FYJU 2V5MA 2ZQKA 4D9QD 3V5HB 1II4E 3HA0A 4E9SA 4GKSA 3WNNA 3DLQR 3LH9A 1JCKA 3K74B 1S9XB 4LVHB 5E6IC 4C47A 2XJLA 2H6UA 2EDXA 2YJLA 3PABA 4KJPD 2Y7QB 5A2LH 5CD3A 5J5EA 3FZUD 4QNPF 3JV4B 1MFNA 3O3BA 4XNQB 2BNRE 3A6BH 3L4UA 4XZ4A 5HI4C 4XO9A 2V9RA 1BQHG 3DJZA 4WWKD 1SOKA 1JN6B 3HE6C 2CO6B 2E9WA 3MMEB 4NKDA 4Z78B 3IPEA 1TITA 2FO8A 4IU2A 4EI6B 2FUTA 3C12A 2EVFA 3BHBA 3BUYB 2Q87A 1D6VH 3CFJB 4RFNC 2G4EA 3RX9A 4DNLA 1E9QB 5E2WL 1OTUD 2PYEA 4NXSA 4QAWA 4KKAC 1D5IL 3AREC 2JH2A 4IJ3C 4Y1AB 5E8EB 1HAUA 1T0NA 4OLVL 4Y5YC 3SYAA 1U0QA 1XF3B 3GMNB 2OJZH 2IXQA 2ZX8A 1MCFA 1NCDH 3B1UA 5DRXB 4ZMAT 4ZMOA 4MZ3A 2DTSA 5MHSD 2YBRA 4Z7WE 4R5XA 3MCLL 2BIOA 3ATDA 5GGTL 1JDAA 1EGJL 3MRDB 1NGZB 3DROB 2QLYA 2VL5B 5F9JB 5HYQB 3PAYA 4QAMB 2WYHA 4NC2B 2V2XB 4UOQA 4WI3A 4Z95H 4ZUUA 2CK0L 3U0PB 4PR5A 2YZ1A 1LE5A 4XZUB 3RBSA 2VDKB 2VR4A 3ARBA 2F1EA 3P77A 2VISA 4J1UB 5HJGA 4PJ8C 3LHPH 5DHYB 4M7JH 2ITCA 3CMOH 3RGVD 4MB1A 3VXOA 2XTJC 3P0YL 4G6FD 2OSWA 2XPGA 5D8JL 5DSCA 1ZEAL 4L4TD 3TF4A 3RKDC 3KR3H 1CLYH 3FW6A 4XB8A 4CVXB 4DQOH 4ZW5A 4UB0L 1AGCB 4K7PY 5E94A 4KI5E 5C0CB 2AQ3A 1U58B 2PYED 4NQQA 4MSWA 4N2AA 4H1LB 4MZRA 3BH8B 3QZBA 4OF0A 4LHUG 4TSBL 3LRKA 1N6QH 1IX2A 2H7WA 3KPOB 3CQQA 2XIIA 5AOKA 3O11B 1P4LA 4R0LC 3GTTA 3ILPA 2VT0A 1EO5A 1QO3B 4YDMA 2CDFB 2FEDC 3R1GL 3WHXB 2O93L 3HKFA 4ODVL 5EORL 1DVSA 1QEWA 1TQWA 3MV9E 4NNPH 1LP9F 4PEEA 2K4WA 3QO1B 3IYLW 3U9UB 3ZKMD 4ZQKA 5EIIA 4KROD 3E7JA 5F1NB 4FNQA 3HNSL 2Q1EA 4LCIH 4PJEF 3VD1A 2EDMA 1MNUL 4PJEB 4RDQF 3QFDA 4Z0XB 3GXMA 5I1CL 2HFEB 3MV11 3QG6A 1CYWA 5DVKA 2F53E 1DFBH 3NCCB 4HGMA 1A6TB 3FUDA 2YBGA 3KLLA 4MNQE 4L0YA 4JFFB 4KDVA 3SJVB 1U9KA 4B7IA 1QPKA 1I7RA 1XF5A 5IEKA 2NQCA 4QRBA 5KVMC 1OK0A 1BVZA 4ZO8A 1PY9A 2GC7C 2VH5H 4XVSH 4KY1L 4Y0GA 1N8ZA 2XBZA 3LN4B 2NY3C 1ZV9A 3RWFA 3WEBA 5MEQA 1DJXA 1OL0A 1S7VB 5DRNB 2VQ1B 3UTOA 2PP7A 3K91A 3ZOAA 4U0QB 2GSIA 5C0JA 1TETH 4GP4B 2BSEA 1EEYB 1R3JA 2ARJA 5H94A 4C56D 1UVQA 5FA4A 2X3AA 2P43B 3S8FB 4FFVD 3RZCB 1XH3B 3B2UD 3PE9A 3CHSA 3ZY7A 4B7LA 2ZCKL 4HK3J 2BCMA 1OB1B 4JHWH 3SGKC 3HMXA 3AMKA 1USZA 1VCAA 3VFOA 1QFUH 2HWZL 1MJ8L 3G5XA 4UANA 4MQXD 4TPRH 2AQ1A 2MCMA 4NKOB 4HOMA 5KG9A 3O6KH 2RTTA 4ILDA 4AE1A 1EHXA 4JQIL 4UQIM 4W9IC 3ATAA 1WA2X 3MQIA 4D0DA 4N1HB 5FGSA 4BA0A 1TJHL 3B9EA 5T3ZE 4L9DA 3EG9B 5D93B 2XPGB 5I8CA 5E6SB 4E5XB 5H4ZA 2R1WA 3VXOB 3GJFB 3KNBB 4WTQA 2H6PA 3L5XL 2YRZA 3O4OB 2WIIB 3PV6A 4GRWH 2B1HL 3LZFL 1Z9PA 3LKOA 1P4BH 4HKXA 1IM9B 2G3XA 4ZPVA 1A3LH 1F41A 4ADIA 4D8OA 1KJ3L 1VLXA 3CBKB 3FN0L 4ZFGH 1FL6B 3FT0A 3MO1A 4Y4HB 3SB3A 1INEH 4K3DL 3NJLA 4R3SB 3L5JA 1F4WL 4ZZKA 4KJQD 3IMSA 1TZHA 4GXVL 2RAMA 1M3IA 1RIVH 4MA3A 3C5ZA 1B3IA 1SYSB 1BLNB 1IC5H 1XXDC 1JZIA 2JIXD 4Z7QB 1RQ5A 2ZCZA 4UOJA 3LXUX 3ZIMA 2DYRB 3BZFB 4K2UH 2ERJC 4YDVB 1BZ9B 1KIPA 4RNRB 3KCPA 1UM4L 4FN0A 1WAPA 1BVKA 1P7QB 3QO1A 1Z9SA 3HS8A 2CXGA 2E86A 4PVBA 2Z93B 1EZVY 1JWMA 3WG7B 5K1NA 1FVDB 2XICA 2ZCLL 5I8KH 1Z5LB 1DVUA 4XP1H 3C2SA 3V5KA 2F53A 1ZWIA 4XBGB 4FCAA 4ONGH 3VSTA 4TLUA 4HJJL 2FJSA 1KCUL 3ARZA 3LCYA 4RAUA 1WAAE 3RAJH 5D2LA 4JMXA 1UWYA 2Z7UA 4PAZA 2P1YA 1GS6X 3O9WD 1PD1A 4PBVC 4YJZL 4OGXL 4HAKA 1IGYB 3GBMH 4LKXB 3OWEA 5AB2A 1QRNB 1NFKA 3S4SB 4YHKL 2SEBA 3M7OA 2AXGA 2Q8BL 2Z4TA 3HE6A 4KUZL 3V4LA 4P5TC 3VGAB 4OZ4B 1E9OA 5C2BL 3VI3A 1RLBA 2VISB 2OCFD 4FQJL 1LVEA 3A4AA 1PYWA 5DRWB 1G94A 4F1ZA 1H9DA 2P24A 3P2DA 1VSCA 4X9FA 2X1WL 4JQXA 3H9SA 4NIKB 5M94B 4KX8A 1CU4L 2VITB 3DROA 3WEOA 4Z77A 4EI0A 2WW8A 3S5ZA 3ZYJA 3U48A 1DO5A 4Z77B 1YEFL 5F93C 3QA3A 2KUTA 3ETBF 3ORJA 4UINH 4X5WB 4KNQA 4QXUL 5DD1H 5HVGB 4NO0A 1IL1A 2B8OT 4NQEB 4QO1A 5FDWB 4U1HA 1WV7T 32C2A 4QHNA 4RGNE 1HVXA 2Z0BA 5DEZA 3BP7B 2XA8L 5I6XC 4GS7C 3AG3B 2EDLA 2EYSB 3FTYA 3RX7A 3TPUB 2PO6C 1D9KC 2UZXA 1INDH 3ARBC 1H8SA 2K7PA 4HPOL 4IRSA 4Y88A 1TLKA 2J20A 3T8XB 2W07B 1AD9A 3IDXL 2QTVA 1P6WA 2GQHA 4WTXA 5BO0D 5PAZA 2OXHB 3DX7B 1BXAA 1OSYA 1TETL 1NGXA 4N20A 2FEDD 3D3VE 4HF5H 4Q6IA 3WGVB 4J23A 4YHYB 2UZYB 2E4TA 4R96A 5FGCB 4AQZA 5GPRA 3FH7A 4PJ9D 5DVMA 1U2HA 2EYSA 3HG1D 3QT2A 4HD9A 1BPLB 1LK2A 1MJJB 2MOQA 1HSAB 4FQXB 1W6WA 5JNYA 2Z93A 4QRRE 4BDVA 4LNRA 5LBSA 1T7ZA 3S37L 4YLCA 3B5TA 4KZDH 1JDDA 2B4CC 3PAUA 4PGDB 1XZWA 3LSOB 4G71B 4GSXA 4HHWA 5CINH 3TO4B 4AYMC 2WXGA 4NZ8A 2C9AA 3US9A 4XAKD 2HKHL 4PU2A 3DMMD 5I17B 1TQBB 4QTHA 4Y9BA 2KT6A 4XAKE 2A9BA 4JKKA 3D69B 4WFGD 3TNMA 4YSDA 4KY2A 1ZTXH 3MV7E 3QDGD 