5ILUA

Autoinhibited etv4
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
97
structure length
97
Chain Sequence
ALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ETS translocation variant 4
publication title Structured and disordered regions cooperatively mediate DNA-binding autoinhibition of ETS factors ETV1, ETV4 and ETV5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 30
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2016-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5iluA00
4R79A 3K69A 2P4WA 1U3EM 5K5QA 5L3EA 2DI3A 3F8NA 2OA4A 5HS8A 1YW9A 3E97A 1GXQA 4WK8F 2QLZA 3QOPA 2QUFA 1R36A 3SFZA 3QAHA 4MNUA 1MZBA 4WCGA 1XGOA 2CWEA 4LMYA 3SZTA 2D45A 2X4HA 2FNPA 4QWQA 1IN7A 3KP2A 5EEHA 1ZREA 2RN7A 3GVAA 4IVNA 3FMRA 3OOPA 1HW1A 1SD6A 2VXZA 4Y17A 3G73A 2COMA 3ZN1A 2FBIA 2FE3A 2ZNYA 2HQRA 4GXOA 3TOBA 1LVAA 1BI2A 2D1HA 3M8FA 3E6BA 1HKQA 1XDUA 3E5XA 2V1DA 2HOEA 5JI6A 1G3YA 2MH9A 1RUOA 4B09A 3O3KA 3P9CA 3TDZC 2XROA 2D1VA 2Q8KA 4TV7A 5ICFA 4UV9A 2TDXA 2HKXA 4A0XA 2CQKA 5F1RA 5D6EA 2WV0A 5HLGA 5KVRA 1J0RA 1FYLA 1P92A 2IP2A 3MWMA 4KA4A 2R7DA 4BHBA 3V7SA 1HKTA 5HOOA 3J81Z 1R1VA 3KCCA 1NHAA 4ZYEA 4B8XA 2RV8A 3QU3A 3DKWA 5JFRA 3JSPA 2M30A 1DPRA 3GUDA 4D0PA 4YFNF 1SFUA 1E2XA 1L3LA 4U7BA 1PUEE 3E5QA 2AS5F 1D8KA 3BP8A 3C7JA 3RDIA 3H3ZA 2P5KA 1U8RA 1YW8A 1V4RA 1J59A 2EWNA 3TO9A 2IA2A 2ADUA 1QNTA 4YFXF 4WXDA 3I5UA 4RAYA 2UZKA 2XKOA 5D4RA 3TKYA 5BMZA 5HS7A 1P4AA 4HQMA 5FO5A 3I53A 4KIFA 5J6XA 3HOTA 2V9VA 3KLOA 4YIFA 3ECHA 1SMYF 2Z33A 2A07F 5FLXK 1TNTA 4UVAA 4N9HA 1I27A 4ZYGA 1PDNC 2EJRA 2YU3A 3KEOA 4P96A 3K9TA 5A2QK 2Q2EA 4WX9A 4ETSA 5E8IA 4HX8A 4L9VA 3B73A 4YFKF 3CTAA 1TTYA 2DPUA 4CGZA 4UUVA 4GYGA 4RB2C 1ZHFA 3CLOA 1ODDA 3ZMUA 2W84A 2ZFWA 1HQCA 2V1XA 2KJCA 2LDUA 1R1UA 5BQTA 3D0SA 2OZUA 3GF2A 1FBSA 3HTUA 1B9MA 2WTEA 3HRSA 3WTWC 2ZKZA 4YG2F 2VE8A 2L02A 3O6BB 1I1SA 1J9IA 2LF7A 3GWZA 1WQ2A 2VBWA 4OIRF 5IT3A 3Q9VA 3BOQA 2BYVE 5E1WA 3BJ6A 3KE2A 5LGNA 2G9WA 2XIGA 3SQNA 2RGVA 1BI3A 4R1HA 5HLHA 3OV8A 4XRFA 3FMQA 3R0JA 1XMKA 4EM2A 3FXRA 2QYOA 4MQVA 5L3BA 3CUQA 1HSTA 5ILUA 1U5TB 4I09A 3I64A 2J5OA 2CYYA 1GVJA 3K1PA 5J8CA 4MTDA 1RIOH 1FSHA 2Q0OA 3FF5A 4NB5A 1XDSA 3GZ5A 3R6SA 5LHHA 4U0WA 2V6CA 4BH9A 1J7KA 5DEQA 3T5XA 1F9NA 1WRJA 2YX7A 3AAFA 1B9NA 2GIVA 4LK0F 1UFMA 1U78A 3F3XA 2A6EF 1MGTA 4AVPA 3K1NA 4MGRA 5CVJA 1P4WA 1ONVA 1S6LA 3DQVC 2R3SA 1USSA 4ESJA 1W7PB 2VBYA 2L4MA 3H3UA 4WXHA 3WTXC 3H92A 2O8XA 5AIPA 3RI4A 4Q48A 1WWXA 3IKVA 4IRHA 2Y48A 4BYYA 4I98B 2FRHA 4HDUA 4P5OA 4Q4ZF 4KUMA 4KMUX 3RKWA 3HTSB 1Z1DA 1ZYRF 4JBAA 1FY7A 1ON1A 2MA3A 1XB4A 1O57A 1BI0A 2P5LC 4O6JA 4HOBA 4Z2YA 3N97A 3F8MA 4OMZA 1QGPA 2HKOA 3PQJA 4IF4A 5FGMA 1ZAOA 2W25A 4MEXF 3E5UA 2XVCA 1ZH5A 2XUBA 1BBYA 2YX4A 2XHKA 1YS6A 3PQKA 3BPXA 2CW0F 2HEOA 3CO7C 3F22A 1OYIA 3HRUA 2KIUA 3HSEA 1F4KA 1RUNA 4IHTA 3K1MA 4A6DA 4P9UA 5JHUA 1K6OA 2KIFA 3RTRA 1IXSB 2QM3A 5ILSA 2HQNA 2Y75A 1UHMA 3R61A 3SXYA 1R58A 2IJLA 4DQ2A 5LBQA 1G3TA 4EVIA 1JGSA 1YFHA 2DTRA 5LEJA 2A68F 1R5HA 1HKSA 2EA2A 2YSRA 2ZMEA 4PCQA 2PJPA 1SAXA 2XAFA 2K02A 4U0YA 4XBFA 5CJ9A 3SHFA 2M45A 4NQWA 2VODA 3IRQA 3FXQA 3JW4A 4I7HA 5DCFA 1XSVA 1QBJA 5ICCA 4HQEA 1MD0A 5DUIA 3MEXA 1LDKB 1R00A 1P6RA 2VBXA 2FSWA 2LKPA 3WE3A 2EK5A 2O6GE 1O7FA 4HW0A 4HLYA 3HRMA 4IRGA 1IAWA 4HYEA 4EGZA 5D5UB 1DUXC 5H20A 1OMIA 4KMFA 2A5YB 3EETA 4A5NA 1TW2A 2E1NA 1UCRA 5HDKA 2KJBA 2NS0A 1Q1HA 4L5IA 3S2WA 3L09A 5E18F 1BIAA 2IT0A 2ISZA 1EH8A 3HSFA 3P7NA 2KIMA 4UVCA 3DPLC 1LB2A 2EV5A 3V7RA 2DU9A 2A3SA 1WSUA 5IT9K 4EJVA 4RB1A 4EM1A 3HOSA 2G7HA 2J5PA 1LNWA 4ZZDA 1G3SA 3ECOA 3BDDA 4RS8A 1OR7A 2Z5UA 1AWCA 2YR2A 1BM9A 3C3WA 3JSOA 3KZZA 3MCZA 3EQLF 2HZTA 2Z3YA 2XAQA 2QBYA 2MH2A 1ZG5A 3IL2A 3GX4X 3WU1B 1IF1A 1SD5A 3R0AA 1FX7A 4EQQA 5ILVA 3I59A 5H6RA 5LEKA 1FBQA 5K5RA 3EUHA 1X3UA 2RDPA 4KNYA 4G7HF 1A04A 2QQBA 2HFHA 2VOOA 1OKRA 4RAZA 3RYRA 3LA7A 1ZARA 5D4SA 1EH7A 1YS7A 4LLLA 2OAZA 1O3RA 2DLLA 5K1YA 1MJAA 1FC3A 4FHTA 2V1UA 2MBFA 2L01A 2XV4S 1S8NA 1LDDA 4ENNA 5DYMA 1S3JA 4LGWA 1XSXA 5CYVA 3D5LA 3K0LA 2KRFA 3ZQ7A 3EYIA 4RB3C 3TGNA 2DK8A 3KP3A 5CVIA 4WF2A 5BOXA 1KU9A 2E1CA 3CUQB 1DDNA 2VC1A 5AIQA 2XRNA 3E6MA 4HLXA 5D5WB 4GO1A 4LB5A 2E7XA 1Z7UA 1I1GA 3M9AA 4A0ZA 4KIBA 3EDPA 1KGSA 3QPTA 1K78A 4K2EA 4RGRA 2JZYA 2PG4A 1K79A 4AWXB 3GZ6A 2IA1A 4FX4A 2KKOA 2K27A 2LNBA 3BROA 1XMAA 4OU0A 3DFGA 3J80K 5FD5A 3B02A 4BQAA 1H9TA 1YW7A 4PGHA 4GGGA 4WXCA 3TQNA 3E6CC 1EH6A 3DV8A 4YIIA 4NHJA 3LQRA 3NQOA 2WWYA 3TDUC 3VFZA 2CSOA 2GA2A 4LB6B 5DUKA 1J75A 2HYGD 4HBLA 1UHWA 1PP8F 3QRFF 3DP7A 4M6YA 2Y0MA 1YIOA 2ZO4A 2R7FA 1F5TA 3FWEA 3IC7A 4HV5A 4OIOF 1TW3A 2O0YA 2LF8A 1BI1A 1ZN2A 4G6DA 3P9IA 3DF8A 4L9JA 1DPUA 2G7UA 2FOKA 1R7JA 2EA4A 2EFQA 5CLSA 4LK1F 3VEPA 1W5SA 3KETA 5ICGA 1IZ1A 4G94A 2RC4A 1ZG1A 3CUQC 1QZZA 3WTSC 3LQQA 1ZRDA 5F6FA 4M72A 1YQAA 4HF1A 2UWMA 2M1BA 4PGGA 4RGUA 2LSOA 4U0VA 1XGNA 1KA8A 1FT9A 3KZYA 3J7AO 2P5VA 2XAJA 4M9XA 3GFJA 5H6QA 1T98A 1CF7A 2ZMEB 4KN4X 4PDKA 1ZRCA 3WGGA 2FF4A 3VOEA 2HWVA 5IT9Z 3KP6A 3KP7A 1BC7C 4KFCA 4ZZLA 2DK5A 1S7AA 5BPIA 1BN5A 4LJZF 5E1XA 2PMHA 3HHGA 1HW5A 1FYKA 4M73A 2EV6A 3WTTC 2F5EA 3U9GA 1XCVA 2Z9OA 4I2OA 4EJOA 1P2FA 3GYHX 5HS9A 2QENA 1BIBA 1FWZA 4LLGF 3V8JA 5E1ZB 2QQAA 3RJPA 3C1DA 1LQ1A 4XLNF 3HSRA 3ISPA 1IN4A 1QO0D 1BOAA 1AOYA 4G7ZF 1YO5C 4N9IA 2PMUA 1MKMA 1QPMA 2GA1A 3R4KA 5LHIA 3K2ZA 2ESHA 5L3GA 5LRSA 1CGPA 1T6SA 4I02A 2A69F 1TQMA 4UVBA 4OMYA 3W6KB 4BAYA 2M5WA 1RNLA 2M8EA 2O3FA 1ON2A 4OOIA 1REPC 1MDMA 4MEYF 4OIQF 1EV7A 5LGUA 4M9ZA 1ZLJA 2GQQA 2HYFA 4L0ZB 4AIHA 4BHCA 1RI7A 1KU3A 2STTA 2CO5A 1T39A 3V8LA 2QBYB 2EFNA 4LG0A 4CDGA 2W24A 4IJAA 3IKTA 3JAMK 1WKMA 4CO8A 4O5VA 1PP7U 3I59B 5LRRA 2W57A 1W5TA 3KP4A 4BXUA 3KP5A 1SD7A 1RZ4A 3ZMDA 1KU7A 4H0EA 2UXNA 4U88A 3W6JB 4Q5SF 3EYYA 4BHPA 2ZBKA 2FXAA 3ABUA 2F5DA 5AONA 1VTNC 3BPVA 4A5MA 1QZYA 3ZMVA 2DBBA 1O7LA 2RNJA 4CXFA 2ZNZA 3I0TA 3I58A 3WODF 5DD4A 3TOAA 2Z99A 3J80Z 1Y0UA 2PEXA 1MJBA 2EFPA 4EJWA 3LAJA 4GCVA 2MC3A 5D5XB 4IRIA 3KFWX 3WE2A 1SMTA 2DT5A 2EV0A 2XKPA 4G8XA 4ZYDA 3ULQB 1Z6RA 2BBYA 1IXCA 4A6EA 2L4AA 5FLXZ 3M8EA 3RPUA 1GXPA 1J2XA 2P7VB 2CGPA 3F6VA 5A2QZ 3SZPA 2XAGA 4EV0A 2P6SA 4ENJA 5TRDA 2OQGA 3WTZA 1I5ZA 4L18B 5FFZA 4UNOA 4OINF 3GFMA 3WGHA 3ZPLA 3F8FA 2CG4A 3ELKA 1K78B 4RGXA 1S29A 1FLIA 2VOPA 3V4GA 1ZGJA 3FHZA 1XGMA 1R5GA 2OBPA 4S04A 2YPRA 2BV6A 5HDGA 2H94A 4UXNA 5D8LB 5DV5A 3GEZA 1O3SA 1KU2A 3F6OA 5JR3A 1JHFA 2PLYA 4IPAA 1STZA 1BJAA 5CVUA 4UHTA 1ULYA 1ZGAA 2GAUA 3BWGA 1IUYA 2QZ8A 4O3MA 3JTGA 1B59A 2OU2A 4EGYA 4IHSA 3QPHA 1XSDA 4I0AA 1SFXA 1FPQA 5CVRA 1IN5A 4P9FA 2BE5F 2DO7A 5E8GA 3T1BA 5D5VB 3HRTA 2PN6A 1R22A 3ZP5A 1LEAA 2FQ3A 4KICA 2IRFG 2NNYA 2EB7A 5DDGA 3M7GA 3I71A 2WC2A 2E7WA 1HBXG 1KYWA 2FMLA 1HXDA 4AIKA 4Y15A 2FEZA 3IHUA 2GZWA 2ISYA 4HX4A 4M9SA 2OQRA 1TNSA 1B1BA 3VB2A 3ZN0A 3ABTA 2B0LA 4MHGA 1IXRC 3U2RA 3DPTA 1HW2A 1B4AA 3F8CA 1IN8A 3LSTA 3NEUA 4AIJA 1Z6TA 2W85A 3JTHA 4LD5A 3FM3A 3Q5FA 3RYPA 3L00A 1JE8A 2PI0A 2FU4A 3QP5A 1T2KA 3DXJF 3GLXA 2PFBA 5L3CA 1LJ9A 3RPQA 1CF7B 2P7CB 2M87A 3RIRA 4EM0B 3N4MA 4A2UA 4U7DA 2RKHA 2H09A 4M6XA 4ENKA 2EFOA 3F8BA 2QQ9A 3FZVA 1FSEA 4HV6A 1BC8C 2FMYA 5LHGA 3HHHA 1TQIA 1ZG3A 5FFXA 1WI9A 2ACJA 4WWCA 3T8TA 2ZXJA 1L0OC 5DCMA 3L9FA 3NRVA 4G7OF 3JAMZ 2VN2A 3ROUA 3BJAA 4FT8A 4GYIA 4EMSA 4ENMA 3KEQA 2DPDA 5E20A 4KT5C 3FM5A 2VT2A 1D3YA 1JHHA 4L9NA 5LLQA 3PFIA 2H27A 2XASA 2OZ6A 1IW7F 4XSXF 2F2EA 3WGIA 4KDPA 5K5OA 2ETHA 4CHUA 4A0YA 3ML6A 1TQPA 2P6TA 2NAZA 4F7ZA 1QQIA 3P9KA 4FX0A 3FMSA 1SD4A 1F1ZA 3CDHA 2FA5A 4EJUA 2D2WA 1LDJA 3CO6C 2K4BA 2MLKA 3HIFA 1TBXA 1XGSA 3RKYA 1R1TA 2CFXA 2L3DA 1MDMB 4E70A 5DD8A 2GXGA 2MD5A 3GW2A 1OYYA 2JRTA 2BGCA 3BY6A 4DNCA 4XSZF 5ERIA 2K7LA 4XLPF 1ZRFA 2EFWA 3HUGA 2P8TA 4LG0B 2IVMA 1DP7P 1XN7A 3IRRA 5ICEA 2DAOA 1KQ0A 2F5CA 2VC0A 1LEBA 1KQ8A 3U1DA 1U2WA 3LA2A 5LGTA 2GWRA 1T0FA 5FB2A 1ZLKA 1G6NA 4HF0A 2K4JA 5L3DA 5HVQC 4BNCA 1YLFA 2UXXA 1Z9CA 2XAHA 1IN6A 4CYDA 3Q9SA 1IRGA 2FBHA 3R60A 4JQFA 3GXOA 3LA3A 4ESBA 4RB0A 3COAC 1O3QA 4N0BA 2A61A 3LFKA 2FBKA 4L5JA 1C0WA 2IPQX 3VODA 3I4PA 3M1EA 3ZMSA 5L3FA 1Z91A 4L0YB 1IRFA 2DW4A 3CUOA 3T0YA 1R23A 1XCBA 2RVCA 1K7AA 4G6QA 2PBIA 2HTJA 1KYZA 2IW5A 3ERED 3FXUA 4P55A 2ESNA 2JTVA 2VE9A 3MQ0A 4KYWA 2X0LA 4HF2A 1OPCA 3IWZA 4LFUA 2STWA 4R8HA 5EEGA 3F72A 2H6BA 5F64A 2JPCA 3T8RA 3ZMZA 4ZH4F 3HYIA 2RQPA 1G4DA 3FX3A 2HR3A 3J81K 3LWFA 3WTUC 1S7OA 4HDVA 1FYMA 4CZZA 1D8JA 3DEUA 4S05A 1W4MA 2NNNA 3WG9A 1YYVA 3V7CA 3LAPA 2JSCA 1U6GA 3MZHA 5D6FA 3MFKA 1TLHB 1YG2A 3TO7A 2VT3A 5BS6A 6PAXA 1FNNA 3L7WA 5CVVA 5D8KB 3QP6A 3GFIA 3KLNA 2XGXA 2HGCA 5FD6A 1J5YA 3L2CA 1GHCA 2O61A 2FNAA 2PQ8A 3WU0A 3E3VA 3REOA 4HAMA 4UV8A 2HTSA 2BEOA 5TJJA 2DQRA 2V79A 4ASNA 4CICA 5ED4A 3WTYC 3WTVC 4OIPF 2NRAC 3MAJA 1FOKA 3C18A 4EJTA 2H6CA 1V3FA 2K86A 1U5TC 4L9TA 1P4XA 1D5VA 1JXSA 1B6AA 4M71A 4ESFA 4KN7X 4ZYHA 1FZPB 4A12A 1E17A 3GFLA 5HDNA 1U5TA 1H9GA 3E6DA 2VONA 2JPBA 4I01A 1G3WA 1T38A 5J8FA 2GXBA 4ON0A 3I54A 1USTA 2JT1A 2ELHA 5HLIA 1YTYA 2OD5A 3BJOA 1HSJA 4Q47A 1Z05A 4HA8A 2NYXA 5KK1A 4RGSA 3G3ZA 4QLCU 1H0MA 2A6HF 4I0BA 3GO5A 4KIGA 2F5FA 4HZFA 2C6YA 2IA0A 1XD7A 4PZJA 1W7PA 3V8KA 4MQ9F 2ZCWA 4MTEA 4G9YA 1FP1D 4JK1X 2O03A 1SFEA 3F21A 1MJ9A 1FBUA 4LLNA 4HX7A 2QVOA 2ZJ2A 5JVTA 3TO6A 3IWFA 1UB9A 2DFIA 4IXAA 2HDCA 3ZMTA 4M74A 2MLGA 2VBZA 3F23A 2L54A 1W7PD 4Y13A 5DCMB 1I6XA 3MZYA 3BZ6A 5BPDA 3CJNA 3RKXA 5E17F 1FP2A 4AD9A 2AXLA 1KQ9A 3QU6A 2DQLA 1OYWA 2HS5A 2QWWA 3O2PE 1O3TA
chains in the Genus database with same CATH superfamily
3K7AJ 2PJRB 4A69C 3IH2A 4DBQA 4R79A 3K69A 3JRCA 2P4WA 1U3EM 4DOZA 1IRXA 5K5QA 2FOWA 2A5WA 5L3EA 2JA7J 2OCCH 2DI3A 2X51A 2H1KA 3F8NA 2OA4A 5HS8A 1SVLA 1YW9A 3E97A 2WB1A 1JUMA 1GXQA 3DEEA 4WK8F 2QLZA 3QOPA 3VSLA 3S17J 4MFEA 2QUFA 4FCYA 3CC2I 1R36A 1WH7A 3ZQIA 3SFZA 3QAHA 2MYSA 4MNUA 1GDTA 1MZBA 4WCGA 1XGOA 2CWEA 4LMYA 3SZTA 1IV8A 2D45A 2X4HA 1ZQ3P 2W48A 2FNPA 1KZHA 3OL4A 4IOAF 3OS0A 4QWQA 2HZDA 1IN7A 3KP2A 5EEHA 1PUFA 1ZREA 2RN7A 1HA8A 3DTEA 1WJDA 2X48A 2OV7A 2ZC2A 3GVAA 4IVNA 3FMRA 3OYEA 3OOPA 1HW1A 3AG1H 1SD6A 1D0ZA 4RAFA 5FLVA 2VXZA 4Y17A 2WAEA 3G73A 3JR9A 2COMA 1E3OC 3ZN1A 2R7RA 3FK6A 2HOTA 2FBIA 5B1AH 2FE3A 2Y0SN 2HQRA 2ZNYA 1FOWA 4C30A 1WJBA 3BLYA 3BTIA 1OFCX 4GXOA 3TOBA 5K7HA 1LVAA 1BI2A 3A1YA 2D1HA 3M8FA 3E6BA 1HKQA 1XDUA 2HI3A 3E5XA 4V2FA 4A3EJ 2V1DA 2HOEA 3BR2A 4M3FA 5JI6A 1G3YA 2MH9A 5F27A 2F5VA 1RUOA 4B09A 1I3QJ 2WY8Q 1E0EA 3O3KA 2ZJQF 3TBIA 3P9CA 3TDZC 1Z67A 2XROA 1X3WB 2D1VA 3HUGB 2Q8KA 4TV7A 3BR6A 4AM3A 4B1RA 5ICFA 4UV9A 2TDXA 5F08A 2HKXA 4A0XA 2CQKA 5F1RA 5D6EA 2WV0A 4UUSB 3JRGA 5HLGA 4MLOA 2DFFA 3BCAA 2OCEA 5KVRA 1J0RA 1FYLA 1PJRA 1P92A 2IP2A 3MWMA 3A01A 2CQ7A 3I4MJ 1HOMA 4KA4A 1TP4A 3GLLA 2LFBA 4D5FA 3RSNA 2Y9ZA 2GM4A 2R7DA 3AG2H 4BHBA 3V7SA 5FKKA 5FLMJ 1HKTA 1K4TA 5HOOA 3J81Z 2ECCA 1R1VA 3K10A 3KCCA 1NHAA 4IKFA 2ZB9A 4ZYEA 2IGKA 4B8XA 4XNFA 2RV8A 4M3GA 1BR4A 3QU3A 3DKWA 5JFRA 3JSPA 3CLQA 2M30A 5J3LA 1G2HA 1JTXA 2LY2A 1DPRA 1ZK8A 2MG4A 3GUDA 2FX0A 4D0PA 2V9PA 4YFNF 2X85A 1HLVA 1SFUA 1G59A 4YELA 1E2XA 2NS7A 1L3LA 1SVOA 4U7BA 1PUEE 3E5QA 3OYMA 2AS5F 1D8KA 4NDLA 2LVSA 2K40A 3BP8A 3C7JA 4MIMA 3RDIA 3ASOH 2XC7A 3SDGA 3H3ZA 2P5KA 3MN2A 1OCZH 1VI0A 2F4IA 1U8RA 1TWHJ 1YW8A 1BL0A 1V4RA 1J59A 2HU9A 4XKWA 1LFPA 2EWNA 5J4VA 1UG0A 3TO9A 1N25A 2IA2A 2ADUA 1QNTA 2LC2A 2ELJA 4WXDA 3I5UA 4YFXF 3MZ8A 4RAYA 2UZKA 2XKOA 3BTLA 5D4RA 3TKYA 3ZQHA 5BMZA 5HS7A 1P4AA 3CCYA 3FXLA 3C2BA 5EZHA 4A3GJ 3CCUI 4HQMA 1JUSA 5FO5A 2IBDA 2VQGA 3I53A 1AHDP 1YI2I 4KIFA 5M3MJ 1P7IA 2MFZA 1DQUA 2CH0A 5J6XA 4QPOA 4M6VA 2ECBA 3HOTA 4OWRB 4IZZA 2V9VA 2K9NA 2M0MA 3KLOA 3X2QH 2Z2SB 4CCKA 4YIFA 3ECHA 2F4OB 1SMYF 5IOYA 5EEAA 