5IM5A

Crystal structure of designed two-component self-assembling icosahedral cage i53-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
TKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Protein binding
molecule keywords Designed Riboflavin synthase
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, O, Q, S
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 5im5A00
2B98A 2A58A 4J07A 2I0FA 1RVV1 2O6HA 1EJBA 2C92A 1C2YA 1NQWA 2VI5A 1KZ6A 4KQ6A 5IM5A 1HQKA 1XN1A 1KZ1A 2B99A 1W19A 1KYVA 1NQUA 1KYYA 2F59A 2C9BA 3NQ41 1DI0A 1KYXA 1ZISA 1C41A 1KZ4A 2A59A 1W29A 2OBXA 3MK31 2C9DA 2C94A 2C97A 2JFBA 1T13A 2A57A 5IM4A 1NQVA 1KZ9A 1NQXA
chains in the Genus database with same CATH superfamily
3ONEA 1Q0LA 1CDOA 3SX4A 3SZ3A 3DVLA 5CG1A 3GMTA 3O21A 4R0MA 1KL7A 3OC6A 2IPLA 4PLPA 1GGKA 4OL0A 3E4DA 3BXXA 1L4MA 3U3XA 4DV3B 2OCBA 2DH6A 2PSFA 3JQRA 4FNAA 4RKEA 4X90A 2A35A 3TQIA 2QA5A 4DA0A 3ESDA 5B64A 4YPFA 4DWVA 5M04A 5EHNA 3WYCA 1XEWY 2C82A 3PQ7A 4J16C 2HH9A 3S70A 5JZOA 3MGCA 2FMUA 2YV1A 2HSGA 4AJ9A 3I5XA 1VGRA 2DG2A 1INLA 1CFZA 1IU9A 2CSUA 2UZAA 4KE8A 1TFRA 4WAUA 5DHRA 4BZZA 5B1DA 3FPJA 5CDFA 1PW7A 2FSIA 3PFFA 3LK7A 1D03A 1DFGA 1MIOB 1RQRA 5CA1B 1OXTA 4FCWA 4FFMA 5KREA 3OA2A 4QUJA 1C7RA 4UEJA 3KQHA 3FOWA 3MJ4A 1PNVA 5G40A 1NBAA 2QMEA 4AULA 3OT1B 4HS4A 5LQCA 3RU3A 4AZ3B 1X74A 5C53B 3CRNA 2FK8A 3O4IA 3BXPA 3BMOA 4C0KA 1C0EA 1C7IA 3HB9A 3NOQA 3Q6MA 1NVUQ 2QG6A 2QLBA 3WIEA 4G0NA 2XUIA 3ETNA 4WECA 3M5DA 1AD2A 1J21A 2Y8EA 3ZWMA 2XOKD 2ZWMA 3GCGA 1NURA 5LUAA 2EL7A 4ZO4A 2B4TO 3NGXA 1E4EB 2XUOA 4F5WA 5LOVA 5JS6A 2P7IA 3F5MA 1B73A 1WXGA 2D2VA 2E4UA 1VFPA 3DAFA 2POCA 2ZDGA 4KQIA 5F7JA 3STYA 2JGMA 2F9MA 3KX2A 4H31A 4LOHA 2A6PA 4H6XA 2BRUA 5IULC 5HIIA 4IV5A 1JDPA 2O0LA 1YA8A 2V7WA 3QKRB 2W6PA 3H75A 3FNFA 4WE3A 1YGPA 2QW8A 4KKVA 5JXIA 3PT9A 3O4FA 1F8GA 1QTRA 1AF4A 3C41J 2PXXA 5TT0A 5A5FA 7MDHA 1G18A 2VK1A 3L6DA 1Z63A 1RAFA 1EP2B 2NUAB 4B8ZA 1JQDA 3F2VA 1HX7A 4HD8A 5K8UA 4CT5A 3R7DA 4I8IA 1GDTA 1AKMA 3K1ZA 1HFJA 2BR5A 2N3ZA 1X7XA 3WDKA 1R27A 1H1DA 1ZGJA 2XVAA 4NR0A 4ZJYA 2V6MA 5JD4A 1AC5A 1V26A 2IL1A 4ZO8A 5EKXA 1SKQA 1SCQA 2VHZA 1O94A 3Q9UA 4MGEA 4EA7A 1AKTA 1NAHA 2PL5A 3IDZA 3UFBA 2GJ8A 3EC7A 1HNNA 1KJ9A 3MCWA 3VR6H 1WULS 1EFAA 3MPOA 2EIXA 2ZREA 5TEWA 3ZGVA 3HU1A 4EENA 4ND8B 4EPWA 3KEGA 3RFTA 2UAGA 1H2FA 5D3MB 3P0HA 1M8KA 3M4XA 3NDJA 3SR3A 2UYYA 1KKMA 3EFOB 4DOMA 1O8CA 2PA0A 1Y9ZA 3OOJA 1VJ1A 2DWOA 4EJMA 4IR7A 1P61B 2RD2A 3PI7A 1W29A 2OFPA 2VJDA 5KNCH 3Q88A 1BYUA 3PLAE 1P18A 2SBTA 1KSFX 2C31A 2ZYDA 1MVOA 4OHKA 3T99A 3OKPA 4I81A 1T8WA 4IOMA 1XNQB 3QTTA 2BBTA 4EF5A 4U1RA 1G64A 2C4HA 4HLNA 4KRYA 3UPDA 5KYWA 3U7GA 3D8SA 4MUKA 1J1IA 2I2XB 2Z43A 4QAJA 1YE5A 3DHYA 5E7MA 3LHSA 1OWLA 3EXEA 3OEWA 4TXJA 3ZC3A 1NMEA 1IQUA 3L77A 1H6BA 3C3CA 5AKKA 2CLIB 2V8OA 1ZN2A 5A9RA 1EFKA 2L19A 1MO5A 3V97A 2Y1EA 3N8KA 3WNBA 3GJSA 1Y8ZA 2ZYRA 1QH1A 3L8GA 2I87A 3LKVA 1RS0A 1VP3A 2QDXA 1LBHA 4O4JA 1CVIA 3M4YA 2AVNA 4RZIA 4BQNA 3LP6A 1AKVA 1G55A 1L5ZA 1EGQA 1T0BA 2ABWA 2QTFA 4RMJA 4C89A 2FFJA 1PF7E 2XUDA 3NIWA 4LRUA 3GQBA 4AIIA 3RVKA 1NM5C 4QHSA 2VRCA 4BVBA 1PKEA 1S89A 3GCZA 2IS4A 2DUWA 2DH5A 5EQFA 2YFYA 4DUPA 5DHPA 2GN8A 4MLDA 2V0GA 3JY6A 1Z2CA 1GUBA 4Y2RA 3KKMA 4TS4A 4Q12A 2C2GA 1Q0PA 1M2OB 4ZT4A 2PO5A 4RLSA 4BFZA 4E7OA 1YBMA 5JCOA 1QAMA 1W4LA 5I9NA 3E03A 1I3NA 1TZMA 2P65A 3ER8A 1T8SA 2Q6KA 4LNUA 2RBEA 4BX9A 2OO7A 2X2EA 5DGTA 3L7IA 3WQSB 1M0EA 3BQ9A 1QE5A 4OQQA 2BGTA 3TLEA 4BQRA 1MTOA 1NW6A 4I19A 3FBWA 4OI4A 3K3PA 1E2DA 1KPGA 3I4LA 1EXNA 4R9UC 3IPLA 4H4DA 1CQWA 4PC7A 3TIGA 5I5EA 2O07A 4EUHA 3NHZA 3ZK9A 2CE7A 3CRW1 2GI4A 3GCWA 4LFBB 2P6PA 2OTCA 3A05A 3TQRA 5A6SB 3BRSA 2AFRA 1C9JA 1L5SA 4K9MA 3A58B 4FOPA 3MD9A 3E7FA 4P3YA 2UYOA 4LMAA 4IWXA 5FBWB 2GAJA 2FW6A 2WTBA 3TSZA 2G67A 4IJQA 3O8QB 5DRYA 1BDBA 1BWSA 1RXEA 4R01A 3TD2A 3DMTC 4DSZA 2C7RA 1XKXA 2G63A 2ZPAA 1ODKA 5U9CA 3A4NA 4MP8A 3HBLA 2I33A 1JJVA 5KYUB 4CV1A 4DLNA 3VRHA 3B53X 3NBFA 4A2CA 3NRBA 3G2JA 4O8ZA 2XECA 3OZWA 3OQOA 2ZE5A 1DJMA 3LGAA 2YBDA 5CCEA 2QSJA 4DEXA 1GQYA 1H2XA 2FWPA 2OL4A 2H59A 3AKZA 4BFUA 3P9CA 4YAFA 2XMSA 1IN7A 2WUWE 4JJEA 4ZVUA 3RAGA 1FDRA 1TT7A 4FSXA 3TZKA 4BKUA 2YASA 4LI0A 5MF6A 4ZAYA 4D5GA 4E0BA 5CD1A 3L6CA 1AHNA 1N4AA 4MVJA 4ZOBA 1RQXA 3WHLA 4MQ6A 4QOHA 1R6XA 4PG5A 4DPKA 3SLRA 1QS0B 2ZRNA 2D1QA 3KUUA 2BFBA 3VDMA 2H1FA 1YB2A 3E3LA 3DCJA 3FUUA 4LJ6A 5GONB 3PIDA 1XZDA 4CIAA 2EGGA 5IN4A 2Q5CA 3TZQA 2CFSA 5B7QA 1K6IA 1W94A 4JUAA 5F12A 5BSFA 3U09A 3PGVA 1RTTA 4LE0A 4OQ4A 2VK2A 4PIPA 2ZJ1A 1ISIA 3WFZA 2AG1A 4G01B 1E1RA 1ZIYA 5IK2A 1QKKA 4OSOA 5SZIA 3DE5X 1A5ZA 3THWB 3SJBA 4NBLA 2JRCA 3KYIB 1BDJA 4Q7JB 3H87A 1W87A 2HQ1A 2ZSEA 3C98A 2DAPA 1ZW6A 3DAPA 4JSRA 1EP1B 1BE8A 1KTVA 3BF7A 3G0CA 3IJEB 5HTKA 5NLLA 2GPWA 3VHRA 4YT2A 2FSVA 