4M8QA 2WYTA 4NQDE 1GZPA 4WNQA 3BRDA 4YK4B 2AXGB 1RUAL 2CUIA 4P2RA 3KVPA 1KY6A 1FWXA 2A83A 2VO8A 3F7VA 1X3DA 3HBGA 1QG3A 3MCG1 3O2DH 4LPYA 4NUPA 2QADD 5C6PB 3U7YH 3PL6A 5D5ME 1GMEA 3L4CA 4E36A 4JZJB 2AZUA 4IHOA 3WUZA 2VDML 3MNVA 4MXWL 4Z7QF 3LYRA 3IDYB 1Y7VA 5A16B 2IDSA 3PGCA 1FZMB 4YWGH 5H8DA 3AG1B 1ETZB 2H1XA 1BBJA 4YK4C 3TL5A 1F2QA 1QEXA 3C5SA 4KBPA 2CO3A 1J86A 2R2CA 5I9QC 4YBQD 4HJUA 1MVYA 1CG9B 4U1LA 4FQJH 1LDSA 2GAZA 4LNVA 3RURA 2HKAA 3RZCA 3VRIB 2F7OA 4J3BA 1VPOH 2ED9A 4WDIB 5IMLB 1I85A 1S9VB 4FNUA 1NLBH 1NUNB 2BVTA 4H44C 3FTGA 1ODUA 1MXGA 2OX5B 5DHXB 3SGKA 4NUMA 5GRXG 3GMQB 2DWDA 4J28A 4ORGA 4RGND 5DK0B 4OV5B 5EC1A 1ZGLA 4JFDE 1GOHA 2AEWA 4HPHA 5K93A 1N0XH 3CVIH 2D3LA 3ULUE 2OL3A 2QSVA 4HWZA 5AD0A 3VXUE 3K0YA 4NYLA 4OM0L 2YA0A 3CLFL 2CDGB 2CG9X 1N26A 2XQBL 3BWUF 3BLKA 1B4RA 1T20A 4GAGL 3RU8L 4GRMA 1HKLL 4Q9RH 4G6KH 3S3CB 3QRBA 4G43B 5HVHC 5KVFE 1IKFH 4XWOD 2FO4A 3QI9A 4NNXB 2ZCLH 2DOCA 5I8KL 5ALCL 5FB8B 4GG6B 1XH0A 3HMXL 1U8IB 1WGOA 2DDQL 4ATWA 4JANA 5DR5L 3QG6B 1NBVH 3MJ7B 3VCLB 1TT6A 2UX7A 2NYYC 3L9YA 3MRMA 2RALA 2IDUA 2A6JB 4XNUH 5DO2C 3OVUB 5T1DL 2FUQA 2QV4A 1RJLA 3NFNB 3EG9A 5I8CB 1T89C 2QHLA 2Z7ZA 4JRXB 1UTDA 3FUJA 4FQLH 1JXJA 3BQVA 3S2AA 1J48A 1F90L 1RJLB 5IOPA 5EIIB 3MV8B 2CR3A 3QIBA 4OF8A 3SOTA 1U21A 1BYOA 3FYEB 4L4VE 4QI3A 3IPBA 4PJ7F 2OSYA 3PWUB 5D7HA 5ANMB 2NZIA 3C5JB 1EQWA 3BVTA 2Y36H 3FCTA 3VXRA 1ZDSA 3TIEB 5CO1A 3KGRA 3BH8A 4X5QA 3U2SB 3O6FB 2JJUA 4AYSA 4UU9A 5KOVC 3VXSA 3G6JF 3WV0A 1UACH 3LVTA 2RH0A 5EU4A 3DPDA 3ZZLA 1TO5A 3GSOA 3P9MB 2AEPH 2OX5A 3P0GB 4JFZL 2H9GA 4JJHA 2JTYA 1FGVH 2YFNA 1FHNA 3RP1A 4JFEA 4M6AA 3KL0A 4N5ED 4K5MA 3VFMA 4QRFA 4Z7NE 1G6RA 5I16B 2ATKA 3GSWA 4WW1B 3CXDH 2ZXQA 1QPXA 2NY3D 5BRZB 3OQRA 1KYOJ 1WHOA 3MYJB 2EXTA 4RDQG 2NTFA 5F9JA 5EBLB 2PKDA 2F6AA 3QQ4B 3PGCB 4KQ3H 4YHLL 4GIAA 1E4WH 5EN3A 4JO4L 3I9GH 4HUVB 4Q7DA 1HOCA 4Y16B 4HA1A 4JQXC 4GMSH 4G1MB 4TVPH 1J1XL 3JTTB 4JVUA 1P0SE 5B1JC 4LSVL 1F58H 3CN2A 1TEGA 2FD6H 4Y4HA 5E5RB 4Y2LA 3FUNA 43C9A 2B2XH 1EEUA 2ADJB 5BRPA 4MYPA 4HKJA 4ZX5A 2XWXA 4GIPD 4UQ2B 1TVHB 5ETUB 5TK2A 3MCYA 4FYSA 1NMAL 3UC2A 2NNCA 3KHOA 5GRVL 3MLYH 3AXLA 3ESMA 3LIZA 5EBMA 1E4WL 3WS6C 1HQ4A 5IHUL 3BIKB 2YD2A 4H88L 4F8TA 2G2PA 4OAWB 4P05A 5IFAH 1C16B 4PWKA 3KPSB 2R2EB 4BCZA 1CS6A 4FQPA 4MAYC 1JV2A 1QMUA 2QPUA 3QDJB 1RZKH 3FTUA 4JZOA 2PO6A 3BH9A 3RL2B 3S35X 2FE0A 5A6MA 4NENB 1F56A 5ICUA 1DBKH 3IFPB 4XHQA 4A37A 5B3JF 2APSA 5IG7B 2Y7QA 3NCJL 1X9QA 5I30L 1PIGA 4PIBA 4CVZB 2WQAA 5DSCB 4DK5A 5ISZE 5JNYB 2X2HA 3WE6A 4NHCL 1AANA 4LVEA 1HEZB 2KH2B 4AQAA 4PWIA 3PUUA 3E2HB 3VI3F 4N68A 4OSUL 5C0EB 1JOIA 1FCCA 1MI5D 2OP4L 4KFZC 2D03L 1WAEA 5GJTH 2PP8A 1KPRB 4RFOH 4JO3H 4ZX6A 5GS1B 2WINA 4NRYA 2EP6A 4DGWC 3V6BR 3VD2A 5BUAA 1TMCB 1BD2D 4UT7L 4FLRA 2HVKA 5LWYL 1C5DA 4OT1H 1FIEA 2XTJB 2BSRA 1CGSL 4NQDD 3WIHL 1CLYL 4DQOL 4GAAA 3G6JE 1PZ5B 1ZLUK 1GSMA 3DIFA 5FUOH 5AZEH 2MPAH 3APDA 3IJYB 3KYMA 4LDEB 5A6IA 4WFGE 1CFTA 2ZUWA 3O3DB 5EFIA 2OR9H 4TL4A 4MDIA 2Z4QA 1DBBH 4MJ4A 2Z8RA 4CBZA 2GFBA 1K8DB 5KSAC 1QZ1A 1V05A 5I82A 2BSSB 2ED8A 2QHRH 1WVZA 2GABA 3ESUF 1UZGA 1DJZA 4QHLB 5LBSL 5E1IA 5CM1A 4K0OA 4OFIA 2GB2A 2IQAB 2PXYC 5AVUB 3UAFA 4W70A 4DESA 5J13C 1F42A 2VDMB 4ZMVA 1RK7A 3FMGL 1PKQB 5D2NE 2FD6L 3OGCA 4Y4KA 4X7DC 3TXAA 5I1IL 5IHBA 3L3KA 5GJTL 3PPSA 4Y5XB 4GQ9H 4KHTH 2P24B 3HPLA 2VDRB 5E9DB 3MLXH 3IJ7A 5ECGA 4KXZH 1XL4A 4O2FA 2VXQL 1O7SA 2YZ8A 4ZT1A 1CR9H 2ZCHH 5AWNH 4QRPA 3EHBB 4OZIB 1DE4A 4FP8L 1FYHB 2VUKA 3V5HA 1XGUB 3EOAA 3PWPD 1KGXA 2DW5A 4HZAA 4K5LA 4AGPA 3RWJB 3D12B 4NSKA 2FJHB 3UZQB 3OLDA 3DECA 5GHWL 1AZCA 4MNQA 4YSCA 3AW5A 3NCYS 3KPNA 2X9WA 4BWUA 3ILQC 1JGLL 3KWVA 3TT3L 4ZUWA 5BZDA 3SQBA 4FI7A 3S8GB 5EIIG 5ADPL 2NY3B 2G60H 2XVBA 4FQLL 4JFZH 5CR1A 5B39B 4WFHE 4G42A 4N28A 2PR9A 4HOZA 4YSTA 4JPSA 5C97A 1W6LA 3RIFF 3IU3B 4ZAKD 4PW9A 3FHAA 4H20L 4YFLF 2AKRA 4NO3B 3WL9A 2EADA 4BZ2L 1O6TA 2F7IA 3R19A 4UZSA 3WCYA 1WK0A 2Z6FA 3S3JA 5AW9B 5IB4B 1MOEA 3P54A 2BIQA 3QI9C 3UTPE 4DEPC 2XQYG 3WXVH 1SHXA 2IJ0C 3SPJA 2WLZA 3VNZA 1OPOA 2JIXB 3W37A 4LRNL 3UBGA 1SLXA 4HUXA 2GIMA 4PJHA 4RWYH 3BPOC 2XFXB 4HUMB 2DTML 4K23L 3NRQA 1VIWA 4TMPA 4L5FL 1RJCA 1CFBA 3RWIA 4Y5XC 2N7SA 2DWTA 4YDJA 4E41A 5IFHH 4HVBA 3L45A 35C8L 4N5EC 12E8L 1NUGA 1JGUH 2NY4C 2VE6A 3FSAA 3O4LB 4MBRA 4AQOA 1DJSA 3B6SB 3BD5A 4NUJB 1AS8A 4YHPB 5I1GL 4GQQA 4KX9A 4X4ZA 4Y4FA 3WO4C 4YUEL 4DTGH 