2CQNA 3H0DA 4BE2A 4XN3A 2Z33A 2A07F 5FLXK 1TNTA 3HC7A 4UVAA 4N9HA 1QPIA 1M1EB 1I27A 4ZYGA 3L2VA 1PDNC 2EJRA 2YU3A 3KEOA 4P96A 2H8WA 2VJ5A 3K9TA 5A2QK 1D0XA 2NVYJ 2Q2EA 1T08B 4F93B 2KIQA 1JJ8C 2WA0A 1LKXA 3GTQJ 4HNVA 4WX9A 4ETSA 2JA5J 4XMYA 3BG6A 1TC3C 3DKXA 5E8IA 3DLAA 3H35A 4F91B 1AU7A 3FBIB 2DN0A 4HX8A 4L9VA 5IP9J 1MNEA 3B73A 4XRSG 4YFKF 1UAAA 2L0KA 3CTAA 1TTYA 2DPUA 2X6WA 2R7WA 2LKSA 2LK2A 4CGZA 4UUVA 4GYGA 4RB2C 1ZHFA 3CLOA 3HEFA 2IGOA 2JRMA 3HL2A 3HOUJ 3CP8A 3M3YJ 1ODDA 3ZMUA 1Z3XA 2W84A 2XPWA 2ZFWA 1HQCA 1ORKA 2V1XA 2KJCA 2LDUA 1R1UA 4IOCF 1T0FC 2E2HJ 5BQTA 3D0SA 2E36A 2JUCA 2OZUA 3OYBA 3GF2A 1FBSA 3A4CA 3HTUA 1MMNA 1B9MA 2WTEA 5CQEA 3HRSA 5GAGJ 3WTWC 2I8DA 2ZJPF 2ZKZA 2AQEA 3DBRB 3U21A 2VE8A 4YG2F 3LSPA 3FISA 2L02A 3O6BB 2LBFA 1I1SA 1B72B 1J9IA 1MIJA 2LF7A 1VQMI 3GWZA 1WQ2A 2VBWA 4OIRF 4E4HA 2NVQJ 5IT3A 2E5NA 2OUMA 3CZ6A 3Q9VA 3BOQA 4RA2A 2BYVE 1VQ8I 2M3AA 2R0QC 3FDYA 1DU6A 3OYKA 2R7UA 2CFOA 1XC5A 5E1WA 3BJ6A 1HDPA 1MH3A 4AUXA 3KE2A 5LGNA 2G9WA 4UB8C 3LOCA 1YX5A 2XIGA 1UMQA 4A3KJ 3SQNA 4BY1J 2RGVA 1BI3A 1WHUA 1Z3YA 4R1HA 5HLHA 3OV8A 1Y1VJ 4XRFA 3FMQA 1BR1A 3R0JA 1XMKA 4EM2A 3FXRA 2QYOA 4MQVA 3F9KA 5DM7F 5L3BA 1RR8C 3CUQA 1HSTA 5ILUA 1U5TB 3DPUA 4I09A 3SEZA 1SC7A 3I64A 3GCMA 3GBGA 1S5LC 2J5OA 2CYYA 1GVJA 2JVHA 3K1PA 2KT0A 5J8CA 2H1LA 3FKJA 4MTDA 1RIOH 2L7MP 1FSHA 2Q0OA 2K9LA 1FOXA 3HXLA 2YS9A 3FF5A 4NB5A 1XDSA 3GZ5A 3R6SA 5LHHA 2HXIA 4U0WA 1VQOI 2R7SA 2V6CA 2DA7A 4BH9A 1J7KA 1Z77A 5DEQA 3T5XA 4E7LA 1E3PA 4A3DJ 1F9NA 4PJMA 3DLLF 1SEUA 4C2TA 4KISA 1WRJA 2YX7A 3AAFA 1B9NA 2GIVA 4LK0F 4IHXA 1OLTA 4JX5A 1UFMA 1U78A 3F3XA 1QVUA 2A6EF 1MGTA 4AVPA 3CF2A 3K1NA 4MGRA 4RMNA 1X19A 2HOAA 4XRSA 5CVJA 1P4WA 4XIDA 3TP3A 1Z21A 2LOOA 2CV2A 1ONVA 1S6LA 2XDVA 4BXXJ 3DQVC 3UR3C 3OS2A 2R3SA 1USSA 4ESJA 4RM2A 1W7PB 2VBYA 2L4MA 3H3UA 4WXHA 2EIKH 3WTXC 4XLFA 2DJNA 3NWSA 3H92A 2O8XA 5AIPA 3RI4A 1VQPI 4Q48A 1WWXA 3IKVA 4IRHA 2Y48A 3AL0B 3IAS2 4BYYA 4I98B 4YEJA 2D5VA 2FRHA 4HDUA 4P5OA 1K4SA 2AXTC 2B63J 4Q4ZF 4KUMA 5M3FJ 4KMUX 5KNLA 3S2DJ 3RKWA 3HTSB 3KPHA 1Z1DA 1FTZA 1ZYRF 2K85A 4BU2A 4ZDLA 4U7DA 4JBAA 1FY7A 1ON1A 2DYRH 2MA3A 2F48A 2BXYA 1XB4A 5FRNA 1O57A 1BI0A 2P5LC 3GMEA 4O6JA 4HOBA 4Z2YA 4BEHA 1I50J 3N97A 3F8MA 3E7LA 4IEJA 2K9SA 3FXJA 4OMZA 1BW6A 1QGPA 2HKOA 5FKLA 3PQJA 4IF4A 4BDZA 2GBYA 2CQXA 5FGMA 4HRIA 2DDBA 3TP0A 2ZSIB 1ITYA 3H3VK 1ZAOA 2W25A 5JVGF 4NC6A 4MEXF 3E5UA 3PJRA 2XVCA 2JA2A 1ZH5A 2XUBA 1BBYA 2E19A 2YX4A 2BY0A 3H5NA 2XHKA 1AKHA 5M5XJ 2P81A 1YS6A 1MNMC 4M3DA 2ICWG 4DYQA 3WU2C 3PQKA 3H9QA 3BPXA 3CESA 2QSHX 2CW0F 2HEOA 2L7ZA 3CO7C 2WADA 1MMGA 3F22A 3CMMA 3G1LA 4HPQA 1OYIA 3HRUA 2KIUA 3ASNH 4Y3OA 3BTCA 4BACA 3HSEA 2DMPA 2CS3A 1F4KA 2RREA 1RUNA 3K1MA 4A6DA 4IHTA 4P9UA 5JHUA 2JVGA 3H9JA 1VQ7I 3DBLB 1X1CA 3OR2C 3PNYA 3KEYA 2E35A 5EJCA 2L9RA 2BY3A 4JP0A 1EA3A 1FJLA 1K6OA 1MMSA 2KIFA 3RTRA 4A3LJ 1PUFB 1RPWA 3QYBA 1J09A 5IP6A 5J40A 1IXSB 4LIUA 2QM3A 3E0JB 3OWTA 4BUPA 5ILSA 2HQNA 2BHYA 2Y75A 1UHMA 2M2EA 1UZCA 3R61A 3SXYA 5F0HA 1R58A 5K7ZA 2IJLA 4DQ2A 5LBQA 1G3TA 3KYLA 4EVIA 1QA6A 1JGSA 3QYEA 1YFHA 3B6AA 1YX3A 2HPMA 2DTRA 5LEJA 2A68F 1R5HA 1HKSA 3G1MA 3CJRB 2KQRA 2VLAA 2EA2A 2YSRA 2ZMEA 4YIRX 1LUJB 4XQFA 4PCQA 2PJPA 4E7JA 1SAXA 3S1NJ 2XAFA 3S93A 2K02A 4U0YA 4XBFA 5GPAA 5CJ9A 3SHFA 3K6GA 2M45A 4NQWA 1ETWA 3OYIA 2VQLA 3FHNA 3VWBA 3IH4A 2VODA 4E7HA 3IRQA 2EIMH 1APLC 3BT9A 3FXQA 4DIQA 3JW4A 4I7HA 5DCFA 4UY8I 1ZGWA 3UKGA 4XORA 1XSVA 3HKZA 3A01B 1QBJA 5DS9A 5ICCA 4HQEA 1MD0A 3OSFA 4MO7A 3AL0C 2VPLA 2EILH 5DUIA 4MFDA 3MEXA 1R00A 1LDKB 1P6RA 2VBXA 2FSWA 4DW6A 2LKPA 4XN0A 1ERDA 3KYDB 3WE3A 2EK5A 2O6GE 1O7FA 2E1MB 4HW0A 4HLYA 4C2MJ 3HRMA 3IH3A 4IRGA 4GFBA 1IAWA 4A93J 4HYEA 4EGZA 5D5UB 1DUXC 5H20A 1U9NA 4BE0A 4F55A 1MMDA 1OMIA 1TL8A 1D1AA 4KMFA 4XKBA 2A5YB 3EETA 4A5NA 4EEFG 5IOZA 3A2KA 3BG9A 3DU5A 1HCRA 1TW2A 5HLTA 2H8RA 1ETKA 3DTIA 1V54H 2E1NA 1X4PA 3HOWJ 1UCRA 2HQAA 5HDKA 2KJBA 3LNQA 1YRNA 2R5ZA 2NS0A 3K4JA 1Q1HA 4L5IA 3S2WA 3L09A 5E18F 2OJED 3K4CA 5IP7J 1OISA 1BIAA 3MD2A 1WCMJ 1T56A 1JKPC 2IT0A 2QF7A 2ISZA 1EH8A 3HSFA 3P7NA 2HYJA 5B1BH 5J1UA 2KIMA 4UVCA 3DPLC 1LB2A 2EV5A 3PUFA 5M5YJ 3V7RA 2DU9A 2A3SA 2DDAA 3LSMA 1WSUA 5IT9K 3OSGA 1MBGA 4C3IJ 3GZNB 4EJVA 1X1PA 1LFBA 2CW8A 2LMDA 3GTMJ 4RB1A 4EM1A 3HOSA 2NVTJ 2G7HA 2GOXB 3S14J 2J5PA 1B8IA 1LNWA 4ZZDA 1A5JA 1G3SA 3ECOA 3BDDA 4PJJA 4RS8A 1OR7A 2Z5UA 4AU7A 4JX4A 4ZJZA 1AWCA 2BHZA 2YR2A 1BM9A 3C3WA 3JSOA 3KZZA 3MCZA 2X6XA 5FRMA 3EQLF 1MW7A 2HZTA 3PUBA 1VFCA 2Z3YA 2XAQA 2QBYA 2KDZA 2MH2A 3ZQQA 4D7NA 3EUHC 4C9YA 5GAEJ 1ZG5A 3IL2A 5LD2C 3GX4X 4BE1A 3LSRA 3WU1B 3J7YJ 1IF1A 1SD5A 2Q2EB 2EQRA 3R0AA 4HNTA 1FX7A 3ZQFA 1A31A 4EQQA 1YJNI 5ILVA 2LP0A 3I59A 5H6RA 5LEKA 3OYHA 2DOAA 1FBQA 2LY1A 3TW7A 3J7AY 1ETYA 5K5RA 1ENHA 1X3UA 3EUHA 2RDPA 4XONA 3H36A 4KNYA 1ETOA 4HNUA 4G7HF 3MVPA 1A04A 4BDYA 2QQBA 1X1AA 2HFHA 2VOOA 1H89C 1X4OA 2JSPA 1OKRA 1ETQA 3KZIC 3M1CA 4RAZA 3OL3A 3RYRA 3LA7A 1Y1WJ 1ZARA 2LREA 2ZSHB 3K4MA 5GAHJ 1GT0C 2DA6A 5D4SA 1EH7A 3HOZJ 1YS7A 4LLLA 1PYVA 1QHGA 2OAZA 2E60A 3GTJJ 1O3RA 4HSTA 5FROA 3CJTB 3CCQI 3FXMA 1JT6A 2DLLA 5BNGA 5K1YA 2VPRA 5GPCA 1MJAA 1FC3A 4FHTA 1YOVB 2V1UA 2MBFA 3BG5A 2QSFX 2DTZA 2L01A 2X1DA 2E1MC 4CZCA 1WFXA 1I39A 2LBFB 2KISA 2XV4S 1S8NA 1LDDA 4PSWA 1IDZA 3LSIA 3OYCA 3RZDJ 4ENNA 2KP6A 2M7BA 3O8GA 2ELKA 5DYMA 1HC8A 4XOPA 1W1WE 1S3JA 1RKWA 4LGWA 2E2JJ 1XSXA 3LMMA 5CYVA 1Y56A 1ETVA 3D5LA 3EUKL 3K0LA 3I55I 2KRFA 3ZQ7A 3EYIA 2CRGA 3BZKA 4RB3C 3JRIA 5EF6A 2XSDC 2EBIA 3P5JA 3TGNA 2DK8A 3KP3A 5CVIA 4WF2A 1WJAA 2XSJC 5BOXA 4GRIA 4NUBA 1KU9A 1D1BA 2E1CA 2JMWA 3CUQB 4JOMA 3PIOF 1DDNA 2VC1A 1D5YA 5AIQA 2XRNA 3E6MA 4HLXA 4OAYA 5D5WB 4GO1A 4ZDOA 1T33A 1WGXA 4LB5A 1BW5A 1FMWA 2E7XA 1Z7UA 1I1GA 3M9AA 1HDDC 2IGNA 4XLAA 4A0ZA 1R4NB 4I99C 4KIBA 3EDPA 1KGSA 4A3MJ 1O3TA 5CQGA 3QPTA 4W97A 1K78A 5C4XJ 4K2EA 3TW6A 3BCBA 4RGRA 3F0CA 2JZYA 2PG4A 1K79A 4AWXB 3GZ6A 3HOVJ 3BR1A 2IA1A 5B3SH 4FX4A 2ME0A 5J4YA 2KKOA 2K27A 1MSEC 1IUFA 3L2WA 2LNBA 3BROA 1XMAA 4OU0A 1MBJA 3DFGA 3ZQGA 5FKMA 3CP2A 2E34A 3J80K 5HODA 3K4KA 5FD5A 2W1OA 3B02A 3RQ4A 2YU9J 4BQAA 1H9TA 1YW7A 4PGHA 4GGGA 2NXNB 4WXCA 3TQNA 3S1QJ 1TWAJ 1T8IA 5JHFA 3E6CC 1EH6A 3DV8A 4YIIA 3OIQA 4NHJA 4X1EA 3LQRA 2CUZA 2DA5A 5DM6F 3CCSI 4B48A 2M4KA 3NQOA 2WWYA 3LSGA 2P0WA 3TDUC 3VFZA 2CSOA 5GTHC 2OTJI 2GA2A 3HGYA 4LB6B 2MD0A 5DUKA 5LFAA 5FKNA 3ONQA 1J75A 1NG6A 3FXKA 2HYGD 3OYFA 1VZ0A 4HBLA 4CA0A 1UHWA 1PP8F 4JX6A 3QRFF 4N4NB 4CCOA 3DP7A 3QPSA 4M6YA 2Y0MA 1YIOA 2ZO4A 2R7FA 1F5TA 3FWEA 5FJ8J 3VYSB 2BVMA 3IC7A 4BEHB 4HV5A 4OIOF 3BC8A 1VQLI 3CDIA 1TW3A 2O0YA 4E7KA 2IGMA 2Y2ZA 2LF8A 3PM1A 1BI1A 2VJ4A 3ZOBA 1ZN2A 4G6DA 2AO9A 3P9IA 3DF8A 1R71A 4L9JA 2W82A 3ABLH 1DPUA 1AKHB 3G2BA 2G7UA 5EGOA 2FOKA 1R7JA 2VIXA 5KAIC 2EA4A 2EFQA 2KLOA 5CLSA 1Y6IA 4LK1F 4LG3A 3VEPA 3VPRA 4CUGA 1W5SA 9ANTA 5C4JJ 3KETA 3BZCA 1RETA 5ICGA 1IZ1A 1U0JA 1EJ9A 4G94A 3PSIA 2RC4A 3IP4B 3MKWB 1ZG1A 4NBQA 4RLQA 3CUQC 1QZZA 2ZJRF 1UG2A 3WTSC 2N8GA 1VNDA 2XB0X 3LQQA 1EF4A 1R4MB 2BVLA 4XL9A 4IQ4A 2VXDA 1ZRDA 1JGGA 5F6FA 1Y8QB 1VQ5I 3SFIA 1Y0NA 3K4NA 4RM3A 4M72A 2NS8A 1YQAA 5E3LA 1U8BA 4HF1A 4I6ZA 2UWMA 2M1BA 4E7IA 2BY2A 4II2A 4PGGA 4RGUA 2GLOA 2LSOA 4U0VA 1XGNA 1KA8A 4B44A 2UV1A 4H4KC 3S3NA 1FT9A 5CKTA 3KZYA 3CJQB 3J7AO 2HXOA 2P5VA 2XAJA 4M9XA 3S1MJ 2BW3A 3GFJA 1JKOC 5H6QA 1T98A 1DP3A 2V1NA 3PIPF 3JRDA 1CF7A 2ZMEB 4KN4X 4PDKA 2W00A 3W2AA 2HVSA 2L9SA 1MMAA 2QSGX 1WH5A 1ZRCA 3WGGA 2FF4A 3VOEA 4NQWB 2HWVA 1XX5A 5IT9Z 3KP6A 3KP7A 3OIPA 1BC7C 2CV1A 4KFCA 3AG3H 1IRZA 2X1EA 4ZZLA 2DK5A 2WY7Q 1S7AA 2MC4A 5BPIA 1WPKA 3GTPJ 1BN5A 4LJZF 5E1XA 2PMHA 2DA2A 2R7QA 2QEXI 2QKMB 3HHGA 3NARA 2F6CA 1HW5A 4U87A 2R7OA 1TT0A 1FYKA 4M73A 5J1YA 3OYDA 2EV6A 1WI3A 1TWCJ 2F5EA 3WTTC 4IHYA 3FBNB 3U9GA 3HJEA 1WJCA 2RAEA 1XCVA 2Z9OA 1MNDA 2LLKA 4I2OA 2R93J 4EJOA 1P2FA 2PX9A 2L2OA 2JA6J 3DEWA 4D1QA 3GYHX 5TISC 3CCVI 5HS9A 3BQZA 2QENA 3UNGC 2PMZA 1BIBA 1FWZA 2IXSA 2KPMA 4LLGF 3V8JA 2TRTA 1ZR4A 4I76A 2FUG2 5E1ZB 2VQCA 3VYTB 2QQAA 2E2IJ 2QQ8A 3RJPA 3C1DA 1LQ1A 4XLNF 1WJFA 3HSRA 3ISPA 5IYDJ 1IN4A 1QO0D 1XMXA 1BOAA 3OR1C 4QPQA 1NK2P 5KHDA 3B6CA 2NVXJ 1AOYA 4G7ZF 1YRNB 2VB6A 1GV5A 1YO5C 2OPTA 4N9IA 2R5ZB 2PMUA 1POGA 3W3CA 2JQ7A 1MKMA 1QU3A 1JTYA 1MH4A 1QPMA 2GA1A 3R4KA 3A0HC 5IPAA 1N78A 5LHIA 4IO9F 3K2ZA 2ESHA 5L3GA 3NWTA 3OS1A 5LRSA 1CGPA 1T6SA 4I02A 3RQIA 2QGUA 1EKEA 1TQMA 2A69F 4UVBA 4IQJA 4OMYA 3W6KB 3D5SC 1OCCH 2M5WA 4BAYA 1RNLA 4ZDPA 2M8EA 1X3ZB 2O3FA 3L2QA 4A3IJ 3PO3J 5TGTA 1ON2A 4OOIA 1REPC 1MDMA 4MEYF 2R4GA 3HKZN 1B8IB 4OIQF 4HSRA 1EV7A 5LGUA 3SEQA 4M9ZA 1ZLJA 1TWGJ 2GQQA 3A03A 2GXAA 2HYFA 4L0ZB 1GVDA 4AIHA 4BHCA 3GTOJ 1RI7A 1KU3A 4W1UA 2STTA 2XF5A 5C44J 2CO5A 1P7JA 2EINH 3V8LA 1T39A 2EFNA 2QBYB 4LG0A 4CDGA 1BOBA 2MW8A 2W24A 4D5CA 4IJAA 4PJLA 1W36C 3IKTA 2VKHA 3JAMK 1WKMA 1UJ8A 4CO8A 3RZOJ 2HDWA 2Y69H 4O5VA 2IAIA 5IY5H 2R7TA 3CC4I 4F52A 1PP7U 3I59B 2VUMJ 5LRRA 3AFHA 2W57A 2VI6A 2ZMEC 1W5TA 3KP4A 4BXUA 3KP5A 4CCJA 1SD7A 1RZ4A 4BJTA 4A3CJ 3ZMDA 1KU7A 5HNFA 4H0EA 2UXNA 1JKQC 4U88A 3W6JB 2VKEA 3EYYA 3PSFA 4Q5SF 1ZELA 2ZBKA 3ABUA 2FXAA 4BHPA 2F5DA 5AONA 4P1WA 1VTNC 3BPVA 2JUGA 3W2VA 4M3EA 1R6RA 2KRCA 1QZYA 4A5MA 3L2RA 3ZMVA 2DBBA 3K70C 1O7LA 2RNJA 5B5EC 4CXFA 1DGWY 1OJLA 2ZNZA 3BG7A 2XGCA 4A3BJ 3I0TA 3HGGA 3I58A 3WODF 4LIVA 1MBHA 5DD4A 4ZTJA 4BJ5C 3TOAA 2OTLI 2Z99A 3J80Z 1Y0UA 2PEXA 4F92B 1JT0A 1MJBA 2NOGA 2WV1A 2EFPA 4EJWA 5HNHA 3LAJA 2EZKA 4GCVA 1K6YA 1YE9A 2I10A 1H8AC 2MC3A 5D5XB 3OYNA 4IRIA 3KFWX 3WE2A 3FK7A 1MBFA 1RC9A 1SMTA 1W36D 2DT5A 5J1RA 2EV0A 2XKPA 3CQZJ 4G8XA 4ZYDA 1LFUP 3ULQB 1Z6RA 3CC7I 2BBYA 5EG0A 1IXCA 3FXOA 3TL4X 4A6EA 1VQNI 2L4AA 5FLXZ 3EPZA 3M8EA 4CYCA 3RPUA 3BTJA 2M4GA 4IHVA 1GXPA 1J2XA 2P7VB 2CGPA 4UB6C 2DMNA 3AG4H 3CCLI 1O4XA 2QCOA 5C3EJ 1GV2A 2CQQA 4LOCA 3OYGA 3F6VA 5A2QZ 2Q1ZB 2GIZA 3CDLA 3CMEI 3SZPA 3VSKA 2XAGA 4EV0A 2XF6A 2P6SA 5E3NA 4ENJA 3HM5A 2OQGA 4IL6C 4FASD 5TRDA 1Z0XA 1VF9A 3WTZA 4AYBA 1I5ZA 4L18B 5FFZA 4UNOA 4OINF 2ID6A 3ZXSA 1K61A 2CJJA 1R5ID 3QOEA 3GFMA 2Z1DA 3WGHA 3ZPLA 3F8FA 2CG4A 3ELKA 1K78B 3K70D 1WVRA 4RGXA 2DMTA 1S29A 1D0YA 4XM3A 1FLIA 2VOPA 5EZGA 3V4GA 3I9V2 1ZGJA 3WHCA 3CMYA 3FHZA 2XRLA 1XGMA 1R5GA 2LYCA 2OBPA 3EUAA 3SDBA 4S04A 3ZR8X 2VQHA 2YPRA 5GADJ 1OR7C 2BV6A 5HDGA 4XLEA 2H94A 4UXNA 1X1BA 5D8LB 5DV5A 2DJIA 1NG7A 3GEZA 1O3SA 1KU2A 2OC6A 3F6OA 4AC0A 5FKOA 3A0BC 5JR3A 1JHFA 2PLYA 4QTRA 4IPAA 4QIWN 2K3FA 4JYKA 1MBKA 1STZA 3PFYA 1BJAA 4EATA 5CVUA 2LD5A 2KRHA 3HOXJ 4B3XA 4UHTA 1ULYA 1ZGAA 2GAUA 3BWGA 3KYCB 1IUYA 2QZ8A 4O3MA 5IYBJ 3JTGA 3Q0WA 3Q0UA 2EIJH 1B59A 2OU2A 4EGYA 1N77A 3HBLA 4IHSA 3QPHA 1XSDA 4I0AA 1R9TJ 1SFXA 1FPQA 1WJEA 5CVRA 5E3OA 1IN5A 5JLXA 4P9FA 1IO2A 2BE5F 2VKDA 2DO7A 3J7ZI 1Y39A 5E8GA 3T1BA 5D5VB 2DCEA 4FTHA 3HRTA 2K3PA 3LSHA 4CCNA 2X6YA 2PN6A 1R22A 3ZP5A 1Y8RB 4PJNA 1F36A 1LEAA 2FQ3A 4KICA 2IRFG 2NNYA 2EB7A 5DDGA 3M7GA 3I71A 3HZJA 2L5QA 2HPIA 4PUSA 2WC2A 1A35A 2E7WA 2X9DA 1HBXG 3LL7A 1KYWA 2FMLA 1HXDA 4AIKA 4DGWB 1GUUA 2CUFA 4Y15A 2FEZA 2WAQA 3IHUA 2GZWA 2ISYA 4HX4A 2ZFUA 4M9SA 1GLNA 4BKXA 2OQRA 1TNSA 2LH9A 3JCUC 1V5EA 3SYTA 3JRAA 2R7XA 1B1BA 3VB2A 1SVMA 3MKLA 4HG2A 3ZN0A 3ABTA 5EGOB 2R7VA 2DODA 1XG1A 2EZIA 3KX2A 1Z7LA 2B0LA 4CCMA 4MHGA 1IXRC 1W0UA 3U2RA 3DPTA 1HW2A 1B4AA 3F8CA 5M5WJ 3HG9A 1IV6A 2DOFA 2V9KA 4CSWA 1IN8A 3LSTA 3NEUA 4BXFA 1P9QC 4X6AJ 2MGQA 5GP9A 4AIJA 2LRDA 1HF0A 1Z6TA 2COBA 1OCRH 5GTIC 2TCTA 2W85A 4G6TB 2WBMA 4UUTA 4J19A 2MABA 3JTHA 4LD5A 2EH3A 2BOLA 3FM3A 4Y7NJ 1AA7A 1X58A 3Q5FA 3RYPA 3L00A 3M07A 2JA8J 2XAUA 1JE8A 2PI0A 2FU4A 3QP5A 1D1CA 1T2KA 2M8GX 3DXJF 3GLXA 2VJJA 2PFBA 2O9LA 1LVKA 2BW3B 3ZQCA 3S32A 5L3CA 2CV0A 1LJ9A 5J47A 