3HRHA 4QKQA 1XEFA 1NJGA 4JCOA 1T6ZA 2AZMA 2EW1A 4MQUA 5FCDA 2LCQA 4G89A 3RVPA 3SF0A 4EJ2A 2C20A 3WLMA 1ORHA 2PT5A 1FYDA 1NBME 4P0TA 1F3OA 4Z6KA 3BHMA 2AN9A 1GG2A 1YZGA 3FZGA 1KJIA 4BMZA 4EG7A 3KR1A 1JIIA 3ML1A 5A3JA 2JLZA 2R8XA 5TR9A 2AW5A 3OAAA 4UVEA 3T38A 3RAPR 4XYBA 4N03A 1NYQA 2EKQA 5FXMA 4L27A 3I12A 1I33A 4IHJA 4JROA 5EJIA 2FJUA 3IUQA 2PL9A 4I46A 1PEDA 1K7YA 3BQMB 4HEJA 5F2NA 5IZCC 1BMFD 2F1IA 1GSOA 4EYOA 2YKGA 2IUTA 1GR1A 1QTQA 1LQUA 1NW8A 4HPWA 5AM1A 1SWVA 1ZUD1 3ET5A 1VRWA 2JGLA 2WRZA 1ELOA 3M6LA 2AW3A 1AUVA 1JI3A 3KOOA 5IUKC 4R7ZA 3H5TA 5DU2A 4Y98A 4F1WA 1N77A 4LJ9A 5ALHA 5DW3A 3SVLA 1ST2A 2D6FA 3OLZA 2IYUA 1C9YA 5CM8B 1JRLA 4KRXA 1RP7A 3PNLA 2CNLA 5HIJA 4YV7A 1PWXA 1SUCA 4XD7A 2D74A 1SBYA 3ZX5A 2AK2A 3L9WA 1OZFA 3WGMA 1KOLA 1JEOA 2Y2UA 2QE7D 2NQ8A 4LJLA 5A2QA 2WJGA 3IKVA 2GCNA 2YX1A 3ZCXA 2O3RA 1XQ1A 3AR7A 2DFDA 2RHBA 4J1TA 1T5TA 5JFOA 3SS9X 4K86A 2YS6A 3PENA 4XVUA 3R7WB 1BDMA 3B52X 2GWRA 1X0XA 3FBGA 2GZSA 4P34A 2NWQA 3FA2A 4BHTA 1COZA 4B33A 2FFAA 3DD1A 4WVLA 5IAAA 2BV3A 2EGHA 3A26A 4FPXA 1S8AA 3BZWA 1HDIA 2WM3A 4IKOA 1S6YA 2I55A 4IY1A 1PT6A 5DSXA 4AF7A 2WT9A 1E5DA 2XBUA 4P93A 1MT0A 4L0CA 3SVTA 2C54A 1E0JA 2J1LA 2B61A 3U7JA 5BOSB 4NJMB 1UBKS 1E8NA 1Q0RA 2H5EA 1QH8B 3AC0A 3T06B 1FSGA 2J9FA 4LRXA 4YMIA 5DHAA 5C8XA 4QPPA 5JW6A 2DQYA 3CA8A 4MEJA 4E15A 2JHFA 1UOOA 3DFZA 3GEMA 2TMKA 1NP3A 4KN6A 4TKVA 3VH2A 3NFYA 1JG2A 3QRWA 2OGUA 3A2MA 1U99A 3JQGB 2FJPA 4Y30A 3SICE 3L43A 1M1UA 1JMVA 4BLVA 3QWIA 4PZCA 4CTOA 5L3QA 3WMEA 2O3SA 1VOTA 3R3ZA 1P7WA 3AIKA 2VXOA 5K0EA 3ERCA 1DHTA 2H6EA 3HNRA 2DFNA 4IEFB 3CW9A 3S1LA 4JGBA 1X8XA 3K1JA 2ZG6A 1FK8A 1P1KA 4UMFA 1TXGA 3RTCA 1PWEA 3C3BA 1O4VA 1RZ3A 1XBTA 4CT4B 1XHEA 1RYBA 1WUHS 3FCAA 2N0SA 4FYHA 4YAJA 4DCTA 1L4EA 1VMAA 1H9BA 1VHLA 2JIPA 4IP0A 4B46A 3OT4A 4WFQA 5EIEA 3DOCA 3HKDA 2FHSA 4HH1A 1IY9A 1R66A 3LBAA 1NFQA 3HUUA 2CLDX 1JYEA 3Q10A 2PLAA 2QRQA 5JTUA 3OICA 1OFIA 5JD5A 1KK2A 3KVRA 1QGOA 3GPCA 3IIKA 2IEZA 1C7FA 3OIDA 1KO7A 4YJ3B 3F8TA 3K0EA 1SG0A 2BFEA 3EC1A 5IBCA 5JXHA 3F46A 3MGBA 4HAIA 3V8RA 4P7GA 5L7TA 3HV0A 2WIGA 2XKBA 1HEIA 4AURA 5LA6F 1AKEA 2CDNA 1MKYA 1V1JA 1AS2A 3PITA 2Z8XA 1KQFA 3G8CA 3BSYA 4IFEA 4DKJA 3IB6A 5G4LA 1L4BA 1KPHA 3C3JA 2R1UA 5FO1A 2LGJA 3H99A 2PS3A 2NYAA 1BKYA 3TPFA 4AQDA 3UMRA 2NGRA 4Q16A 2B21A 2C0QA 2AUMA 3SX2A 2GPYA 5FNZA 2C2OA 2FRDA 1KI7A 2R7KA 3LXRA 2ORWA 3H7IA 4ZA2A 1N0WA 5C51B 3HZZA 5IJZA 5E3HA 1KRWA 4TXNA 4RY9A 4XJTA 1YQUA 2HJSA 2XWJI 4QU9A 3MTIA 3BKXA 3OLQA 3WJ1A 4IMRA 4EDFA 3HUEA 4GOXA 4BKPA 4BNUA 5CEFA 1V9LA 4LRTB 3BSFA 4ZI7F 1CUJA 3FPEA 2OESA 4B82A 1TUIA 3GJZA 3EZ2A 2VRWA 5K6AC 5ESXA 4PZDA 4R1OA 4F9FA 4MWCA 1OILA 2RJOA 1P60A 4RK4A 2ZZMA 5AW0A 2C83A 2Y1LA 3E9RA 1PJBA 1LC0A 1RQ7A 1TU3A 1C1YA 1Q7TA 1L7MA 2OCIA 1K86A 2RI6A 3HWX1 4L3OA 3WWOA 4CG3A 1QRTA 3K70B 2QLNA 5BURA 5FWNA 1N7HA 4RWEA 1BRMA 2COUA 2AOUB 3MS2A 3ROPA 1V7PC 3NIDB 4KGZA 5DEIA 4IYRA 5IKOA 3TZLA 1Q1EA 3PTLA 2G77B 3U4DA 3B82A 3CZCA 3I9JA 3U48A 2HCFA 5EQTA 2ZIVB 4OOFA 4DA8A 1AHIA 4OHRA 1S8OA 4G5GA 1XU4A 1ZEJA 2EQAA 3WBBA 1Y7LA 4H17A 1I0ZA 3LVQE 1KI2A 2D5CA 5HF9A 2NP6A 3TL3A 5IZ4A 5KINB 2ONKA 1QVZA 1H9AA 2ZRPA 2GHRA 1Y6JA 2QY6A 4V2IA 5I48A 3GMDA 2QROA 3ORYA 1PD0A 1TJNA 1A8HA 2ZB7A 2A5FA 4GPTA 1DBQA 1JTVA 3REQA 1Y3HA 2HHJA 4N5HX 2Q1UA 4KXNA 2IV2X 4DNFA 2V65A 1QCYA 3AF0A 4V2UA 3ADDA 4G56A 3RSSA 1SA0B 3TOXA 1H0RA 2ZRHA 4MR8A 1UDBA 4W5NA 5B6PA 4YV2A 2YXLA 2GCEA 3STHA 2JFFA 5KNCA 4HNHA 2RAPA 3D6MA 1U5BA 1QHXA 1IRIA 4UHJA 3CW2A 1CQXA 1NZJA 3QVUA 3O8BA 1YB1A 3ZNNA 3KQPA 4F45A 2YZMA 3AHJA 2GMWA 2OAGA 4KREA 3ABQB 2ACKA 1ZL0A 3WB0A 4O4JF 3HB7A 3R5TA 2QTMA 3H0EA 5EE3A 3D3QA 4Q9AA 5ED4A 4G8CA 4IOLA 5JDIA 2QXYA 1H9CA 2BZGA 2A5GA 1C3XA 1Y81A 2JGJA 3EVNA 4MW2A 4ZAZA 1EP9A 3SIXA 1X7XB 1ZG3A 3PWKA 4V0ME 3RIYA 3IAEA 4P35A 2VSYA 4AUNA 3T7IA 3B1WA 2O8CB 1C41A 1K0FA 3BXFA 2C2HA 2GPSA 1DBSA 1GKUB 4DWWA 1H2WA 2I3BA 4J94A 4TOIA 5E7IA 3WGIA 1Y7PA 4GZLA 4IIFA 2BUAA 4M7PA 1V11B 4U0JA 1EX6A 5EIBC 1E3TA 2RH4A 1XEXA 2XHEA 2A1IA 4XVHA 1Y9EA 3NIFB 1ETHA 1NE7A 3TDMA 3W5HA 4CMHA 1KJNA 1XKQA 4AKEA 2XCSB 1EFTA 4Z4CA 3H4IA 3WB2A 3GFOA 2HSZA 2BDUA 2O6HA 4DHEA 5HZGA 1US8B 2G9QA 1SQFA 4OBEA 3TOSA 4A6DA 2ID9A 2BF7A 5ALDA 3RODA 3V34A 1K4KA 2B92A 5JARA 1LPOA 1M6EX 1JBEA 4FLMA 3LBFA 2ZU6A 1RLTA 3E22B 2HFJA 4BO2A 5DEOA 5IG2A 1DKNA 4K87A 2JVKA 4RIFA 4AYTA 5LM3A 4DR1B 2DGDA 1DAIA 4IQFA 4N5DA 2C97A 2UXDB 2F90A 3C7KA 1JF8A 2ZFUA 3AW9A 4TTAA 3ZWYA 3HUFA 3RIEA 5MDHA 1N5RA 3EVGA 4C87A 1Z75A 2WW8A 3F1LA 1D2NA 5JHHB 1Q1GA 4H15A 3AIMA 2CNDA 2COKA 4TLBA 3RB8A 5K8VA 1RZRA 3T54A 1E4OA 4D3ZA 1JDJA 3JZMA 3W5JA 5CX1B 1H22A 1YVRA 1UPFA 5JOQA 3JD4A 1W2HA 1V8PA 2R97A 2OZLB 3W3AD 3IS3A 1V1RA 2NTYC 3JAKA 1WDLA 3Q7TA 5H3CA 1WQ4A 2IIVA 2O8FB 1H5QA 1Z0UA 2VP9A 1XU7A 4LGYA 1Q3HA 4YIKA 1MAUA 