5EO1B 4LBAA 5L6YL 5LG6A 2V9UA 1XAUA 1JI2A 1NEPA 3O0RL 3PNWA 3V0AC 3GSQA 4BQCA 1XTLA 4BQ9A 5ILTL 5E08H 2YKKA 3TFKD 2LFEA 3MRPB 5CJ8A 1MCDA 1V7NH 3FT9A 5E8OA 4PJBA 2F19L 3PXJA 5IBLC 5D2LE 4OD3H 1WP6A 3FOMB 4RMBA 2VXUL 1PNDA 3H9SE 4P57A 2JLPA 1BZ8A 1FL3B 4HHGA 4MQ7B 3S37X 1NC2D 4UM9B 3A3YB 5FCUL 2CRYA 1Q9WA 5IJDC 3ABGA 4LOUD 3MROA 5FKPA 4AQ1B 1RURL 2Y2TA 4UI2A 2GSIB 5C0JB 1WDAA 2PWGA 3HAEG 1YJDC 3QNYB 3O3AA 5C3TA 2GBTA 3RWFB 1P5VB 3LN4A 5LNEA 1H3GA 4NHUA 5H35A 2R8SH 2CJUL 2PP9A 1I7ZB 2P80A 2WZ6A 4XMTA 2C9UA 2JIXA 1DUZA 1U3HA 1NOLA 2ROXA 5DS2A 3OAZK 4EIBA 4HK0B 2ZNXA 4MJ6B 1MCWM 3PNRB 3VXPB 3SE9L 1HIMH 4H2CA 3IU3A 3OHMB 4QT5B 5LXVA 4DIXA 3Q05A 5DO8A 4QYAA 4WEUD 2XHNA 3ZT7A 4ZQKB 3K2UH 1MFMA 3RWDB 3IJHB 5C7XH 1Q8MA 4NN5C 2JB6B 2VR5A 4PJ9A 2D9QB 3RIAK 2ZWNA 5JPNC 1AFVH 2K1MA 1XX9C 4ZUTB 3LNGA 4N87A 1UWEH 3GI9H 3TEUA 2EXSA 3E9TA 3CLEL 3UZQA 2OBGA 2QT6A 1W15A 1ZHNA 3IDJB 4ZO7A 3WUWB 2VC2H 3O45A 3QH3A 5BJTB 1HL9A 1T5KA 3EJQA 3ECUA 5AQ0A 5AAMC 1DE4B 1CGYA 2GTZA 1OWWA 4OZGE 4YSRA 3RFZA 4RMVA 3BP4B 2DQGH 3UIYA 5LKNA 4CW1A 5FKPB 5E95B 4PJAF 3OKLA 2RIKA 5IVZA 3EF4A 3KPPA 3X11B 1CK0L 4KGJA 4BHUA 3FUKA 2F7PA 2ZKXA 4IK6A 5FS5A 3IDYC 2YGPA 1YEHH 3O6MH 3G5VB 4PJ5A 1IC7L 4XNXL 2OS7A 3BSZA 2IEPA 3HZKB 1EMTL 5CP7A 1ZLWK 2IQAA 2QSQA 1DQJB 2BNRD 5IB3A 4MASA 5E8OB 4WK4B 5D1QE 5GZOA 3H6AA 2XG4B 1K8DA 1E27A 3LZRA 5CLZA 1S4IA 3GNML 4RFNB 1WF5A 1PY4A 3BAEL 5DEFB 4JHBA 1XSJA 4ENEC 2YD5A 1E5YA 3K71A 2IAAC 3IE9A 4HJGA 3EO0A 4G6MH 1IGFH 3DUUA 4JCLA 4GNKB 4W93A 3CUPB 4Q0XL 3DIFB 3D30A 4FNLH 1K3ZA 3F5WA 4PJ6A 2QQNH 4HEPA 2OMXA 4LSRL 4TQPA 1TPXB 1SUHA 2NYZA 3ZK0A 1MPAH 5HI5D 5HJDA 3I85A 4Q4EA 2I7OA 4XXWA 4ZSOA 5HHMD 4CVWA 1B0IA 5SV3A 5T1MB 3RVTD 4Z3EA 3BKYL 1MAKA 1CICD 4EZKA 3GHBH 5T3XH 4XBPA 2F08A 3RY5A 3O6ML 4KRLB 7FABH 4Y7MA 3FQTB 4NO0D 4XNQA 3UPRB 4JO1L 5IHZB 4U6HA 2I5YH 4QRPE 1KT2A 2KPWA 4S0TD 2XWRA 4YFLI 4ANUA 4NQTA 4RH4A 2LW3A 2V6HA 3EH1A 5JYMA 1BAWA 2F1AA 3IE4A 4NFDA 1J8RA 1K5NB 2WVSA 4IU3B 4MMZB 5TQ0L 3ZO0A 1F11A 1AXSA 4O9HH 2PN5A 4ZMQA 1QBML 5J89A 4Y89A 3GHBL 2R2EA 5TDOB 1TQCB 3VH8B 4DZ8A 3WKMH 2NXZD 5HDWA 5G4MA 2X4TA 3ULUD 3Q8CA 4DP9X 3U4AA 4D2NA 2G2RA 4ZYKB 1HXYB 4CSTA 4XHJD 2XTJD 1TYJA 4TNVK 4Z7OE 2VR6A 4GKNA 4TS6A 5AB1A 1XFPA 3S35H 1HC1A 4CADB 4KKBC 4GKZA 4X6DE 2ISDA 3FF8A 4OZGF 4OZGA 3EFFA 3QWOB 4NKQB 2R0WL 4LL1A 5TPWL 2OTUA 2OMVB 2G4GA 4PBWD 3JWOH 1ECZA 1EJ6A 1CZ8L 4N2CA 2JKXA 4NN6B 4AIZA 2H32A 4GPVA 4PV9B 3PF2A 3GYRA 2YRLA 3AGVA 1NSNL 4OFPA 3VFVB 1U8NA 3ZHNA 1OGTA 3KEDA 2CBMA 3GBML 4OZHF 2TSBA 4PJGB 5E8NB 5JXED 2X5PA 5J6GB 4I9WD 2BPBA 4WW1A 2ATKB 4ODVH 4RQQA 3RGVC 2AJSL 2UY7B 1I9JH 3VXRE 4XMPH 4AGOA 2QVIA 4WWPA 1AO7A 4E5XG 3Q5TA 4QRSA 4KDWA 1SY6L 4HWBH 4ZG1A 3W0WE 2P5EB 2EECA 4BA8A 4MS8C 3HTLX 4NKIH 5B1KA 5B7EA 1MFCL 1QBAA 2E59A 4GAGH 5AW5B 3RU8H 2WNXA 3OX8B 1DQLL 1JWUA 1YA5A 2W8CA 3DDGA 4CJ0A 5EU4B 1RZIA 3BVDB 4X50A 4S1QL 4KFMA 4XNYH 3B7RL 2DM7A 1M2VB 1OM3H 3KYMB 4HD5A 1X5ZA 3FB6B 4B9PA 5IQMA 1RZ8B 3D0VA 3HG1A 2NW3A 2VXVL 3PY9A 5FUOL 2HRGA 5AZEL 4KV5E 2WWMC 4PBDA 3RI5F 2EE6A 1OO2A 1C5DB 1QFHA 1FG2A 1R3LB 3GUTB 5E2VL 4N3TA 5J12B 3QO0B 1WE5A 5F3HA 3HFMH 4FNTA 3UMTA 5I26A 1MNUH 4PTUA 3T2OA 3AM8A 3WAJA 3ATBA 4JRYD 1XQ4A 3VE0A 1ZRUA 4R7LA 3ZDXF 5FHAL 3QUKA 1JRHH 4IDJL 3QUHA 2NSMA 5BMFH 1A1NA 5GRYA 3TJHD 2WXFA 3L2LA 4BKSC 2VDLB 4AYEC 4F37F 2XETA 2FLMA 5JOFA 1AKPA 3LZFH 3TZVB 5BUGA 3OXRB 3P4OB 5FF6A 4I2XE 3BT0A 1ZJAA 2VMCA 1UA6H 3OKKB 4F7TB 4D9RE 1MF2H 4PWJA 2YIHA 4ZO6A 5C7ZA 1EHAA 1OOWA 2EDDA 4S1SL 4U3SA 1ACYH 3K8LA 4ALAH 4GXFA 5JHDB 1H0DB 1L9NA 1A9EB 3C8KA 2F58L 3BAEH 3ZKNC 1ORSA 2FIRT 4P4KB 1SXZA 1TENA 2CDGA 3AXHA 2Y6SC 4PCSA 1DBJH 1IO4C 4PRDB 4A2DA 1JP5A 5EC1B 1T04A 4APQD 4YPGA 5FM5O 4YSUA 1ZGLB 3PWVA 1PU0A 1PEWA 4P48A 2BJML 1RU9L 4HIIB 2UZPA 3GZKA 3ETBJ 1IC7H 2IBBA 3BGMB 2Q7YA 3QDMB 3CXHJ 4LHUB 3K46A 4N9GB 3T4YA 1W8OA 4FFYH 2X12A 5FYJL 3VRIA 1LDPH 2UZIL 2VLRD 1BQSA 4IOFC 3SDXA 3CHQA 1F3DJ 4MBOA 4XMXA 4YR6A 4E41B 3QIBD 4XVSL 2HN7B 3WI9A 3MRQB 1OAYL 2VR3A 5B1BB 2ATPA 2N3JA 3DOSB 5C0AD 1KPVA 2OK0H 3NJXA 3QJXA 2OJZL 4K4KA 1H15B 1KBGL 4XCEB 1XR8A 3LNHA 4P5TA 5CJXC 3AT8A 5D1QB 5I1EL 2O5YL 3LEVH 1TOXA 4TTGA 4UZGA 3NP3A 1QW8A 1H19A 2VR8A 3L1OL 3RLSA 4OD2A 5ESAA 1FH2A 3WNIA 4FABL 1X7SA 3U36B 2ZUQB 4K71B 3HI6H 3QORC 1N7MH 4P59L 4DP1X 1JRHI 2ENJA 2O61B 1KJVB 5D7IB 4LLDB 4UDUA 3RPIB 2AV1A 4JPIA 2H45A 4XGZB 