5IJMA

Crystal structure of an acyl-coa binding protein (lmjf.17.0620) of leishmania major
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
b'SHMSAADFEAAVAYVRSLPKEGPVQLDNAAKLQFYSLYKQATEGDVTGSQPWAVQVEARAKWDAWNSCKGMKSEDAKAAYVRRLLTLLRSQGIQWKPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Lipid binding protein
source organism Leishmania major
publication title Crystal Structure of an Acyl-CoA Binding Protein (LmjF.17.0620) of Leishmania major
rcsb
total genus 33
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 5ijmA00
2AEHA 2J0JA 3U7DA 3ZDTA 2RQ1A 4ZRIA 2AL6A 1ISNA 2J0MA 1GC7A 2WH5A 3EPYA 3AU4A 4NY0A 4P7IA 4CYEA 4EKUA 1H4RA 1J19A 2J0KA 5IJMA 3PZDA 1HBKA 4DXAB 1MIZB 1ACAA 3BINA 2FDQA 2CQUA 2COPA 2I1JA 2HE7A 3WA0A 4F7GA 1E5WA 1NVLA 2D10A 3FLVA 4HDOA 4ZRKA 2CB8A 1MIXA 3QIJA 2D2QA 4HDQA 4YL8A 1SGHA 1GG3A 2I1KA 1EF1A 2LBBA 2HRJA 2D11A 1Y19B 2ZPYA 2YVCA 1MK9B 1NI2A 1HB8A 2EMSA 2FJ9A 3FP5A 3PVLA 2ABDA 3G9WA 4ZRJA 3X23A 3IVFA 1NTIA 1GC6A 1MK7B 3U8ZA 1ST7A 2EMTA 3AU5A 1HB6A
chains in the Genus database with same CATH superfamily
3ZDTA 2RQ1A 1VBGA 3EPYA 1H4RA 1J19A 3E9OA 1MIZB 3WA0A 4TKNA 5JVLA 1GGOA 4F7GA 1E5WA 2D10A 3FLVA 2CB8A 3E9LA 4JKFA 2LBBA 4JKEA 1NI2A 1HB8A 3G9WA 1KC7A 4JK7A 1ST7A 4EKUA 2AEHA 2J0JA 4JKAA 4JKDA 2AL6A 2WH5A 3PZDA 2FDQA 2I1JA 4ZRKA 4JKGB 1JDEA 2I1KA 1EF1A 4GXBA 2D11A 1Y19B 2YVCA 4JKHA 4ILHA 3E66A 1MK9B 2FJ9A 4JKGA 2ABDA 4ZRJA 3SBGA 1GC6A 3U8ZA 4JK9A 1KBLA 3AU5A 1HB6A 3U7DA 2X0SA 4P7IA 1GC7A 4ILJA 4NY0A 4JKBA 4DXAB 2CQUA 3ENBA 3QIJA 2D2QA 4HDQA 4YL8A 2HRJA 3PVLA 3FP5A 4JKCA 4ZRIA 1ISNA 2J0MA 4CYEA 3AU4A 2J0KA 1DIKA 5IJMA 1HBKA 1VBHA 3BINA 1ACAA 2COPA 2HE7A 1NVLA 4HDOA 1MIXA 4ILGB 4JK8A 1SGHA 1GG3A 2R82A 2ZPYA 2EMSA 3E9PA 3X23A 3IVFA 3SBTA 1NTIA 1MK7B 2EMTA 2DIKA
chains in the Genus database with same CATH topology
3ZDTA 2RQ1A 1VBGA 3EPYA 1H4RA 1J19A 3E9OA 1MIZB 3WA0A 4TKNA 5JVLA 1GGOA 4F7GA 1E5WA 2D10A 3FLVA 2CB8A 3E9LA 4JKFA 2LBBA 4JKEA 1NI2A 1HB8A 3G9WA 1KC7A 4JK7A 1ST7A 4EKUA 2AEHA 2J0JA 4JKAA 4JKDA 2AL6A 2WH5A 3PZDA 2FDQA 2I1JA 4ZRKA 4JKGB 1JDEA 2I1KA 1EF1A 4GXBA 2D11A 1Y19B 2YVCA 4JKHA 4ILHA 3E66A 1MK9B 2FJ9A 4JKGA 2ABDA 4ZRJA 3SBGA 1GC6A 3U8ZA 4JK9A 1KBLA 3AU5A 1HB6A 3U7DA 2X0SA 4P7IA 1GC7A 4ILJA 4NY0A 4JKBA 4DXAB 2CQUA 3ENBA 3QIJA 2D2QA 4HDQA 4YL8A 2HRJA 3PVLA 3FP5A 4JKCA 4ZRIA 1ISNA 2J0MA 4CYEA 3AU4A 2J0KA 1DIKA 5IJMA 1HBKA 1VBHA 3BINA 1ACAA 2COPA 2HE7A 1NVLA 4HDOA 1MIXA 4ILGB 4JK8A 1SGHA 1GG3A 2R82A 2ZPYA 2EMSA 3E9PA 3X23A 3IVFA 3SBTA 1NTIA 1MK7B 2EMTA 2DIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AEH A;  2J0J A;  3U7D A;  3ZDT A;  2RQ1 A;  4ZRI A;  2AL6 A;  1ISN A;  2J0M A;  1GC7 A;  2WH5 A;  3EPY A;  3AU4 A;  4NY0 A;  4P7I A;  4CYE A;  4EKU A;  1H4R A;  1J19 