4KJZA 1X2NA 2M34A 3RPQA 4FE7A 1CF7B 2P7CB 4C3HJ 3GTGJ 3FIWA 2M87A 4FETA 3RIRA 4KT6A 2NOJB 4EM0B 3OMYA 4DZJA 3N4MA 2A6TA 1IGNA 3A02A 2ZXIA 4A2UA 2KDOA 2H09A 2RKHA 4M6XA 2FJ1A 2Y9YA 5JLWA 3AKZA 3S3OA 1MSFC 5E3MA 3S2HJ 4KITB 4ENKA 2FQ4A 4Y4RA 2R5YA 1QRYA 2LTPA 2EFOA 1TZLA 3F8BA 3K4BA 2QQ9A 2K9QA 3S1RJ 3FZVA 4Z6YA 1FSEA 4HV6A 1BC8C 4AVZA 1V5GA 2FMYA 3QODA 2Y0SA 5F1JA 5LHGA 3HHHA 1TQIA 1ZG3A 4ANJA 1W5CC 4XKVA 5E79C 3CCEI 5FFXA 3PNVA 1WI9A 3G6EI 2ACJA 4WWCA 3T8TA 3OOUA 2ZXJA 1L0OC 5EDNA 3I3LA 2M9HA 2AQFA 3DKYA 5DCMA 3L9FA 3NRVA 2XGDA 3QQAA 5KAFC 4G7OF 3WHBA 4YRVA 3K2AA 2X6OA 1X1DA 3GTLJ 3JAMZ 3CCMI 2VN2A 3ROUA 3BJAA 4FT8A 4GYIA 4EMSA 5F0FA 4ENMA 4BGDA 3ZGKA 3KEQA 2DPDA 2KL4A 5E20A 4KT5C 3FM5A 2VT2A 3I4NJ 1D3YA 1TWFJ 1JHHA 4B47A 2PJRA 3H1CA 4L9NA 5LLQA 2EZLA 2RNGA 3PFIA 4M3BA 3H5AA 2H27A 2XASA 2OZ6A 1IW7F 4XSXF 2CUJA 2F2EA 3LSKA 3WGIA 4KDPA 5K5OA 2ETHA 1FTTA 5F04A 1KONA 4E7SA 3MMYB 4CHUA 1FEXA 2JN6A 4A0YA 3ML6A 1TQPA 2P6TA 1XPXA 4PSXA 2NAZA 4F7ZA 1QQIA 3P9KA 4FX0A 3FMSA 2XF7A 4NC7A 4ABZA 1SD4A 1YJWI 1F1ZA 3Q3SA 1DGRM 3CDHA 2FA5A 4EJUA 2D2WA 3ABMH 2R7ZJ 1LDJA 1VQ6I 3CO6C 4XICA 1LE8B 2K4BA 2V6EA 2MLKA 3HIFA 1TBXA 4XRMA 1XGSA 3GTKJ 3D5RC 3RKYA 2DT6A 1R1TA 1ETXA 3BR0A 3TMOA 1PVEA 1QHHD 2CFXA 2M0CA 5F0CA 1FOYA 2W4SA 2BZTA 2L3DA 4DYRA 4DYCA 4E70A 1MDMB 4XLHA 5DD8A 2GXGA 2MD5A 3GW2A 1RR7A 1YIJI 3QYFA 1OYYA 2JRTA 2BGCA 3RCOA 3BY6A 2AHQA 1FIAA 4DNCA 1IJWC 2LKXA 4XSZF 5ERIA 2K7LA 4V19K 4XLPF 4GDFA 2UUZA 1ZRFA 2EFWA 3HUGA 2P8TA 4LG0B 2IVMA 2E1OA 1DP7P 2PMZN 1XN7A 4ZC3A 3TEDA 3M4OJ 4UUSA 3IRRA 3WG7H 5ICEA 1OQYA 2V4JC 2DAOA 1JKRC 1KQ0A 2F5CA 2VC0A 3FKIJ 1LEBA 1KQ8A 3U1DA 2VL8A 1U2WA 3LA2A 4NC8A 1F43A 5LGTA 4J01A 2GWRA 1T0FA 5FB2A 1ZLKA 4DJAA 1G6NA 4HF0A 2K4JA 3IUOA 2L7KA 4BJ6C 2DT7B 2X1CA 5L3DA 5HVQC 2DOEA 4PFPA 2Z16A 4PFOA 3OY9A 1YLFA 4BNCA 2UXXA 1Z9CA 2XAHA 3ZQLA 1IN6A 4BS9A 1S7EA 4CYDA 3Q9SA 4BQQA 4D7MA 2A05A 3RKQA 1IRGA 2E5ZA 3DCFA 2FBHA 3R60A 5IYCJ 1XS9A 4JQFA 2VASA 1BR2A 3GXOA 3L1PA 3LA3A 4ESBA 1YHQI 4RB0A 4E6KG 1A36A 3COAC 1O3QA 1UELB 4RBOA 1NK3P 3G1OA 1FMVA 2A61A 3LFKA 4N0BA 2FBKA 3CF5F 3G71I 4L5JA 5CPRB 1C0WA 2IPQX 3HPGA 3VODA 3I4PA 3M1EA 3ZMSA 5L3FA 4DZPA 1Z91A 4J00A 1IRFA 2DW4A 3CUOA 4L0YB 3T0YA 1BJZA 3QWLA 1R23A 1XCBA 1IG7A 4BL0B 2RVCA 1K7AA 4G6QA 2PBIA 2HTJA 2IS2A 1W0TA 1KYZA 1FIPA 3M8JA 1VQ9I 1OCOH 2IW5A 4B4CA 1E3HA 1G8XA 2ZXWH 4HEA2 5EG0B 3ERED 3DWLE 3FXUA 1T95A 4CYCB 2IS4A 4P55A 1QVTA 1S9HA 1YITI 2ESNA 2JTVA 2VE9A 3S16J 3MQ0A 4BBRJ 5KCMA 1H88C 2KFDA 4X0GA 4KYWA 2X0LA 4HF2A 1ACIA 1OPCA 3IWZA 3CCJI 4LFUA 2STWA 4R8HA 2JK3A 5EEGA 3F72A 1VQ4I 2H6BA 2M7AA 5F64A 2JPCA 3T8RA 3ZMZA 2L9VA 3CCRI 4ZH4F 2O5RA 3HYIA 1U9OA 2RQPA 1G4DA 3FX3A 1RESA 2DMUA 3O8HA 2HR3A 2XB5A 4G12A 2L7FP 3J81K 2KHMA 1OCTC 3LWFA 3K4LA 1XTAA 3WTUC 1S7OA 4HDVA 2NVUB 1FYMA 4CZZA 3JRFA 1D8JA 3DEUA 4S05A 1W4MA 5H2FC 4RLFA 2NNNA 2Y30A 1IC8A 2JWTA 3WG9A 1YYVA 3ZCOA 3BQYA 4PJ0C 3V7CA 5EYRA 1V55H 3ERMA 3LAPA 2ID3A 2JSCA 1LE8A 1BA5A 2OF7A 4NNJA 2EZHA 1LPQA 1U6GA 2CMPA 3MZHA 2B9SA 5D6FA 3MFKA 1TLHB 4AIDA 1YG2A 4QSHA 3Q0VA 1OCPA 2JJ7A 2VT3A 3TO7A 5BS6A 2GOMA 2F4MB 3OYLA 1DU0A 6PAXA 3BR3A 3V42A 1FNNA 3L7WA 5CVVA 1JI8A 2KZVA 3LFUA 3SJMA 5D8KB 3QP6A 3GFIA 3KLNA 2XGXA 2HGCA 4RAGA 1A6IA 4S0HB 5FD6A 1UHSA 2K9MA 1J5YA 3I56I 1RRJA 3L2CA 3S8PA 1GHCA 2KMUA 3LSJA 2O61A 2FNAA 3VYUB 2PQ8A 3H0GJ 4ZYAA 3WU0A 3E3VA 3VDXA 4N4OB 3ESWB 3REOA 4HAMA 4LITA 3HPHA 2HNHA 2KZGA 1V5FA 2CU7A 4UV8A 1A6QA 3JREA 2VKVA 2HQ5A 2HTSA 2BEOA 5TJJA 2DQRA 2V79A 3H5RA 4C3JJ 1S72I 4ASNA 4CICA 5ED4A 1SFKA 1B72A 3DBHB 2K5CA 3WTYC 1RKTA 3NAUA 2FD5A 2Y31A 3WTVC 4OIPF 4AYBN 3ZRGA 3MAJA 2NRAC 1FOKA 3VYRB 3C18A 4EJTA 2H6CA 1V3FA 3MKYB 2HVQA 3ABKH 2K86A 1U5TC 1IDYA 2HDDA 4L9TA 1P4XA 1SANA 1QZEA 2LG4A 4CCLA 2HOSA 1D5VA 1JXSA 1B6AA 4M71A 4ESFA 4V2GA 4KN7X 2ME6A 2G0EA 3L2UA 4ZYHA 3N05A 3BG3A 3G4SI 1NH3A 1FZPB 4A12A 4II3A 2DFHA 1WZ2A 4IHWA 1E17A 3JRBA 4A3JJ 1I6HJ 2V7FA 2CUEA 5K7FA 2ZXHA 3GFLA 5HDNA 2XPVA 1Q1VA 1U5TA 4XK4A 4BQNA 1H9GA 3E6DA 2YUSA 3JRHA 2VONA 3OYAA 4PK4A 2E71A 2JPBA 4I01A 2DFEA 2IS1A 3U1KA 1G3WA 1T38A 2MSYA 5J8FA 2GXBA 4ON0A 3DTKA 3I54A 1I3AA 2V26A 1USTA 2JT1A 4RDUA 2EPFA 4E7ZA 2ELHA 5HLIA 2LY9A 2OD5A 1YTYA 3BJOA 1HSJA 1TT5B 1K83J 4Q47A 2BY1A 1Z05A 3KIOA 4HA8A 2VJIA 4FE4A 2NYXA 5KK1A 4RGSA 3G3ZA 4ZTFA 5DTDA 4BY7J 3IAM2 1YJ9I 4QLCU 1H0MA 2A6HF 2I5UA 2W7NA 4XOTA 3HB9A 2DA1A 1JUPA 2WB1N 3PNTA 4I0BA 3GO5A 4KIGA 1CQTA 2QA4I 1JJ6C 5B66C 4F3QA 2F5FA 4HZFA 4XLCA 2C6YA 2IA0A 3IV5A 1XD7A 4PZJA 4L5EA 1W7PA 2LR8A 4B3AA 1SFOJ 2DA3A 2DMQA 2DYSH 1N75A 3CD6I 3V8KA 4MQ9F 1SAUA 2O7OA 2IEKA 3SZGA 2ZCWA 3W2WA 4A3FJ 3DU6A 2WAQN 4OAZA 1VQKI 4MTEA 4G9YA 1R49A 4DBRA 1FP1D 4JK1X 3PL8A 4XKCA 2IS6A 1NTCA 2DA4A 4BQOA 3D1NI 2O03A 3W6VA 1SFEA 3RPUD 1MJ9A 3F21A 2R5YB 4CH7A 1FBUA 3PO2J 1ZKGA 4LLNA 2XPUA 3MKZA 1ZR2A 4HX7A 2QVOA 2ZJ2A 5JVTA 1ZTRA 3TO6A 4FISA 3IWFA 1UB9A 2DXIA 2B7EA 2CW7A 2DFIA 4IXAA 4Y33A 2WAFA 3QPLA 2XGEA 2HDCA 4FQGA 4Y52J 3ZMTA 2L9NA 4M74A 1MBEA 2MLGA 2VBZA 3S3MA 3F23A 3BR5A 3OIOA 2L54A 1W7PD 3C2HA 1WJ5A 2QKLB 5DCMB 1X2MA 1I6XA 4Y13A 3OYJA 3MZYA 3BZ6A 3CMAI 3HDDA 5BPDA 3CJNA 3HOYJ 3C2GA 4IX7A 3RKXA 5E17F 2BXZA 2RQQA 2R92J 4B43A 1FP2A 4AD9A 2AXLA 1KQ9A 2HVRA 3QU6A 3E1SA 2DQLA 1OYWA 2HS5A 4ITVA 4D9JA 4BBSJ 3S15J 2QWWA 3H9GA 3O2PE 4C2UA 4XR6A 2O8KA
chains in the Genus database with same CATH topology
4R79A 3K69A 2P4WA 1U3EM 5K5QA 5L3EA 2DI3A 3F8NA 2OA4A 5HS8A 1YW9A 3E97A 1GXQA 4WK8F 2QLZA 3QOPA 2QUFA 1R36A 3SFZA 3QAHA 4MNUA 1MZBA 4WCGA 1XGOA 2CWEA 4LMYA 3SZTA 2D45A 2X4HA 2FNPA 4QWQA 1IN7A 3KP2A 5EEHA 1ZREA 2RN7A 3GVAA 4IVNA 3FMRA 3OOPA 1HW1A 1SD6A 2VXZA 4Y17A 3G73A 2COMA 3ZN1A 2FBIA 2FE3A 2ZNYA 2HQRA 4GXOA 3TOBA 1LVAA 1BI2A 2D1HA 3M8FA 3E6BA 1HKQA 1XDUA 3E5XA 2V1DA 2HOEA 5JI6A 1G3YA 2MH9A 1RUOA 4B09A 3O3KA 3P9CA 3TDZC 2XROA 2D1VA 2Q8KA 4TV7A 5ICFA 4UV9A 2TDXA 2HKXA 4A0XA 2CQKA 5F1RA 5D6EA 2WV0A 5HLGA 5KVRA 1J0RA 1FYLA 1P92A 2IP2A 3MWMA 4KA4A 2R7DA 4BHBA 3V7SA 1HKTA 5HOOA 3J81Z 1R1VA 3KCCA 1NHAA 4ZYEA 4B8XA 2RV8A 3QU3A 3DKWA 5JFRA 3JSPA 2M30A 1DPRA 3GUDA 4D0PA 4YFNF 1SFUA 1E2XA 1L3LA 4U7BA 1PUEE 3E5QA 2AS5F 1D8KA 3BP8A 3C7JA 3RDIA 3H3ZA 2P5KA 1U8RA 1YW8A 1V4RA 1J59A 2EWNA 3TO9A 2IA2A 2ADUA 1QNTA 4YFXF 4WXDA 3I5UA 4RAYA 2UZKA 2XKOA 5D4RA 3TKYA 5BMZA 5HS7A 1P4AA 4HQMA 5FO5A 3I53A 4KIFA 5J6XA 3HOTA 2V9VA 3KLOA 4YIFA 3ECHA 1SMYF 2Z33A 2A07F 5FLXK 1TNTA 4UVAA 4N9HA 1I27A 4ZYGA 1PDNC 2EJRA 2YU3A 3KEOA 4P96A 3K9TA 5A2QK 2Q2EA 4WX9A 4ETSA 5E8IA 4HX8A 4L9VA 3B73A 4YFKF 3CTAA 1TTYA 2DPUA 4CGZA 4UUVA 4GYGA 4RB2C 1ZHFA 3CLOA 1ODDA 3ZMUA 2W84A 2ZFWA 1HQCA 2V1XA 2KJCA 2LDUA 1R1UA 5BQTA 3D0SA 2OZUA 3GF2A 1FBSA 3HTUA 1B9MA 2WTEA 3HRSA 3WTWC 2ZKZA 4YG2F 2VE8A 2L02A 3O6BB 1I1SA 1J9IA 2LF7A 3GWZA 1WQ2A 2VBWA 4OIRF 5IT3A 3Q9VA 3BOQA 2BYVE 5E1WA 3BJ6A 3KE2A 5LGNA 2G9WA 2XIGA 3SQNA 2RGVA 1BI3A 4R1HA 5HLHA 3OV8A 4XRFA 3FMQA 3R0JA 1XMKA 4EM2A 3FXRA 2QYOA 4MQVA 5L3BA 3CUQA 1HSTA 5ILUA 1U5TB 4I09A 3I64A 2J5OA 2CYYA 1GVJA 3K1PA 5J8CA 4MTDA 1RIOH 1FSHA 2Q0OA 3FF5A 4NB5A 1XDSA 3GZ5A 3R6SA 5LHHA 4U0WA 2V6CA 4BH9A 1J7KA 5DEQA 3T5XA 1F9NA 1WRJA 2YX7A 3AAFA 1B9NA 2GIVA 4LK0F 1UFMA 1U78A 3F3XA 2A6EF 1MGTA 4AVPA 3K1NA 4MGRA 5CVJA 1P4WA 1ONVA 1S6LA 3DQVC 2R3SA 1USSA 4ESJA 1W7PB 2VBYA 2L4MA 3H3UA 4WXHA 3WTXC 3H92A 2O8XA 5AIPA 3RI4A 4Q48A 1WWXA 3IKVA 4IRHA 2Y48A 4BYYA 4I98B 2FRHA 4HDUA 4P5OA 4Q4ZF 4KUMA 4KMUX 3RKWA 3HTSB 1Z1DA 1ZYRF 4JBAA 1FY7A 1ON1A 2MA3A 1XB4A 1O57A 1BI0A 2P5LC 4O6JA 4HOBA 4Z2YA 3N97A 3F8MA 4OMZA 1QGPA 2HKOA 3PQJA 4IF4A 5FGMA 1ZAOA 2W25A 4MEXF 3E5UA 2XVCA 1ZH5A 2XUBA 1BBYA 2YX4A 2XHKA 1YS6A 3PQKA 3BPXA 2CW0F 2HEOA 3CO7C 3F22A 1OYIA 3HRUA 2KIUA 3HSEA 1F4KA 1RUNA 4IHTA 3K1MA 4A6DA 4P9UA 5JHUA 1K6OA 2KIFA 3RTRA 1IXSB 2QM3A 5ILSA 2HQNA 2Y75A 1UHMA 3R61A 3SXYA 1R58A 2IJLA 4DQ2A 5LBQA 1G3TA 4EVIA 1JGSA 1YFHA 2DTRA 5LEJA 2A68F 1R5HA 1HKSA 2EA2A 2YSRA 2ZMEA 4PCQA 2PJPA 1SAXA 2XAFA 2K02A 4U0YA 4XBFA 5CJ9A 3SHFA 2M45A 4NQWA 2VODA 3IRQA 3FXQA 3JW4A 4I7HA 5DCFA 1XSVA 1QBJA 5ICCA 4HQEA 1MD0A 5DUIA 3MEXA 1LDKB 1R00A 1P6RA 2VBXA 2FSWA 2LKPA 3WE3A 2EK5A 2O6GE 1O7FA 4HW0A 4HLYA 3HRMA 4IRGA 1IAWA 4HYEA 4EGZA 5D5UB 1DUXC 5H20A 1OMIA 4KMFA 2A5YB 3EETA 4A5NA 1TW2A 2E1NA 1UCRA 5HDKA 2KJBA 2NS0A 1Q1HA 4L5IA 3S2WA 3L09A 5E18F 1BIAA 2IT0A 2ISZA 1EH8A 3HSFA 3P7NA 2KIMA 4UVCA 3DPLC 1LB2A 2EV5A 3V7RA 2DU9A 2A3SA 1WSUA 5IT9K 4EJVA 4RB1A 4EM1A 3HOSA 2G7HA 2J5PA 1LNWA 4ZZDA 1G3SA 3ECOA 3BDDA 4RS8A 1OR7A 2Z5UA 1AWCA 2YR2A 1BM9A 3C3WA 3JSOA 3KZZA 3MCZA 3EQLF 2HZTA 2Z3YA 2XAQA 2QBYA 2MH2A 1ZG5A 3IL2A 3GX4X 3WU1B 1IF1A 1SD5A 3R0AA 1FX7A 4EQQA 5ILVA 3I59A 5H6RA 5LEKA 1FBQA 5K5RA 3EUHA 1X3UA 2RDPA 4KNYA 4G7HF 1A04A 2QQBA 2HFHA 2VOOA 1OKRA 4RAZA 3RYRA 3LA7A 1ZARA 5D4SA 1EH7A 1YS7A 4LLLA 2OAZA 1O3RA 2DLLA 5K1YA 1MJAA 1FC3A 4FHTA 2V1UA 2MBFA 2L01A 2XV4S 1S8NA 1LDDA 4ENNA 5DYMA 1S3JA 4LGWA 1XSXA 5CYVA 3D5LA 3K0LA 2KRFA 3ZQ7A 3EYIA 4RB3C 3TGNA 2DK8A 3KP3A 5CVIA 4WF2A 5BOXA 1KU9A 2E1CA 3CUQB 1DDNA 2VC1A 5AIQA 2XRNA 3E6MA 4HLXA 5D5WB 4GO1A 4LB5A 2E7XA 1Z7UA 1I1GA 3M9AA 4A0ZA 4KIBA 3EDPA 1KGSA 3QPTA 1K78A 4K2EA 4RGRA 2JZYA 2PG4A 1K79A 4AWXB 3GZ6A 2IA1A 4FX4A 2KKOA 2K27A 2LNBA 3BROA 1XMAA 4OU0A 3DFGA 3J80K 5FD5A 3B02A 4BQAA 1H9TA 1YW7A 4PGHA 4GGGA 4WXCA 3TQNA 3E6CC 1EH6A 3DV8A 4YIIA 4NHJA 3LQRA 3NQOA 2WWYA 3TDUC 3VFZA 2CSOA 2GA2A 4LB6B 5DUKA 1J75A 2HYGD 4HBLA 1UHWA 1PP8F 3QRFF 3DP7A 4M6YA 2Y0MA 1YIOA 2ZO4A 2R7FA 1F5TA 3FWEA 3IC7A 4HV5A 4OIOF 1TW3A 2O0YA 2LF8A 1BI1A 1ZN2A 4G6DA 3P9IA 3DF8A 4L9JA 1DPUA 2G7UA 2FOKA 1R7JA 2EA4A 2EFQA 5CLSA 4LK1F 3VEPA 1W5SA 3KETA 5ICGA 1IZ1A 4G94A 2RC4A 1ZG1A 3CUQC 1QZZA 3WTSC 3LQQA 1ZRDA 5F6FA 4M72A 1YQAA 4HF1A 2UWMA 2M1BA 4PGGA 4RGUA 2LSOA 4U0VA 1XGNA 1KA8A 1FT9A 3KZYA 3J7AO 2P5VA 2XAJA 4M9XA 3GFJA 5H6QA 1T98A 1CF7A 2ZMEB 4KN4X 4PDKA 1ZRCA 3WGGA 2FF4A 3VOEA 2HWVA 5IT9Z 3KP6A 3KP7A 1BC7C 4KFCA 4ZZLA 2DK5A 1S7AA 5BPIA 1BN5A 4LJZF 5E1XA 2PMHA 3HHGA 1HW5A 1FYKA 4M73A 2EV6A 3WTTC 2F5EA 3U9GA 1XCVA 2Z9OA 4I2OA 4EJOA 1P2FA 3GYHX 5HS9A 2QENA 1BIBA 1FWZA 4LLGF 3V8JA 5E1ZB 2QQAA 3RJPA 3C1DA 1LQ1A 4XLNF 3HSRA 3ISPA 1IN4A 1QO0D 1BOAA 1AOYA 4G7ZF 1YO5C 4N9IA 2PMUA 1MKMA 1QPMA 2GA1A 3R4KA 5LHIA 3K2ZA 2ESHA 5L3GA 5LRSA 1CGPA 1T6SA 4I02A 2A69F 1TQMA 4UVBA 4OMYA 3W6KB 4BAYA 2M5WA 1RNLA 2M8EA 2O3FA 1ON2A 4OOIA 1REPC 1MDMA 4MEYF 4OIQF 1EV7A 5LGUA 4M9ZA 1ZLJA 2GQQA 2HYFA 4L0ZB 4AIHA 4BHCA 1RI7A 1KU3A 2STTA 2CO5A 1T39A 3V8LA 2QBYB 2EFNA 4LG0A 4CDGA 2W24A 4IJAA 3IKTA 3JAMK 1WKMA 4CO8A 4O5VA 1PP7U 3I59B 5LRRA 2W57A 1W5TA 3KP4A 4BXUA 3KP5A 1SD7A 1RZ4A 3ZMDA 1KU7A 4H0EA 2UXNA 4U88A 3W6JB 4Q5SF 3EYYA 4BHPA 2ZBKA 2FXAA 3ABUA 2F5DA 5AONA 1VTNC 3BPVA 4A5MA 1QZYA 3ZMVA 2DBBA 1O7LA 2RNJA 4CXFA 2ZNZA 3I0TA 3I58A 3WODF 5DD4A 3TOAA 2Z99A 3J80Z 1Y0UA 2PEXA 1MJBA 2EFPA 4EJWA 3LAJA 4GCVA 2MC3A 5D5XB 4IRIA 3KFWX 3WE2A 1SMTA 2DT5A 2EV0A 2XKPA 4G8XA 4ZYDA 3ULQB 1Z6RA 2BBYA 1IXCA 4A6EA 2L4AA 5FLXZ 3M8EA 3RPUA 1GXPA 1J2XA 2P7VB 2CGPA 3F6VA 5A2QZ 3SZPA 2XAGA 4EV0A 2P6SA 4ENJA 5TRDA 2OQGA 3WTZA 1I5ZA 4L18B 5FFZA 4UNOA 4OINF 3GFMA 3WGHA 3ZPLA 3F8FA 2CG4A 3ELKA 1K78B 4RGXA 1S29A 1FLIA 2VOPA 3V4GA 1ZGJA 3FHZA 1XGMA 1R5GA 2OBPA 4S04A 2YPRA 2BV6A 5HDGA 2H94A 4UXNA 5D8LB 5DV5A 3GEZA 1O3SA 1KU2A 3F6OA 5JR3A 1JHFA 2PLYA 4IPAA 1STZA 1BJAA 5CVUA 4UHTA 1ULYA 1ZGAA 2GAUA 3BWGA 1IUYA 2QZ8A 4O3MA 3JTGA 1B59A 2OU2A 4EGYA 4IHSA 3QPHA 1XSDA 4I0AA 1SFXA 1FPQA 5CVRA 1IN5A 4P9FA 2BE5F 2DO7A 5E8GA 3T1BA 5D5VB 3HRTA 2PN6A 1R22A 3ZP5A 1LEAA 2FQ3A 4KICA 2IRFG 2NNYA 2EB7A 5DDGA 3M7GA 3I71A 2WC2A 2E7WA 1HBXG 1KYWA 2FMLA 1HXDA 4AIKA 4Y15A 2FEZA 3IHUA 2GZWA 2ISYA 4HX4A 4M9SA 2OQRA 1TNSA 1B1BA 