5DLMH 4JO3L 1HCZA 3T3PB 3TYGL 2C3VB 4GI9A 1XEDA 5GZOC 2OMVA 4YGVA 2WZ5A 5CJQH 3LS4L 1MLCA 1YNKL 3BDYH 4UQBA 2V0AA 3HR5A 1G7IA 3VD4A 4OZGB 2J71A 3R1GH 5DF0A 2B20A 3MRJA 3QUMB 4ZUWB 3H4FA 1KJ2L 2NCMA 1FDLH 3QJZA 2DQCH 4BE6A 1JPFA 4R84A 3FHEA 4YDIL 1JFQH 2TRYA 4DFHA 1XGRB 4YH6A 5IF0A 1A7NL 4X9YA 1D9KA 3ELQA 3TN0A 2IPKA 3ALPA 4E68A 4XNZB 1MREH 3FTZA 5IFAL 1JHKH 2AC0A 1UCBL 1YPZF 1H8OA 1TYEB 4H8WC 1FNLA 1Q72L 4NRZB 1NCIA 4K55A 4JREB 3EOTH 5GXBB 4PCYA 1PZ2A 3A4FA 4ZX3A 4JPKL 2LGNA 2YO3A 2DLIA 4K7PH 2D2OA 4WO4B 5FCUH 1LK3H 2E47A 3EFOB 4UUJB 5HI3D 1SBSH 3U1QA 4ICWA 4LSPH 3VQLA 4L2LA 4OIIH 1KWKA 4IRSB 4UV4H 1E28A 2R51A 1WA0X 4P46C 3DJSA 4JFWA 1U33A 3KS0H 1OGTB 3MN8A 4MB4A 2P8MB 3F7YB 3T0BA 4NHCH 1UD2A 4O2CA 1TZGL 1KCUH 3LTVA 2OKMA 5DZ9A 2BVQA 3Q8AA 5JUEH 3INUL 5IMLA 3IXTB 4X5WA 3VG0L 1NFAA 2JNZA 4TSCH 1JZ5A 2WKGA 1JHLH 4NO5B 4KKNA 1BZ7A 1KB3A 3HNTH 4POUB 3H9SB 1QPPA 2XWJB 4P99A 1ZK5A 5GS1A 3WOVA 5FPIA 1YSOA 4HLJA 3LKRA 2K3TA 3QJSB 4IOIA 2KZWA 4WI2A 3SO3B 1IBYA 1KUMA 3KYNB 4GAFB 4XMKH 3MFFB 3REVB 4WI5A 3PHQB 1JFQL 2CIIA 3KLDA 5FGRA 3OAWA 2H0FA 5FW8A 2YOAA 3PYCA 5EUOA 1IKNA 1QR1A 5CU9A 1OAZH 3O4LE 2WO3B 4MJIA 1SMAA 1DJIA 2AJZA 4P2CG 3T0WA 3UGUA 4E41D 3CFDA 1BG9A 5AW0B 4C83A 2UYLB 5JW4M 2N01B 3RKPA 4F57L 5K59E 1GAFL 2PPFA 2WO2B 1ID2A 3EAKA 2FX9L 4PJFA 3EYFA 3MACH 5I23A 5T33L 1HQRB 4B41A 3WN5A 5JHLA 3NH7L 1AIFA 3KVDD 4MA1C 5ANHA 4EVNA 1YPZE 4DGYH 3DNKA 3GQFA 5DJ2A 5D6DC 5GRJL 1FDLL 5IQ7L 2G0LA 3CZEA 3HW7A 2F54A 3K71B 1DQIA 4G1EB 3C8HA 4HXAH 4A1RA 3FDWA 3SDAD 2NZ9C 1O7VA 3GXIA 1VEOA 1RJZA 2C7UB 3R18A 4ZAKB 1V3LA 2W38A 2HB0A 2HFGH 3SGDH 5HPMA 4ZMTA 1ET7A 1C5CH 3RNKA 2N59A 3ZDZE 5IB3B 4PG9B 3JSSA 4OCYL 3CDZB 4XAWH 1AD9B 5D70L 3RILA 2X2YA 5DUBA 1K2DA 5FX3A 1NAKH 2WIIA 4OF6A 1FL5B 2X42A 4K7PL 4YBHA 1B9ZA 2C4FU 3LZLA 5LBVA 1OV8A 2YD3A 2IO5A 3MJ8B 3QZNA 3BP6A 2WXLA 3VRLE 1X5AA 2VXSH 4WW2C 2AHIA 4D0DB 5DJDA 4X4YB 3HNTL 1R5VB 5D1XD 3SD5A 4NAJA 4AQ1A 5IB2A 4IKIA 2P8PB 1P4IH 2OSLB 5C0FA 3TYFA 1ORQA 1GY1A 2CALA 4HS6B 4B9ZA 3ML9A 5IVNA 1X9LA 1SYVA 4H8HA 3NSCA 3EJYC 1LILA 3L4XA 4P57B 3PIQA 1C7SA 3IU4L 1SQ2N 4WW2F 1KXTB 5D2NB 4CL7A 3MLSH 2QGEA 4BH7A 2BH0A 3OF6A 1ERNA 1KIQB 1MHHB 3BGFC 2FWOA 3GZPA 3LS4H 1YNKH 1MFEL 4MVBC 4GSDL 4E9LA 4OCSL 5D55A 1SEQL 4JEGB 4PYHA 3WTSA 3BIAX 5I15H 2DH3A 3UERA 2BHYA 2D7PA 2M26A 3BVNB 5SWZA 3UYPA 4NUGH 1RH8A 43CAA 1I9RH 2YJQA 3M8OL 5CCJA 4XE0A 4D8PB 3DSFH 4I0PD 5GGVH 4FLOA 3E2HC 2CCLA 3WLWD 3KJ4C 1SRDA 5GS3A 3E38A 3ZJAA 3HG3A 4PJ5E 2YPLE 4W9LC 5EU7C 1AD0A 2O5YH 3LEVL 2CM6A 4ELKB 4DUVA 3EDFA 2CKBH 4MMZC 3Q0HA 2AGJL 1P5UA 1UCBH 2MH4A 1DDHA 3OWRA 1U6AH 5DJ8B 5B4MC 3NIDF 1UA3A 2G5UA 1BSIA 4UV7H 3UH8A 3MV9D 2IANB 4L3EA 1SLWA 2KZKA 2QDVA 4XO5A 1OF2A 3QDAA 4PJAB 4LSPL 3QHZL 2VZTA 4TVPD 2AVFA 1J9QA 1F3DH 1W16A 1OT2A 1X5HA 2K7QA 4Z7WF 4RNRA 4CDGC 4JK0D 2AKRB 2CK2A 4NO3A 1TQCC 4DHLA 1UM4H 3ILPB 3JWDH 3T09A 2MNWA 3GMPB 1WIUA 3GXNA 1XCXA 5J1TC 1C1EH 1HI6B 3QRLA 2I25N 2Q8AL 2P5WD 4BM7A 2FT6A 3EJTA 4I0PA 4X2UA 2YD7A 3M45A 3MRPA 2FYYA 1A6VH 3FOLA 4HKXB 3WFZA 4P4RA 5CZXC 1MRCL 4TVPE 2XBDA 5DD6B 1CI5A 1JGDB 4L23A 3CFBA 4ODXB 1NGWB 4WWNA 4BKTC 2OXGA 3EDJA 1G4RA 1OVZA 4LLMA 1JGDA 4R4FL 3ZSTA 3V6FA 5IFJA 5I6LA 5F7MC 1IIKA 1YNLL 2DJUA 5LGJB 4U4BA 1NBZA 3QEHA 1BDYA 3LRGA 4ZW7A 3K81A 1E6JH 3BN9C 4NOBA 4YXKH 3G5XB 3NPSB 3P11H 2RQ8A 1BIIB 3FTVA 3LKQA 1PL3A 2BX5A 1QZNA 2FDBP 2QTEA 3U6XA 4W9GC 5BOPA 1U42A 5BRZE 2YPKA 2EIDA 3FQWA 1I82A 5FA3A 5C0DA 3KE0A 4PVMA 1IFHL 3A6CH 1MELA 1F4AA 2FX8L 1L4IA 3IFNL 3KW7A 4Z7NB 1MJUL 3WJMB 1HINH 4N0CC 1VERA 1F4YH 4HUWB 4LAJH 3DSNA 3AB0B 3WXWH 5EPMB 3DETC 1T21B 4U1MA 4P4KC 4DZBB 2X2IA 3GLZA 2O6PA 3H3BC 4I13B 3GJFK 1BMWA 4PS3A 1I75A 3STZA 5L2KE 1HYRC 1BGXH 4Y8DC 3SBRA 1KB5H 4LL4A 2A4ZA 2YS4A 1N4XH 4BHUI 5HD8C 2ZXAA 1ONQB 4ZMXA 3RUGF 1E8WA 1DCEA 2GI0A 2ICWI 2GK2A 3DX2A 1XWVA 3V6ZA 3L3OB 3S96A 2PCYA 4IBYA 5AB9A 3IJ8A 2W07A 1QNZH 1R24A 4ZD3L 1PTZA 3SDCB 1EHLH 3PABB 4PVLA 3QEQB 3O9WB 1UYWH 1IKNC 1W72B 3V0DA 1S9XA 3GMLA 2FVNA 4PLOB 4ZS7L 1V10A 2ZXWB 4YIQA 2F54B 1SHMA 2CDEA 4GKSB 1HEZA 4MFHA 4LSTH 4W9ZA 4J5VA 3WIIL 1OXYA 1F4WH 2NY7H 4A2GA 4ERSL 1UYWL 1QSEA 2H0EA 4WO4D 1XIWA 1LO0H 1Z3RA 2J1YA 5FLVA 5JDJA 3JT0A 1UKSA 2B5IB 2R7EB 1IL1B 1MHHA 3JYCA 5KS9E 4NO0B 3TNNB 4XCYB 1RVFL 5D2NA 1KY7A 5JZ7C 1EVUA 3RVWC 4BFJA 4PS4L 2ZF9A 3AQDA 2VLME 3NZHH 4NQED 1OLZA 1DQLH 5D6DA 1OE3A 3CFDB 