A;  2J0K A;  5IJM A;  3PZD A;  1HBK A;  4DXA B;  1MIZ B;  1ACA A;  3BIN A;  2FDQ A;  2CQU A;  2COP A;  2I1J A;  2HE7 A;  3WA0 A;  4F7G A;  1E5W A;  1NVL A;  2D10 A;  3FLV A;  4HDO A;  4ZRK A;  2CB8 A;  1MIX A;  3QIJ A;  2D2Q A;  4HDQ A;  4YL8 A;  1SGH A;  1GG3 A;  2I1K A;  1EF1 A;  2LBB A;  2HRJ A;  2D11 A;  1Y19 B;  2ZPY A;  2YVC A;  1MK9 B;  1NI2 A;  1HB8 A;  2EMS A;  2FJ9 A;  3FP5 A;  3PVL A;  2ABD A;  3G9W A;  4ZRJ A;  3X23 A;  3IVF A;  1NTI A;  1GC6 A;  1MK7 B;  3U8Z A;  1ST7 A;  2EMT A;  3AU5 A;  1HB6 A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  2RQ1 A;  1VBG A;  3EPY A;  1H4R A;  1J19 A;  3E9O A;  1MIZ B;  3WA0 A;  4TKN A;  5JVL A;  1GGO A;  4F7G A;  1E5W A;  2D10 A;  3FLV A;  2CB8 A;  3E9L A;  4JKF A;  2LBB A;  4JKE A;  1NI2 A;  1HB8 A;  3G9W A;  1KC7 A;  4JK7 A;  1ST7 A;  4EKU A;  2AEH A;  2J0J A;  4JKA A;  4JKD A;  2AL6 A;  2WH5 A;  3PZD A;  2FDQ A;  2I1J A;  4ZRK A;  4JKG B;  1JDE A;  2I1K A;  1EF1 A;  4GXB A;  2D11 A;  1Y19 B;  2YVC A;  4JKH A;  4ILH A;  3E66 A;  1MK9 B;  2FJ9 A;  4JKG A;  2ABD A;  4ZRJ A;  3SBG A;  1GC6 A;  3U8Z A;  4JK9 A;  1KBL A;  3AU5 A;  1HB6 A;  3U7D A;  2X0S A;  4P7I A;  1GC7 A;  4ILJ A;  4NY0 A;  4JKB A;  4DXA B;  2CQU A;  3ENB A;  3QIJ A;  2D2Q A;  4HDQ A;  4YL8 A;  2HRJ A;  3PVL A;  3FP5 A;  4JKC A;  4ZRI A;  1ISN A;  2J0M A;  4CYE A;  3AU4 A;  2J0K A;  1DIK A;  5IJM A;  1HBK A;  1VBH A;  3BIN A;  1ACA A;  2COP A;  2HE7 A;  1NVL A;  4HDO A;  1MIX A;  4ILG B;  4JK8 A;  1SGH A;  1GG3 A;  2R82 A;  2ZPY A;  2EMS A;  3E9P A;  3X23 A;  3IVF A;  3SBT A;  1NTI A;  1MK7 B;  2EMT A;  2DIK A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  2RQ1 A;  1VBG A;  3EPY A;  1H4R A;  1J19 A;  3E9O A;  1MIZ B;  3WA0 A;  4TKN A;  5JVL A;  1GGO A;  4F7G A;  1E5W A;  2D10 A;  3FLV A;  2CB8 A;  3E9L A;  4JKF A;  2LBB A;  4JKE A;  1NI2 A;  1HB8 A;  3G9W A;  1KC7 A;  4JK7 A;  1ST7 A;  4EKU A;  2AEH A;  2J0J A;  4JKA A;  4JKD A;  2AL6 A;  2WH5 A;  3PZD A;  2FDQ A;  2I1J A;  4ZRK A;  4JKG B;  1JDE A;  2I1K A;  1EF1 A;  4GXB A;  2D11 A;  1Y19 B;  2YVC A;  4JKH A;  4ILH A;  3E66 A;  1MK9 B;  2FJ9 A;  4JKG A;  2ABD A;  4ZRJ A;  3SBG A;  1GC6 A;  3U8Z A;  4JK9 A;  1KBL A;  3AU5 A;  1HB6 A;  3U7D A;  2X0S A;  4P7I A;  1GC7 A;  4ILJ A;  4NY0 A;  4JKB A;  4DXA B;  2CQU A;  3ENB A;  3QIJ A;  2D2Q A;  4HDQ A;  4YL8 A;  2HRJ A;  3PVL A;  3FP5 A;  4JKC A;  4ZRI A;  1ISN A;  2J0M A;  4CYE A;  3AU4 A;  2J0K A;  1DIK A;  5IJM A;  1HBK A;  1VBH A;  3BIN A;  1ACA A;  2COP A;  2HE7 A;  1NVL A;  4HDO A;  1MIX A;  4ILG B;  4JK8 A;  1SGH A;  1GG3 A;  2R82 A;  2ZPY A;  2EMS A;  3E9P A;  3X23 A;  3IVF A;  3SBT A;  1NTI A;  1MK7 B;  2EMT A;  2DIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...