3VB2A 3ZN0A 3ABTA 2B0LA 4MHGA 1IXRC 3U2RA 3DPTA 1HW2A 1B4AA 3F8CA 1IN8A 3LSTA 3NEUA 4AIJA 1Z6TA 2W85A 3JTHA 4LD5A 3FM3A 3Q5FA 3RYPA 3L00A 1JE8A 2PI0A 2FU4A 3QP5A 1T2KA 3DXJF 3GLXA 2PFBA 5L3CA 1LJ9A 3RPQA 1CF7B 2P7CB 2M87A 3RIRA 4EM0B 3N4MA 4A2UA 4U7DA 2RKHA 2H09A 4M6XA 4ENKA 2EFOA 3F8BA 2QQ9A 3FZVA 1FSEA 4HV6A 1BC8C 2FMYA 5LHGA 3HHHA 1TQIA 1ZG3A 5FFXA 1WI9A 2ACJA 4WWCA 3T8TA 2ZXJA 1L0OC 5DCMA 3L9FA 3NRVA 4G7OF 3JAMZ 2VN2A 3ROUA 3BJAA 4FT8A 4GYIA 4EMSA 4ENMA 3KEQA 2DPDA 5E20A 4KT5C 3FM5A 2VT2A 1D3YA 1JHHA 4L9NA 5LLQA 3PFIA 2H27A 2XASA 2OZ6A 1IW7F 4XSXF 2F2EA 3WGIA 4KDPA 5K5OA 2ETHA 4CHUA 4A0YA 3ML6A 1TQPA 2P6TA 2NAZA 4F7ZA 1QQIA 3P9KA 4FX0A 3FMSA 1SD4A 1F1ZA 3CDHA 2FA5A 4EJUA 2D2WA 1LDJA 3CO6C 2K4BA 2MLKA 3HIFA 1TBXA 1XGSA 3RKYA 1R1TA 2CFXA 2L3DA 1MDMB 4E70A 5DD8A 2GXGA 2MD5A 3GW2A 1OYYA 2JRTA 2BGCA 3BY6A 4DNCA 4XSZF 5ERIA 2K7LA 4XLPF 1ZRFA 2EFWA 3HUGA 2P8TA 4LG0B 2IVMA 1DP7P 1XN7A 3IRRA 5ICEA 2DAOA 1KQ0A 2F5CA 2VC0A 1LEBA 1KQ8A 3U1DA 1U2WA 3LA2A 5LGTA 2GWRA 1T0FA 5FB2A 1ZLKA 1G6NA 4HF0A 2K4JA 5L3DA 5HVQC 4BNCA 1YLFA 2UXXA 1Z9CA 2XAHA 1IN6A 4CYDA 3Q9SA 1IRGA 2FBHA 3R60A 4JQFA 3GXOA 3LA3A 4ESBA 4RB0A 3COAC 1O3QA 4N0BA 2A61A 3LFKA 2FBKA 4L5JA 1C0WA 2IPQX 3VODA 3I4PA 3M1EA 3ZMSA 5L3FA 1Z91A 4L0YB 1IRFA 2DW4A 3CUOA 3T0YA 1R23A 1XCBA 2RVCA 1K7AA 4G6QA 2PBIA 2HTJA 1KYZA 2IW5A 3ERED 3FXUA 4P55A 2ESNA 2JTVA 2VE9A 3MQ0A 4KYWA 2X0LA 4HF2A 1OPCA 3IWZA 4LFUA 2STWA 4R8HA 5EEGA 3F72A 2H6BA 5F64A 2JPCA 3T8RA 3ZMZA 4ZH4F 3HYIA 2RQPA 1G4DA 3FX3A 2HR3A 3J81K 3LWFA 3WTUC 1S7OA 4HDVA 1FYMA 4CZZA 1D8JA 3DEUA 4S05A 1W4MA 2NNNA 3WG9A 1YYVA 3V7CA 3LAPA 2JSCA 1U6GA 3MZHA 5D6FA 3MFKA 1TLHB 1YG2A 3TO7A 2VT3A 5BS6A 6PAXA 1FNNA 3L7WA 5CVVA 5D8KB 3QP6A 3GFIA 3KLNA 2XGXA 2HGCA 5FD6A 1J5YA 3L2CA 1GHCA 2O61A 2FNAA 2PQ8A 3WU0A 3E3VA 3REOA 4HAMA 4UV8A 2HTSA 2BEOA 5TJJA 2DQRA 2V79A 4ASNA 4CICA 5ED4A 3WTYC 3WTVC 4OIPF 2NRAC 3MAJA 1FOKA 3C18A 4EJTA 2H6CA 1V3FA 2K86A 1U5TC 4L9TA 1P4XA 1D5VA 1JXSA 1B6AA 4M71A 4ESFA 4KN7X 4ZYHA 1FZPB 4A12A 1E17A 3GFLA 5HDNA 1U5TA 1H9GA 3E6DA 2VONA 2JPBA 4I01A 1G3WA 1T38A 5J8FA 2GXBA 4ON0A 3I54A 1USTA 2JT1A 2ELHA 5HLIA 1YTYA 2OD5A 3BJOA 1HSJA 4Q47A 1Z05A 4HA8A 2NYXA 5KK1A 4RGSA 3G3ZA 4QLCU 1H0MA 2A6HF 4I0BA 3GO5A 4KIGA 2F5FA 4HZFA 2C6YA 2IA0A 1XD7A 4PZJA 1W7PA 3V8KA 4MQ9F 2ZCWA 4MTEA 4G9YA 1FP1D 4JK1X 2O03A 1SFEA 3F21A 1MJ9A 1FBUA 4LLNA 4HX7A 2QVOA 2ZJ2A 5JVTA 3TO6A 3IWFA 1UB9A 2DFIA 4IXAA 2HDCA 3ZMTA 4M74A 2MLGA 2VBZA 3F23A 2L54A 1W7PD 4Y13A 5DCMB 1I6XA 3MZYA 3BZ6A 5BPDA 3CJNA 3RKXA 5E17F 1FP2A 4AD9A 2AXLA 1KQ9A 3QU6A 2DQLA 1OYWA 2HS5A 2QWWA 3O2PE 1O3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R79 A;  3K69 A;  2P4W A;  1U3E M;  5K5Q A;  5L3E A;  2DI3 A;  3F8N A;  2OA4 A;  5HS8 A;  1YW9 A;  3E97 A;  1GXQ A;  4WK8 F;  2QLZ A;  3QOP A;  2QUF A;  1R36 A;  3SFZ A;  3QAH A;  4MNU A;  1MZB A;  4WCG A;  1XGO A;  2CWE A;  4LMY A;  3SZT A;  2D45 A;  2X4H A;  2FNP A;  4QWQ A;  1IN7 A;  3KP2 A;  5EEH A;  1ZRE A;  2RN7 A;  3GVA A;  4IVN A;  3FMR A;  3OOP A;  1HW1 A;  1SD6 A;  2VXZ A;  4Y17 A;  3G73 A;  2COM A;  3ZN1 A;  2FBI A;  2FE3 A;  2ZNY A;  2HQR A;  4GXO A;  3TOB A;  1LVA A;  1BI2 A;  2D1H A;  3M8F A;  3E6B A;  1HKQ A;  1XDU A;  3E5X A;  2V1D A;  2HOE A;  5JI6 A;  1G3Y A;  2MH9 A;  1RUO A;  4B09 A;  3O3K A;  3P9C A;  3TDZ C;  2XRO A;  2D1V A;  2Q8K A;  4TV7 A;  5ICF A;  4UV9 A;  2TDX A;  2HKX A;  4A0X A;  2CQK A;  5F1R A;  5D6E A;  2WV0 A;  5HLG A;  5KVR A;  1J0R A;  1FYL A;  1P92 A;  2IP2 A;  3MWM A;  4KA4 A;  2R7D A;  4BHB A;  3V7S A;  1HKT A;  5HOO A;  3J81 Z;  1R1V A;  3KCC A;  1NHA A;  4ZYE A;  4B8X A;  2RV8 A;  3QU3 A;  3DKW A;  5JFR A;  3JSP A;  2M30 A;  1DPR A;  3GUD A;  4D0P A;  4YFN F;  1SFU A;  1E2X A;  1L3L A;  4U7B A;  1PUE E;  3E5Q A;  2AS5 F;  1D8K A;  3BP8 A;  3C7J A;  3RDI A;  3H3Z A;  2P5K A;  1U8R A;  1YW8 A;  1V4R A;  1J59 A;  2EWN A;  3TO9 A;  2IA2 A;  2ADU A;  1QNT A;  4YFX F;  4WXD A;  3I5U A;  4RAY A;  2UZK A;  2XKO A;  5D4R A;  3TKY A;  5BMZ A;  5HS7 A;  1P4A A;  4HQM A;  5FO5 A;  3I53 A;  4KIF A;  5J6X A;  3HOT A;  2V9V A;  3KLO A;  4YIF A;  3ECH A;  1SMY F;  2Z33 A;  2A07 F;  5FLX K;  1TNT A;  4UVA A;  4N9H A;  1I27 A;  4ZYG A;  1PDN C;  2EJR A;  2YU3 A;  3KEO A;  4P96 A;  3K9T A;  5A2Q K;  2Q2E A;  4WX9 A;  4ETS A;  5E8I A;  4HX8 A;  4L9V A;  3B73 A;  4YFK F;  3CTA A;  1TTY A;  2DPU A;  4CGZ A;  4UUV A;  4GYG A;  4RB2 C;  1ZHF A;  3CLO A;  1ODD A;  3ZMU A;  2W84 A;  2ZFW A;  1HQC A;  2V1X A;  2KJC A;  2LDU A;  1R1U A;  5BQT A;  3D0S A;  2OZU A;  3GF2 A;  1FBS A;  3HTU A;  1B9M A;  2WTE A;  3HRS A;  3WTW C;  2ZKZ A;  4YG2 F;  2VE8 A;  2L02 A;  3O6B B;  1I1S A;  1J9I A;  2LF7 A;  3GWZ A;  1WQ2 A;  2VBW A;  4OIR F;  5IT3 A;  3Q9V A;  3BOQ A;  2BYV E;  5E1W A;  3BJ6 A;  3KE2 A;  5LGN A;  2G9W A;  2XIG A;  3SQN A;  2RGV A;  1BI3 A;  4R1H A;  5HLH A;  3OV8 A;  4XRF A;  3FMQ A;  3R0J A;  1XMK A;  4EM2 A;  3FXR A;  2QYO A;  4MQV A;  5L3B A;  3CUQ A;  1HST A;  5ILU A;  1U5T B;  4I09 A;  3I64 A;  2J5O A;  2CYY A;  1GVJ A;  3K1P A;  5J8C A;  4MTD A;  1RIO H;  1FSH A;  2Q0O A;  3FF5 A;  4NB5 A;  1XDS A;  3GZ5 A;  3R6S A;  5LHH A;  4U0W A;  2V6C A;  4BH9 A;  1J7K A;  5DEQ A;  3T5X A;  1F9N A;  1WRJ A;  2YX7 A;  3AAF A;  1B9N A;  2GIV A;  4LK0 F;  1UFM A;  1U78 A;  3F3X A;  2A6E F;  1MGT A;  4AVP A;  3K1N A;  4MGR A;  5CVJ A;  1P4W A;  1ONV A;  1S6L A;  3DQV C;  2R3S A;  1USS A;  4ESJ A;  1W7P B;  2VBY A;  2L4M A;  3H3U A;  4WXH A;  3WTX C;  3H92 A;  2O8X A;  5AIP A;  3RI4 A;  4Q48 A;  1WWX A;  3IKV A;  4IRH A;  2Y48 A;  4BYY A;  4I98 B;  2FRH A;  4HDU A;  4P5O A;  4Q4Z F;  4KUM A;  4KMU X;  3RKW A;  3HTS B;  1Z1D A;  1ZYR F;  4JBA A;  1FY7 A;  1ON1 A;  2MA3 A;  1XB4 A;  1O57 A;  1BI0 A;  2P5L C;  4O6J A;  4HOB A;  4Z2Y A;  3N97 A;  3F8M A;  4OMZ A;  1QGP A;  2HKO A;  3PQJ A;  4IF4 A;  5FGM A;  1ZAO A;  2W25 A;  4MEX F;  3E5U A;  2XVC A;  1ZH5 A;  2XUB A;  1BBY A;  2YX4 A;  2XHK A;  1YS6 A;  3PQK A;  3BPX A;  2CW0 F;  2HEO A;  3CO7 C;  3F22 A;  1OYI A;  3HRU A;  2KIU A;  3HSE A;  1F4K A;  1RUN A;  4IHT A;  3K1M A;  4A6D A;  4P9U A;  5JHU A;  1K6O A;  2KIF A;  3RTR A;  1IXS B;  2QM3 A;  5ILS A;  2HQN A;  2Y75 A;  1UHM A;  3R61 A;  3SXY A;  1R58 A;  2IJL A;  4DQ2 A;  5LBQ A;  1G3T A;  4EVI A;  1JGS A;  1YFH A;  2DTR A;  5LEJ A;  2A68 F;  1R5H A;  1HKS A;  2EA2 A;  2YSR A;  2ZME A;  4PCQ A;  2PJP A;  1SAX A;  2XAF A;  2K02 A;  4U0Y A;  4XBF A;  5CJ9 A;  3SHF A;  2M45 A;  4NQW A;  2VOD A;  3IRQ A;  3FXQ A;  3JW4 A;  4I7H A;  5DCF A;  1XSV A;  1QBJ A;  5ICC A;  4HQE A;  1MD0 A;  5DUI A;  3MEX A;  1LDK B;  1R00 A;  1P6R A;  2VBX A;  2FSW A;  2LKP A;  3WE3 A;  2EK5 A;  2O6G E;  1O7F A;  4HW0 A;  4HLY A;  3HRM A;  4IRG A;  1IAW A;  4HYE A;  4EGZ A;  5D5U B;  1DUX C;  5H20 A;  1OMI A;  4KMF A;  2A5Y B;  3EET A;  4A5N A;  1TW2 A;  2E1N A;  1UCR A;  5HDK A;  2KJB A;  2NS0 A;  1Q1H A;  4L5I A;  3S2W A;  3L09 A;  5E18 F;  1BIA A;  2IT0 A;  2ISZ A;  1EH8 A;  3HSF A;  3P7N A;  2KIM A;  4UVC A;  3DPL C;  1LB2 A;  2EV5 A;  3V7R A;  2DU9 A;  2A3S A;  1WSU A;  5IT9 K;  4EJV A;  4RB1 A;  4EM1 A;  3HOS A;  2G7H A;  2J5P A;  1LNW A;  4ZZD A;  1G3S A;  3ECO A;  3BDD A;  4RS8 A;  1OR7 A;  2Z5U A;  1AWC A;  2YR2 A;  1BM9 A;  3C3W A;  3JSO A;  3KZZ A;  3MCZ A;  3EQL F;  2HZT A;  2Z3Y A;  2XAQ A;  2QBY A;  2MH2 A;  1ZG5 A;  3IL2 A;  3GX4 X;  3WU1 B;  1IF1 A;  1SD5 A;  3R0A A;  1FX7 A;  4EQQ A;  5ILV A;  3I59 A;  5H6R A;  5LEK A;  1FBQ A;  5K5R A;  3EUH A;  1X3U A;  2RDP A;  4KNY A;  4G7H F;  1A04 A;  2QQB A;  2HFH A;  2VOO A;  1OKR A;  4RAZ A;  3RYR A;  3LA7 A;  1ZAR A;  5D4S A;  1EH7 A;  1YS7 A;  4LLL A;  2OAZ A;  1O3R A;  2DLL A;  5K1Y A;  1MJA A;  1FC3 A;  4FHT A;  2V1U A;  2MBF A;  2L01 A;  2XV4 S;  1S8N A;  1LDD A;  4ENN A;  5DYM A;  1S3J A;  4LGW A;  1XSX A;  5CYV A;  3D5L A;  3K0L A;  2KRF A;  3ZQ7 A;  3EYI A;  4RB3 C;  3TGN A;  2DK8 A;  3KP3 A;  5CVI A;  4WF2 A;  5BOX A;  1KU9 A;  2E1C A;  3CUQ B;  1DDN A;  2VC1 A;  5AIQ A;  2XRN A;  3E6M A;  4HLX A;  5D5W B;  4GO1 A;  4LB5 A;  2E7X A;  1Z7U A;  1I1G A;  3M9A A;  4A0Z A;  4KIB A;  3EDP A;  1KGS A;  3QPT A;  1K78 A;  4K2E A;  4RGR A;  2JZY A;  2PG4 A;  1K79 A;  4AWX B;  3GZ6 A;  2IA1 A;  4FX4 A;  2KKO A;  2K27 A;  2LNB A;  3BRO A;  1XMA A;  4OU0 A;  3DFG A;  3J80 K;  5FD5 A;  3B02 A;  4BQA A;  1H9T A;  1YW7 A;  4PGH A;  4GGG A;  4WXC A;  3TQN A;  3E6C C;  1EH6 A;  3DV8 A;  4YII A;  4NHJ A;  3LQR A;  3NQO A;  2WWY A;  3TDU C;  3VFZ A;  2CSO A;  2GA2 A;  4LB6 B;  5DUK A;  1J75 A;  2HYG D;  4HBL A;  1UHW A;  1PP8 F;  3QRF F;  3DP7 A;  4M6Y A;  2Y0M A;  1YIO A;  2ZO4 A;  2R7F A;  1F5T A;  3FWE A;  3IC7 A;  4HV5 A;  4OIO F;  1TW3 A;  2O0Y A;  2LF8 A;  1BI1 A;  1ZN2 A;  4G6D A;  3P9I A;  3DF8 A;  4L9J A;  1DPU A;  2G7U A;  2FOK A;  1R7J A;  2EA4 A;  2EFQ A;  5CLS A;  4LK1 F;  3VEP A;  1W5S A;  3KET A;  5ICG A;  1IZ1 A;  4G94 A;  2RC4 A;  1ZG1 A;  3CUQ C;  1QZZ A;  3WTS C;  3LQQ A;  1ZRD A;  5F6F A;  4M72 A;  1YQA A;  4HF1 A;  2UWM A;  2M1B A;  4PGG A;  4RGU A;  2LSO A;  4U0V A;  1XGN A;  1KA8 A;  1FT9 A;  3KZY A;  3J7A O;  2P5V A;  2XAJ A;  4M9X A;  3GFJ A;  5H6Q A;  1T98 A;  1CF7 A;  2ZME B;  4KN4 X;  4PDK A;  1ZRC A;  3WGG A;  2FF4 A;  3VOE A;  2HWV A;  5IT9 Z;  3KP6 A;  3KP7 A;  1BC7 C;  4KFC A;  4ZZL A;  2DK5 A;  1S7A A;  5BPI A;  1BN5 A;  4LJZ F;  5E1X A;  2PMH A;  3HHG A;  1HW5 A;  1FYK A;  4M73 A;  2EV6 A;  3WTT C;  2F5E A;  3U9G A;  1XCV A;  2Z9O A;  4I2O A;  4EJO A;  1P2F A;  3GYH X;  5HS9 A;  2QEN A;  1BIB A;  1FWZ A;  4LLG F;  3V8J A;  5E1Z B;  2QQA A;  3RJP A;  3C1D A;  1LQ1 A;  4XLN F;  3HSR A;  3ISP A;  1IN4 A;  1QO0 D;  1BOA A;  1AOY A;  4G7Z F;  1YO5 C;  4N9I A;  2PMU A;  1MKM A;  1QPM A;  2GA1 A;  3R4K A;  5LHI A;  3K2Z A;  2ESH A;  5L3G A;  5LRS A;  1CGP A;  1T6S A;  4I02 A;  2A69 F;  1TQM A;  4UVB A;  4OMY A;  3W6K B;  4BAY A;  2M5W A;  1RNL A;  2M8E A;  2O3F A;  1ON2 A;  4OOI A;  1REP C;  1MDM A;  4MEY F;  4OIQ F;  1EV7 A;  5LGU A;  4M9Z A;  1ZLJ A;  2GQQ A;  2HYF A;  4L0Z B;  4AIH A;  4BHC A;  1RI7 A;  1KU3 A;  2STT A;  2CO5 A;  1T39 A;  3V8L A;  2QBY B;  2EFN A;  4LG0 A;  4CDG A;  2W24 A;  4IJA A;  3IKT A;  3JAM K;  1WKM A;  4CO8 A;  4O5V A;  1PP7 U;  3I59 B;  5LRR A;  2W57 A;  1W5T A;  3KP4 A;  4BXU A;  3KP5 A;  1SD7 A;  1RZ4 A;  3ZMD A;  1KU7 A;  4H0E A;  2UXN A;  4U88 A;  3W6J B;  4Q5S F;  3EYY A;  4BHP A;  2ZBK A;  2FXA A;  3ABU A;  2F5D A;  5AON A;  1VTN C;  3BPV A;  4A5M A;  1QZY A;  3ZMV A;  2DBB A;  1O7L A;  2RNJ A;  4CXF A;  2ZNZ A;  3I0T A;  3I58 A;  3WOD F;  5DD4 A;  3TOA A;  2Z99 A;  3J80 Z;  1Y0U A;  2PEX A;  1MJB A;  2EFP A;  4EJW A;  3LAJ A;  4GCV A;  2MC3 A;  5D5X B;  4IRI A;  3KFW X;  3WE2 A;  1SMT A;  2DT5 A;  2EV0 A;  2XKP A;  4G8X A;  4ZYD A;  3ULQ B;  1Z6R A;  2BBY A;  1IXC A;  4A6E A;  2L4A A;  5FLX Z;  3M8E A;  3RPU A;  1GXP A;  1J2X A;  2P7V B;  2CGP A;  3F6V A;  5A2Q Z;  3SZP A;  2XAG A;  4EV0 A;  2P6S A;  4ENJ A;  5TRD A;  2OQG A;  3WTZ A;  1I5Z A;  4L18 B;  5FFZ A;  4UNO A;  4OIN F;  3GFM A;  3WGH A;  3ZPL A;  3F8F A;  2CG4 A;  3ELK A;  1K78 B;  4RGX A;  1S29 A;  1FLI A;  2VOP A;  3V4G A;  1ZGJ A;  3FHZ A;  1XGM A;  1R5G A;  2OBP A;  4S04 A;  2YPR A;  2BV6 A;  5HDG A;  2H94 A;  4UXN A;  5D8L B;  5DV5 A;  3GEZ A;  1O3S A;  1KU2 A;  3F6O A;  5JR3 A;  1JHF A;  2PLY A;  4IPA A;  1STZ A;  1BJA A;  5CVU A;  4UHT A;  1ULY A;  1ZGA A;  2GAU A;  3BWG A;  1IUY A;  2QZ8 A;  4O3M A;  3JTG A;  1B59 A;  2OU2 A;  4EGY