4C83B 3IT8D 4Y1SA 1VFAB 1F2XK 5TH2A 4JE0A 4XP1L 4AXWA 4HIXL 2WLNA 2VDKL 4H8WH 3ECQA 5FV2A 2NXZB 5IB2B 1D5ZB 4GEIA 3NA9H 2PYFA 2QKIB 4OZ4A 3U1PA 5C08B 1HESA 2Z35B 4Q9QH 1TJIL 2PXYD 3QYNA 3HC4L 5DD1L 3HBQA 1WBXA 4FQIH 5F8RC 4GAYB 2B7DT 1RL1A 2UUDK 3FC8A 4JO1H 4U1SB 4L18A 5D6CA 3K8KA 3CMOL 4PFEA 5I18L 4J1UA 4W9FC 2CA4A 3DO4A 2V9QA 1K6QL 2QEJA 4XNYL 2HLEB 3MXVL 4AMKL 3RGBA 2WXIA 1YAZA 3EUDA 3PG2A 1CXKA 2X10A 3QPXL 1JNHB 4N2BA 4Y4FC 3CU7A 2EEFA 3PGFH 4H8PA 5C2BH 3MOQA 2OTWA 3KBPA 1WZMA 3L5XH 1FVDA 3C08L 4D9LL 5D9SB 3FT3A 4Z5RA 3QWRD 3DX3A 2NUPA 4AYBA 3NCYP 3MLRL 4F15C 4O2CB 3VM5A 5J12C 4H1LH 2NY1C 2P5ED 1I8IB 3GNMH 4AXWB 1EFXA 3LN5A 3MV7B 3QISA 2RFXB 1N70A 2HWZH 5DQJB 3UBFA 3VGDA 4F9PC 1CZ8H 2XWTA 3BQUD 3FB5B 5EZPA 3TO4D 1BFTA 4XN2A 2GY5A 3OKOB 5E4OA 4F8OA 2LLLA 2AJZB 3NIFB 3C5JA 3FCTB 4HZ1A 2IAMC 1BOGB 1KB5A 5DJAA 1OCRB 5EO0B 1S9YA 2BCKA 3KEHA 4X80H 1ILSA 3E0GA 2LLNA 1YY8A 4YQXL 1TNMA 2XTSA 4ZPVB 3EJZC 2YGOA 1CK0H 1R75A 2EEXA 1HHJA 3E6FA 3NP4A 4WJ5A 5EU7E 1P5UC 3P3RA 3TBWB 3AG2B 4P3CH 4TSBH 5JHLL 2PABA 5KN5B 5HHVL 3ZYOA 4AC4A 4ZW3A 1TCRA 4G8FA 4ICXA 2NY0C 2EDJA 2A6JA 2DQ6A 1BFOB 3CVHB 1MUJB 2J8UA 1U6AL 3F04A 4OZFA 3SCMB 4Z8FL 5FGCE 2GITA 2VYRE 1I7UA 3IAQA 3MLRH 3FB7B 4UBDC 1X5LA 5C0IB 3V6ZB 4HPYL 1B6DA 3D3VB 4ZBJA 4L8DB 2WLYA 4NN6C 2VDRL 2XV0A 1ONQA 3ZE2E 5GSVB 1KSRA 4YSPA 1JYXA 3IXTA 1ZDQA 1DL7H 4PJ9C 1I7TA 4IBUA 3BGFB 3DARA 2FTAA 4OCWL 3AS2A 4MAZA 3AS1A 1A1OA 3UAAA 2DJSA 1ZHLA 1NFDF 2X53A 2IDTA 4APXB 1HFUA 1QOKA 2FHBA 4FLHA 1H6FA 5L8KB 5DYOB 1HZKA 3KM1A 2JJWA 4A68A 4QRTA 5F72S 4RGNB 3L5WA 5ISZA 4N0CD 4MDJB 4NQEE 3QUYD 3W39A 3FQWB 3RFZC 4MS6A 4XCEA 3O8XD 4LHUD 3FU3A 2CKNA 3TO2B 3D3VA 2BIHA 1AZZC 1BIIA 2WQUA 4YUEH 1KLGA 6PAZA 5L88H 1AKJB 3HG5A 3HHRB 3HG2A 1FZOA 4M9PA 1QI5A 1A9VA 4DPAX 4IW4C 2ENPA 3QIBB 3QZMA 3TV3L 1HZLA 4TYUA 3MNVB 1QQDA 1AHWB 4TQEL 3DJ9A 5FHBH 1NAML 2VJXA 1YPZB 3I75B 4F33B 4QTIH 2A9MH 2PXYB 3NABL 5G4OA 3G7TA 1VGKA 4LF3A 3TT3H 2LTQC 3CFBB 2KBGA 5DHVB 3HCVB 4N25A 3OZLA 1UXLA 2E27H 3DV6B 2Q7AA 3PWVB 1QRNE 5FO2A 1UM6L 5D4JA 3I9IA 2WZPA 3L9BA 3WFEH 1BF5A 4FQ1L 3IEAA 2AANA 4FQCH 4HH8A 2IIJA 1F0LA 3L9RB 4BEIA 3SYCA 4HWEL 5DD3H 2FO1A 5B8CC 2YQBA 1O7DE 1CFSB 1YAIA 4XXWC 5KZCB 1ZVSB 3DHUA 3GI9L 4HCRH 2FECL 4KX7A 4QPEA 3VH8G 2Y24A 2P28B 4J4PD 5E23A 2YGVA 1J8HA 2NUPB 5ADPH 1W72L 3VX0A 2DMBA 1JGLH 2W9EH 4PUBL 4CDHA 2J7LA 1DQML 3HNVH 4TNVF 2ZSVA 1A1NB 4PSRA 4L3EB 1HEHC 3Q6FB 3RVXD 4FKEA 1U8LA 3U7WL 5TE7H 1DQMH 2YC1B 3EADA 4N2LA 3UX9B 3FH5A 3OL2A 4HQQL 1JUFB 4LLVB 4PV1C 4PB9H 4R8WL 2QSCH 4M03A 3AT0A 3MRCA 4JG0H 1FZMA 1FHGA 1W72H 3PXLA 4F8PA 2HH0L 2WLIB 3VW3H 3DA0A 3GMOB 2EIZB 1IE4A 5D7JA 3MYZA 2ADFL 5I1JL 5D2NC 2H1LM 2CBTA 2V2WB 5CU5A 1ZGLP 4G7VL 3QB7C 5ITFA 3BGMA 4WI7A 4UQCA 3ULUL 2KKQA 2FQFA 2VLMD 3KBHE 4YPGB 5T3ZL 1WFUA 3OGOE 3QCVL 3WS3B 1JG9A 4PWGA 4NP9A 4NRXA 1NGPH 2FYVA 1FYTA 3OKNA 1JZHA 4X7TA 4Y4KD 3QJQB 4J2QA 3MBEB 3MRLA 1JD9A 1BPVA 1WFNA 3ZQXA 4YLQT 5J6GA 2C7FA 2I9TB 2Z1PA 4KK5C 2J5LC 3F7RA 2CIKB 1XXFC 3MODH 4XXDA 5SX5H 3TJEH 1KFAH 2DKMA 4MD0A 1NEZA 1XIWB 3GIVB 3EJJX 1GYWA 2Q86B 5I2IA 1JVOA 4G8FB 1KPUB 4M56A 2Y06H 2CLRA 2ICCA 5F70A 1JGVL 4Q6IC 5DMGD 3TVMD 1F1GA 2Y6TE 3DC0A 3TOPA 4C58B 3MRGB 5ICYA 2V5RA 1NEUA 1Q9KB 1NANI 4PJ7E 4LKXA 5A43C 5D7LE 3QQNA 4XCNA 4P2QD 3ZDYB 4GKZB 5I1DA 1BFVL 3QO0A 5SWZD 3ARBD 3ISRA 5TJWK 3DV4A 1NWPA 1A6UH 3WKYA 4AQEB 1MSPA 2HPOA 3SJVE 6FABL 1GGCL 2PPAA 4JZNB 4WFEE 4NPKA 5I6KA 1A6WH 2JJSA 1MCPH 2NY6B 2F53B 5FGBA 4JUSA 1AXSB 4F9PA 2QR0B 1OAZL 3CNKA 3BPNC 3NIGE 1E4XH 3L7EB 3DVNA 2VSMB 4TUKL 3NZ8A 3DSNB 4Z7IA 4U1HB 4Z5RB 3JUYA 1P1ZA 4Z7NF 3VVVA 2Q2LA 1CLOH 1U91A 1BWWA 3WD5L 3GBNH 1YUHA 3MV9B 2X1OA 4DP6X 2YEVB 1AG6A 4N8CL 1KWGA 1QFWI 3KXFD 4AJWA 3OR6B 5HHOB 1VF5C 2A1WH 2WCSA 3KVQA 5GGUB 3UDWA 2ZWSA 3AGWA 3K1DA 5AG8A 3V7AG 1SXAA 4OSUH 5DHEA 3LIZH 3L6FB 4ENED 1OPGL 4PRIE 4AIZB 4O5LH 3IDMA 5C0CE 1UHVA 1VFMA 2ZX7A 4NQUA 4OLZH 3LMJH 5FO7B 1T2JA 3KLAA 4PGEB 5FXCH 1JZ7A 4X9HA 4LLMB 3GMMB 4WNSA 5FECB 4FQQA 1W2KT 1JK8A 3MFFA 5CHNB 4MD4B 3UTZB 3REVA 3ZVVA 4RZCB 4IYKA 5FKAA 3RHWF 5MEND 3M46A 4DKFH 3IKKA 3C6EA 1EA9C 3I6KB 2IH1B 2C8NA 2W80C 2FNBA 4NZDA 3WMSA 2B59B 3KXFA 1AGEB 2OJ1A 3H7BB 5FM4A 3UBXI 1U3NA 3RIAF 3W57A 4X7EC 4JFQB 5JIIA 5FYJD 3GMPA 2BY1A 2ZXEB 4TVUA 5FYJH 1WT5C 1D7CA 2NY6C 2GIXA 4N0YH 4M93C 5EZLB 4NAMA 1O6VA 3ESOA 4Z18A 1KTRL 1WCBB 1CDIA 3DX8A 