5IJMA

Crystal structure of an acyl-coa binding protein (lmjf.17.0620) of leishmania major
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
98
structure length
98
Chain Sequence
SHMSAADFEAAVAYVRSLPKEGPVQLDNAAKLQFYSLYKQATEGDVTGSQPWAVQVEARAKWDAWNSCKGMKSEDAKAAYVRRLLTLLRSQGIQWKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Acyl-CoA Binding Protein (LmjF.17.0620) of Leishmania major
rcsb
source organism Leishmania major
molecule tags Lipid binding protein
molecule keywords Uncharacterized protein
total genus 33
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2016-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 5ijmA00
4NY0A 1ISNA 2AL6A 4YL8A 3ZDTA 1NVLA 2D10A 2FJ9A 3FLVA 2AEHA 4CYEA 3PVLA 4EKUA 3QIJA 1NI2A 1MIZB 2J0JA 1GC6A 1HBKA 1EF1A 2ABDA 2D11A 1HB6A 2D2QA 1SGHA 1GC7A 4DXAB 1H4RA 2FDQA 2HRJA 2ZPYA 1Y19B 3IVFA 3WA0A 2HE7A 3AU4A 4F7GA 4P7IA 1MK7B 1MK9B 3U7DA 1NTIA 2J0KA 4ZRIA 4ZRKA 3EPYA 1J19A 2RQ1A 4ZRJA 1HB8A 2WH5A 2EMTA 3PZDA 3U8ZA 1E5WA 3BINA 1MIXA 2EMSA 2LBBA 2COPA 1GG3A 5IJMA 4HDQA 3G9WA 2YVCA 3AU5A 2CQUA 3FP5A 4HDOA 2CB8A 3X23A 1ST7A 1ACAA 2I1KA 2J0MA 2I1JA
chains in the Genus database with same CATH superfamily
3ZDTA 2FJ9A 1GGOA 4EKUA 3PVLA 3QIJA 2X0SA 1EF1A 4ILHA 4JKBA 2ZPYA 4P7IA 4GXBA 1MK9B 3U7DA 4JK8A 3U8ZA 3BINA 1MIXA 2EMSA 2LBBA 3SBGA 4ILJA 5IJMA 2YVCA 3AU5A 2CB8A 5JVLA 2I1JA 4NY0A 4YL8A 1NVLA 2D10A 1VBHA 1GC6A 2D11A 1HB6A 4JK7A 3ENBA 4JKEA 3WA0A 2HE7A 3AU4A 4JKDA 3SBTA 1GG3A 3FP5A 4HDOA 3X23A 1ST7A 4JKFA 2J0MA 1KBLA 1ISNA 2AL6A 3FLVA 2AEHA 2DIKA 1MIZB 1HBKA 2ABDA 2D2QA 1GC7A 2HRJA 2FDQA 4F7GA 1KC7A 3EPYA 1J19A 4ZRJA 1HB8A 3PZDA 2EMTA 1E5WA 4JK9A 3E9PA 2COPA 2I1KA 3E9LA 4CYEA 1DIKA 4JKGA 1NI2A 2J0JA 4JKGB 4DXAB 1SGHA 4JKHA 3E9OA 1H4RA 1Y19B 3IVFA 1VBGA 3E66A 1MK7B 1JDEA 1NTIA 2J0KA 4ZRIA 4ZRKA 2RQ1A 2WH5A 4ILGB 2R82A 4JKAA 4HDQA 3G9WA 2CQUA 1ACAA 4JKCA 4TKNA
chains in the Genus database with same CATH topology
3ZDTA 2FJ9A 1GGOA 4EKUA 3PVLA 3QIJA 2X0SA 1EF1A 4ILHA 4JKBA 2ZPYA 4P7IA 4GXBA 1MK9B 3U7DA 4JK8A 3U8ZA 3BINA 1MIXA 2EMSA 2LBBA 3SBGA 4ILJA 5IJMA 2YVCA 3AU5A 2CB8A 5JVLA 2I1JA 4NY0A 4YL8A 1NVLA 2D10A 1VBHA 1GC6A 2D11A 1HB6A 4JK7A 3ENBA 4JKEA 3WA0A 2HE7A 3AU4A 4JKDA 3SBTA 1GG3A 3FP5A 4HDOA 3X23A 1ST7A 4JKFA 2J0MA 1KBLA 1ISNA 2AL6A 3FLVA 2AEHA 2DIKA 1MIZB 1HBKA 2ABDA 2D2QA 1GC7A 2HRJA 2FDQA 4F7GA 1KC7A 3EPYA 1J19A 4ZRJA 1HB8A 3PZDA 2EMTA 1E5WA 4JK9A 3E9PA 2COPA 2I1KA 3E9LA 4CYEA 1DIKA 4JKGA 1NI2A 2J0JA 4JKGB 4DXAB 1SGHA 4JKHA 3E9OA 1H4RA 1Y19B 3IVFA 1VBGA 3E66A 1MK7B 1JDEA 1NTIA 2J0KA 4ZRIA 4ZRKA 2RQ1A 2WH5A 4ILGB 2R82A 4JKAA 4HDQA 3G9WA 2CQUA 1ACAA 4JKCA 4TKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  1ISN A;  2AL6 A;  4YL8 A;  3ZDT A;  1NVL A;  2D10 A;  2FJ9 A;  3FLV A;  2AEH A;  4CYE A;  3PVL A;  4EKU A;  3QIJ A;  1NI2 