A;  4IHS A;  3QPH A;  1XSD A;  4I0A A;  1SFX A;  1FPQ A;  5CVR A;  1IN5 A;  4P9F A;  2BE5 F;  2DO7 A;  5E8G A;  3T1B A;  5D5V B;  3HRT A;  2PN6 A;  1R22 A;  3ZP5 A;  1LEA A;  2FQ3 A;  4KIC A;  2IRF G;  2NNY A;  2EB7 A;  5DDG A;  3M7G A;  3I71 A;  2WC2 A;  2E7W A;  1HBX G;  1KYW A;  2FML A;  1HXD A;  4AIK A;  4Y15 A;  2FEZ A;  3IHU A;  2GZW A;  2ISY A;  4HX4 A;  4M9S A;  2OQR A;  1TNS A;  1B1B A;  3VB2 A;  3ZN0 A;  3ABT A;  2B0L A;  4MHG A;  1IXR C;  3U2R A;  3DPT A;  1HW2 A;  1B4A A;  3F8C A;  1IN8 A;  3LST A;  3NEU A;  4AIJ A;  1Z6T A;  2W85 A;  3JTH A;  4LD5 A;  3FM3 A;  3Q5F A;  3RYP A;  3L00 A;  1JE8 A;  2PI0 A;  2FU4 A;  3QP5 A;  1T2K A;  3DXJ F;  3GLX A;  2PFB A;  5L3C A;  1LJ9 A;  3RPQ A;  1CF7 B;  2P7C B;  2M87 A;  3RIR A;  4EM0 B;  3N4M A;  4A2U A;  4U7D A;  2RKH A;  2H09 A;  4M6X A;  4ENK A;  2EFO A;  3F8B A;  2QQ9 A;  3FZV A;  1FSE A;  4HV6 A;  1BC8 C;  2FMY A;  5LHG A;  3HHH A;  1TQI A;  1ZG3 A;  5FFX A;  1WI9 A;  2ACJ A;  4WWC A;  3T8T A;  2ZXJ A;  1L0O C;  5DCM A;  3L9F A;  3NRV A;  4G7O F;  3JAM Z;  2VN2 A;  3ROU A;  3BJA A;  4FT8 A;  4GYI A;  4EMS A;  4ENM A;  3KEQ A;  2DPD A;  5E20 A;  4KT5 C;  3FM5 A;  2VT2 A;  1D3Y A;  1JHH A;  4L9N A;  5LLQ A;  3PFI A;  2H27 A;  2XAS A;  2OZ6 A;  1IW7 F;  4XSX F;  2F2E A;  3WGI A;  4KDP A;  5K5O A;  2ETH A;  4CHU A;  4A0Y A;  3ML6 A;  1TQP A;  2P6T A;  2NAZ A;  4F7Z A;  1QQI A;  3P9K A;  4FX0 A;  3FMS A;  1SD4 A;  1F1Z A;  3CDH A;  2FA5 A;  4EJU A;  2D2W A;  1LDJ A;  3CO6 C;  2K4B A;  2MLK A;  3HIF A;  1TBX A;  1XGS A;  3RKY A;  1R1T A;  2CFX A;  2L3D A;  1MDM B;  4E70 A;  5DD8 A;  2GXG A;  2MD5 A;  3GW2 A;  1OYY A;  2JRT A;  2BGC A;  3BY6 A;  4DNC A;  4XSZ F;  5ERI A;  2K7L A;  4XLP F;  1ZRF A;  2EFW A;  3HUG A;  2P8T A;  4LG0 B;  2IVM A;  1DP7 P;  1XN7 A;  3IRR A;  5ICE A;  2DAO A;  1KQ0 A;  2F5C A;  2VC0 A;  1LEB A;  1KQ8 A;  3U1D A;  1U2W A;  3LA2 A;  5LGT A;  2GWR A;  1T0F A;  5FB2 A;  1ZLK A;  1G6N A;  4HF0 A;  2K4J A;  5L3D A;  5HVQ C;  4BNC A;  1YLF A;  2UXX A;  1Z9C A;  2XAH A;  1IN6 A;  4CYD A;  3Q9S A;  1IRG A;  2FBH A;  3R60 A;  4JQF A;  3GXO A;  3LA3 A;  4ESB A;  4RB0 A;  3COA C;  1O3Q A;  4N0B A;  2A61 A;  3LFK A;  2FBK A;  4L5J A;  1C0W A;  2IPQ X;  3VOD A;  3I4P A;  3M1E A;  3ZMS A;  5L3F A;  1Z91 A;  4L0Y B;  1IRF A;  2DW4 A;  3CUO A;  3T0Y A;  1R23 A;  1XCB A;  2RVC A;  1K7A A;  4G6Q A;  2PBI A;  2HTJ A;  1KYZ A;  2IW5 A;  3ERE D;  3FXU A;  4P55 A;  2ESN A;  2JTV A;  2VE9 A;  3MQ0 A;  4KYW A;  2X0L A;  4HF2 A;  1OPC A;  3IWZ A;  4LFU A;  2STW A;  4R8H A;  5EEG A;  3F72 A;  2H6B A;  5F64 A;  2JPC A;  3T8R A;  3ZMZ A;  4ZH4 F;  3HYI A;  2RQP A;  1G4D A;  3FX3 A;  2HR3 A;  3J81 K;  3LWF A;  3WTU C;  1S7O A;  4HDV A;  1FYM A;  4CZZ A;  1D8J A;  3DEU A;  4S05 A;  1W4M A;  2NNN A;  3WG9 A;  1YYV A;  3V7C A;  3LAP A;  2JSC A;  1U6G A;  3MZH A;  5D6F A;  3MFK A;  1TLH B;  1YG2 A;  3TO7 A;  2VT3 A;  5BS6 A;  6PAX A;  1FNN A;  3L7W A;  5CVV A;  5D8K B;  3QP6 A;  3GFI A;  3KLN A;  2XGX A;  2HGC A;  5FD6 A;  1J5Y A;  3L2C A;  1GHC A;  2O61 A;  2FNA A;  2PQ8 A;  3WU0 A;  3E3V A;  3REO A;  4HAM A;  4UV8 A;  2HTS A;  2BEO A;  5TJJ A;  2DQR A;  2V79 A;  4ASN A;  4CIC A;  5ED4 A;  3WTY C;  3WTV C;  4OIP F;  2NRA C;  3MAJ A;  1FOK A;  3C18 A;  4EJT A;  2H6C A;  1V3F A;  2K86 A;  1U5T C;  4L9T A;  1P4X A;  1D5V A;  1JXS A;  1B6A A;  4M71 A;  4ESF A;  4KN7 X;  4ZYH A;  1FZP B;  4A12 A;  1E17 A;  3GFL A;  5HDN A;  1U5T A;  1H9G A;  3E6D A;  2VON A;  2JPB A;  4I01 A;  1G3W A;  1T38 A;  5J8F A;  2GXB A;  4ON0 A;  3I54 A;  1UST A;  2JT1 A;  2ELH A;  5HLI A;  1YTY A;  2OD5 A;  3BJO A;  1HSJ A;  4Q47 A;  1Z05 A;  4HA8 A;  2NYX A;  5KK1 A;  4RGS A;  3G3Z A;  4QLC U;  1H0M A;  2A6H F;  4I0B A;  3GO5 A;  4KIG A;  2F5F A;  4HZF A;  2C6Y A;  2IA0 A;  1XD7 A;  4PZJ A;  1W7P A;  3V8K A;  4MQ9 F;  2ZCW A;  4MTE A;  4G9Y A;  1FP1 D;  4JK1 X;  2O03 A;  1SFE A;  3F21 A;  1MJ9 A;  1FBU A;  4LLN A;  4HX7 A;  2QVO A;  2ZJ2 A;  5JVT A;  3TO6 A;  3IWF A;  1UB9 A;  2DFI A;  4IXA A;  2HDC A;  3ZMT A;  4M74 A;  2MLG A;  2VBZ A;  3F23 A;  2L54 A;  1W7P D;  4Y13 A;  5DCM B;  1I6X A;  3MZY A;  3BZ6 A;  5BPD A;  3CJN A;  3RKX A;  5E17 F;  1FP2 A;  4AD9 A;  2AXL A;  1KQ9 A;  3QU6 A;  2DQL A;  1OYW A;  2HS5 A;  2QWW A;  3O2P E;  1O3T A; 
#chains in the Genus database with same CATH topology
 3K7A J;  2PJR B;  4A69 C;  3IH2 A;  4DBQ A;  4R79 A;  3K69 A;  3JRC A;  2P4W A;  1U3E M;  4DOZ A;  1IRX A;  5K5Q A;  2FOW A;  2A5W A;  5L3E A;  2JA7 J;  2OCC H;  2DI3 A;  2X51 A;  2H1K A;  3F8N A;  2OA4 A;  5HS8 A;  1SVL A;  1YW9 A;  3E97 A;  2WB1 A;  1JUM A;  1GXQ A;  3DEE A;  4WK8 F;  2QLZ A;  3QOP A;  3VSL A;  3S17 J;  4MFE A;  2QUF A;  4FCY A;  3CC2 I;  1R36 A;  1WH7 A;  3ZQI A;  3SFZ A;  3QAH A;  2MYS A;  4MNU A;  1GDT A;  1MZB A;  4WCG A;  1XGO A;  2CWE A;  4LMY A;  3SZT A;  1IV8 A;  2D45 A;  2X4H A;  1ZQ3 P;  2W48 A;  2FNP A;  1KZH A;  3OL4 A;  4IOA F;  3OS0 A;  4QWQ A;  2HZD A;  1IN7 A;  3KP2 A;  5EEH A;  1PUF A;  1ZRE A;  2RN7 A;  1HA8 A;  3DTE A;  1WJD A;  2X48 A;  2OV7 A;  2ZC2 A;  3GVA A;  4IVN A;  3FMR A;  3OYE A;  3OOP A;  1HW1 A;  3AG1 H;  1SD6 A;  1D0Z A;  4RAF A;  5FLV A;  2VXZ A;  4Y17 A;  2WAE A;  3G73 A;  3JR9 A;  2COM A;  1E3O C;  3ZN1 A;  2R7R A;  3FK6 A;  2HOT A;  2FBI A;  5B1A H;  2FE3 A;  2Y0S N;  2HQR A;  2ZNY A;  1FOW A;  4C30 A;  1WJB A;  3BLY A;  3BTI A;  1OFC X;  4GXO A;  3TOB A;  5K7H A;  1LVA A;  1BI2 A;  3A1Y A;  2D1H A;  3M8F A;  3E6B A;  1HKQ A;  1XDU A;  2HI3 A;  3E5X A;  4V2F A;  4A3E J;  2V1D A;  2HOE A;  3BR2 A;  4M3F A;  5JI6 A;  1G3Y A;  2MH9 A;  5F27 A;  2F5V A;  1RUO A;  4B09 A;  1I3Q J;  2WY8 Q;  1E0E A;  3O3K A;  2ZJQ F;  3TBI A;  3P9C A;  3TDZ C;  1Z67 A;  2XRO A;  1X3W B;  2D1V A;  3HUG B;  2Q8K A;  4TV7 A;  3BR6 A;  4AM3 A;  4B1R A;  5ICF A;  4UV9 A;  2TDX A;  5F08 A;  2HKX A;  4A0X A;  2CQK A;  5F1R A;  5D6E A;  2WV0 A;  4UUS B;  3JRG A;  5HLG A;  4MLO A;  2DFF A;  3BCA A;  2OCE A;  5KVR A;  1J0R A;  1FYL A;  1PJR A;  1P92 A;  2IP2 A;  3MWM A;  3A01 A;  2CQ7 A;  3I4M J;  1HOM A;  4KA4 A;  1TP4 A;  3GLL A;  2LFB A;  4D5F A;  3RSN A;  2Y9Z A;  2GM4 A;  2R7D A;  3AG2 H;  4BHB A;  3V7S A;  5FKK A;  5FLM J;  1HKT A;  1K4T A;  5HOO A;  3J81 Z;  2ECC A;  1R1V A;  3K10 A;  3KCC A;  1NHA A;  4IKF A;  2ZB9 A;  4ZYE A;  2IGK A;  4B8X A;  4XNF A;  2RV8 A;  4M3G A;  1BR4 A;  3QU3 A;  3DKW A;  5JFR A;  3JSP A;  3CLQ A;  2M30 A;  5J3L A;  1G2H A;  1JTX A;  2LY2 A;  1DPR A;  1ZK8 A;  2MG4 A;  3GUD A;  2FX0 A;  4D0P A;  2V9P A;  4YFN F;  2X85 A;  1HLV A;  1SFU A;  1G59 A;  4YEL A;  1E2X A;  2NS7 A;  1L3L A;  1SVO A;  4U7B A;  1PUE E;  3E5Q A;  3OYM A;  2AS5 F;  1D8K A;  4NDL A;  2LVS A;  2K40 A;  3BP8 A;  3C7J A;  4MIM A;  3RDI A;  3ASO H;  2XC7 A;  3SDG A;  3H3Z A;  2P5K A;  3MN2 A;  1OCZ H;  1VI0 A;  2F4I A;  1U8R A;  1TWH J;  1YW8 A;  1BL0 A;  1V4R A;  1J59 A;  2HU9 A;  4XKW A;  1LFP A;  2EWN A;  5J4V A;  1UG0 A;  3TO9 A;  1N25 A;  2IA2 A;  2ADU A;  1QNT A;  2LC2 A;  2ELJ A;  4WXD A;  3I5U A;  4YFX F;  3MZ8 A;  4RAY A;  2UZK A;  2XKO A;  3BTL A;  5D4R A;  3TKY A;  3ZQH A;  5BMZ A;  5HS7 A;  1P4A A;  3CCY A;  3FXL A;  3C2B A;  5EZH A;  4A3G J;  3CCU I;  4HQM A;  1JUS A;  5FO5 A;  2IBD A;  2VQG A;  3I53 A;  1AHD P;  1YI2 I;  4KIF A;  5M3M J;  1P7I A;  2MFZ A;  1DQU A;  2CH0 A;  5J6X A;  4QPO A;  4M6V A;  2ECB A;  3HOT A;  4OWR B;  4IZZ A;  2V9V A;  2K9N A;  2M0M A;  3KLO A;  3X2Q H;  2Z2S B;  4CCK A;  4YIF A;  3ECH A;  2F4O B;  1SMY F;  5IOY A;  5EEA A;  2CQN A;  3H0D A;  4BE2 A;  4XN3 A;  2Z33 A;  2A07 F;  5FLX K;  1TNT A;  3HC7 A;  4UVA A;  4N9H A;  1QPI A;  1M1E B;  1I27 A;  4ZYG A;  3L2V A;  1PDN C;  2EJR A;  2YU3 A;  3KEO A;  4P96 A;  2H8W A;  2VJ5 A;  3K9T A;  5A2Q K;  1D0X A;  2NVY J;  2Q2E A;  1T08 B;  4F93 B;  2KIQ A;  1JJ8 C;  2WA0 A;  1LKX A;  3GTQ J;  4HNV A;  4WX9 A;  4ETS A;  2JA5 J;  4XMY A;  3BG6 A;  1TC3 C;  3DKX A;  5E8I A;  3DLA A;  3H35 A;  4F91 B;  1AU7 A;  3FBI B;  2DN0 A;  4HX8 A;  4L9V A;  5IP9 J;  1MNE A;  3B73 A;  4XRS G;  4YFK F;  1UAA A;  2L0K A;  3CTA A;  1TTY A;  2DPU A;  2X6W A;  2R7W A;  2LKS A;  2LK2 A;  4CGZ A;  4UUV A;  4GYG A;  4RB2 C;  1ZHF A;  3CLO A;  3HEF A;  2IGO A;  2JRM A;  3HL2 A;  3HOU J;  3CP8 A;  3M3Y J;  1ODD A;  3ZMU A;  1Z3X A;  2W84 A;  2XPW A;  2ZFW A;  1HQC A;  1ORK A;  2V1X A;  2KJC A;  2LDU A;  1R1U A;  4IOC F;  1T0F C;  2E2H J;  5BQT A;  3D0S A;  2E36 A;  2JUC A;  2OZU A;  3OYB A;  3GF2 A;  1FBS A;  3A4C A;  3HTU A;  1MMN A;  1B9M A;  2WTE A;  5CQE A;  3HRS A;  5GAG J;  3WTW C;  2I8D A;  2ZJP F;  2ZKZ A;  2AQE A;  3DBR B;  3U21 A;  2VE8 A;  4YG2 F;  3LSP A;  3FIS A;  2L02 A;  3O6B B;  2LBF A;  1I1S A;  1B72 B;  1J9I A;  1MIJ A;  2LF7 A;  1VQM I;  3GWZ A;  1WQ2 A;  2VBW A;  4OIR F;  4E4H A;  2NVQ J;  5IT3 A;  2E5N A;  2OUM A;  3CZ6 A;  3Q9V A;  3BOQ A;  4RA2 A;  2BYV E;  1VQ8 I;  2M3A A;  2R0Q C;  3FDY A;  1DU6 A;  3OYK A;  2R7U A;  2CFO A;  1XC5 A;  5E1W A;  3BJ6 A;  1HDP A;  1MH3 A;  4AUX A;  3KE2 A;  5LGN A;  2G9W A;  4UB8 C;  3LOC A;  1YX5 A;  2XIG A;  1UMQ A;  4A3K J;  3SQN A;  4BY1 J;  2RGV A;  1BI3 A;  1WHU A;  1Z3Y A;  4R1H A;  5HLH A;  3OV8 A;  1Y1V J;  4XRF A;  3FMQ A;  1BR1 A;  3R0J A;  1XMK A;  4EM2 A;  3FXR A;  2QYO A;  4MQV A;  3F9K A;  5DM7 F;  5L3B A;  1RR8 C;  3CUQ A;  1HST A;  5ILU A;  1U5T B;  3DPU A;  4I09 A;  3SEZ A;  1SC7 A;  3I64 A;  3GCM A;  3GBG A;  1S5L C;  2J5O A;  2CYY A;  1GVJ A;  2JVH A;  3K1P A;  2KT0 A;  5J8C A;  2H1L A;  3FKJ A;  4MTD A;  1RIO H;  2L7M P;  1FSH A;  2Q0O A;  2K9L A;  1FOX A;  3HXL A;  2YS9 A;  3FF5 A;  4NB5 A;  1XDS A;  3GZ5 A;  3R6S A;  5LHH A;  2HXI A;  4U0W A;  1VQO I;  2R7S A;  2V6C A;  2DA7 A;  4BH9 A;  1J7K A;  1Z77 A;  5DEQ A;  3T5X A;  4E7L A;  1E3P A;  4A3D J;  1F9N A;  4PJM A;  3DLL F;  1SEU A;  4C2T A;  4KIS A;  1WRJ A;  2YX7 A;  3AAF A;  1B9N A;  2GIV A;  4LK0 F;  4IHX A;  1OLT A;  4JX5 A;  1UFM A;  1U78 A;  3F3X A;  1QVU A;  2A6E F;  1MGT A;  4AVP A;  3CF2 A;  3K1N A;  4MGR A;  4RMN A;  1X19 A;  2HOA A;  4XRS A;  5CVJ A;  1P4W A;  4XID A;  3TP3 A;  1Z21 A;  2LOO A;  2CV2 A;  1ONV A;  1S6L A;  2XDV A;  4BXX J;  3DQV C;  3UR3 C;  3OS2 A;  2R3S A;  1USS A;  4ESJ A;  4RM2 A;  1W7P B;  2VBY A;  2L4M A;  3H3U A;  4WXH A;  2EIK H;  3WTX C;  4XLF A;  2DJN A;  3NWS A;  3H92 A;  2O8X A;  5AIP A;  3RI4 A;  1VQP I;  4Q48 A;  1WWX A;  3IKV A;  4IRH A;  2Y48 A;  3AL0 B;  3IAS 2;  4BYY A;  4I98 B;  4YEJ A;  2D5V A;  2FRH A;  4HDU A;  4P5O A;  1K4S A;  2AXT C;  2B63 J;  4Q4Z F;  4KUM A;  5M3F J;  4KMU X;  5KNL A;  3S2D J;  3RKW A;  3HTS B;  3KPH A;  1Z1D A;  1FTZ A;  1ZYR F;  2K85 A;  4BU2 A;  4ZDL A;  4U7D A;  4JBA A;  1FY7 A;  1ON1 A;  2DYR H;  2MA3 A;  2F48 A;  2BXY A;  1XB4 A;  5FRN A;  1O57 A;  1BI0 A;  2P5L C;  3GME A;  4O6J A;  4HOB A;  4Z2Y A;  4BEH A;  1I50 J;  3N97 A;  3F8M A;  3E7L A;  4IEJ A;  2K9S A;  3FXJ A;  4OMZ A;  1BW6 A;  1QGP A;  2HKO A;  5FKL A;  3PQJ A;  4IF4 A;  4BDZ A;  2GBY A;  2CQX A;  5FGM A;  4HRI A;  2DDB A;  3TP0 A;  2ZSI B;  1ITY A;  3H3V K;  1ZAO A;  2W25 A;  5JVG F;  4NC6 A;  4MEX F;  3E5U A;  3PJR A;  2XVC A;  2JA2 A;  1ZH5 A;  2XUB A;  1BBY A;  2E19 A;  2YX4 A;  2BY0 A;  3H5N A;  2XHK A;  1AKH A;  5M5X J;  2P81 A;  1YS6 A;  1MNM C;  4M3D A;  2ICW G;  4DYQ A;  3WU2 C;  3PQK A;  3H9Q A;  3BPX A;  3CES A;  2QSH X;  2CW0 F;  2HEO A;  2L7Z A;  3CO7 C;  2WAD A;  1MMG A;  3F22 A;  3CMM A;  3G1L A;  4HPQ A;  1OYI