3J27A 5I6MA 1IGML 2YA2A 4ECNA 3PQYD 3G04A 1RERA 3D1MC 4NLHA 3QUZD 4HIEA 1LP9A 4JB9H 1J0JA 2BP0A 2OULB 3BP4A 3QAQA 2DRUA 4ABVA 5HHNB 4JO4H 3TH4T 1HWWA 1QUNB 3AC0A 3WNOA 5BJTA 1G9NH 3VRJA 4JRFA 2F2HA 2NY0B 3S2CA 3BKCL 4N2FA 4PJBF 3MRFB 3TTSA 1T1ZB 1FZJA 5K9JL 3US0A 1I7RB 2AMUA 3Q9PA 2MPAL 4PRPE 1R34A 1BZEA 3EFOA 1P53A 2Y1VA 1R1CA 3HNVL 3I84A 2JB5L 3O9WC 3B37A 3PLYA 1JPSH 4X8CA 2BNRB 3MRBA 1PPIA 4UAHA 1L9MA 3VG0H 2Q3ZA 5DEJA 3S9DB 1PMYA 3NTCH 3P4NA 2X6MA 4F57H 1HKFA 4WK2B 2BFGA 3KPRD 2X88A 5AVWB 4HH9A 2ZXBA 1UZ8A 4JMNA 1PF3A 3W0WB 1E4JA 2A1WL 2JWYA 5FHAH 1H3XA 4NKMA 5B8CA 5IJCC 1JS4A 4PI2A 4WI4A 3BVVA 5KG9B 3A67L 3F8UB 4LCUB 1AY1L 4AT6B 3TN0C 2Y2YA 1MHPH 4JLRB 4QD2E 4FQXC 1QVOB 3E1F1 3BO8A 3WY4A 5CP3A 4GRWF 5CILL 1Y0LB 4PJGE 1SQMA 1XR9A 3KPOA 3OAUL 4IEFA 2IOIA 3WIIH 1HHKB 1XH3A 1BQRA 5GGSA 3UABA 2DQHL 1NDMA 2JCCB 4NWTL 1OAYH 2LAAA 5GGSY 5A1AA 5LAXA 4X0NA 1Q0XL 2R0ZH 3I6LD 5L2KA 1ZHBA 3SQOH 4MJID 4L9LB 2E9BA 4B0MB 1ZMYA 5DUJA 2C9RA 2GTZB 4Y9CA 3ME0B 4P46A 3ARDC 4QLRA 4Y1AD 5DR5H 4KH9A 4XN9A 1BF2A 2DDQH 1FFOA 2PMZA 4ODTL 4O58L 4WO4C 3WTUA 4Z7OB 3W2DH 3FOMA 2WLKA 3OJMB 1E30A 5HI4D 1MQKH 1FG9C 3CFQA 4PCKA 5B1JA 4QOKD 4OCMC 4EF3A 4Y4HC 5BV7L 3GT6A 5B3SB 5TQ2L 1RUAH 4KTEL 3AZUA 1DJWA 5TE4H 4GRWB 4U7SA 3BC9A 2CRZA 3UYOD 2FB4L 3RWDA 4NKMB 2DV6A 4RISL 4Y2NA 1MCOL 3GSQB 3W1ZA 3FQ2A 2BP5M 3FTXA 2W91A 1OSZB 4HFUL 2WMPB 1MWOA 3GMNA 4L8SC 3CQPA 3IBEA 4PLJD 2C9SA 3U6RA 1NFDB 3QJFB 3MX0A 5GS1C 4IKJA 4JHUA 2R4RL 3QDMA 4L2YA 1CLZL 3UXFA 4LSQH 2BVOB 3SDXE 4K7FA 4Z7WA 2WVVA 5IBUB 2EABA 1DUZB 1NIEA 4MLSA 3PP4H 4NJAH 1F02I 3EF7A 4EI6A 3NESA 4RCAA 4Z7OF 5I1KL 3O2WL 1JVKA 2CHWA 2XN9B 3MMEA 2C3XA 3UC0L 2XC8A 3D39A 2LVEA 4A2FA 2CJ3A 2P42B 4XC3L 4ZFOA 3GO1L 1VENA 2EIJB 2BRQA 1H0DA 4QMEA 5C0CA 1AD0B 5A7EA 1KTDB 1S6NA 2BC4B 2XZZA 3SKNA 1SZNA 2VN7A 4KXCA 1J1PL 2BXZA 4R5TA 2OQJA 1A6VL 3N44F 4YX2L 5JMOC 2KLSA 1BX2B 2YD4A 3DUSB 2OMZA 1BW8A 4RAHA 4Y2DA 3VSVA 3EDEA 2DQTH 1UEYA 2R9HD 3PPEA 2WN2A 3GSUB 1TEYA 3B9DA 1AP2A 2JJSC 3SGEH 2AXJA 4X8XA 5FGBC 5BV7C 2P52A 1B0WA 4R6UA 3NA4A 4FLQA 3U83A 1DUYA 4TOYH 3QEUA 5I6NA 3DX1A 4Z6AT 3JZYA 3H55A 2H1PH 1OHZA 4LIQL 1JHLL 5E56A 1T5WB 8PAZA 2B0SL 5EDSA 4M62H 3PRZA 3FO0L 4NO5A 4G6JL 8CGTA 1IARB 3FCGA 1NGYA 3ZKXB 4EUPB 3IFLL 4DQAA 4EXPX 4Y4FB 2FK9A 3V0HA 4H1LG 2HRPL 3BUIA 1T0NB 1N3NB 2NX5B 3IMWA 4GJTB 1RZIB 2NY5C 3IPFA 5D7LD 2VE6B 3RAJL 1A64A 3QUML 1KJ2B 1UOKA 2EYRB 2ODHA 5F1IB 5CR8A 1XF2A 5JPMC 1A7RH 1TSHA 3MJ8A 2CO7B 4RSYA 3NUKA 1XCWA 4HU2A 2YAFA 3MNDA 3QIWB 4PIRF 4F91B 2XOTA 3T8VA 1KGUA 4BELD 3BXNA 3Q8FA 2R0KL 2AABH 2EJ1A 2R69H 4GUPA 3TCLB 4GSUA 2PR4L 1MCKA 2QV2A 2E76C 1NM4A 2P5WE 2B14A 4AV0A 1H3TA 3KH3A 2OCCB 4WWKC 1PEZA 1UXSA 2D0GA 2HXAA 2IAMB 2ZUVA 3H9ZA 4NAQA 3O3DA 5EFIB 3BGAA 3FRUA 4R0LA 4MQSB 3K2IA 1YHPA 4JN1L 2WBKA 4X6EB 1PZ5A 1QYGH 4OZFG 3ZL4L 3JV5A 4QTFA 2WV3A 1T4WA 3WNPA 4G5ZL 4FYQA 4HCGA 1E90A 2KI6A 1W0VB 3ARED 4HUNB 4MCYA 1MF2L 1DEEB 3D2TA 4R4BB 2G9HA 5GRUH 2E56A 3L3JA 3GSNL 4LGSB 2YPVL 1MEXL 1IGTA 4LOEA 5EIQA 3PDGA 1ADQA 3D52A 3FSZA 5AYUL 1IFGA 2I24N 2YD9A 4OTXL 4EOWH 3NJMA 1JAEA 3QQ9C 1S7UA 2E75C 3GM0A 5BVPH 1GGYA 1ZA3A 1RIVL 5E9DA 4IS6B 1PJWA 3QNXB 4ZODA 2YPLD 4XVJH 2RR3A 1TIUA 4GRLD 5I9QB 1OM9A 1P7QD 4Y5XA 2VMDA 2O61A 1WFIA 3L3KB 4M1DH 3OXSA 3PHQA 3EZJB 3GGWB 3QAZB 1EHLL 3ETTA 2EDWA 4G9FE 2GW5A 1NGQH 4WWOA 3CHOA 4XPGL 1KN4H 3TF7C 1OHQA 2DJ4A 4GH7B 4OAWA 4BXSV 1A8ZA 5GIRB 2NOYA 4OW6A 5K1VA 4KI1A 3NSFA 2HJKB 2ATPB 4NQCD 3EGDA 2I69A 2N0KA 4P3CL 2NLJB 5CLTA 4OJEH 3VFGH 3VVWA 3E6HB 1XGQA 4HWUA 3QPXH 1OOAA 4O58H 5DUPH 1F1AA 4NDMA 2YAMA 4XMPL 1J5IA 4ZW8A 4LMQI 5LAPA 3Q2NA 2C5DC 2NY4D 1SOQA 1AQDA 1QRND 4L4VA 1OTTC 1AXTL 2Q7YB 1Y1UA 1O6SA 2DLFL 5C07A 4ONFL 1OAKL 2DMGA 3SHSA 4U6YA 4PB0L 4MA8L 1EJOH 1HHIA 3P9LB 1Z3GH 3F62A 2HVKB 1KYFA 2IDCA 4IOSD 3N1FC 4PRHA 1J9CT 1MDTA 4XVJL 4XN1A 3Q2VA 4KUZH 4M7LT 2FWSA 4JAMB 5FC9A 4GLRI 2LU5A 1KJ3H 1FNSL 2ZSVB 4XP4H 1D6EA 3FN0H 4BH8A 3N1QC 4CU6A 5F7NC 2WUBH 2WBJD 4WO4A 1BX2A 3DUSA 3LH2L 4M61B 4CC1A 2A7BA 1ESOA 4JFED 3HUJE 4R83A 5HSFA 2K78A 4QR7A 2DPKA 5MERA 4NRZA 2APTA 3PGFL 4P4KD 4P5SA 4MB5A 2WXOA 1GS7A 4J2XA 1L6ZA 4UU9B 3TVMC 2VLJB 3L1FA 1HIML 4BGLA 1G7HA 2ID5A 1BAGA 4UT9L 2FZ3A 5DHVH 5IF0B 4B60A 1ZA6B 2Z31D 1IBDA 2A38A 5LQBL 1ZPLA 4XVOA 2XKNB 2VDOH 5IT2L 2BVOA 3L9EA 3QJVB 1JK9B 2YOCA 3X1EA 2DAVA 3ULVD 4IQHA 4LF3B 3SE8H 3TBVB 4YSEA 