A;  1MIZ B;  2J0J A;  1GC6 A;  1HBK A;  1EF1 A;  2ABD A;  2D11 A;  1HB6 A;  2D2Q A;  1SGH A;  1GC7 A;  4DXA B;  1H4R A;  2FDQ A;  2HRJ A;  2ZPY A;  1Y19 B;  3IVF A;  3WA0 A;  2HE7 A;  3AU4 A;  4F7G A;  4P7I A;  1MK7 B;  1MK9 B;  3U7D A;  1NTI A;  2J0K A;  4ZRI A;  4ZRK A;  3EPY A;  1J19 A;  2RQ1 A;  4ZRJ A;  1HB8 A;  2WH5 A;  2EMT A;  3PZD A;  3U8Z A;  1E5W A;  3BIN A;  1MIX A;  2EMS A;  2LBB A;  2COP A;  1GG3 A;  5IJM A;  4HDQ A;  3G9W A;  2YVC A;  3AU5 A;  2CQU A;  3FP5 A;  4HDO A;  2CB8 A;  3X23 A;  1ST7 A;  1ACA A;  2I1K A;  2J0M A;  2I1J A; 
#chains in the Genus database with same CATH topology
 3ZDT A;  2FJ9 A;  1GGO A;  4EKU A;  3PVL A;  3QIJ A;  2X0S A;  1EF1 A;  4ILH A;  4JKB A;  2ZPY A;  4P7I A;  4GXB A;  1MK9 B;  3U7D A;  4JK8 A;  3U8Z A;  3BIN A;  1MIX A;  2EMS A;  2LBB A;  3SBG A;  4ILJ A;  5IJM A;  2YVC A;  3AU5 A;  2CB8 A;  5JVL A;  2I1J A;  4NY0 A;  4YL8 A;  1NVL A;  2D10 A;  1VBH A;  1GC6 A;  2D11 A;  1HB6 A;  4JK7 A;  3ENB A;  4JKE A;  3WA0 A;  2HE7 A;  3AU4 A;  4JKD A;  3SBT A;  1GG3 A;  3FP5 A;  4HDO A;  3X23 A;  1ST7 A;  4JKF A;  2J0M A;  1KBL A;  1ISN A;  2AL6 A;  3FLV A;  2AEH A;  2DIK A;  1MIZ B;  1HBK A;  2ABD A;  2D2Q A;  1GC7 A;  2HRJ A;  2FDQ A;  4F7G A;  1KC7 A;  3EPY A;  1J19 A;  4ZRJ A;  1HB8 A;  3PZD A;  2EMT A;  1E5W A;  4JK9 A;  3E9P A;  2COP A;  2I1K A;  3E9L A;  4CYE A;  1DIK A;  4JKG A;  1NI2 A;  2J0J A;  4JKG B;  4DXA B;  1SGH A;  4JKH A;  3E9O A;  1H4R A;  1Y19 B;  3IVF A;  1VBG A;  3E66 A;  1MK7 B;  1JDE A;  1NTI A;  2J0K A;  4ZRI A;  4ZRK A;  2RQ1 A;  2WH5 A;  4ILG B;  2R82 A;  4JKA A;  4HDQ A;  3G9W A;  2CQU A;  1ACA A;  4JKC A;  4TKN A; 
#chains in the Genus database with same CATH homology
 3ZDT A;  2FJ9 A;  1GGO A;  4EKU A;  3PVL A;  3QIJ A;  2X0S A;  1EF1 A;  4ILH A;  4JKB A;  2ZPY A;  4P7I A;  4GXB A;  1MK9 B;  3U7D A;  4JK8 A;  3U8Z A;  3BIN A;  1MIX A;  2EMS A;  2LBB A;  3SBG A;  4ILJ A;  5IJM A;  2YVC A;  3AU5 A;  2CB8 A;  5JVL A;  2I1J A;  4NY0 A;  4YL8 A;  1NVL A;  2D10 A;  1VBH A;  1GC6 A;  2D11 A;  1HB6 A;  4JK7 A;  3ENB A;  4JKE A;  3WA0 A;  2HE7 A;  3AU4 A;  4JKD A;  3SBT A;  1GG3 A;  3FP5 A;  4HDO A;  3X23 A;  1ST7 A;  4JKF A;  2J0M A;  1KBL A;  1ISN A;  2AL6 A;  3FLV A;  2AEH A;  2DIK A;  1MIZ B;  1HBK A;  2ABD A;  2D2Q A;  1GC7 A;  2HRJ A;  2FDQ A;  4F7G A;  1KC7 A;  3EPY A;  1J19 A;  4ZRJ A;  1HB8 A;  3PZD A;  2EMT A;  1E5W A;  4JK9 A;  3E9P A;  2COP A;  2I1K A;  3E9L A;  4CYE A;  1DIK A;  4JKG A;  1NI2 A;  2J0J A;  4JKG B;  4DXA B;  1SGH A;  4JKH A;  3E9O A;  1H4R A;  1Y19 B;  3IVF A;  1VBG A;  3E66 A;  1MK7 B;  1JDE A;  1NTI A;  2J0K A;  4ZRI A;  4ZRK A;  2RQ1 A;  2WH5 A;  4ILG B;  2R82 A;  4JKA A;  4HDQ A;  3G9W A;  2CQU A;  1ACA A;  4JKC A;  4TKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...