3UBMA 1R6AA 1BW9B 1CJKC 1ZQ9A 2DR0A 3B9RA 3GG9A 3KM0A 1P5ZB 3H86A 2Q4TA 4IIEA 4LXTA 2JHCA 5AHKA 9ATCA 1RHUA 5HRCA 3W1WA 3KXPA 2A57A 4ND5A 5LYJB 2IV3A 3T3IA 1MXFA 2OZKA 2J85A 1DAOA 3BJZA 1CZLA 3HCNA 3K92A 4JL5A 4OMUA 4QUIA 2G82A 4CHGA 1IM8A 2GKOA 3C7DB 5ILOA 3VA7A 2I0FA 3I6IA 4TTSA 3U7EB 3OFSA 1J8MF 3DV2A 2PH7A 1GPNA 1H1TA 4J0KA 1U9ZA 4TL9A 4G41A 2BMWA 3T5BA 3IEIA 3NC4A 2NVWA 5K5EA 1WQ3A 1ZKDA 3IAM6 1ISMA 1PAUA 3PEEA 4JKIA 3RPEA 4J76A 1EHYA 4M2LA 1HDEA 2Y9MB 3BAZA 4ZICA 4HQLA 1FXSA 1P2TA 3LQ1A 5K0BA 4EYGA 3A4MA 3JQPA 4KVZA 2I2WA 2C7PA 1FJHA 4HFJA 1D3AA 2VUTA 3BD7A 3X1DA 4OX9B 4XVRA 4O4IA 1ORIA 2WDZA 4LXXA 2ID7A 1QHHA 4JVSB 2HC9A 1H93A 2W2NA 5J40A 3RVDA 4BV2A 5IPFA 5BR8B 4NBVA 3ZEAA 1JJ7A 3WLTA 3TPCA 4LHEA 4JLPA 1X8KA 3HA3A 2O7VA 2WP0A 4QGBA 3CNLA 4NJMA 3E4CA 3CEPB 1RPJA 5DTQA 1X1RA 2X6TA 4CFYA 5K9ZA 4ONEA 3AUYA 1YVUA 2XF2A 4MKRA 3DCNA 2QB5A 4RYDA 5EIHA 3RUFA 5TMBA 3OG9A 1CB7A 5HYVA 4M8SA 5HBGA 3RUEA 1OV4A 3D4OA 1E60A 3FWHA 3HY3A 3L1IA 4ICIA 4B2PA 4JL6A 3H2SA 1BU5A 1RJFA 2IJGX 2IXAA 3M9XA 4GEKA 3K8QA 2VP6A 1TZ2A 4TV8B 4WW0A 1RM3A 3TLKA 2JGFA 4N82A 4AJPA 1YRQA 3K31A 4FDMA 1O97D 1E8DA 3M3HA 4P53A 4TSRA 1T8TA 3CTMA 5BSUA 1SXJD 3SXPA 4BO3A 5BVHB 1JS1X 2VN8A 2DKOA 5EKUA 2GB4A 4BNVA 1QWOA 2JI9A 2GBCA 1RYMA 1IEVA 1YI0A 4QPCA 3DAOA 1NF3A 1R16A 1XB2A 5AVJA 1YRAA 4P3KA 5IUNC 3FZNA 2DM6A 3VKGA 1ZH8A 3OOEA 1E6CA 3IDAA 4LMBA 2AH5A 5CEJA 1CJUC 2GAIA 4Q4AB 1SAYA 4OHUA 5KBYA 4XPIA 1SVSA 1TEHA 4EATA 4DDTA 2VTEA 2V5AA 2X5NA 4TKUA 4WL0A 3AIOA 3ROMA 5IXJA 3FVVA 3PHGA 4WLNA 2XBMA 1X13A 1ULBA 2RHJA 4WVFA 4ARZB 4XKJA 4FFRA 4CM8B 3BCUA 2IUFA 3EWSA 5I4KA 4ETNA 3B6KA 2DTXA 1YRBA 3JYQA 3KPUA 1DHRA 2FAXA 2FPSA 1VMIA 3H97A 4JYPA 2WWVD 1JPJA 3AGQA 3RF7A 4D79A 1PTJA 2F00A 4JASB 2QVBA 4JLWA 1VXRA 3IPCA 5H7XA 1SKUA 3SXUB 3K0CC 4R2IA 3OPMA 4X1IB 5I01A 1OR8A 3KSZO 5T8KC 5FWYA 4DA9A 2QR2A 3PR1A 4MK4A 2O2XA 2IWRA 2FN8A 2DWQA 2J4DA 3LGSA 4CVNA 4D80A 3SIWA 3GK3A 3N86A 1LVUA 2F3SA 2IYEA 3O82A 4NZYA 5ITWA 5DBFA 3RHFA 1UAAA 3FWKA 5BUQA 3WZMA 7REQA 3QXSA 3AY7A 1QP0A 3BL5A 1FUYB 4I1PA 2F8MA 5LPNA 5H83A 1R7RA 4DRXB 5FTJA 4P54A 1NIPA 3IP7A 3W3ZB 3KQQA 1U3DA 4M1WA 3W6ZA 1FMFA 4ARBA 4P8RA 5EMMA 4M0CA 3EZGA 1T2FA 2CVFA 1THMA 1UBTS 2WP8J 4WKBA 1LTKA 3OO1A 1HY3A 3IXMA 3UHOA 2E4ZA 1B43A 4D5EA 1ST3A 4Z4EA 5DBEX 1I9CA 3M6VA 4URVR 1HQDA 1R9JA 3QSGA 4Y6LA 1UOPA 1CY8A 3KL2A 4L9SA 4NFLA 5KVQA 3ZD9A 1MZVA 2JAWA 2R6R1 2B36A 1RM4A 3SZMA 4I5FA 1QH9A 1Y7HA 5CX4A 4P2GA 2I6SA 2UYGA 2P3LA 4YJ2F 2W58A 4GBMA 3AEQA 2PT9A 4GX0A 4TL8A 1JHYA 5CH5A 4XWWA 1D4OA 1OZHA 2NO5A 1XL1A 1C80A 4EHLA 2X40A 1EK5A 2PUFA 2NADA 3GUYA 4AWAA 3JQQA 3K0FA 4JUDX 1FW8A 4PVCA 5LBIA 1XZJA 3HL4A 2UU9B 2CNOA 4B6OA 1TQ4A 4LOKA 4GW3A 3L7LA 2P9CA 4D98A 1F2TA 4OQNA 4IMJB 1K0UA 3WIDA 4A0GA 3D43A 2E87A 1AU9A 4YRRA 3T95A 4XIFA 5IVDA 1DB3A 3N8IA 5J5AA 3Q3GE 1KU0A 1SXGA 2RGEA 1UZNA 1L5LA 3OU7A 1BXRA 3T4UA 4E5MA 1RPNA 4DV2B 3NCHA 3U9LA 3VX3A 1G4AE 4YP7A 1GSIA 4QBIA 4B3IA 3BXHA 2OA0A 3P94A 3WWZA 3ZDQA 2Z1DA 1HTWA 3ZDXB 4OMDA 4B35A 4EJSC 1GTRA 4YCJA 3D6VA 4X62B 1YJ8A 1JAIA 4CIWA 2GFIA 3EPRA 3AI3A 1O2DA 3IR5A 2RCYA 4JITA 3KR0A 4QUDA 3P0RA 4QC2A 3K9QO 1LX7A 4HATA 4UU8A 2BEWB 4UPDA 1B6TA 2BCGY 2N1BA 1CQPA 3HCDA 5IYZB 4OJNA 3OLYA 3RASA 3KT0A 3W04A 2VWHA 1N2JA 2R7NA 5BORA 1XYYA 1PG2A 3PA8A 3WWDA 4CM7A 4K3UA 4YRMA 2VF5X 1XU9A 4J0JA 1QIFA 2HMWA 3EBLA 1WUJS 1VJCA 3KEOA 1DT3A 1F8UA 1WKBA 2FSUA 3RLFA 4C4OA 4DARA 4AP6A 5HZHA 1JKXA 1U2RA 3S2YA 3FPGA 1JMKC 2NO4A 1A82A 1W44A 4U7DA 1E0KA 1TLLA 3OD5A 3PI6A 4MR8B 5LQSA 2GZ1A 4AZ0B 4ZDIA 2GBLC 2CDCA 3CVUA 3AQ4A 3O6VA 3SAJA 4D4MA 3A4TA 3AFGA 1NA5A 4LPKA 1P2VA 1SB8A 1XZNA 1IOLA 2YWRA 3JWPA 5CT8A 1V6SA 5HMLA 1I4WA 4CMAA 4OHVA 3H5VA 3W5UA 2LD4A 3H2IA 1TX4B 1DELA 1UDCA 1CQIA 1YQXA 4KXWA 1IBMB 3HFSA 4EHIA 3U3JA 1GDDA 4QWWA 4BZQA 1FYWA 1R1DA 4GZ3A 2PYDA 3HKBB 1WDWB 3DO5A 3NFRA 4U7TB 5H0IA 4MJ3A 3VDXA 2Y3IA 3H2YA 2P4SA 3ZZTA 3RFXA 4ZHQB 4DV1B 3F73A 1HURA 3USES 4EAQA 1H6DA 3JQ8B 1QSGA 4F12A 1J00A 2JFPA 4NCBA 4ZVQA 2E89A 4TLMB 2AWOA 4BMOB 2I7CA 3TWOA 2LNDA 3CNNA 4IX9A 4KHZA 3I23A 4MWGA 4TTQA 5BSHA 5ALWA 3VAZA 3QF7A 5EP2A 4KQFA 2P41A 4F4DA 1S7CA 4CM4A 4E70A 2PBRA 1Q2XA 4UKDA 1JT9A 2EFCB 1J0AA 1XHFA 1Z4MA 2V7GA 3A6HA 3OQBA 4UPVA 4NESA 1J24A 3D8BA 1E2QA 3UK0A 3D6HA 2RIPA 4AT1A 4PQEA 3EIUA 1P4RA 1YIAA 3TOCA 3LU1A 3SBOA 4XWOA 5LZ4A 3HR7A 2LZ0A 1C7QA 1J8VA 3FUVA 3RV4A 3TRDA 4QOGA 5BRJA 4D97A 1R5JA 2Z95A 2QUAA 1Z7YA 2Q50A 3FYUB 3OZDA 4BYMA 5B2EA 3DDWA 3PQ4A 3IB3A 2AT1A 3TIFA 4H7KA 2XVXA 2R751 4NY1A 1SRRA 1C0KA 3QE9Y 4H4CA 4OLBA 5JECA 1BA3A 4ZQBA 1UWKA 3KZVA 4HMPA 2V7BA 4M7WA 4NZOA 4B87A 1YV9A 1IN6A 4QZVA 3DR3A 5DPMA 1BMDA 1Y4UA 2H0RA 4Z9AA 1IXYA 4K6CA 1JXQA 3G0HA 4XWKA 3MLBA 2M9MA 4HB3A 1E5XA 4CM9A 1T24A 2BE7A 2PQMA 1H2YA 3AIIA 5IKPA 2OSBA 1PZXA 