5IOPB 3T6QC 1TG8A 1JXFA 3VD7A 4GXVH 4DKDC 1CE6A 5E9DE 3W0WD 4KKZA 3AT9A 1CF8L 4LLYA 1L3WA 3AFLA 5D4HA 2IGFL 3RTQD 1M7DB 1TTGA 4C56B 4AUYA 5HJBA 1OAUL 2FBOJ 5J8OA 3PGDA 2NTFB 2VLRB 2DWEA 4MJ5B 1XT5A 4QHMA 5AAMA 1UWGH 3WSQH 3NFSH 5IMKB 3TS8A 1T0OA 2EDRA 1FC2D 2OMUB 3LZOA 5AVXB 2EO1A 3SZKC 3MLVL 2RMNA 1HINL 1YRKA 3G6DL 4OV6F 4PRBA 5EBWB 1PKOA 2I7SA 1XIWC 3GD1C 3BISA 4G80A 4NHUB 3X17A 3ULVF 1A4BA 2NY7L 2YUXA 3CQFA 4B9JA 4H25A 2FWUA 2DWDB 4UQAA 1J5OH 1UD6A 4NNYB 3RIFK 1C1EL 1DEDA 1NCTA 5EIVA 4L1TA 2ICWA 3QDGB 5CBAA 4KKBD 1DLFL 4ESKA 2DQCL 2VERA 4X4ME 4GRLB 2OTUB 2VKXA 4WUUE 1ZLVH 3TC9A 1K4CA 4MMXB 3OHXC 2XTJE 2YPVH 4MAYD 1UJ3B 5MEPA 1HHKA 5GGSB 5E6RB 1JK9A 4TXVB 5FYLL 3S35L 1IVLA 3FFDB 4HIIA 5BZWB 3TPKA 1CC3A 5D72H 5KBKA 2BW4A 3LHAA 4Y5YB 3O41A 2FZ3B 2PWDA 5F1SA 2DI9A 4PD4J 3FT1A 2FEJA 3N43F 1SPDA 1AS7A 5C0GB 1G7QB 1M71A 4L4TB 5MENB 1G9NL 2VLKE 3F7VB 4OGYH 5FOBA 3HC0A 1B9KA 1F4HA 1NPNA 3CN1A 1MCQA 4P2RE 4PGEA 9CGTA 1Q1JH 5JORB 4IMLB 5KUKA 3MNZB 5JTWA 1KLUA 5TE6H 5TDPA 1NC4B 1NMBH 3A24A 2CD0A 3OMIB 4GEJA 4ONHB 1DDTA 4IIQB 4HFUH 3K2KA 4WWKA 3U1SL 4F58L 1LHZA 3TZVC 3I02A 1TTAA 3DGDA 3L3JB 4FG0A 2JI2A 1F3JA 3FH8A 3CFCH 4XNMA 5IQNA 2IDFA 4LSRH 3EJYD 1X5FA 5I28A 1XBRA 3NYKA 3NZSA 5C07B 3U0WH 2CKBL 3ARUA 2VRAA 5D9SA 5IB1A 3SPIA 5C86A 3ULVH 1BVNP 4FHKA 1IJ9A 4H0IA 5DVOA 4YE4L 4A6YB 2EVIA 3QJUB 1TU2A 2EE3A 1JWUB 4NO2A 5DEFA 3WDHA 4AW7A 4AJYV 3GSXB 2CBOA 4U1GB 4G8GB 1QUPA 1S2EA 2IOOA 2Y5QA 3EHBC 1RZ7H 2BOBB 1BYNA 3TCLA 3IKCA 5GJSL 3O3UN 4PP1C 2BIPA 5ALBL 2XPZA 3H4HA 3PL6C 3UG4A 3DRTB 1V7ML 1ICTA 3CFEA 3GSVB 5KVEE 3T8XA 3BD4A 5IMOA 1YEJL 4KNTA 3OJVC 3K4ZA 3T5WA 3IU4H 4YVNA 4FI8A 3WY3A 2JVUA 3N40P 4NM4L 2G30A 4CSPA 1GZPB 4WNQB 4F93B 1LXMA 5DO2D 5J6SA 1IT9L 3ROLB 5I76B 1RZFL 4HSQA 5JHAA 4I9WE 3MLTA 5E00B 2D73A 1NEZB 3GIVA 2BK8A 1AR1C 3ABLB 3RZCC 4DCQA 4QXGL 3H8NA 2J8UE 1WC7B 5L6YH 3MAWA 4TNEA 1SLUA 4U4IA 5GISH 1NPJA 1TJMA 3NIDE 2X4QB 3LSOA 4GKNB 1R17A 5F7AA 1KG0B 1NCWH 4BFEA 2ZXDA 5IV2B 1A7BA 1EO8H 4GQZA 3TLRA 3V6OC 3WKQA 3EJUA 4P9MH 4PJ9B 1BV8A 1AS6A 2J44A 3IETB 2CM5A 1GAFH 5K9OB 4F80A 1A3ZA 3FO2B 1B2WH 1PLAA 1VEPA 1GKOA 3TM6A 3AM8C 2FX7L 2QZ5A 5J9PB 5LCVL 1I8MA 3T2PA 1I9JL 2FB4H 3UTSD 1H3PL 4X98B 2GIYA 4XO4A 3WNKA 1GGBL 5DWUH 1KEGL 2E9IA 2YHGA 4UV4L 5GRJH 4S1RL 1U4FA 4XP6H 1HX0A 4YDNA 3MJ6A 3NJVA 2COQA 3DJTA 3D39B 4BYHA 1T1YB 3I02B 3TJHC 1SDDB 4JFDB 2ZPKH 4M48H 1Q9KA 2DIAA 2COVD 5F7YC 5KSUA 5ICYB 3SO3C 3L16A 1JHTB 5D71H 4YBLC 3HPJA 4F2ME 3THMH 3BZ5A 4OLXH 2OMYB 4XODA 3VSUA 4XVTL 4RAVB 2AJ3A 3IVKB 4C57C 4KJPC 1J8HB 2ED7A 2OPCA 2UVFA 1KN2H 1RUMH 4G9DB 3RJQB 5CCKL 3U6RB 4N3UA 3VDBA 3D8MA 2R2HB 3K5RA 4O51B 5CZVL 1CMOA 5E4AA 5C0DB 5B3NA 1YO4A 1J12A 2PO6B 3BH9B 1JI1A 4MQ7A 5B7MA 5K69A 4Z1PA 4MKMA 5F7FA 2B39A 1GIGH 1M71B 2AK1H 4M7KL 3UEZA 3V6OE 3UTTD 4JG5A 5DMKB 3V0IA 2IBZY 1DVZA 4I77H 1NCOA 1OF0A 4MX7B 3CGTA 1JPGB 1EAOA 4S11A 4TNFA 5D5MB 2IH9A 4U6TA 1SDYA 4FZEH 3ZKXC 3L2NA 1WICA 5BZWA 2K9UA 4LSUL 5D7IF 2PWHA 4E9XA 4JNXA 1SHSA 4NQDB 4Z7VA 4OKVA 4HU8A 5T3XE 5GSRB 5TDNA 1N59A 2AJVH 1PZAA 1CDGA 4BGDA 2BZCA 4S0SD 1MW2A 4W9HC 4H25B 5K39A 5IKCB 5B22A 5F9WC 1L9OA 4ZJ9A 5I0ZA 5D7JC 1AKJA 2B5IC 3GHEL 4GFXA 4PJCA 2Y5EA 2WYIA 4U7MA 4MXQC 1URLA 2E6PA 4AZUA 1MCWW 3V4VB 4GW5B 1CICC 3Q6FA 5CGYC 1PY0A 3JBG7 4MQTB 1Z5LA 4ZMLA 3R7RA 3LKPA 3N1GC 4G7QB 4JFEB 2XTLA 4QRRB 4LCUA 4H2AA 4N26A 4ODSL 5C8JB 5T3ZD 2HZHA 5DYOA 4Q14A 3C09C 1FLRH 2L7QA 3LB6D 3WS6A 3ZYZA 2APXA 4G3YL 3UG5A 4ANKA 4W9EC 4OF5A 4P23D 2J1ZA 4R4ND 1KNOB 2B3RA 2F7RA 3GF8A 2AQQA 4UTBH 1KELH 2GT9B 2GBUA 3MV8D 4C59B 5IGXH 1DTUA 5HDQL 3QXAA 1NQBA 4TQEH 2BNUA 3SKJH 2R69L 3G5YB 3POHA 3SSGA 3TV3H 3HBZA 4M1CC 2CR6A 4JG1H 3BESR 5J1SC 3N40F 4D3CL 2A6IB 3TJEL 5DT1L 3F83A 1KXVA 1J11A 1LQSR 4A2HA 5BCAA 3HI5H 1QLEL 2FGWH 4S1SH 1T0MA 1QI4A 2C9XA 2VZ1A 1L7IH 2P5WA 1KJ2H 4X6CE 1KBWA 1VGEL 2AJYL 3MOAL 4OM0H 1U3HD 2ETWA 1YPZA 3VACA 5TF1H 2H41A 1TQTA 1QQDB 5HGBA 3CD4A 1G9HA 3QXDB 5LAXB 5LHDA 1PS3A 3PP3H 1IEAB 3ZRCC 4DEUA 1QX1A 4HJTA 5DJXA 3QFJD 2J4WH 1KCKA 1DL7L 4KOBA 2W5PA 4Q52A 2B15A 2OFQA 5EHFA 4L9LC 5F7HA 3D39D 4FQ2L 5HHPB 5KSAA 3SKOB 2RCSH 4AMKH 4PGCA 1I8IA 2VN5A 4YHOH 1AZRA 3VA6A 1BWMA 1HHIB 5MEOB 4CVXA 2XY2A 3FCSA 4JPWL 4X6FA 5A3ID 4GUCA 3PNWB 4IKLA 2VQ1A 5F97E 3L4WA 5CEYA 1S7VA 3FTGB 5EA0L 5FECA 3TBSA 4Y4KC 5C0BB 5CGTA 3BUPA 4UINL 5B39G 3UFIA 3F7LA 2K8MA 3ZTJH 3UTTE 3HE6D 