A;  3HRU A;  2KIU A;  3ASN H;  4Y3O A;  3BTC A;  4BAC A;  3HSE A;  2DMP A;  2CS3 A;  1F4K A;  2RRE A;  1RUN A;  3K1M A;  4A6D A;  4IHT A;  4P9U A;  5JHU A;  2JVG A;  3H9J A;  1VQ7 I;  3DBL B;  1X1C A;  3OR2 C;  3PNY A;  3KEY A;  2E35 A;  5EJC A;  2L9R A;  2BY3 A;  4JP0 A;  1EA3 A;  1FJL A;  1K6O A;  1MMS A;  2KIF A;  3RTR A;  4A3L J;  1PUF B;  1RPW A;  3QYB A;  1J09 A;  5IP6 A;  5J40 A;  1IXS B;  4LIU A;  2QM3 A;  3E0J B;  3OWT A;  4BUP A;  5ILS A;  2HQN A;  2BHY A;  2Y75 A;  1UHM A;  2M2E A;  1UZC A;  3R61 A;  3SXY A;  5F0H A;  1R58 A;  5K7Z A;  2IJL A;  4DQ2 A;  5LBQ A;  1G3T A;  3KYL A;  4EVI A;  1QA6 A;  1JGS A;  3QYE A;  1YFH A;  3B6A A;  1YX3 A;  2HPM A;  2DTR A;  5LEJ A;  2A68 F;  1R5H A;  1HKS A;  3G1M A;  3CJR B;  2KQR A;  2VLA A;  2EA2 A;  2YSR A;  2ZME A;  4YIR X;  1LUJ B;  4XQF A;  4PCQ A;  2PJP A;  4E7J A;  1SAX A;  3S1N J;  2XAF A;  3S93 A;  2K02 A;  4U0Y A;  4XBF A;  5GPA A;  5CJ9 A;  3SHF A;  3K6G A;  2M45 A;  4NQW A;  1ETW A;  3OYI A;  2VQL A;  3FHN A;  3VWB A;  3IH4 A;  2VOD A;  4E7H A;  3IRQ A;  2EIM H;  1APL C;  3BT9 A;  3FXQ A;  4DIQ A;  3JW4 A;  4I7H A;  5DCF A;  4UY8 I;  1ZGW A;  3UKG A;  4XOR A;  1XSV A;  3HKZ A;  3A01 B;  1QBJ A;  5DS9 A;  5ICC A;  4HQE A;  1MD0 A;  3OSF A;  4MO7 A;  3AL0 C;  2VPL A;  2EIL H;  5DUI A;  4MFD A;  3MEX A;  1R00 A;  1LDK B;  1P6R A;  2VBX A;  2FSW A;  4DW6 A;  2LKP A;  4XN0 A;  1ERD A;  3KYD B;  3WE3 A;  2EK5 A;  2O6G E;  1O7F A;  2E1M B;  4HW0 A;  4HLY A;  4C2M J;  3HRM A;  3IH3 A;  4IRG A;  4GFB A;  1IAW A;  4A93 J;  4HYE A;  4EGZ A;  5D5U B;  1DUX C;  5H20 A;  1U9N A;  4BE0 A;  4F55 A;  1MMD A;  1OMI A;  1TL8 A;  1D1A A;  4KMF A;  4XKB A;  2A5Y B;  3EET A;  4A5N A;  4EEF G;  5IOZ A;  3A2K A;  3BG9 A;  3DU5 A;  1HCR A;  1TW2 A;  5HLT A;  2H8R A;  1ETK A;  3DTI A;  1V54 H;  2E1N A;  1X4P A;  3HOW J;  1UCR A;  2HQA A;  5HDK A;  2KJB A;  3LNQ A;  1YRN A;  2R5Z A;  2NS0 A;  3K4J A;  1Q1H A;  4L5I A;  3S2W A;  3L09 A;  5E18 F;  2OJE D;  3K4C A;  5IP7 J;  1OIS A;  1BIA A;  3MD2 A;  1WCM J;  1T56 A;  1JKP C;  2IT0 A;  2QF7 A;  2ISZ A;  1EH8 A;  3HSF A;  3P7N A;  2HYJ A;  5B1B H;  5J1U A;  2KIM A;  4UVC A;  3DPL C;  1LB2 A;  2EV5 A;  3PUF A;  5M5Y J;  3V7R A;  2DU9 A;  2A3S A;  2DDA A;  3LSM A;  1WSU A;  5IT9 K;  3OSG A;  1MBG A;  4C3I J;  3GZN B;  4EJV A;  1X1P A;  1LFB A;  2CW8 A;  2LMD A;  3GTM J;  4RB1 A;  4EM1 A;  3HOS A;  2NVT J;  2G7H A;  2GOX B;  3S14 J;  2J5P A;  1B8I A;  1LNW A;  4ZZD A;  1A5J A;  1G3S A;  3ECO A;  3BDD A;  4PJJ A;  4RS8 A;  1OR7 A;  2Z5U A;  4AU7 A;  4JX4 A;  4ZJZ A;  1AWC A;  2BHZ A;  2YR2 A;  1BM9 A;  3C3W A;  3JSO A;  3KZZ A;  3MCZ A;  2X6X A;  5FRM A;  3EQL F;  1MW7 A;  2HZT A;  3PUB A;  1VFC A;  2Z3Y A;  2XAQ A;  2QBY A;  2KDZ A;  2MH2 A;  3ZQQ A;  4D7N A;  3EUH C;  4C9Y A;  5GAE J;  1ZG5 A;  3IL2 A;  5LD2 C;  3GX4 X;  4BE1 A;  3LSR A;  3WU1 B;  3J7Y J;  1IF1 A;  1SD5 A;  2Q2E B;  2EQR A;  3R0A A;  4HNT A;  1FX7 A;  3ZQF A;  1A31 A;  4EQQ A;  1YJN I;  5ILV A;  2LP0 A;  3I59 A;  5H6R A;  5LEK A;  3OYH A;  2DOA A;  1FBQ A;  2LY1 A;  3TW7 A;  3J7A Y;  1ETY A;  5K5R A;  1ENH A;  1X3U A;  3EUH A;  2RDP A;  4XON A;  3H36 A;  4KNY A;  1ETO A;  4HNU A;  4G7H F;  3MVP A;  1A04 A;  4BDY A;  2QQB A;  1X1A A;  2HFH A;  2VOO A;  1H89 C;  1X4O A;  2JSP A;  1OKR A;  1ETQ A;  3KZI C;  3M1C A;  4RAZ A;  3OL3 A;  3RYR A;  3LA7 A;  1Y1W J;  1ZAR A;  2LRE A;  2ZSH B;  3K4M A;  5GAH J;  1GT0 C;  2DA6 A;  5D4S A;  1EH7 A;  3HOZ J;  1YS7 A;  4LLL A;  1PYV A;  1QHG A;  2OAZ A;  2E60 A;  3GTJ J;  1O3R A;  4HST A;  5FRO A;  3CJT B;  3CCQ I;  3FXM A;  1JT6 A;  2DLL A;  5BNG A;  5K1Y A;  2VPR A;  5GPC A;  1MJA A;  1FC3 A;  4FHT A;  1YOV B;  2V1U A;  2MBF A;  3BG5 A;  2QSF X;  2DTZ A;  2L01 A;  2X1D A;  2E1M C;  4CZC A;  1WFX A;  1I39 A;  2LBF B;  2KIS A;  2XV4 S;  1S8N A;  1LDD A;  4PSW A;  1IDZ A;  3LSI A;  3OYC A;  3RZD J;  4ENN A;  2KP6 A;  2M7B A;  3O8G A;  2ELK A;  5DYM A;  1HC8 A;  4XOP A;  1W1W E;  1S3J A;  1RKW A;  4LGW A;  2E2J J;  1XSX A;  3LMM A;  5CYV A;  1Y56 A;  1ETV A;  3D5L A;  3EUK L;  3K0L A;  3I55 I;  2KRF A;  3ZQ7 A;  3EYI A;  2CRG A;  3BZK A;  4RB3 C;  3JRI A;  5EF6 A;  2XSD C;  2EBI A;  3P5J A;  3TGN A;  2DK8 A;  3KP3 A;  5CVI A;  4WF2 A;  1WJA A;  2XSJ C;  5BOX A;  4GRI A;  4NUB A;  1KU9 A;  1D1B A;  2E1C A;  2JMW A;  3CUQ B;  4JOM A;  3PIO F;  1DDN A;  2VC1 A;  1D5Y A;  5AIQ A;  2XRN A;  3E6M A;  4HLX A;  4OAY A;  5D5W B;  4GO1 A;  4ZDO A;  1T33 A;  1WGX A;  4LB5 A;  1BW5 A;  1FMW A;  2E7X A;  1Z7U A;  1I1G A;  3M9A A;  1HDD C;  2IGN A;  4XLA A;  4A0Z A;  1R4N B;  4I99 C;  4KIB A;  3EDP A;  1KGS A;  4A3M J;  1O3T A;  5CQG A;  3QPT A;  4W97 A;  1K78 A;  5C4X J;  4K2E A;  3TW6 A;  3BCB A;  4RGR A;  3F0C A;  2JZY A;  2PG4 A;  1K79 A;  4AWX B;  3GZ6 A;  3HOV J;  3BR1 A;  2IA1 A;  5B3S H;  4FX4 A;  2ME0 A;  5J4Y A;  2KKO A;  2K27 A;  1MSE C;  1IUF A;  3L2W A;  2LNB A;  3BRO A;  1XMA A;  4OU0 A;  1MBJ A;  3DFG A;  3ZQG A;  5FKM A;  3CP2 A;  2E34 A;  3J80 K;  5HOD A;  3K4K A;  5FD5 A;  2W1O A;  3B02 A;  3RQ4 A;  2YU9 J;  4BQA A;  1H9T A;  1YW7 A;  4PGH A;  4GGG A;  2NXN B;  4WXC A;  3TQN A;  3S1Q J;  1TWA J;  1T8I A;  5JHF A;  3E6C C;  1EH6 A;  3DV8 A;  4YII A;  3OIQ A;  4NHJ A;  4X1E A;  3LQR A;  2CUZ A;  2DA5 A;  5DM6 F;  3CCS I;  4B48 A;  2M4K A;  3NQO A;  2WWY A;  3LSG A;  2P0W A;  3TDU C;  3VFZ A;  2CSO A;  5GTH C;  2OTJ I;  2GA2 A;  3HGY A;  4LB6 B;  2MD0 A;  5DUK A;  5LFA A;  5FKN A;  3ONQ A;  1J75 A;  1NG6 A;  3FXK A;  2HYG D;  3OYF A;  1VZ0 A;  4HBL A;  4CA0 A;  1UHW A;  1PP8 F;  4JX6 A;  3QRF F;  4N4N B;  4CCO A;  3DP7 A;  3QPS A;  4M6Y A;  2Y0M A;  1YIO A;  2ZO4 A;  2R7F A;  1F5T A;  3FWE A;  5FJ8 J;  3VYS B;  2BVM A;  3IC7 A;  4BEH B;  4HV5 A;  4OIO F;  3BC8 A;  1VQL I;  3CDI A;  1TW3 A;  2O0Y A;  4E7K A;  2IGM A;  2Y2Z A;  2LF8 A;  3PM1 A;  1BI1 A;  2VJ4 A;  3ZOB A;  1ZN2 A;  4G6D A;  2AO9 A;  3P9I A;  3DF8 A;  1R71 A;  4L9J A;  2W82 A;  3ABL H;  1DPU A;  1AKH B;  3G2B A;  2G7U A;  5EGO A;  2FOK A;  1R7J A;  2VIX A;  5KAI C;  2EA4 A;  2EFQ A;  2KLO A;  5CLS A;  1Y6I A;  4LK1 F;  4LG3 A;  3VEP A;  3VPR A;  4CUG A;  1W5S A;  9ANT A;  5C4J J;  3KET A;  3BZC A;  1RET A;  5ICG A;  1IZ1 A;  1U0J A;  1EJ9 A;  4G94 A;  3PSI A;  2RC4 A;  3IP4 B;  3MKW B;  1ZG1 A;  4NBQ A;  4RLQ A;  3CUQ C;  1QZZ A;  2ZJR F;  1UG2 A;  3WTS C;  2N8G A;  1VND A;  2XB0 X;  3LQQ A;  1EF4 A;  1R4M B;  2BVL A;  4XL9 A;  4IQ4 A;  2VXD A;  1ZRD A;  1JGG A;  5F6F A;  1Y8Q B;  1VQ5 I;  3SFI A;  1Y0N A;  3K4N A;  4RM3 A;  4M72 A;  2NS8 A;  1YQA A;  5E3L A;  1U8B A;  4HF1 A;  4I6Z A;  2UWM A;  2M1B A;  4E7I A;  2BY2 A;  4II2 A;  4PGG A;  4RGU A;  2GLO A;  2LSO A;  4U0V A;  1XGN A;  1KA8 A;  4B44 A;  2UV1 A;  4H4K C;  3S3N A;  1FT9 A;  5CKT A;  3KZY A;  3CJQ B;  3J7A O;  2HXO A;  2P5V A;  2XAJ A;  4M9X A;  3S1M J;  2BW3 A;  3GFJ A;  1JKO C;  5H6Q A;  1T98 A;  1DP3 A;  2V1N A;  3PIP F;  3JRD A;  1CF7 A;  2ZME B;  4KN4 X;  4PDK A;  2W00 A;  3W2A A;  2HVS A;  2L9S A;  1MMA A;  2QSG X;  1WH5 A;  1ZRC A;  3WGG A;  2FF4 A;  3VOE A;  4NQW B;  2HWV A;  1XX5 A;  5IT9 Z;  3KP6 A;  3KP7 A;  3OIP A;  1BC7 C;  2CV1 A;  4KFC A;  3AG3 H;  1IRZ A;  2X1E A;  4ZZL A;  2DK5 A;  2WY7 Q;  1S7A A;  2MC4 A;  5BPI A;  1WPK A;  3GTP J;  1BN5 A;  4LJZ F;  5E1X A;  2PMH A;  2DA2 A;  2R7Q A;  2QEX I;  2QKM B;  3HHG A;  3NAR A;  2F6C A;  1HW5 A;  4U87 A;  2R7O A;  1TT0 A;  1FYK A;  4M73 A;  5J1Y A;  3OYD A;  2EV6 A;  1WI3 A;  1TWC J;  2F5E A;  3WTT C;  4IHY A;  3FBN B;  3U9G A;  3HJE A;  1WJC A;  2RAE A;  1XCV A;  2Z9O A;  1MND A;  2LLK A;  4I2O A;  2R93 J;  4EJO A;  1P2F A;  2PX9 A;  2L2O A;  2JA6 J;  3DEW A;  4D1Q A;  3GYH X;  5TIS C;  3CCV I;  5HS9 A;  3BQZ A;  2QEN A;  3UNG C;  2PMZ A;  1BIB A;  1FWZ A;  2IXS A;  2KPM A;  4LLG F;  3V8J A;  2TRT A;  1ZR4 A;  4I76 A;  2FUG 2;  5E1Z B;  2VQC A;  3VYT B;  2QQA A;  2E2I J;  2QQ8 A;  3RJP A;  3C1D A;  1LQ1 A;  4XLN F;  1WJF A;  3HSR A;  3ISP A;  5IYD J;  1IN4 A;  1QO0 D;  1XMX A;  1BOA A;  3OR1 C;  4QPQ A;  1NK2 P;  5KHD A;  3B6C A;  2NVX J;  1AOY A;  4G7Z F;  1YRN B;  2VB6 A;  1GV5 A;  1YO5 C;  2OPT A;  4N9I A;  2R5Z B;  2PMU A;  1POG A;  3W3C A;  2JQ7 A;  1MKM A;  1QU3 A;  1JTY A;  1MH4 A;  1QPM A;  2GA1 A;  3R4K A;  3A0H C;  5IPA A;  1N78 A;  5LHI A;  4IO9 F;  3K2Z A;  2ESH A;  5L3G A;  3NWT A;  3OS1 A;  5LRS A;  1CGP A;  1T6S A;  4I02 A;  3RQI A;  2QGU A;  1EKE A;  1TQM A;  2A69 F;  4UVB A;  4IQJ A;  4OMY A;  3W6K B;  3D5S C;  1OCC H;  2M5W A;  4BAY A;  1RNL A;  4ZDP A;  2M8E A;  1X3Z B;  2O3F A;  3L2Q A;  4A3I J;  3PO3 J;  5TGT A;  1ON2 A;  4OOI A;  1REP C;  1MDM A;  4MEY F;  2R4G A;  3HKZ N;  1B8I B;  4OIQ F;  4HSR A;  1EV7 A;  5LGU A;  3SEQ A;  4M9Z A;  1ZLJ A;  1TWG J;  2GQQ A;  3A03 A;  2GXA A;  2HYF A;  4L0Z B;  1GVD A;  4AIH A;  4BHC A;  3GTO J;  1RI7 A;  1KU3 A;  4W1U A;  2STT A;  2XF5 A;  5C44 J;  2CO5 A;  1P7J A;  2EIN H;  3V8L A;  1T39 A;  2EFN A;  2QBY B;  4LG0 A;  4CDG A;  1BOB A;  2MW8 A;  2W24 A;  4D5C A;  4IJA A;  4PJL A;  1W36 C;  3IKT A;  2VKH A;  3JAM K;  1WKM A;  1UJ8 A;  4CO8 A;  3RZO J;  2HDW A;  2Y69 H;  4O5V A;  2IAI A;  5IY5 H;  2R7T A;  3CC4 I;  4F52 A;  1PP7 U;  3I59 B;  2VUM J;  5LRR A;  3AFH A;  2W57 A;  2VI6 A;  2ZME C;  1W5T A;  3KP4 A;  4BXU A;  3KP5 A;  4CCJ A;  1SD7 A;  1RZ4 A;  4BJT A;  4A3C J;  3ZMD A;  1KU7 A;  5HNF A;  4H0E A;  2UXN A;  1JKQ C;  4U88 A;  3W6J B;  2VKE A;  3EYY A;  3PSF A;  4Q5S F;  1ZEL A;  2ZBK A;  3ABU A;  2FXA A;  4BHP A;  2F5D A;  5AON A;  4P1W A;  1VTN C;  3BPV A;  2JUG A;  3W2V A;  4M3E A;  1R6R A;  2KRC A;  1QZY A;  4A5M A;  3L2R A;  3ZMV A;  2DBB A;  3K70 C;  1O7L A;  2RNJ A;  5B5E C;  4CXF A;  1DGW Y;  1OJL A;  2ZNZ A;  3BG7 A;  2XGC A;  4A3B J;  3I0T A;  3HGG A;  3I58 A;  3WOD F;  4LIV A;  1MBH A;  5DD4 A;  4ZTJ A;  4BJ5 C;  3TOA A;  2OTL I;  2Z99 A;  3J80 Z;  1Y0U A;  2PEX A;  4F92 B;  1JT0 A;  1MJB A;  2NOG A;  2WV1 A;  2EFP A;  4EJW A;  5HNH A;  3LAJ A;  2EZK A;  4GCV A;  1K6Y A;  1YE9 A;  2I10 A;  1H8A C;  2MC3 A;  5D5X B;  3OYN A;  4IRI A;  3KFW X;  3WE2 A;  3FK7 A;  1MBF A;  1RC9 A;  1SMT A;  1W36 D;  2DT5 A;  5J1R A;  2EV0 A;  2XKP A;  3CQZ J;  4G8X A;  4ZYD A;  1LFU P;  3ULQ B;  1Z6R A;  3CC7 I;  2BBY A;  5EG0 A;  1IXC A;  3FXO A;  3TL4 X;  4A6E A;  1VQN I;  2L4A A;  5FLX Z;  3EPZ A;  3M8E A;  4CYC A;  3RPU A;  3BTJ A;  2M4G A;  4IHV A;  1GXP A;  1J2X A;  2P7V B;  2CGP A;  4UB6 C;  2DMN A;  3AG4 H;  3CCL I;  1O4X A;  2QCO A;  5C3E J;  1GV2 A;  2CQQ A;  4LOC A;  3OYG A;  3F6V A;  5A2Q Z;  2Q1Z B;  2GIZ A;  3CDL A;  3CME I;  3SZP A;  3VSK A;  2XAG A;  4EV0 A;  2XF6 A;  2P6S A;  5E3N A;  4ENJ A;  3HM5 A;  2OQG A;  4IL6 C;  4FAS D;  5TRD A;  1Z0X A;  1VF9 A;  3WTZ A;  4AYB A;  1I5Z A;  4L18 B;  5FFZ A;  4UNO A;  4OIN F;  2ID6 A;  3ZXS A;  1K61 A;  2CJJ A;  1R5I D;  3QOE A;  3GFM A;  2Z1D A;  3WGH A;  3ZPL A;  3F8F A;  2CG4 A;  3ELK A;  1K78 B;  3K70 D;  1WVR A;  4RGX A;  2DMT A;  1S29 A;  1D0Y A;  4XM3 A;  1FLI A;  2VOP A;  5EZG A;  3V4G A;  3I9V 2;  1ZGJ A;  3WHC A;  3CMY A;  3FHZ A;  2XRL A;  1XGM A;  1R5G A;  2LYC A;  2OBP A;  3EUA A;  3SDB A;  4S04 A;  3ZR8 X;  2VQH A;  2YPR A;  5GAD J;  1OR7 C;  2BV6 A;  5HDG A;  4XLE A;  2H94 A;  4UXN A;  1X1B A;  5D8L B;  5DV5 A;  2DJI A;  1NG7 A;  3GEZ A;  1O3S A;  1KU2 A;  2OC6 A;  3F6O A;  4AC0 A;  5FKO A;  3A0B C;  5JR3 A;  1JHF A;  2PLY A;  4QTR A;  4IPA A;  4QIW N;  2K3F A;  4JYK A;  1MBK A;  1STZ A;  