3EDMA 4EI8A 4NLLA 4RPIA 2UZ4A 3SN6A 4YDQA 1CP3A 5JJLA 2NACA 1P3Y1 3UFXA 1BMQA 3IIMA 3K9LA 2F43B 2EYQA 4M1MA 3RQSA 4B3JA 1J97A 1MH9A 4C78A 1OC2A 2H08A 3WOHA 4RTOA 1DEKA 1RHJA 2JANA 4NFYA 4Y0VA 1ZHHA 3TPZA 3P2MA 3VPCA 4ROTA 2XCRB 3UA3A 1ZD1A 2PR7A 2DMRA 2ZRFA 1YR6A 4ZVPA 2I9KA 3L6OO 3GOHA 1C29B 4RK5A 1P4HA 4Q66C 3O7WA 2PSEA 4H1TA 2AUTA 4WGFA 1G7CA 3F7TA 2HBYA 3CRVA 3LVRE 3NVDA 3TCXB 3W4IA 1KYXA 2Z4RA 2P9GA 2VAXA 1A98A 1XTKA 2HTEA 3CEAA 3TI7A 2ENWA 2ZRCA 3B6EA 2BZSA 1ULTA 3D7SA 4J9UE 1OAOA 4CM5A 2WD7B 1P1FA 1NDHA 1OLUA 4IUDS 3R6GA 3UW3A 4CFZA 2AQ8A 2QN2A 3LT4A 3TKAA 1X3LA 2JATA 3FH0A 1T2CA 1E2BA 2PKYX 1HEUA 1PQUA 3ZH9B 1YZKA 1ZMTA 4PS1A 5REQA 2ETVA 2IUEA 3TJMA 1A4XA 4KWTA 3MINB 1F0YA 3RGGA 1C14A 1EVJA 4FONA 4RKFA 3NX4A 1QU2A 1R4AA 3QVXA 1LF0A 4WERA 4FZRA 2WLTA 4K2HA 1TGYA 2VDQB 3KTDA 1ZO8A 1O3YA 2ZWIA 1PP4A 2YXDA 4OD0A 5F73A 3S2FA 3VYSB 3P45A 3LYUA 3T5GA 1W6RA 4R7GA 3SYRA 2R5FA 3T34A 4MOWA 5KZMB 4HDRA 3SYLA 1RABA 1A9SA 5JSYA 3GLGE 2ZJZA 4P38A 2PH1A 2NP7A 1YR7A 3CJRA 4MVCA 3GQBB 4XGIA 1VGQA 1RQ2A 1QX4A 1RE0A 3DM5A 3LPNA 4I9HA 1QRAA 3N6VA 1V6AA 2R62A 4DQXA 4EA9A 3VR3A 1E1DA 1SXQA 1SUPA 2AN4A 3AOGA 3QV1A 1OI2A 2LR0A 1DQPA 2ZYGA 3M4ZA 4ZXPA 2EWMA 5DNDA 3Q12A 5DT9A 3ETJA 1ZC4A 5TQVA 4E5KA 1UFQA 1C9EA 2QVYX 4JP8A 4ZPJA 3K6JA 2BBSA 4OB7A 3TE7A 1SH7A 3VYRB 4L6IA 2JH3A 4ID9A 4LBVA 5HXAA 2G4VA 3TW0A 2O2YA 1ZGCA 1KERA 3CUVA 3WQBA 4IMIB 5CXUA 5A0VA 4OHYA 1GU1A 3DVQX 4YJ2B 4MHTA 4WZBA 3BWXA 1FJGB 3U4HA 3C6XA 4ND4A 1M74A 2I4TA 2ZVPX 3NHWA 4H3KB 4MVJI 1EFRD 5BXQC 5I45A 5LWHA 3I37X 4E13A 5KOIA 3EWAA 1D09A 5HEKA 2DLNA 4ZZ2A 4CKYA 5F2KA 2WOJA 5AK5A 4X66B 5BPFA 2GLUA 4H27A 1U0OC 1ABFA 2C5GA 3DQZA 1FVXA 3LM8A 2IZOA 2NU6B 4D8XA 2DB3A 3PUJA 1QDLB 4J7AA 2NNLD 4MV8A 4O4HA 5A0FA 4K28A 2O3JA 1ULUA 4NMLA 2QD2A 3KNZA 3C45A 4Z5XA 3DMTA 2VJBA 2VPZA 3IULA 3KLBA 3Q7SA 4US0R 2B7BA 1PK9A 4YQEA 5C8DA 3IJ5A 3LL4A 4ZJPA 5EIBD 5T4HA 4ZJZA 4XYMA 4LZPA 4DCGA 4EJSA 1AA6A 1PJ4A 1WW2A 3L18A 4O0LA 4PBRA 5HDBB 4YP6A 1JJAA 1FFYA 1GAXA 2Q27A 1THZA 2O4CA 5F77A 5BNWA 3OE7D 1W59A 4MGYR 3D2BA 2SKDA 1E59A 4O4LA 4QUHA 1TTPB 4BV3A 3AWDA 3F4KA 6ADHA 2ERXA 5FHRA 4ZGWA 2W0MA 2PD4A 4FFSA 4IMPA 1U11A 5KKAA 1N33B 4IW3B 4FSDA 2FE4A 5BSWA 4QGAA 2FGKA 4FUTA 4QXAA 1H0HA 2P1RA 2Z83A 3DUFA 5G4KB 1CRPA 3U4AA 4P98A 1ZMBA 4EPXA 2X86A 3WK4A 4AJ4A 1CS0B 1T43A 3IMKA 5U4XA 3LQFA 1R0LA 4E30A 2VXCA 1ITZA 3HMQA 1XWIA 2YJ6A 4KR0A 2NM0A 1E1NA 1VA4A 1GNTA 1N3YA 1YR1A 1Z5ZA 2IXGA 4V39A 4WGGA 1JZSA 5A3SA 4L0QA 2Z3ZA 2QSUA 1YD7A 3V9AA 1BFUA 5AVKA 5KSWB 3C6MA 3EQ2A 3JSAA 4PPYA 1GTMA 4FGWA 4AECA 5FL7A 2GT1A 4GAEA 4NVRA 1H8HA 1DVRA 1YDFA 5BPHA 4GP6A 4U7FA 3RARA 4LJ7A 3I6QA 1B42A 1JEEA 3SIRA 2F1KA 1HDXA 4BLSA 2IPNA 2WZDA 5ARBA 2L0XA 2VR1A 4FJ1A 5AO9A 3W8FA 3PRHA 4HADA 5EJ8A 3RVSA 3BFPA 4LX8A 3JQFC 4Q5IA 4HFRA 1HORA 2PM8A 4D4LA 1IQ0A 1VBMA 3U49A 1GNQA 4MQLA 4S12A 4HJXA 4R9RA 4BMDA 5AOBA 5LC1A 3HXOA 3A1WA 3R8CA 5A03A 4LOAA 4ZVRA 3N7UA 4L8LA 5FP0A 3N1UA 3L7DA 1HEYA 4GPZA 4OAPA 1DC8A 5TGDA 1VYHA 3ITNA 4HYEA 4YA6A 4UEWA 1Y6GA 1U90A 4E5UA 2CVOA 2G71A 2GQ0A 2AR9A 1M6VB 1XAJA 1S9HA 4Z0NA 2MSNA 5D7NA 3P9KA 3GWZA 3MRXA 4UULA 4X6YA 1BA2A 2G8LA 2PZFA 1Q92A 2QRPA 2XQFA 1FFHA 1W19A 3LDFA 4MS4A 4OFXA 3WJ2A 4AYXA 5HJ7A 4TZ6A 2PX0A 1S1CA 4ZQHA 1XMJA 1XJWA 2E4YA 1ZK3A 3VU0A 1ZD3A 1L9XA 1SG6A 1BDHA 5I8PA 2YW2A 2EERA 4BO6A 3KLOA 3QJGA 2XE7A 1FDUA 4BUCA 5KQGA 5I8WA 4IJVA 5DZSA 1DJOA 5JASA 5LU9A 1JYSA 5L6LB 4IKEA 4OIFA 4JQCA 5K6TA 1Q91A 1TT5A 1OA0A 3A1TA 3IGFA 4RK0A 4ENTA 2NPFA 1JJFA 1Z07A 2ACVA 5CXXA 3F4LA 1AIPA 1Q7CA 1FX0A 1JDVA 1XZCA 3A6ZA 2QY9A 4WPGA 4Z4HA 1QTNA 4L4XA 3KDPA 3OMXA 2JH9A 3HXPA 4QODA 1YONA 5BWLA 1TM7E 2EDAA 5B1IA 3PF9A 2W11A 5JS2A 1PVVA 5LB2A 5I7AA 4Z9FA 1YZTA 2OV8A 1NJ8A 1GZSA 1RBQA 3O90A 5KYYB 5J2TA 1J20A 1OBHA 1NN1A 2XA2A 4HNAB 3QKWA 2RB4A 1VQ1A 4K9NA 1C4KA 3FUTA 3R77A 3UICA 2AJLI 3CIFA 1WV0A 4KIFA 1KOJA 4NQZA 4BAUA 3MLEA 1FFGA 5DO9A 3ELBA 3KBOA 3ADBA 1Z6GA 5D87A 1GIAA 3FN4A 2XKJE 5KAMA 5TQ0B 4D44A 1TADA 1UMCB 4RVHA 4XEHA 4HAUA 4PN3A 3GHYA 3AG5A 2GKSA 1HT3A 5JADA 3GI1A 3WVNA 3HDQA 4RQBA 4TVOA 4JI3B 4EYSA 3E5HA 4KW7A 1M9NA 1TJ4A 4NIMA 3AI2A 2IYZA 1E6MA 4B75A 1TM1E 4H08A 1KXJA 1QQ7A 5DNEA 1Y1LA 4L8WB 4EUNA 4OYRA 5A5DA 1KYTA 3WGUA 2DP4E 3NEPX 1XTVA 2C1XA 4EHKA 5ITVA 1MHPA 2QVLA 1E0SA 1NLMA 2Q2QA 2F1OA 4EY6A 4OHCA 3VR6D 3MT7A 1NIJA 1AS3A 3EY4A 3IE2A 4Z3KA 4IQGA 2FVYA 1ZVQA 1I3OA 3D1VA 4I6GA 4L28A 4LSZA 4CETA 2XIQA 1T9GR 5EHZA 2VZ8A 3EFEA 2C3OA 5H81A 4PM4A 1V1MB 5FQOA 2H9AA 1BVHA 4JVNA 4FFPA 1WDKA 1J33A 4Y0AA 2GCOA 2VA9A 3SKVA 3ZE9A 3O91A 1VTKA 4XVCA 5B7GA 4TVKA 2X14A 1ZFNA 3CF6R 3JQDA 4I4IA 4F97A 3RYHB 3EGDA 1YFJA 2NU7A 1QORA 4M1SA 2PL3A 1X80A 5A3VA 4PLFA 2A3NA 4R2MA 4TTTS 5FV4A 1CULC 1UXGA 1ZI9A 2EDCA 4ZMSA 2AFHA 2W2PA 4RHCA 4KVAA 4X7BA 1TJ3A 