2EDFA 1TTFA 3HJEA 3GXUB 1ZLUH 2DS4A 2FBJH 3SCMC 3S88L 4I88A 2GG1A 2EE0A 1DVQA 4HETA 3WE1A 4LQ1A 1M6UA 2X4OA 3LQZA 2IV9A 3QEQD 3IFOB 3FBQA 3MUUA 3KPQB 4L4VD 3SQOL 4X42A 2YWZA 3DXAD 1AJ7L 3AY2A 2CH8A 4ES9A 4YO0A 5L8JB 2R23A 2VWEC 3RPBA 3Q01A 1AGFA 4I1NB 1KXQA 3U2IA 4ZS6C 1S7XA 4PCTA 4WSJA 4EN3B 3EOBA 2HVJA 3MLZH 3SBWC 2FJUB 5LN4A 2OYPA 5C0CD 4NLAA 2ITFA 2PYEB 1JBJA 1WCBA 3RWHB 4Z7QE 4XVUD 5FO9A 4PJFB 1MCOH 4RISH 3B9KA 4F7EA 1MI5B 3BFWA 3RVXC 1AQKH 5DFVD 4OF3A 1EBAA 4LT7A 1GC1H 3H54A 3CHXA 4JZNA 1NAMH 4LEBA 2H3KA 1IGTB 1OP5K 1JN6A 1AGEA 3H7BA 4J8RA 1KTBA 4MSWB 4X7SL 2RFXA 3C09B 3B1TA 4FQHA 4WY7H 3VO0A 5FO8B 4OB5H 3QSKB 5IBLD 5LNDA 2GBAA 3I6KA 3QUYB 3KPNB 4FULA 3RQ3A 1T7VA 5ESQA 2BSTA 2VDMH 1B90A 3V4UL 3FCUB 3HFML 4KJYB 2WZPD 2EUWA 4BFIA 5IWLA 2V4LA 4PGBA 1U36A 2Y9RT 2QZQA 4LLWB 3DXAA 5ACZA 1BJ8A 1LP9E 4QRAA 3O6LL 2OTWB 4Q9QL 1A0QL 3O9WA 3HZMB 1F4YL 3MSPA 2RCSL 4U1IA 4Q9BA 4XPBH 2I60H 4PJHE 4AL8L 2WN3A 2ENYA 1ZANL 3PHOA 5E99H 4AQ1C 3UGEA 4S2SA 4Y2OB 2IG2H 3DRQA 4WAFA 4HS8H 2VW7A 1BXXA 2IQ9L 3S36X 3T0DA 4KZEH 4XPHL 2IXQB 5FYKH 2UZXB 5E1HB 1WFMA 4L1HA 1WBXB 1O9ZA 1XMWA 1NIFA 1KV7A 1MY7A 3BYTA 3KW8A 3EIFA 3KGTA 3HZ3A 3L7EA 3FYIB 5KTEH 3DHJA 2X2UA 3QCTH 3PFQA 4M8VA 3K7UA 3MGOA 1UATA 1RZJL 1NIDA 3MJ9H 3S3PA 3JWNC 5TH2B 4YHZL 3T1FB 4ZAKC 3OPZL 1NGYB 4YDZA 2BP8B 2ZICA 2YWYA 4JFFE 1UGNA 3ZRSA 4FZEL 1IQDA 3VXSD 1KYAA 4I4WB 5I8EB 1LO4L 3JV4A 4KKPA 4NN7C 1E67A 5E8DL 2ZP8A 1MKFA 1IEAA 5IEHB 1SFDA 2IF7A 1QSEB 3KDMB 1BJ1H 2JJTC 4OFKA 5ITBH 5IUSA 3U9PL 4JCMA 4U31A 1G7LB 5CSGA 3FRPB 4DK6A 1EERB 2IPKB 3JTBA 3IRZA 3GMLB 1QRNA 4M5YH 5DD6A 4BFIB 4ZUSA 1SN2A 3UEQA 4Z23A 1PLGH 2W1NA 3Q3GB 1YEGL 1FIGH 3CZGA 3QULA 1MCEA 4M1DL 1L9SA 3KPSA 5E2UH 1T20B 2IV8A 3O3EA 4C4UA 2TSAA 4U05A 2VJ0A 1YMMB 4Y5VB 4DVBB 4EJ1C 5KVDH 3IRPX 4M43H 4MA1B 3K6SB 5AFAA 3KLQA 1INEL 3BFOA 4K3DH 3KDPB 5JPNA 3L3HA 1A02N 3EYQC 5T1JA 1IRAY 1QLEB 2VSDA 1KZQA 5IM7B 3P69A 5C09A 4WFFD 2BY0A 5AENA 5HYJE 5I0WA 3SDDA 1K6QH 1SFHA 4JVPA 5C8JA 3GSNH 3KCPB 4DJMA 1TZ8A 3WFDL 3B2DC 2XN2A 2GAZB 2R23B 4CSSA 4EKXA 4GSDH 4YO0B 3UL4A 4JQIH 5MP6H 3BN3B 2HLFD 3DOSA 4MAUL 4GAJH 1N67A 1BQLH 4WJKB 4XBEL 5FK9B 5HJ3A 5C07D 3SIKA 1NBQA 5DD0L 3NA9L 4W1TA 3WEXB 2H5UA 3O8XB 1CT8A 4BZ1A 4YR6B 5DD5L 4P2QB 1MW0A 3GBNL 4F8LA 2ZWZA 2ZZUT 2QL1A 2Z91A 1Z9MA 3GJFA 3KNBA 1CPUA 1H8NA 4GOSA 1WJ3A 3FUFA 3JVFC 4TM9A 2VCOA 3QWNA 3SDDB 4DGIH 4LPVA 3OKYA 5EU5A 2YXVA 1RVFH 4LPWA 4L9LA 1OARL 1QLRA 4QXTA 4OUUB 3KL3A 3TWCH 4NP4L 2FWOB 5BW7A 1O75A 1I7TB 3DMMA 4X9IA 2BWDA 3MRKB 4LHQB 4BH7B 5L0QC 4P4KA 3OLEA 4QEGA 5F1OB 1DZBA 2G5RA 2XYBA 1BEXA 3D18B 3TIEA 3CFNA 3L54A 5E9DD 4H26B 5I75C 3H0TA 3P73A 5HHOD 4YEEA 2DLHA 3QXDA 5DHVA 3NIGF 1AFVL 3D4ZA 1E8ZA 4HDIA 4F7CA 1L0XA 2KYIA 3KWWA 5B8CB 4HQQH 5SX4I 4JG9A 1LEGA 5KYYA 1D7FA 2O30A 4JFDA 4MA7L 4ODHH 3VTTA 4KI5F 4P9HL 1N5YL 1L5GA 1E5UI 1A47A 3MHZA 1GW0A 1JYWA 2M2DA 3E80A 3O4OC 5J1AA 5JIHA 3N85L 3GZQA 4JFFA 3UTSA 3CSTA 1BXVA 3ZUNC 4ODBD 3ECBA 5IGXL 1RZ8A 3D0VB 3HG1B 1NCCH 3LD8B 2H3NB 4FQIL 4F58H 4NYLB 3MV7A 43CAB 1D3CA 3V0VB 3V5DA 2AJXH 1BCIA 3KPLA 4WHDA 1NMBL 4JN2B 5F0PB 5C09E 4BFFA 5DJZA 1MCCA 4ORGB 4TV3A 5DK0A 3RA7L 4Y1TA 3X14B 5ILTH 1E3FA 4MXVF 5K9OA 1ED3B 5F44A 1AGDB 2LOEA 4GG8A 32C2B 2DMKA 2HX8A 1G9MC 1FNEB 4YDLC 4XNBA 1MCSA 4KWUA 5JDSB 2WNKA 2V2TB 1ZS8A 3F64A 3C60D 3GLEA 3HAEA 2QQQA 1P4LB 1HSBA 1H3WM 3QHFL 4F1SA 1TMQA 1V3MA 5HYSA 1L7TH 4L8DA 1KCVH 1F90H 1B2YA 5DMIL 1B2WL 1N10A 3NN8A 4KVNL 3QRGL 5CEXA 3H1ZA 1HEJC 4GQPH 4CMMA 1ORQB 2GJPA 4R9HA 4NGHL 3CVHA 1PYWB 5A16A 5E00A 1MCIA 1EGJH 1E43A 3DXAE 4DVRL 5I1HL 1R0AL 4FFWD 4HHAA 3LZQA 2WC7A 4U1SA 1QBLL 1Z1WA 3QZOA 3CXFA 4AH2B 3W38A 2WD0A 2CHNA 2O5ZH 4AH2A 1QNZL 3OQ3B 1EZSA 5FCSH 5FO7A 4EUPH 4MRBA 1S8DB 5I8OL 1A1MA 1QBLH 4PJBE 4MNQD 4G9FD 4H20H 1VFAA 4PR5B 15C8L 2GCYB 4IJ3B 3LKNA 5I1HH 2ZKYA 1MIMH 1QWHA 5DMKA 4QY8B 1KBKA 4MD5A 1NGZA 4FI6A 1ETA1 4B53A 3R8BB 5SWSA 2K6ZA 4FYTA 1ZWIB 1TU2B 2D3NA 4G1EA 3B83A 4NO2B 3TBBA 4DERA 1MI5A 3DX9B 4KJWD 4PI0A 4WV1A 4IU3A 2BSBA 4WI0B 3NQKA 5AG9A 2MTAA 5T8IA 4ZMWA 2XWCA 4MNGB 1G5GA 1UWGL 2BVQB 3V55A 3AQZA 1AGDA 5E6UB 3IAGC 4QXVA 4MNGA 3WN5B 1A2YB 3WIHH 5KW9H 2W94A 4JN2A 4YLBA 5GRWA 5IESH 4J3OH 4OFQA 4BK4A 2E3VA 4FA6A 3RA7H 4PHXA 1NDGA 4IJTA 4QOKE 2UZYA 3KJ6L 2YRBA 3RDJA 1RZFH 1A7NH 4MA3B 3ZQ9A 1T1YA 1A7OH 2ZG3A 3QQ9D 2UYLA 2BXYA 4Y9GA 3T6VA 5KW9L 1A5FH 3JTSB