3PFY A;  1BJA A;  4EAT A;  5CVU A;  2LD5 A;  2KRH A;  3HOX J;  4B3X A;  4UHT A;  1ULY A;  1ZGA A;  2GAU A;  3BWG A;  3KYC B;  1IUY A;  2QZ8 A;  4O3M A;  5IYB J;  3JTG A;  3Q0W A;  3Q0U A;  2EIJ H;  1B59 A;  2OU2 A;  4EGY A;  1N77 A;  3HBL A;  4IHS A;  3QPH A;  1XSD A;  4I0A A;  1R9T J;  1SFX A;  1FPQ A;  1WJE A;  5CVR A;  5E3O A;  1IN5 A;  5JLX A;  4P9F A;  1IO2 A;  2BE5 F;  2VKD A;  2DO7 A;  3J7Z I;  1Y39 A;  5E8G A;  3T1B A;  5D5V B;  2DCE A;  4FTH A;  3HRT A;  2K3P A;  3LSH A;  4CCN A;  2X6Y A;  2PN6 A;  1R22 A;  3ZP5 A;  1Y8R B;  4PJN A;  1F36 A;  1LEA A;  2FQ3 A;  4KIC A;  2IRF G;  2NNY A;  2EB7 A;  5DDG A;  3M7G A;  3I71 A;  3HZJ A;  2L5Q A;  2HPI A;  4PUS A;  2WC2 A;  1A35 A;  2E7W A;  2X9D A;  1HBX G;  3LL7 A;  1KYW A;  2FML A;  1HXD A;  4AIK A;  4DGW B;  1GUU A;  2CUF A;  4Y15 A;  2FEZ A;  2WAQ A;  3IHU A;  2GZW A;  2ISY A;  4HX4 A;  2ZFU A;  4M9S A;  1GLN A;  4BKX A;  2OQR A;  1TNS A;  2LH9 A;  3JCU C;  1V5E A;  3SYT A;  3JRA A;  2R7X A;  1B1B A;  3VB2 A;  1SVM A;  3MKL A;  4HG2 A;  3ZN0 A;  3ABT A;  5EGO B;  2R7V A;  2DOD A;  1XG1 A;  2EZI A;  3KX2 A;  1Z7L A;  2B0L A;  4CCM A;  4MHG A;  1IXR C;  1W0U A;  3U2R A;  3DPT A;  1HW2 A;  1B4A A;  3F8C A;  5M5W J;  3HG9 A;  1IV6 A;  2DOF A;  2V9K A;  4CSW A;  1IN8 A;  3LST A;  3NEU A;  4BXF A;  1P9Q C;  4X6A J;  2MGQ A;  5GP9 A;  4AIJ A;  2LRD A;  1HF0 A;  1Z6T A;  2COB A;  1OCR H;  5GTI C;  2TCT A;  2W85 A;  4G6T B;  2WBM A;  4UUT A;  4J19 A;  2MAB A;  3JTH A;  4LD5 A;  2EH3 A;  2BOL A;  3FM3 A;  4Y7N J;  1AA7 A;  1X58 A;  3Q5F A;  3RYP A;  3L00 A;  3M07 A;  2JA8 J;  2XAU A;  1JE8 A;  2PI0 A;  2FU4 A;  3QP5 A;  1D1C A;  1T2K A;  2M8G X;  3DXJ F;  3GLX A;  2VJJ A;  2PFB A;  2O9L A;  1LVK A;  2BW3 B;  3ZQC A;  3S32 A;  5L3C A;  2CV0 A;  1LJ9 A;  5J47 A;  4KJZ A;  1X2N A;  2M34 A;  3RPQ A;  4FE7 A;  1CF7 B;  2P7C B;  4C3H J;  3GTG J;  3FIW A;  2M87 A;  4FET A;  3RIR A;  4KT6 A;  2NOJ B;  4EM0 B;  3OMY A;  4DZJ A;  3N4M A;  2A6T A;  1IGN A;  3A02 A;  2ZXI A;  4A2U A;  2KDO A;  2H09 A;  2RKH A;  4M6X A;  2FJ1 A;  2Y9Y A;  5JLW A;  3AKZ A;  3S3O A;  1MSF C;  5E3M A;  3S2H J;  4KIT B;  4ENK A;  2FQ4 A;  4Y4R A;  2R5Y A;  1QRY A;  2LTP A;  2EFO A;  1TZL A;  3F8B A;  3K4B A;  2QQ9 A;  2K9Q A;  3S1R J;  3FZV A;  4Z6Y A;  1FSE A;  4HV6 A;  1BC8 C;  4AVZ A;  1V5G A;  2FMY A;  3QOD A;  2Y0S A;  5F1J A;  5LHG A;  3HHH A;  1TQI A;  1ZG3 A;  4ANJ A;  1W5C C;  4XKV A;  5E79 C;  3CCE I;  5FFX A;  3PNV A;  1WI9 A;  3G6E I;  2ACJ A;  4WWC A;  3T8T A;  3OOU A;  2ZXJ A;  1L0O C;  5EDN A;  3I3L A;  2M9H A;  2AQF A;  3DKY A;  5DCM A;  3L9F A;  3NRV A;  2XGD A;  3QQA A;  5KAF C;  4G7O F;  3WHB A;  4YRV A;  3K2A A;  2X6O A;  1X1D A;  3GTL J;  3JAM Z;  3CCM I;  2VN2 A;  3ROU A;  3BJA A;  4FT8 A;  4GYI A;  4EMS A;  5F0F A;  4ENM A;  4BGD A;  3ZGK A;  3KEQ A;  2DPD A;  2KL4 A;  5E20 A;  4KT5 C;  3FM5 A;  2VT2 A;  3I4N J;  1D3Y A;  1TWF J;  1JHH A;  4B47 A;  2PJR A;  3H1C A;  4L9N A;  5LLQ A;  2EZL A;  2RNG A;  3PFI A;  4M3B A;  3H5A A;  2H27 A;  2XAS A;  2OZ6 A;  1IW7 F;  4XSX F;  2CUJ A;  2F2E A;  3LSK A;  3WGI A;  4KDP A;  5K5O A;  2ETH A;  1FTT A;  5F04 A;  1KON A;  4E7S A;  3MMY B;  4CHU A;  1FEX A;  2JN6 A;  4A0Y A;  3ML6 A;  1TQP A;  2P6T A;  1XPX A;  4PSX A;  2NAZ A;  4F7Z A;  1QQI A;  3P9K A;  4FX0 A;  3FMS A;  2XF7 A;  4NC7 A;  4ABZ A;  1SD4 A;  1YJW I;  1F1Z A;  3Q3S A;  1DGR M;  3CDH A;  2FA5 A;  4EJU A;  2D2W A;  3ABM H;  2R7Z J;  1LDJ A;  1VQ6 I;  3CO6 C;  4XIC A;  1LE8 B;  2K4B A;  2V6E A;  2MLK A;  3HIF A;  1TBX A;  4XRM A;  1XGS A;  3GTK J;  3D5R C;  3RKY A;  2DT6 A;  1R1T A;  1ETX A;  3BR0 A;  3TMO A;  1PVE A;  1QHH D;  2CFX A;  2M0C A;  5F0C A;  1FOY A;  2W4S A;  2BZT A;  2L3D A;  4DYR A;  4DYC A;  4E70 A;  1MDM B;  4XLH A;  5DD8 A;  2GXG A;  2MD5 A;  3GW2 A;  1RR7 A;  1YIJ I;  3QYF A;  1OYY A;  2JRT A;  2BGC A;  3RCO A;  3BY6 A;  2AHQ A;  1FIA A;  4DNC A;  1IJW C;  2LKX A;  4XSZ F;  5ERI A;  2K7L A;  4V19 K;  4XLP F;  4GDF A;  2UUZ A;  1ZRF A;  2EFW A;  3HUG A;  2P8T A;  4LG0 B;  2IVM A;  2E1O A;  1DP7 P;  2PMZ N;  1XN7 A;  4ZC3 A;  3TED A;  3M4O J;  4UUS A;  3IRR A;  3WG7 H;  5ICE A;  1OQY A;  2V4J C;  2DAO A;  1JKR C;  1KQ0 A;  2F5C A;  2VC0 A;  3FKI J;  1LEB A;  1KQ8 A;  3U1D A;  2VL8 A;  1U2W A;  3LA2 A;  4NC8 A;  1F43 A;  5LGT A;  4J01 A;  2GWR A;  1T0F A;  5FB2 A;  1ZLK A;  4DJA A;  1G6N A;  4HF0 A;  2K4J A;  3IUO A;  2L7K A;  4BJ6 C;  2DT7 B;  2X1C A;  5L3D A;  5HVQ C;  2DOE A;  4PFP A;  2Z16 A;  4PFO A;  3OY9 A;  1YLF A;  4BNC A;  2UXX A;  1Z9C A;  2XAH A;  3ZQL A;  1IN6 A;  4BS9 A;  1S7E A;  4CYD A;  3Q9S A;  4BQQ A;  4D7M A;  2A05 A;  3RKQ A;  1IRG A;  2E5Z A;  3DCF A;  2FBH A;  3R60 A;  5IYC J;  1XS9 A;  4JQF A;  2VAS A;  1BR2 A;  3GXO A;  3L1P A;  3LA3 A;  4ESB A;  1YHQ I;  4RB0 A;  4E6K G;  1A36 A;  3COA C;  1O3Q A;  1UEL B;  4RBO A;  1NK3 P;  3G1O A;  1FMV A;  2A61 A;  3LFK A;  4N0B A;  2FBK A;  3CF5 F;  3G71 I;  4L5J A;  5CPR B;  1C0W A;  2IPQ X;  3HPG A;  3VOD A;  3I4P A;  3M1E A;  3ZMS A;  5L3F A;  4DZP A;  1Z91 A;  4J00 A;  1IRF A;  2DW4 A;  3CUO A;  4L0Y B;  3T0Y A;  1BJZ A;  3QWL A;  1R23 A;  1XCB A;  1IG7 A;  4BL0 B;  2RVC A;  1K7A A;  4G6Q A;  2PBI A;  2HTJ A;  2IS2 A;  1W0T A;  1KYZ A;  1FIP A;  3M8J A;  1VQ9 I;  1OCO H;  2IW5 A;  4B4C A;  1E3H A;  1G8X A;  2ZXW H;  4HEA 2;  5EG0 B;  3ERE D;  3DWL E;  3FXU A;  1T95 A;  4CYC B;  2IS4 A;  4P55 A;  1QVT A;  1S9H A;  1YIT I;  2ESN A;  2JTV A;  2VE9 A;  3S16 J;  3MQ0 A;  4BBR J;  5KCM A;  1H88 C;  2KFD A;  4X0G A;  4KYW A;  2X0L A;  4HF2 A;  1ACI A;  1OPC A;  3IWZ A;  3CCJ I;  4LFU A;  2STW A;  4R8H A;  2JK3 A;  5EEG A;  3F72 A;  1VQ4 I;  2H6B A;  2M7A A;  5F64 A;  2JPC A;  3T8R A;  3ZMZ A;  2L9V A;  3CCR I;  4ZH4 F;  2O5R A;  3HYI A;  1U9O A;  2RQP A;  1G4D A;  3FX3 A;  1RES A;  2DMU A;  3O8H A;  2HR3 A;  2XB5 A;  4G12 A;  2L7F P;  3J81 K;  2KHM A;  1OCT C;  3LWF A;  3K4L A;  1XTA A;  3WTU C;  1S7O A;  4HDV A;  2NVU B;  1FYM A;  4CZZ A;  3JRF A;  1D8J A;  3DEU A;  4S05 A;  1W4M A;  5H2F C;  4RLF A;  2NNN A;  2Y30 A;  1IC8 A;  2JWT A;  3WG9 A;  1YYV A;  3ZCO A;  3BQY A;  4PJ0 C;  3V7C A;  5EYR A;  1V55 H;  3ERM A;  3LAP A;  2ID3 A;  2JSC A;  1LE8 A;  1BA5 A;  2OF7 A;  4NNJ A;  2EZH A;  1LPQ A;  1U6G A;  2CMP A;  3MZH A;  2B9S A;  5D6F A;  3MFK A;  1TLH B;  4AID A;  1YG2 A;  4QSH A;  3Q0V A;  1OCP A;  2JJ7 A;  2VT3 A;  3TO7 A;  5BS6 A;  2GOM A;  2F4M B;  3OYL A;  1DU0 A;  6PAX A;  3BR3 A;  3V42 A;  1FNN A;  3L7W A;  5CVV A;  1JI8 A;  2KZV A;  3LFU A;  3SJM A;  5D8K B;  3QP6 A;  3GFI A;  3KLN A;  2XGX A;  2HGC A;  4RAG A;  1A6I A;  4S0H B;  5FD6 A;  1UHS A;  2K9M A;  1J5Y A;  3I56 I;  1RRJ A;  3L2C A;  3S8P A;  1GHC A;  2KMU A;  3LSJ A;  2O61 A;  2FNA A;  3VYU B;  2PQ8 A;  3H0G J;  4ZYA A;  3WU0 A;  3E3V A;  3VDX A;  4N4O B;  3ESW B;  3REO A;  4HAM A;  4LIT A;  3HPH A;  2HNH A;  2KZG A;  1V5F A;  2CU7 A;  4UV8 A;  1A6Q A;  3JRE A;  2VKV A;  2HQ5 A;  2HTS A;  2BEO A;  5TJJ A;  2DQR A;  2V79 A;  3H5R A;  4C3J J;  1S72 I;  4ASN A;  4CIC A;  5ED4 A;  1SFK A;  1B72 A;  3DBH B;  2K5C A;  3WTY C;  1RKT A;  3NAU A;  2FD5 A;  2Y31 A;  3WTV C;  4OIP F;  4AYB N;  3ZRG A;  3MAJ A;  2NRA C;  1FOK A;  3VYR B;  3C18 A;  4EJT A;  2H6C A;  1V3F A;  3MKY B;  2HVQ A;  3ABK H;  2K86 A;  1U5T C;  1IDY A;  2HDD A;  4L9T A;  1P4X A;  1SAN A;  1QZE A;  2LG4 A;  4CCL A;  2HOS A;  1D5V A;  1JXS A;  1B6A A;  4M71 A;  4ESF A;  4V2G A;  4KN7 X;  2ME6 A;  2G0E A;  3L2U A;  4ZYH A;  3N05 A;  3BG3 A;  3G4S I;  1NH3 A;  1FZP B;  4A12 A;  4II3 A;  2DFH A;  1WZ2 A;  4IHW A;  1E17 A;  3JRB A;  4A3J J;  1I6H J;  2V7F A;  2CUE A;  5K7F A;  2ZXH A;  3GFL A;  5HDN A;  2XPV A;  1Q1V A;  1U5T A;  4XK4 A;  4BQN A;  1H9G A;  3E6D A;  2YUS A;  3JRH A;  2VON A;  3OYA A;  4PK4 A;  2E71 A;  2JPB A;  4I01 A;  2DFE A;  2IS1 A;  3U1K A;  1G3W A;  1T38 A;  2MSY A;  5J8F A;  2GXB A;  4ON0 A;  3DTK A;  3I54 A;  1I3A A;  2V26 A;  1UST A;  2JT1 A;  4RDU A;  2EPF A;  4E7Z A;  2ELH A;  5HLI A;  2LY9 A;  2OD5 A;  1YTY A;  3BJO A;  1HSJ A;  1TT5 B;  1K83 J;  4Q47 A;  2BY1 A;  1Z05 A;  3KIO A;  4HA8 A;  2VJI A;  4FE4 A;  2NYX A;  5KK1 A;  4RGS A;  3G3Z A;  4ZTF A;  5DTD A;  4BY7 J;  3IAM 2;  1YJ9 I;  4QLC U;  1H0M A;  2A6H F;  2I5U A;  2W7N A;  4XOT A;  3HB9 A;  2DA1 A;  1JUP A;  2WB1 N;  3PNT A;  4I0B A;  3GO5 A;  4KIG A;  1CQT A;  2QA4 I;  1JJ6 C;  5B66 C;  4F3Q A;  2F5F A;  4HZF A;  4XLC A;  2C6Y A;  2IA0 A;  3IV5 A;  1XD7 A;  4PZJ A;  4L5E A;  1W7P A;  2LR8 A;  4B3A A;  1SFO J;  2DA3 A;  2DMQ A;  2DYS H;  1N75 A;  3CD6 I;  3V8K A;  4MQ9 F;  1SAU A;  2O7O A;  2IEK A;  3SZG A;  2ZCW A;  3W2W A;  4A3F J;  3DU6 A;  2WAQ N;  4OAZ A;  1VQK I;  4MTE A;  4G9Y A;  1R49 A;  4DBR A;  1FP1 D;  4JK1 X;  3PL8 A;  4XKC A;  2IS6 A;  1NTC A;  2DA4 A;  4BQO A;  3D1N I;  2O03 A;  3W6V A;  1SFE A;  3RPU D;  1MJ9 A;  3F21 A;  2R5Y B;  4CH7 A;  1FBU A;  3PO2 J;  1ZKG A;  4LLN A;  2XPU A;  3MKZ A;  1ZR2 A;  4HX7 A;  2QVO A;  2ZJ2 A;  5JVT A;  1ZTR A;  3TO6 A;  4FIS A;  3IWF A;  1UB9 A;  2DXI A;  2B7E A;  2CW7 A;  2DFI A;  4IXA A;  4Y33 A;  2WAF A;  3QPL A;  2XGE A;  2HDC A;  4FQG A;  4Y52 J;  3ZMT A;  2L9N A;  4M74 A;  1MBE A;  2MLG A;  2VBZ A;  3S3M A;  3F23 A;  3BR5 A;  3OIO A;  2L54 A;  1W7P D;  3C2H A;  1WJ5 A;  2QKL B;  5DCM B;  1X2M A;  1I6X A;  4Y13 A;  3OYJ A;  3MZY A;  3BZ6 A;  3CMA I;  3HDD A;  5BPD A;  3CJN A;  3HOY J;  3C2G A;  4IX7 A;  3RKX A;  5E17 F;  2BXZ A;  2RQQ A;  2R92 J;  4B43 A;  1FP2 A;  4AD9 A;  2AXL A;  1KQ9 A;  2HVR A;  3QU6 A;  3E1S A;  2DQL A;  1OYW A;  2HS5 A;  4ITV A;  4D9J A;  4BBS J;  3S15 J;  2QWW A;  3H9G A;  3O2P E;  4C2U A;  4XR6 A;  2O8K A; 
#chains in the Genus database with same CATH homology
 4R79 A;  3K69 A;  2P4W A;  1U3E M;  5K5Q A;  5L3E A;  2DI3 A;  3F8N A;  2OA4 A;  5HS8 A;  1YW9 A;  3E97 A;  1GXQ A;  4WK8 F;  2QLZ A;  3QOP A;  2QUF A;  1R36 A;  3SFZ A;  3QAH A;  4MNU A;  1MZB A;  4WCG A;  1XGO A;  2CWE A;  4LMY A;  3SZT A;  2D45 A;  2X4H A;  2FNP A;  4QWQ A;  1IN7 A;  3KP2 A;  5EEH A;  1ZRE A;  2RN7 A;  3GVA A;  4IVN A;  3FMR A;  3OOP A;  1HW1 A;  1SD6 A;  2VXZ A;  4Y17 A;  3G73 A;  2COM A;  3ZN1 A;  2FBI A;  2FE3 A;  2ZNY A;  2HQR A;  4GXO A;  3TOB A;  1LVA A;  1BI2 A;  2D1H A;  3M8F A;  3E6B A;  1HKQ A;  1XDU A;  3E5X A;  2V1D A;  2HOE A;  5JI6 A;  1G3Y A;  2MH9 A;  1RUO A;  4B09 A;  3O3K A;  3P9C A;  3TDZ C;  2XRO A;  2D1V A;  2Q8K A;  4TV7 A;  5ICF A;  4UV9 A;  2TDX A;  2HKX A;  4A0X A;  2CQK A;  5F1R A;  5D6E A;  2WV0 A;  5HLG A;  5KVR A;  1J0R A;  1FYL A;  1P92 A;  2IP2 A;  3MWM A;  4KA4 A;  2R7D A;  4BHB A;  3V7S A;  1HKT A;  5HOO A;  3J81 Z;  1R1V A;  3KCC A;  1NHA A;  4ZYE A;  4B8X A;  2RV8 A;  3QU3 A;  3DKW A;  5JFR A;  3JSP A;  2M30 A;  1DPR A;  3GUD A;  4D0P A;  4YFN F;  1SFU A;  1E2X A;  1L3L A;  4U7B A;  1PUE E;  3E5Q A;  2AS5 F;  1D8K A;  3BP8 A;  3C7J A;  3RDI A;  3H3Z A;  2P5K A;  1U8R A;  1YW8 A;  1V4R A;  1J59 A;  2EWN A;  3TO9 A;  2IA2 A;  2ADU A;  1QNT A;  4YFX F;  4WXD A;  3I5U A;  4RAY A;  2UZK A;  2XKO A;  5D4R A;  3TKY A;  5BMZ A;  5HS7 A;  1P4A A;  4HQM A;  5FO5 A;  3I53 A;  4KIF A;  5J6X A;  3HOT A;  2V9V A;  3KLO A;  4YIF A;  3ECH A;  1SMY F;  2Z33 A;  2A07 F;  5FLX K;  1TNT A;  4UVA A;  4N9H A;  1I27 A;  4ZYG A;  1PDN C;  2EJR A;  2YU3 A;  3KEO A;  4P96 A;  3K9T A;  5A2Q K;  2Q2E A;  4WX9 A;  4ETS A;  5E8I A;  4HX8 A;  4L9V A;  3B73 A;  4YFK F;  3CTA A;  1TTY A;  2DPU A;  