4DADA 2HJVA 3QHQA 1FQWA 2V9ZA 1SOAA 2WB4A 3F6RA 3KJGA 1JV2B 3NTQA 3FMVA 4JLKA 5D3KA 1J8DA 5HR5A 3L8ZA 5KVAA 1NQXA 3RLIA 4CEHB 3E53A 4PZPA 5K1ZA 2CV2A 2ZBEA 4EABA 5AJWA 4WOJA 4C2TA 1RKQA 3EZXA 3ANYB 1KE1A 1MD9A 2ONZA 2P90A 3KUCA 3U3MA 2WA1A 4LSMA 4HDQB 4JP3A 1PJCA 2WZQA 1SXJA 3EH2A 3OZAA 2VL7A 3IEMA 2CDRA 1QR6A 1G60A 2QN1A 2C9YA 4YPVA 5KU1A 1JQ3A 4JN6B 2OAQ1 2BMDA 4NPCA 1NUQA 4P3OA 3ORRA 2QU8A 1MGOA 1PWYE 3C74A 3FTPA 4HNGA 3B12A 1ZK2A 4LI3X 3ZV7A 3MM4A 3QU7A 1JHVA 3OWXA 1O6BA 1K08A 2QJRA 2VT6A 1JPNA 2WYWA 3GLQA 2BI8A 1JKJB 2XWPA 3CPSA 1SULA 4PQGA 2IYPA 4RZXA 1WU8A 1GL7A 2G0TA 1KVTA 3VV3A 3HA5A 4OFWA 5ECYA 2Y99A 1FDTA 5E6SA 4XYGA 3F5DA 1ND5A 3MWJA 4QT0A 5EQJB 3GRCA 2HWYA 2H2AA 1NV8A 3SE0A 1Q14A 1QRRA 1LSSA 1IHPA 3VH4A 1XUOA 4IDGA 4KXLA 5E4JA 3TMKA 4D96A 3ZE6A 4QXPA 3BAFA 4F5ZA 2QE6A 1O08A 2OCGA 3TINA 4FC7A 1G0NA 4TN1A 4KWEA 1RE1A 1A8QA 1TUGA 2DHCA 2WDPA 1D07A 2D8MA 4KMMA 5T4EA 2RK6A 4RH0A 1D0SA 3W5VA 3G2PA 4WJZA 1KBZA 5J43A 5JIBA 1W7AA 4XFKA 1KZ9A 5J5CA 1D1PA 4O4IF 2FTKE 2AD5A 2QG9A 3R7NA 4E6PA 1HQYE 2O2DA 2W2TA 3BDAA 4UZFA 1FE8A 4NYMQ 2JC3A 4GMFA 1IZ9A 5LD2B 1GKKA 2MYUA 2QRZA 3LNCA 5KX5F 3G68A 3D6NB 5MN5A 3EZLA 5SICE 2W9XA 1Q20A 1PR5A 4TS3A 1EX7A 1NLUA 3B13B 4G1BA 5CNJA 4BLTA 1CY6A 4YECA 5ITZA 3CNQS 4L4RA 4LV6A 3EHDA 3ER6A 5G2OA 1LLQA 4MQFA 3QKRA 2XZTA 3EQ9A 2WOOA 3N9IA 2GZRA 2Z2JA 3PC8C 1H94A 4JD5A 3RF6A 1SVOA 4C0XA 3PEYA 2MYNA 3A4YA 1W88A 2R1ZA 4JJZA 3O03A 3UQZA 4G1VA 1OYVA 4NU0A 2DR2A 1Z2AA 2IYYA 4DMHA 4BRWA 1W4BA 4H3HB 4P3XA 4Y9RA 3BK1A 3OY7A 4PYMA 5G1OA 4C7VA 5CK5A 2BGNA 3LG2A 3P2JA 3S2EA 2BGUA 4OPMA 5ALMA 1Z13A 3GGGA 1SGWA 1J56A 4L16A 4XE5A 4MCIA 3W2HA 2O7RA 5EIWA 1VIMA 5CBKA 4Z7QB 3BF8A 2CCJA 5LA6B 5ALPA 4CCYB 3I4FA 4BFVA 4N41A 1W73A 3ZVNA 3I6ZA 4G0OA 3S2ZA 4H1WA 2YC2C 1EP3B 4PG7A 4JC8A 1R0XA 1ODFA 4E21A 2RGGA 4KGXA 3F96A 1ACMA 2XTMA 4GSYA 1J1ZA 1U04A 1XMPA 1BJRE 1XL0A 4DIBA 4EX7A 1UFRA 2PWAA 1E89A 1VHTA 3MTJA 2BW0A 2EGUA 4WD3A 4H60A 4DR2B 3WMGA 4RIEA 1KJWA 1V96A 3VAYA 3QVLA 3MAJA 4EJSB 1XNGA 1SVUA 3Q3IA 4J1QA 3OESA 1MX9A 2ZSBA 1YZNA 1T5BA 1ECBA 1CEXA 1DWOA 1FTSA 4YJFA 1T4BA 4KO1S 3MS4A 1JMYA 1RHKA 1J06A 1FTGA 2XYVA 2ZXEA 1KEPA 1DOAA 1QZUA 2DUNA 1JXOA 1IBCA 2W98A 4JT4A 4KKXB 2GRUA 3PV0A 1N2GA 4PTYA 4MHSA 1SC6A 5IKMA 2OK8A 3IVMA 1I32A 8ADHA 4F2WA 2G83A 3SQNA 4R54A 5EJ4A 1U7ZA 1TW3A 2PEZA 2R8OA 1N5IA 2PZMA 1Z4PX 4J07A 3I1JA 4C4ZA 2MYTA 5LWQA 2OMKA 2CV0A 2HRCA 4FE3A 3BICA 4LZNA 5WRFA 4D2IA 2FY8A 1UXJA 4QPNA 5A5VA 4JXXA 5AM2A 2MYPA 5K0LA 2FZLA 3V80A 1YMQA 1V7CA 4R8VA 5KTPA 1KMIY 2H1VA 4F3KA 4BGUA 2XI4A 5H02A 3ES9A 2G8NA 3GA7A 4IDOA 5LQMA 4XUEA 2OHIA 4QG3A 1GTG1 1C1DB 1E6LA 3ABOB 3IJRA 3HDYA 3IPYA 4MMXB 3RKRA 2OP1A 3AUJB 3E70C 3MJDA 2GEUA 5CDTA 2HBRA 4U2EA 2ODAA 2OO5A 4QO8A 3TI9A 2YWFA 2PUJA 2EZ4A 1EWVA 1W96A 1P73A 3MELA 3HQ4O 5DCUA 5ANRB 2AZTA 5G02A 1J5EB 3RHTA 4F0JA 3PPWA 2XVMA 3ANTA 1XZIA 1ECGA 2JJ1A 3PLNA 4GBGA 2WG1A 4Q9IA 3SDBA 4DLLA 3HBJA 3QVWA 1PYOA 5IS2A 1ZL2A 1YDMA 5H9WA 2IK8A 2JBAA 3EZFA 2A86A 2B83A 3D4NA 2Q3LA 3PD1A 2XEXA 1N6LA 1TJYA 3R0QA 4J1NA 4PSVA 4JCCA 4X1OA 3SS8A 4YRAA 4H0NA 1J2RA 2J31A 1A5BB 2HCJB 3NNDA 4CBVA 5IT0A 1B8PA 4LRQA 1ISPA 5ADUS 2FKNA 3HV2A 4IGAA 5B1SA 2GTPA 4D9FA 3URKA 1SNYA 5MN6A 1V47A 3KVNA 1K5HA 3H8VA 1OY1A 4YT8A 5EHIA 3QVKA 2GPBA 4AG3A 4Z53A 3M6MD 4KFCA 3Q7QA 4O0MA 3DLAA 5FNVF 4RDCA 1QYRA 5L3VA 3DF7A 3CUKA 1QK5A 3I3SR 2Y1OA 3N3BC 3EMDA 4HDKB 1F2TB 1FRQA 2HB6A 1VJ0A 2X41A 1XXHA 3IKMB 3I53A 4JJFA 1NVAA 4LYDA 2W6NA 1QG6A 5IBPA 1ZX1A 5HILA 1P81A 1DKQA 1HLPA 2QTHA 2OM2A 3N2YA 5EE9A 1USIA 4Q1DA 3RROA 3TS1A 4OF4A 3T15A 1H4SA 2C5EA 1HV8A 2O7SA 3GEGA 5CCXA 3IXQA 3AUUA 4FEEA 5TGTA 2XITA 1LU9A 4P4SB 5JNSA 4DDHA 3KJXA 4M0UA 2LCIA 1SZPA 1XCGB 4P3PA 1OLXA 1NNEA 2RB5A 2PMBA 1Z0JA 3PFNA 2HHHB 2ZZKA 4EW3A 4UVDA 1T9DA 3NAMA 3OETA 1SKAA 4KJZA 5HA5A 4LDNA 1TI7A 2Z3VA 4JYCA 4R1SA 2B5WA 4RF2A 5CLQA 2NVUA 4YMUA 4YR9A 5JSFA 4E5VA 4LC1A 4HH4A 5C80A 4B7AA 8LDHA 1XP5A 4OOEA 3KJIA 1KI9A 1OXKB 2J5BA 4HI0E 3T7EA 4CT0A 3BA1A 3DJFA 3AMVA 3ZVMA 1OH7A 2GS9A 1M8GA 2ZDQA 2EP5A 1UJBA 4I3HA 4URUR 4YJGB 4IIHA 1I4DD 1M83A 3GW8A 5ERXA 1CXZA 3S68A 1PS8A 1YZFA 1UPBA 1BS2A 5I5GA 1JR3E 3DV0B 4O2BF 2VEOA 1TF2A 4UDOA 1QE3A 3TB6A 4L50A 4BCBA 1G9TA 2ZE7A 2QMZA 4YRTA 4BUZA 4KQWA 3BPSA 1ECFA 4H59A 1HK7A 3AL2A 5TB5A 4A16A 4FK8A 1NBHA 2L42A 2PSSA 1VCNA 4ZKEA 4DVJA 2Q4BA 3NUQA 1M8PA 4YBZA 4Y1FA 3IUNA 3A10A 3E1KA 3G9XA 2V6BA 4RACA 1I7QB 3A6PC 2ZTVA 3J81k 3GJTA 4BE4A 2FEKA 4X45A 3I0ZA 4BNXA 4YI3A 1Y5IA 3SXUA 3T5PA 2NZUG 3IEUA 3A6JA 3TQQA 2HPHA 3TXAA 4E2FA 5I7SA 3EG9A 3N75A 1NBEA 2IYVA 3NHPA 1IY2A 1VDZA 2PEYA 3C3KA 4R5HA 3VJKA 4E14A 1MPTA 1N6IA 4GLJA 2H4YA 2ZUWA 3RYFA 3L0IB 2AXNA 2QWXA 2R8RA 3M33A 3PFCA 2GEBA 1IZ7A 1SBQA 2I1WA 1LJUA 4MAMA 1KARA 1NRWA 2WTMA 4XCQA 3G13A 4MRVA 4WADA 1A69A 5FUBA 3UJPA 4BLOA 1O0SA 5E6UB 3H9JA 1TD1A 1IIRA 1RWPA 1W36C 1WUKS 3KUDA 3SHVA 3UH0A 3V7FA 4S35A 1C2YA 2I67A 1S2MA 2Z56A 3LTNC 4C3UA 2AEFA 3D6AA 2P9JA 4UEQA 5KJCA 4PCLA 1FFXB 2IX9A 5K8JB 4OK3A 1EPUA 3ETEA 3AR8A 3OFVA 1YL5A 4UBMA 4ENRA 2ZIXA 3CIOA 1U8UA 3KAQA 4TTVA 2WTXA 4OP2A 2DQ4A 2OXCA 3AUFA 4RA9B 3MS7A 4X41A 5J4LA 4F56A 2PUEA 4JWKA 2WU1A 1MH1A 3Q3CA 2WNHA 4F6LA 1VPVA 1S5PA 2UXCB 3WJ7A 4BOYA 2W2QA 2W4IA 1FDSA 4I55F 3TKYA 1KKUA 2PMWB 4H77A 3CZAA 3QBDA 4URXR 4GVLA 4BVKA 5KJ6A 4O1HA 2XMCA 3IEKA 3HL0A 5E6SB 4HGOA 2R8EA 3IR7A 3ABIA 4M0KA 4CMGA 3Q98A 2O2HA 3KPJA 4JKOA 1AKYA 1NATA 1E3MA 2OC9A 2CWWA 4ZU6X 1K3FA 4G0XA 2FFRA 2CXPA 3V8PA 5KDDA 4EG1A 3ICOA 1LBIA 3ZWAA 4JZKA 4KXUA 4HN4B 3QSYA 1L8QA 3B9PA 3K5HA 1SXPA 2H4JA 4WOPA 4FI3C 4F71A 1G4HA 2V7UA 1VCMA 1YOVA 2AA3A 3VKFA 3NHMA 3CMCO 2Z6QA 3LX8A 2I8LA 4DGQA 5CB8A 2CBGA 3PD0A 4UBOA 3BSSA 3LLUA 1V3VA 2YJTD 4FE7A 1S2DA 4MYDA 3N8HA 4DLYA 2YWXA 3LBYA 1UM9B 2ONJA 1G6OA 3M3DA 4DN6A 1JBQA 4I9FA 1MOPA 2ZAYA 1ENOA 2NZYA 1B0UA 1HSZA 4XQ0A 4A4DA 3VTKA 4KC0A 5CMLA 1EGMB 1WIWA 1YB4A 4UTVA 3EXHC 1T6BY 4YUXA 1HDRA 3L7YA 4XX1A 1Z17A 3F49S 2ORED 2G88A 3LRXA 3W9UA 4KVFA 5TQ0A 3P2IA 4TQGA 1RAIA 1PJ8A 1DJPA 1XDSA 2P2NA 3GZTB 2ERCA 2GVZC 2O5VA 3GDOA 2PG3A 1HFWA 1VYVA 2O20A 2RHDA 2X2FA 3GNLA 4I6EA 1E9FA 1BCRA 4RXMA 2AHRA 4HYQA 3HN2A 1XCPA 1W8IA 3O8RA 3KWLA 2QOEA 2FZ5A 1CC1S 1TK3A 1G98A 4Z51A 2FUEA 3WL8A 3Q72A 5BNZA 1CU1A 1UEJA 3TEJA 1A8PA 1KA9H 4MUGA 4JI6B 1PGOA 2A9FA 2EU8A 4ZU1X 3WXMA 2XQJA 2QT1A 3EIHA 4HRVA 3C1AA 4KPGA 3M3PA 5L95A 1YBFA 4PSUA 1SOVA 4JDPA 4RLFA 5CXSA 5CITA 5BY2A 1NQAO 1K6EA 1AK2A 3ZX4A 3ED5A 3EVBA 4LHYA 1H4VB 1EIWA 3MW8A 3TTTA 4K9RA 3GPDG 2BEJA 1PSZA 5REQB 1QK3A 1MOZA 3E3NA 1NVVQ 3FTFA 1Q0SA 5CA1A 1GTZA 3N7TA 4MO2A 5A02A 5K0GA 4MDFA 3OBBA 1CT9A 2FRXA 5EWJB 3WAJA 4F4JA 4KR3A 2Z9DA 3PGKA 1X39A 4XB6B 4P3NA 3FRIA 2XGMA 3IV9A 4LY0A 3NMUF 4YRIA 1L7BA 4BQSA 2CNWD 3ESQA 5B57C 1WTCA 1Q19A 1NOKA 2GF0A 3PC7A 2B0CA 1N6KA 2HV8A 3DOEA 1VHDA 1L5KA 5FUQA 1DXHA 3MJRA 4DB2A 2FPIB 5BR1A 2VAMA 1LZKA 4QGFA 1BX0A 1G21A 3D0KA 2KJQA 4ZOQI 5JAIA 1ZHOA 1BWPA 2WF9A 1TL7C 5JDIC 5JCJA 2ZWOA 1X7YA 3U3KA 3IIJA 1MEEA 2H54A 2ZRDA 4LJRA 2H9YA 1U3UA 1EJBA 3EXIA 2OAP1 4TKZA 7ADHA 1K27A 3BH7A 1VBKA 3K30A 2ROQA 2X7HA 2W37A 4WCVA 3NWPA 5AUOB 4WRRA 3PC8A 5FUXA 4G8BA 4RHTA 1HE4A 4OAOA 2MCFA 5JYEA 4KACA 1GA6A 3SJCA 7ABPA 4Q1EA 3WI7A 1T1SA 2GTIA 4GNRA 1AQUA 4AICA 1QYXA 2REXB 2V7QD 5L53A 3PQ6A 4TZKA 1Y34E 4Z2YA 5H80A 3K96A 1LXCA 2B1IA 3JCZA 3WIOA 5SY6A 3Q40A 3NM5A 4DBLC 1G38A 2RHWA 5EE0A 4GMKA 1Q44A 1TM3E 2CXQA 3QEJA 4M76B 4ESVA 4JZYA 2QXUA 2R1TA 4IXMA 2XUZA 2PUVA 3HE3A 5FA5A 1E1QA 3GRPA 1RJWA 1U7HA 3NEAA 2XMGA 4P81A 1ONNA 1WY7A 2HR1A 4NCJA 1MC1A 3FUXA 2CLCX 2PXHA 3WP1B 1E4YA 4B6PA 2IS6A 1NDUA 3NDRA 5FBHA 4BQFA 1OBFO 2XDAA 1N3IA 1L7EA 1V7ZA 4PYKA 1HE3A 3ZJ4A 2J3KA 3GR6A 4ZZ0A 2C0PA 1PD1A 4AJOA 4KR2A 2Y4NA 5ALOA 4IXWA 1JA0A 4IIDA 1E3IA 5B36A 2ZJAA 1Y1TA 3I04A 1ISFA 4HB0A 4E46A 4HY3A 3R9WA 2BTQB 1D6NA 4UMEA 5J58A 4J0CA 3LKDA 1P80A 2AFIA 3MSXA 4MPJA 3AF2A 3CJTA 3LWDA 3HWRA 4Q1VA 1FS5A 4GBED 3TSAA 3EYAA 4L5AA 2JI4A 3O3MB 3E8SA 1OV6A 4YP1A 4E88A 1ZWLA 4KI7A 3JWIA 2I4IA 3VPGA 2HT1A 4RGQA 5IF3A 3NAGA 1RXIA 2BHNA 3VKVA 4EKYA 5CD9A 2YNMA 1EK0A 3N3AC 4M1ZA 4MAAA 3T5AA 1S3IA 5JAPA 4JBXA 3GLSA 3PTAA 2WAAA 1FTQA 3CC8A 3GUZA 4RPLA 2OYCA 4AWXA 4ETWA 4PFKA 3USZA 1QUFA 1MCZA 3R3VA 5I7RA 3NH9A 4ZT5A 1ZN7A 3S3TA 5E6RB 3S55A 3HLTA 5AFSA 1GOTA 4DMLA 4B31A 3KZ1E 4MB2A 2FQXA 1T13A 1VB3A 3DDUA 1M2WA 3D3WB 4IILA 3B89A 4D0GA 5FAXA 3K5WA 4G09A 5HKAA 1NF8A 4PQFA 3DE1X 1LK0A 3HCBA 4OUKX 4QQKA 2G5TA 2Q28A 3QG5A 4IDCA 3C6KA 4GX1A 4B3CA 3EXAA 1QZ3A 1JIKA 4O08A 1AQYA 4HN2A 3KOZA 4MRMB 2YWEA 4XSVA 2WUEA 4ZP1A 3WLAA 2V98A 1VI6A 3FAKA 3WL3A 5F4ZA 3KUKA 2E7ZA 1C2TA 1PT9A 3DXZA 2BJHA 4L7VA 1GU0A 4NZNA 1TT5B 1GRRA 1W0JD 2OCLA 1RXYA 2C9BA 2ZIFA 3O1IC 3V7WA 4DSNA 1XAGA 1LNQA 2WT4A 4KN5A 1M75A 3SZUA 1O87A 3KG2A 5FULA 5BWOA 2Z5LA 5K2MA 1O58A 1G8YA 1FY2A 3W2IA 1IOZA 2Q7DA 3F98A 4MA4A 2Q1XA 3RBZA 3SR4A 3V5NA 5BWNA 2GKGA 2VHWA 5KNDD 3OI7A 3REFA 4WQMA 4D8YA 2WIAA 2WSSD 2YTZA 2O8FA 2H07A 2J3JA 3HJHA 5LQJA 5HNKA 2F9LA 4G81A 1K4MA 4L7QA 1E9SA 4AMVA 3BJMA 4CDRA 2ZE6A 3R75A 3WK7A 3BMCB 2QT9A 1NJFA 2H17A 2J07A 1W93A 4NE2A 1M2EA 1L6RA 3KWFA 1CUBA 1E1LA 3D4LA 4RLHA 5AJHA 4DY4A 3TR5A 1U7WA 2Y6VA 2RHHA 4MQMA 4N6NA 4O4HB 4R8MA 1V0JA 2ZK7A 4RVOA 1XE3A 3T7AA 4CV0A 1P19A 3V42A 3BUSA 3NT5A 4TUYB 2ZAIA 5B4TA 4F6RB 4FT2A 4C01A 1YH3A 2CHEA 3JQGA 1BOFA 4U2KA 3TJZA 3R9XB 2GA8A 1MABB 4PXYA 4WTOA 4D0NA 5AOCA 3RYFB 2XZLA 1ZXLA 3GDGA 2M6RA 2VO1A 2FNAA 2YUTA 3GNSA 3GRYA 4EUSA 1NMYA 5AXAA 4TV9A 3S0JA 2X2OA 2P4HX 4X71A 3SWWA 2WE7A 4RV9A 4XEUA 1CJBA 2W2MA 3AR6A 1WSBA 1KQNA 4XJVA 4LX0A 3COPA 4UREA 4RTPA 2R68A 1JKJA 4M7RA 