4CGZ A;  4UUV A;  4GYG A;  4RB2 C;  1ZHF A;  3CLO A;  1ODD A;  3ZMU A;  2W84 A;  2ZFW A;  1HQC A;  2V1X A;  2KJC A;  2LDU A;  1R1U A;  5BQT A;  3D0S A;  2OZU A;  3GF2 A;  1FBS A;  3HTU A;  1B9M A;  2WTE A;  3HRS A;  3WTW C;  2ZKZ A;  4YG2 F;  2VE8 A;  2L02 A;  3O6B B;  1I1S A;  1J9I A;  2LF7 A;  3GWZ A;  1WQ2 A;  2VBW A;  4OIR F;  5IT3 A;  3Q9V A;  3BOQ A;  2BYV E;  5E1W A;  3BJ6 A;  3KE2 A;  5LGN A;  2G9W A;  2XIG A;  3SQN A;  2RGV A;  1BI3 A;  4R1H A;  5HLH A;  3OV8 A;  4XRF A;  3FMQ A;  3R0J A;  1XMK A;  4EM2 A;  3FXR A;  2QYO A;  4MQV A;  5L3B A;  3CUQ A;  1HST A;  5ILU A;  1U5T B;  4I09 A;  3I64 A;  2J5O A;  2CYY A;  1GVJ A;  3K1P A;  5J8C A;  4MTD A;  1RIO H;  1FSH A;  2Q0O A;  3FF5 A;  4NB5 A;  1XDS A;  3GZ5 A;  3R6S A;  5LHH A;  4U0W A;  2V6C A;  4BH9 A;  1J7K A;  5DEQ A;  3T5X A;  1F9N A;  1WRJ A;  2YX7 A;  3AAF A;  1B9N A;  2GIV A;  4LK0 F;  1UFM A;  1U78 A;  3F3X A;  2A6E F;  1MGT A;  4AVP A;  3K1N A;  4MGR A;  5CVJ A;  1P4W A;  1ONV A;  1S6L A;  3DQV C;  2R3S A;  1USS A;  4ESJ A;  1W7P B;  2VBY A;  2L4M A;  3H3U A;  4WXH A;  3WTX C;  3H92 A;  2O8X A;  5AIP A;  3RI4 A;  4Q48 A;  1WWX A;  3IKV A;  4IRH A;  2Y48 A;  4BYY A;  4I98 B;  2FRH A;  4HDU A;  4P5O A;  4Q4Z F;  4KUM A;  4KMU X;  3RKW A;  3HTS B;  1Z1D A;  1ZYR F;  4JBA A;  1FY7 A;  1ON1 A;  2MA3 A;  1XB4 A;  1O57 A;  1BI0 A;  2P5L C;  4O6J A;  4HOB A;  4Z2Y A;  3N97 A;  3F8M A;  4OMZ A;  1QGP A;  2HKO A;  3PQJ A;  4IF4 A;  5FGM A;  1ZAO A;  2W25 A;  4MEX F;  3E5U A;  2XVC A;  1ZH5 A;  2XUB A;  1BBY A;  2YX4 A;  2XHK A;  1YS6 A;  3PQK A;  3BPX A;  2CW0 F;  2HEO A;  3CO7 C;  3F22 A;  1OYI A;  3HRU A;  2KIU A;  3HSE A;  1F4K A;  1RUN A;  4IHT A;  3K1M A;  4A6D A;  4P9U A;  5JHU A;  1K6O A;  2KIF A;  3RTR A;  1IXS B;  2QM3 A;  5ILS A;  2HQN A;  2Y75 A;  1UHM A;  3R61 A;  3SXY A;  1R58 A;  2IJL A;  4DQ2 A;  5LBQ A;  1G3T A;  4EVI A;  1JGS A;  1YFH A;  2DTR A;  5LEJ A;  2A68 F;  1R5H A;  1HKS A;  2EA2 A;  2YSR A;  2ZME A;  4PCQ A;  2PJP A;  1SAX A;  2XAF A;  2K02 A;  4U0Y A;  4XBF A;  5CJ9 A;  3SHF A;  2M45 A;  4NQW A;  2VOD A;  3IRQ A;  3FXQ A;  3JW4 A;  4I7H A;  5DCF A;  1XSV A;  1QBJ A;  5ICC A;  4HQE A;  1MD0 A;  5DUI A;  3MEX A;  1LDK B;  1R00 A;  1P6R A;  2VBX A;  2FSW A;  2LKP A;  3WE3 A;  2EK5 A;  2O6G E;  1O7F A;  4HW0 A;  4HLY A;  3HRM A;  4IRG A;  1IAW A;  4HYE A;  4EGZ A;  5D5U B;  1DUX C;  5H20 A;  1OMI A;  4KMF A;  2A5Y B;  3EET A;  4A5N A;  1TW2 A;  2E1N A;  1UCR A;  5HDK A;  2KJB A;  2NS0 A;  1Q1H A;  4L5I A;  3S2W A;  3L09 A;  5E18 F;  1BIA A;  2IT0 A;  2ISZ A;  1EH8 A;  3HSF A;  3P7N A;  2KIM A;  4UVC A;  3DPL C;  1LB2 A;  2EV5 A;  3V7R A;  2DU9 A;  2A3S A;  1WSU A;  5IT9 K;  4EJV A;  4RB1 A;  4EM1 A;  3HOS A;  2G7H A;  2J5P A;  1LNW A;  4ZZD A;  1G3S A;  3ECO A;  3BDD A;  4RS8 A;  1OR7 A;  2Z5U A;  1AWC A;  2YR2 A;  1BM9 A;  3C3W A;  3JSO A;  3KZZ A;  3MCZ A;  3EQL F;  2HZT A;  2Z3Y A;  2XAQ A;  2QBY A;  2MH2 A;  1ZG5 A;  3IL2 A;  3GX4 X;  3WU1 B;  1IF1 A;  1SD5 A;  3R0A A;  1FX7 A;  4EQQ A;  5ILV A;  3I59 A;  5H6R A;  5LEK A;  1FBQ A;  5K5R A;  3EUH A;  1X3U A;  2RDP A;  4KNY A;  4G7H F;  1A04 A;  2QQB A;  2HFH A;  2VOO A;  1OKR A;  4RAZ A;  3RYR A;  3LA7 A;  1ZAR A;  5D4S A;  1EH7 A;  1YS7 A;  4LLL A;  2OAZ A;  1O3R A;  2DLL A;  5K1Y A;  1MJA A;  1FC3 A;  4FHT A;  2V1U A;  2MBF A;  2L01 A;  2XV4 S;  1S8N A;  1LDD A;  4ENN A;  5DYM A;  1S3J A;  4LGW A;  1XSX A;  5CYV A;  3D5L A;  3K0L A;  2KRF A;  3ZQ7 A;  3EYI A;  4RB3 C;  3TGN A;  2DK8 A;  3KP3 A;  5CVI A;  4WF2 A;  5BOX A;  1KU9 A;  2E1C A;  3CUQ B;  1DDN A;  2VC1 A;  5AIQ A;  2XRN A;  3E6M A;  4HLX A;  5D5W B;  4GO1 A;  4LB5 A;  2E7X A;  1Z7U A;  1I1G A;  3M9A A;  4A0Z A;  4KIB A;  3EDP A;  1KGS A;  3QPT A;  1K78 A;  4K2E A;  4RGR A;  2JZY A;  2PG4 A;  1K79 A;  4AWX B;  3GZ6 A;  2IA1 A;  4FX4 A;  2KKO A;  2K27 A;  2LNB A;  3BRO A;  1XMA A;  4OU0 A;  3DFG A;  3J80 K;  5FD5 A;  3B02 A;  4BQA A;  1H9T A;  1YW7 A;  4PGH A;  4GGG A;  4WXC A;  3TQN A;  3E6C C;  1EH6 A;  3DV8 A;  4YII A;  4NHJ A;  3LQR A;  3NQO A;  2WWY A;  3TDU C;  3VFZ A;  2CSO A;  2GA2 A;  4LB6 B;  5DUK A;  1J75 A;  2HYG D;  4HBL A;  1UHW A;  1PP8 F;  3QRF F;  3DP7 A;  4M6Y A;  2Y0M A;  1YIO A;  2ZO4 A;  2R7F A;  1F5T A;  3FWE A;  3IC7 A;  4HV5 A;  4OIO F;  1TW3 A;  2O0Y A;  2LF8 A;  1BI1 A;  1ZN2 A;  4G6D A;  3P9I A;  3DF8 A;  4L9J A;  1DPU A;  2G7U A;  2FOK A;  1R7J A;  2EA4 A;  2EFQ A;  5CLS A;  4LK1 F;  3VEP A;  1W5S A;  3KET A;  5ICG A;  1IZ1 A;  4G94 A;  2RC4 A;  1ZG1 A;  3CUQ C;  1QZZ A;  3WTS C;  3LQQ A;  1ZRD A;  5F6F A;  4M72 A;  1YQA A;  4HF1 A;  2UWM A;  2M1B A;  4PGG A;  4RGU A;  2LSO A;  4U0V A;  1XGN A;  1KA8 A;  1FT9 A;  3KZY A;  3J7A O;  2P5V A;  2XAJ A;  4M9X A;  3GFJ A;  5H6Q A;  1T98 A;  1CF7 A;  2ZME B;  4KN4 X;  4PDK A;  1ZRC A;  3WGG A;  2FF4 A;  3VOE A;  2HWV A;  5IT9 Z;  3KP6 A;  3KP7 A;  1BC7 C;  4KFC A;  4ZZL A;  2DK5 A;  1S7A A;  5BPI A;  1BN5 A;  4LJZ F;  5E1X A;  2PMH A;  3HHG A;  1HW5 A;  1FYK A;  4M73 A;  2EV6 A;  3WTT C;  2F5E A;  3U9G A;  1XCV A;  2Z9O A;  4I2O A;  4EJO A;  1P2F A;  3GYH X;  5HS9 A;  2QEN A;  1BIB A;  1FWZ A;  4LLG F;  3V8J A;  5E1Z B;  2QQA A;  3RJP A;  3C1D A;  1LQ1 A;  4XLN F;  3HSR A;  3ISP A;  1IN4 A;  1QO0 D;  1BOA A;  1AOY A;  4G7Z F;  1YO5 C;  4N9I A;  2PMU A;  1MKM A;  1QPM A;  2GA1 A;  3R4K A;  5LHI A;  3K2Z A;  2ESH A;  5L3G A;  5LRS A;  1CGP A;  1T6S A;  4I02 A;  2A69 F;  1TQM A;  4UVB A;  4OMY A;  3W6K B;  4BAY A;  2M5W A;  1RNL A;  2M8E A;  2O3F A;  1ON2 A;  4OOI A;  1REP C;  1MDM A;  4MEY F;  4OIQ F;  1EV7 A;  5LGU A;  4M9Z A;  1ZLJ A;  2GQQ A;  2HYF A;  4L0Z B;  4AIH A;  4BHC A;  1RI7 A;  1KU3 A;  2STT A;  2CO5 A;  1T39 A;  3V8L A;  2QBY B;  2EFN A;  4LG0 A;  4CDG A;  2W24 A;  4IJA A;  3IKT A;  3JAM K;  1WKM A;  4CO8 A;  4O5V A;  1PP7 U;  3I59 B;  5LRR A;  2W57 A;  1W5T A;  3KP4 A;  4BXU A;  3KP5 A;  1SD7 A;  1RZ4 A;  3ZMD A;  1KU7 A;  4H0E A;  2UXN A;  4U88 A;  3W6J B;  4Q5S F;  3EYY A;  4BHP A;  2ZBK A;  2FXA A;  3ABU A;  2F5D A;  5AON A;  1VTN C;  3BPV A;  4A5M A;  1QZY A;  3ZMV A;  2DBB A;  1O7L A;  2RNJ A;  4CXF A;  2ZNZ A;  3I0T A;  3I58 A;  3WOD F;  5DD4 A;  3TOA A;  2Z99 A;  3J80 Z;  1Y0U A;  2PEX A;  1MJB A;  2EFP A;  4EJW A;  3LAJ A;  4GCV A;  2MC3 A;  5D5X B;  4IRI A;  3KFW X;  3WE2 A;  1SMT A;  2DT5 A;  2EV0 A;  2XKP A;  4G8X A;  4ZYD A;  3ULQ B;  1Z6R A;  2BBY A;  1IXC A;  4A6E A;  2L4A A;  5FLX Z;  3M8E A;  3RPU A;  1GXP A;  1J2X A;  2P7V B;  2CGP A;  3F6V A;  5A2Q Z;  3SZP A;  2XAG A;  4EV0 A;  2P6S A;  4ENJ A;  5TRD A;  2OQG A;  3WTZ A;  1I5Z A;  4L18 B;  5FFZ A;  4UNO A;  4OIN F;  3GFM A;  3WGH A;  3ZPL A;  3F8F A;  2CG4 A;  3ELK A;  1K78 B;  4RGX A;  1S29 A;  1FLI A;  2VOP A;  3V4G A;  1ZGJ A;  3FHZ A;  1XGM A;  1R5G A;  2OBP A;  4S04 A;  2YPR A;  2BV6 A;  5HDG A;  2H94 A;  4UXN A;  5D8L B;  5DV5 A;  3GEZ A;  1O3S A;  1KU2 A;  3F6O A;  5JR3 A;  1JHF A;  2PLY A;  4IPA A;  1STZ A;  1BJA A;  5CVU A;  4UHT A;  1ULY A;  1ZGA A;  2GAU A;  3BWG A;  1IUY A;  2QZ8 A;  4O3M A;  3JTG A;  1B59 A;  2OU2 A;  4EGY A;  4IHS A;  3QPH A;  1XSD A;  4I0A A;  1SFX A;  1FPQ A;  5CVR A;  1IN5 A;  4P9F A;  2BE5 F;  2DO7 A;  5E8G A;  3T1B A;  5D5V B;  3HRT A;  2PN6 A;  1R22 A;  3ZP5 A;  1LEA A;  2FQ3 A;  4KIC A;  2IRF G;  2NNY A;  2EB7 A;  5DDG A;  3M7G A;  3I71 A;  2WC2 A;  2E7W A;  1HBX G;  1KYW A;  2FML A;  1HXD A;  4AIK A;  4Y15 A;  2FEZ A;  3IHU A;  2GZW A;  2ISY A;  4HX4 A;  4M9S A;  2OQR A;  1TNS A;  1B1B A;  3VB2 A;  3ZN0 A;  3ABT A;  2B0L A;  4MHG A;  1IXR C;  3U2R A;  3DPT A;  1HW2 A;  1B4A A;  3F8C A;  1IN8 A;  3LST A;  3NEU A;  4AIJ A;  1Z6T A;  2W85 A;  3JTH A;  4LD5 A;  3FM3 A;  3Q5F A;  3RYP A;  3L00 A;  1JE8 A;  2PI0 A;  2FU4 A;  3QP5 A;  1T2K A;  3DXJ F;  3GLX A;  2PFB A;  5L3C A;  1LJ9 A;  3RPQ A;  1CF7 B;  2P7C B;  2M87 A;  3RIR A;  4EM0 B;  3N4M A;  4A2U A;  4U7D A;  2RKH A;  2H09 A;  4M6X A;  4ENK A;  2EFO A;  3F8B A;  2QQ9 A;  3FZV A;  1FSE A;  4HV6 A;  1BC8 C;  2FMY A;  5LHG A;  3HHH A;  1TQI A;  1ZG3 A;  5FFX A;  1WI9 A;  2ACJ A;  4WWC A;  3T8T A;  2ZXJ A;  1L0O C;  5DCM A;  3L9F A;  3NRV A;  4G7O F;  3JAM Z;  2VN2 A;  3ROU A;  3BJA A;  4FT8 A;  4GYI A;  4EMS A;  4ENM A;  3KEQ A;  2DPD A;  5E20 A;  4KT5 C;  3FM5 A;  2VT2 A;  1D3Y A;  1JHH A;  4L9N A;  5LLQ A;  3PFI A;  2H27 A;  2XAS A;  2OZ6 A;  1IW7 F;  4XSX F;  2F2E A;  3WGI A;  4KDP A;  5K5O A;  2ETH A;  4CHU A;  4A0Y A;  3ML6 A;  1TQP A;  2P6T A;  2NAZ A;  4F7Z A;  1QQI A;  3P9K A;  4FX0 A;  3FMS A;  1SD4 A;  1F1Z A;  3CDH A;  2FA5 A;  4EJU A;  2D2W A;  1LDJ A;  3CO6 C;  2K4B A;  2MLK A;  3HIF A;  1TBX A;  1XGS A;  3RKY A;  1R1T A;  2CFX A;  2L3D A;  1MDM B;  4E70 A;  5DD8 A;  2GXG A;  2MD5 A;  3GW2 A;  1OYY A;  2JRT A;  2BGC A;  3BY6 A;  4DNC A;  4XSZ F;  5ERI A;  2K7L A;  4XLP F;  1ZRF A;  2EFW A;  3HUG A;  2P8T A;  4LG0 B;  2IVM A;  1DP7 P;  1XN7 A;  3IRR A;  5ICE A;  2DAO A;  1KQ0 A;  2F5C A;  2VC0 A;  1LEB A;  1KQ8 A;  3U1D A;  1U2W A;  3LA2 A;  5LGT A;  2GWR A;  1T0F A;  5FB2 A;  1ZLK A;  1G6N A;  4HF0 A;  2K4J A;  5L3D A;  5HVQ C;  4BNC A;  1YLF A;  2UXX A;  1Z9C A;  2XAH A;  1IN6 A;  4CYD A;  3Q9S A;  1IRG A;  2FBH A;  3R60 A;  4JQF A;  3GXO A;  3LA3 A;  4ESB A;  4RB0 A;  3COA C;  1O3Q A;  4N0B A;  2A61 A;  3LFK A;  2FBK A;  4L5J A;  1C0W A;  2IPQ X;  3VOD A;  3I4P A;  3M1E A;  3ZMS A;  5L3F A;  1Z91 A;  4L0Y B;  1IRF A;  2DW4 A;  3CUO A;  3T0Y A;  1R23 A;  1XCB A;  2RVC A;  1K7A A;  4G6Q A;  2PBI A;  2HTJ A;  1KYZ A;  2IW5 A;  3ERE D;  3FXU A;  4P55 A;  2ESN A;  2JTV A;  2VE9 A;  3MQ0 A;  4KYW A;  2X0L A;  4HF2 A;  1OPC A;  3IWZ A;  4LFU A;  2STW A;  4R8H A;  5EEG A;  3F72 A;  2H6B A;  5F64 A;  2JPC A;  3T8R A;  3ZMZ A;  4ZH4 F;  3HYI A;  2RQP A;  1G4D A;  3FX3 A;  2HR3 A;  3J81 K;  3LWF A;  3WTU C;  1S7O A;  4HDV A;  1FYM A;  4CZZ A;  1D8J A;  3DEU A;  4S05 A;  1W4M A;  2NNN A;  3WG9 A;  1YYV A;  3V7C A;  3LAP A;  2JSC A;  1U6G A;  3MZH A;  5D6F A;  3MFK A;  1TLH B;  1YG2 A;  3TO7 A;  2VT3 A;  5BS6 A;  6PAX A;  1FNN A;  3L7W A;  5CVV A;  5D8K B;  3QP6 A;  3GFI A;  3KLN A;  2XGX A;  2HGC A;  5FD6 A;  1J5Y A;  3L2C A;  1GHC A;  2O61 A;  2FNA A;  2PQ8 A;  3WU0 A;  3E3V A;  3REO A;  4HAM A;  4UV8 A;  2HTS A;  2BEO A;  5TJJ A;  2DQR A;  2V79 A;  4ASN A;  4CIC A;  5ED4 A;  3WTY C;  3WTV C;  4OIP F;  2NRA C;  3MAJ A;  1FOK A;  3C18 A;  4EJT A;  2H6C A;  1V3F A;  2K86 A;  1U5T C;  4L9T A;  1P4X A;  1D5V A;  1JXS A;  1B6A A;  4M71 A;  4ESF A;  4KN7 X;  4ZYH A;  1FZP B;  4A12 A;  1E17 A;  3GFL A;  5HDN A;  1U5T A;  1H9G A;  3E6D A;  2VON A;  2JPB A;  4I01 A;  1G3W A;  1T38 A;  5J8F A;  2GXB A;  4ON0 A;  3I54 A;  1UST A;  2JT1 A;  2ELH A;  5HLI A;  1YTY A;  2OD5 A;  3BJO A;  1HSJ A;  4Q47 A;  1Z05 A;  4HA8 A;  2NYX A;  5KK1 A;  4RGS A;  3G3Z A;  4QLC U;  1H0M A;  2A6H F;  4I0B A;  3GO5 A;  4KIG A;  2F5F A;  4HZF A;  2C6Y A;  2IA0 A;  1XD7 A;  4PZJ A;  1W7P A;  3V8K A;  4MQ9 F;  2ZCW A;  4MTE A;  4G9Y A;  1FP1 D;  4JK1 X;  2O03 A;  1SFE A;  3F21 A;  1MJ9 A;  1FBU A;  4LLN A;  4HX7 A;  2QVO A;  2ZJ2 A;  5JVT A;  3TO6 A;  3IWF A;  1UB9 A;  2DFI A;  4IXA A;  2HDC A;  3ZMT A;  4M74 A;  2MLG A;  2VBZ A;  3F23 A;  2L54 A;  1W7P D;  4Y13 A;  5DCM B;  1I6X A;  3MZY A;  3BZ6 A;  5BPD A;  3CJN A;  3RKX A;  5E17 F;  1FP2 A;  4AD9 A;  2AXL A;  1KQ9 A;  3QU6 A;  2DQL A;  1OYW A;  2HS5 A;  2QWW A;  3O2P E;  1O3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...