3TLGB 4IH9A 2G1KA 2D2FA 5L7WA 1WZEA 2DR3A 3DZKA 1QOPB 1DTWA 2QVZX 4MS1B 2ICAA 3O8DA 3CONA 2QRHA 4XM2A 1EXWA 4MZXA 2YFHA 1N32B 4BATA 5JYCA 1E79A 4II2A 2WY2D 3R23A 1BVRA 4LXHA 4TKLA 5MHTA 1WS6A 3FWNA 4NL4H 1CR2A 1G5IA 2VATA 3PUHA 4IVPA 4I1IA 4IIGA 3G6WA 1G5QA 1N8KA 2OLJA 3GUVA 3WLKX 4N12A 2W22A 4PSCA 5CFNA 1STOA 3EA0A 1SCDA 1QHYA 5ALQA 4LXQA 4BNWA 1NMXA 3UTCA 1XDUA 3G2NA 4ZYZA 1RRPA 1RWOA 3TBHA 4D0RA 2QRKA 1FSSA 1UM9A 3H5NA 4Z49A 5C9ZA 3NEJA 3QMWA 4ZTBA 2HWWA 3HHEA 1AS0A 1ORRA 4MIKA 2FKAA 2PMEA 3RUDA 1BD3A 4A92A 3T8YA 3I64A 3ZKWB 1J8FA 2X9NA 4AN1A 5IJ9A 3ON5A 1WZUA 1NNLA 4HF7A 3CTPA 4RK6A 2Y77A 3BXGA 4FE4A 1A9YA 4ARIA 2HD4A 5EWLA 3NLLA 4XI9A 2LDXA 3KZMA 1FU8A 2ZS9A 4X65B 3PJRA 1MLDA 3UWMA 1DP4A 4CFSA 1LNZA 6NULA 2HREA 3NATA 2B6HA 4PTZA 4ARZA 4CM8A 5LMCA 2JLVA 2FU5C 1MUUA 3GARA 2EYUA 3D2LA 1M66A 3SEAA 1QGUA 1UXHA 3UT5A 4DPMA 1IWOA 3JAMA 2PCJA 1VSTA 4Q1BA 2WUFA 3MWDB 4KWHA 3LCVB 4YP5A 4ZVOA 5C2JB 4HTFA 3T0FA 4LYYA 2CUKA 5FBRB 4ASUD 4DXHA 3IT1A 3TO5A 2VUSA 3CR7A 1CUZA 4IGKA 5BQPA 5K3SA 4AD8A 1XDGA 3G8DA 4YB8A 2Z57A 1N9ZA 2AJCA 3P0IA 2FPRA 2V58A 3C3MA 2OB1A 2PGXA 1A5TA 2C2MA 2I2FA 3GRVA 1ADJA 1V45E 4GP9A 2P9TA 4TRRA 3ZXIA 2EZ9A 4ZWNA 4TYWA 4MW5A 1GPAA 1JECA 1W0CA 3CZQA 4Q18A 3Q1LA 1SUIA 3ZG6A 3ZGLA 3ONDA 3EN0A 3Q9NA 3WO0A 2H8GA 1OT5A 4J3NA 2EAUA 2J3MA 3H4MA 1D2MA 1E9EA 1EFVB 3DOIA 3GVPA 1ODLA 1AX9A 1RYZA 3OBIA 3QWHA 1N25A 5EXDA 4O3MA 3PPVA 1R0RE 2JFWA 4I5GA 2WJIA 2EG5A 1MRNA 1AA9A 4QXRA 5DWDA 1PQ4A 3CUTA 3ABRB 1XTPA 1JG3A 1I2AA 5AKEA 4A6XA 2YZ2A 3OZBA 3IQEA 3HB1A 2H1HA 3RR2A 2PSDA 1JAHA 4U6QA 1VIVA 2R6HA 4C6TA 3UHPA 3J81A 1D9XA 3PUXA 1IJFA 2FN3A 3U17A 2N46A 4HDMB 2X0DA 3KEMA 3V4SA 1JP7A 1YR2A 3JQAA 2IYTA 3A9WA 4N7MA 1ZIPA 2P4UA 3O8LA 4NDZA 5DRTA 1FFBA 5DK6A 1Z2OX 4NMXB 4DLPA 4BN4A 5JZSA 1Y8CA 2ZRAA 1FC0A 3EG9B 4WFIA 4W5QA 3G5MA 3ZWPA 5T67A 2EW8A 2GERA 1AQ6A 1PRYA 5EFOA 4P5DA 1A96A 2C7QA 1N1EA 3TEFA 1H42A 1FQOA 5FPPA 3U61B 3FHTA 2FF5A 4JC4A 2PVSA 1K8XB 3I28A 4AL4A 4EGSA 5CB4A 1T1JA 4JSYA 2DFKB 4JQZA 4J0QA 1M1XB 4D9JA 5JNLA 2WJ6A 3GLIA 4OATA 5B2FA 2C4UA 2ZSIA 4NQRA 4WA8A 1K89A 3S2IA 2DQKA 1O77A 2M1XA 4MQEA 5KTRA 1ZINA 2E5FA 4JI7B 1XV5A 2DERA 2PZKA 1GZ6A 5AVZA 1HXHA 1L7RA 3MG9A 4RFVA 3KDAA 4AJNA 4Z86A 2L17A 1ZA2A 1Y3DE 4X1YA 4F4CA 1N8SA 2J6IA 3A28A 4JXZA 5AKYA 3C39A 1GU7A 4F9GA 3OT1A 4U9UA 4RJJA 2VYNA 1NTRA 3VSDA 2G4LA 3CW8X 3LUDA 4IHQA 2H1CA 2R6CA 2ZGVA 5EXEA 1CEYA 5CR9A 1D2HA 1OU0A 1WW3A 2OSVA 3PX3A 5A0TA 2X8AA 1D0IA 4HNAA 3LUKA 1XAHA 1PEKE 1REQA 3HG7A 1GCOA 1P0CA 3LC7O 2ZE8A 2LRHA 1RMQA 4CQMB 1U8YA 2Q5FA 4EEKA 3ADCA 1U1CA 1Y48E 2VDJA 2ID4A 5HS6A 3L46A 2Q3DA 1E9RA 1YB6A 3AB3A 3G9UA 1II9A 3T3OA 4MPPA 1U8CB 2ZQYA 4MV3A 4DNPA 3S8EA 2C00A 1XD2A 1XX6A 3H8WA 3RD5A 4BX0A 2CMKA 2OCPA 3AUKA 1H23A 3IMCA 3Q2OA 2A7QA 1JPVA 2JEZA 4GRIA 4O1MA 1IY1A 2AYZA 5JV5A 4U2FA 4WLUA 1T6XA 2ZUSA 4YFVA 1Z37A 1GP2A 3TGLA 1GCGA 1FP2A 1PSWA 2JARA 5HF5A 4BE7B 3RU9A 3TNLA 3CZ5A 4KQCA 2Y0BA 3CRQA 2GXQA 3HN7A 3UG6A 1NM5A 2YVUA 1TCBA 3KLMX 3P7MA 5EZQA 5TS3A 4LCEA 3GLKA 5FEUA 5D6NA 1PI3A 3DE7X 5EUCA 5E9AA 3KPYA 1APBA 3R2JA 2RGRA 4Z3OA 1F38A 2Q46A 5DB4A 4ZAWA 4CLRB 3RBAA 3KT3A 4DIDA 2WD9A 2ZIWB 2QZSA 4RTRA 2YOGA 4PFJA 5C8VA 4AKGA 3G5LA 4GQBA 5J4VA 1B26A 2A5YB 1KEVA 1AXEA 2GJSA 2MINB 3ETLA 3LT0A 2QZ4A 4HYYA 3R0XA 3DMPA 3JYHA 3CE9A 1DX6A 1SWWA 3PTZA 3DFMA 3GT7A 2NVUB 2OHXA 3L40A 3NT2A 3SSAA 1NSYA 2JASA 4NFSA 4BZWA 2O8CA 3K09A 3I2HA 2XT0A 5AJZA 2H1OA 4QLAA 1XDBA 3VV2A 1GL6A 3GZNA 2VP2A 4WCDA 1KH3A 3VGJA 3QI7A 4MUYA 1F2VA 4JJIA 3ZHYA 4CF4A 5ITSA 3CSSA 1PR4A 3MAAC 4CGYA 4B3TB 3FYUC 1IK6A 4EOGA 2CBXA 3CQ9A 3SQOA 3WC4A 2RKWA 3CY6A 4NDAA 4EJ0A 3IMEA 3LO8A 4YAGA 4DV0B 1NUTA 3KKOA 4TUYF 5JISA 1RNLA 4RHEA 2O1WA 3AUSA 3W1VA 2JGNA 3BXOA 3NQ41 3FOCA 2CYAA 3CRZA 4LQCA 1IY0A 4MDYA 1CUWA 4RHYA 1E2PA 3WMWA 5A9TA 1L5HB 1LPPA 4N39A 3UMCA 2C2KA 1ZW1A 3VSEA 3O9ZA 4EGCB 5EA2A 5F51A 1VLMA 3EVEA 3MMPA 4FQ8A 2J9ZB 3V8NA 3HACA 5AJYA 1J0BA 4ARSA 4DTIA 4Z1MD 3MGGA 1JFSA 2YWBA 3G6KA 4ALJA 5KQSA 1TYDE 4BNJA 4WUTA 3VYUB 2D2EA 1OZAA 1K7CA 2I2CA 3ZPXA 2HMYB 2XXBA 4BRUA 4ZFNA 3IDQA 1WXXA 1I6WA 5FBZA 1J2YA 1ZCZA 2I65A 5K3AA 1EKXA 2DCMA 2ACWA 2B82A 2OKCA 3OIFA 1R64A 2OYRA 3KE8A 5E1OA 3IP5A 5MFZA 4M0EA 3R7LA 1YVEI 1FP1D 2O2JA 4LVUA 3SXJA 5KJ1A 4CEIA 2OCDA 2IBMA 3F7MA 5JMPA 1Y9JA 4EK9A 1U3TA 4Q3AA 4GM0A 4CN8A 2H65A 3RS8A 5H1YA 2HU2A 3I9V1 2ZLBA 1DTWB 3A1CA 2Q3EA 4II7A 3RE1A 4EMBA 2QU7A 2OHGA 2XYGA 3QLJA 2INGX 4GH5A 4DLXA 3VU3A 1KIAA 1V2HE 4MICA 2D62A 4PHCA 4A82A 4B6RA 1OKKA 1OQAA 5J2TB 5EWJA 1NT4A 3N39C 5DBIA 1SHUX 3STUA 3AWIA 3QLUC 1YKSA 3P71T 4AIRA 4DT1B 1XALA 2BUBA 2Q6OA 4MR9A 4F5YA 2JVIA 1T36B 1Z5OA 4P08A 4C43A 4DCUA 3I62A 1KC1A 1FFEA 4BB9A 2ZQ5A 4YGYA 3ANXA 1O03A 2VDKB 3HU3A 3C70A 2FPGA 3I42A 1BQEA 1Z5PA 4L5JA 4PYLA 3ZGOA 3ZUPA 4C0WA 4RZQA 4UTNA 4KB5A 3K0FB 1XGKA 2D0DA 2P9YA 2ZI7A 5AVTA 2DC1A 4C06A 2H1IA 3LD9A 1RQLA 1YZQA 1YULA 2WILA 3DMYA 2NQ2C 5BSEA 3GPBA 3K6KA 1RAGA 1H0SA 3P2EA 4RTQA 3UXYA 3RHSA 4G5RA 5FJJA 3TD9A 3ZNPA 1VCOA 2R86A 1LV8A 3FI0A 3U1VA 1ZOSA 1W30A 1I4TD 5TMPA 2JJMA 4NYJR 1M1YE 4QL3A 3WLQA 2O1XA 3KVOA 4NOMA 1GA4A 4N3CA 5HFAA 4B84A 1VHWA 4DREA 2CLSA 2X0RA 1SCUA 4UOEA 5AVQA 4NAVA 3DGEC 2YCBA 5CB4F 5IX8A 3FKSD 3I9V6 1DUIA 5IU6A 5IT5A 1WHSB 4C0QC 3M1LA 3JYPA 4RPJA 4M1OA 2VZ9A 5DGIA 1DZ3A 4LYHA 3S5JA 3MUFA 3WRYA 4H3SA 1DIHA 4XFDA 1YWGO 1II0A 5ALSA 4RF5A 3THWA 3ZWOA 5IEBA 1WV1A 4HUQA 1VP9A 2OILA 2G7MC 4XLLA 3CLKA 1MB4A 2PLRA 4UC0A 2ZATA 4V24A 1UK6A 5EHXA 1DDOA 1SJ9A 1JUDA 3KHKA 2ID8A 4I14A 4GGPA 2FSSA 3BIJA 2VCEA 5LCXA 2IEAA 3K32A 4UM7A 1Z4OA 2BTOA 4V0SA 3QPWA 2VXBA 5LBUA 1CZKA 1T4MA 2GX6A 3TBKA 1VJGA 4MVJF 4X7MA 5ALYA 1I13A 1O6ZA 4X1KB 3AEKA 4R3WA 3MQ4A 4JEIA 2I29A 4R1NA 5DLEA 5BVGB 1JA9A 2IE0A 1OE0A 1IMOA 4XWAA 4A0SA 3OCWA 3QYAA 2B2NA 3SD7A 3D8NA 3A6FA 3BD8A 4YRDA 3ANLA 5A7HA 1MNQA 2VVTA 1Z15A 2ZCVA 4PX9A 3ZW8A 3Q8KA 2DUMA 4KH1A 3V8EA 1X9IA 4PHHA 1EDEA 3IT3A 3DW1X 2VAWA 4NBKA 5K4HA 2YY7A 3RNOA 2JAPA 2ZYHA 2ZUUA 1D7OA 3JU3A 1PS9A 3NM6B 1A72A 2WSYB 4FYMA 4C7OB 3CR3C 1GNVA 4OGWA 3C8ZA 3PA6A 3V33A 5HFNA 1K8RA 3WOVA 1XTBA 1NOJA 1K2WA 4GEGA 2PE5A 4UFNA 4FGLA 4RTNA 1BWRA 5AVVA 4BLRA 3DMHA 2FDXA 1CUXA 4MYUA 5CFMA 1VM6A 1IK4A 5DTJA 4Q6WA 4L9RA 5AHOA 1JR6A 3AESB 5DISB 1D6MA 3BHIA 3DMNA 3EDYA 1JBKA 1Y3IA 2DBZA 3DL7A 3JALA 4M7OA 4PC2A 4FQ5A 4UAGA 5DP1A 3VZPA 4C3ZA 5JH7F 1XEWX 4CMBA 5ALZA 1W5SA 1G9XA 3ND7A 1YDWA 4G84A 2I6XA 1GLNA 5UKDA 1RRVA 4A6EA 1I24A 5LXTF 4XFJA 2NXNA 1PGNA 2VF2A 4FFBB 2FQ1A 1GA1A 3UF0A 4M8KA 5I47A 2QYOA 1ISSA 3BKWA 5TF4A 1ZISA 4BDTA 1ONOA 1X7DA 4MTCA 1PDOA 2GYVA 4PLZA 1XNRB 3GVHA 1KI1A 3FMPB 4WK0B 3QPVA 2Q0QA 4ZGGA 2BP7A 3OO0A 2VK8A 1SIBE 1R18A 1PKXA 4XGNA 5JU6A 1TKAA 2Q1SA 3ISVA 5HQ3B 1XSEA 2OOSA 4HCJA 4LOIA 1VL0A 2O48X 1MW9X 1M5RA 4H1HA 1PR2A 1HWYA 5J2UA 3GLFB 2C4WA 3AQIA 2BWJA 2ZB8A 2XJ9A 4ZJUA 4QVIA 4AKIA 4E3WA 2P9HA 1NSFA 2H18A 2QRNA 3EPJA 2IPAB 1JR2A 4QASA 3T3PB 3PF8A 3LUAA 1PTJC 4AJLA 2XPCA 3BMQB 4OUDB 2M6SA 5BMVA 3NZEA 1LV7A 4F3NA 4CM4B 3PFBA 4L2IB 5DGXA 3F6PA 4C7XA 4N4AA 3VR5A 3DMRA 2UXBB 2BM8A 1LPAB 5LLTA 1QFYA 1FP6A 3FOBA 2K87A 4ZARA 2YVKA 3B51X 1JHQA 1T2VA 3HPRA 2JGRA 3IHWA 1H2BA 2VDVE 2CLLB 3ELWA 4MS1A 3UWSA 1CJSA 3AUXA 3W3AH 2C99A 5E4FA 4EM6A 4BPBA 5E1DA 3CF4A 3FSEA 3R0JA 3C6BA 1OFVA 2C58A 2I66A 3EGCA 2FPPA 3H3FA 3IO5A 3QM1A 1DJLA 5ABPA 4YIHA 2QLTA 3TVYA 2YYSA 3CLRD 4YS6A 4EKNB 3GJ0A 2X8LA 3FB4A 5JSUA 2CXHA 4CG2A 2COEA 1XLWA 1JLSA 2QX8A 3BTSA 4FHDA 4RX1A 1KFKB 5AK0A 3T3HA 3ZTTA 3W6UA 3H8SA 3ZIAD 3DC2A 3BHNA 4W5WA 2GZDA 3B6JA 3D8UA 2FG5A 2QTLA 2W6OA 4GPD1 4D8UA 1UKZA 4KO2S 2WQ7A 3RYCB 4RABA 2B8WA 1RXUA 3JATA 3LUPA 3QH4A 5JAHA 3HJGA 3NP7A 1FX0B 5JNWA 5KC9A 1YIOA 4Q93A 4ZOLA 2G04A 2EF0A 1K6MA 4ALIA 2QYSA 1NI5A 2D0PB 3RUHA 4EW2A 3E81A 4Q3KA 3DS8A 5FI3A 1WMFA 1U98A 1FNCA 1M7BA 3NP9A 2Q1WA 2YWDA 3AEXA 4FHFA 4TXHA 4X20A 2P2ZA 3EBOA 3SJ7A 5TLSA 2Z0MA 3AX6A 3T1YB 2Z4TA 3B3FA 4LK3A 5AKJA 3W7BA 5BN4A 3K9WA 4IDQA 4L51A 3FCEA 5HS4A 5HKKD 3LLSA 2YV2A 3DZBA 5K3FA 1Z7WA 1FMJA 2EXXA 2FMIA 5ILQA 3VR3D 3S1SA 3NW9A 1KPIA 5LQKA 3A6DA 1XZEA 3MXTA 3AEZA 1PCXA 2ZRQA 3IESA 3PHHA 3R5FA 2P77A 3OZFA 3ZDYB 3U62A 5CDHA 4GRDA 4K6HA 3P9PA 4FYPA 4Q7EA 4WBNA 5J1TB 1UC4B 1LBQA 3FYSA 5KYGA 5JVDA 1FW6A 2WYVA 1YDHA 3EEOA 3Q4GA 4HAXA 3DMFA 4TSFD 5DULA 3A1FA 5EG5A 1OC4A 2MU1A 2VHVA 3VTZA 4D6XA 4GIBA 2DBYA 3ZOZA 4OBWA 5IRCD 2X8BA 1FJXA 5K7SA 1P2SA 3QYFA 2Q0HA 2CJWB 4O59O 4DEYA 4CLOA 5JT1A 1XMOB 2GEDA 1YUBA 3I0NA 4UNNA 5FOUA 1W36B 2YHIA 3EGOA 1XVUA 3RM3A 1B8UA 3TECE 3OX3A 1NAIA 1SBIA 4KODA 4WKNA 4MI6A 4AI6A 3LT2A 5AI9A 4AROA 4RA6B 1DCMA 3RT9A 2WIFA 4MCAA 1Z5WA 4YRBA 5IKEA 2K5UA 1RC8A 2AOTB 3DE3X 3W5AA 1R0ZA 5CT6A 3RRJA 4B6SA 4PIMA 3GJ5A 3SQWA 2XMQA 5BUZA 1A0OA 1QOQB 2D4AA 3JQEA 3GAAA 1R8YA 2VRNA 2H06A 2FOLA 4RKRA 3IE0A 3RK0A 3FMFA 2YFQA 1FTNA 5TPWA 1T2AA 4XRGA 2O4UX 3TD6A 3TYXA 2IYWA 4TXLA 3V4OA 5LQDA 3JX9A 4HRYA 1MENA 3L4SO 1WXWA 1Z2DA 1EJ6A 4HN9A 2DPGA 3IJPA 1X1EA 3T1TA 2GN4A 4Q4LA 4YREA 5F3WB 3QKSA 1XCLA 4UU7A 2R85A 4IF6A 4QTZA 2JLAA 2YWCA 1N57A 1T0PA 2VNSA 4RELA 4DA6A 1Z88A 1NBMD 2AC4A 4O4LB 3LC2O 2YCLA 1AKNA 1Z4NA 2XUJA 3NGMA 2P67A 4QLOA 4BE9A 4CKXA 2CXTA 1U1EA 1EXMA 1BVUA 3OUUA 5K8CA 2HWUA 4FYVA 4QGGA 4FWBA 2AVDA 2XBLA 3N59A 3ITEA 4ZCPA 3RFUA 3WYEA 4D45A 1J0EA 4UVIA 4RFSA 1PLKA 4YRCA 4UZSA 3VOAA 1GG8A 3C14C 2Y1FA 1LI7A 1U5BB 2QRLA 4YRFA 4M0MA 4KQJA 3RWBA 1SBCA 4IXTA 1UBFA 2FFHA 5HSGA 2EC5A 4S04A 2OV1A 1UJCA 4PG4A 1T3GA 2GRJA 2H1LA 3O4GA 4HV4A 3DB2A 3F6EX 4Y7CA 1U6IA 2R48A 4OB6A 1CG6A 2OO3A 3CBQA 1TO6A 3RSZA 4FD2A 3UWDA 1TCVA 4JJ7A 2BR3A 5IHPA 3MTEA 5LZ7A 3HXTA 3PX7A 4YI5A 3W79A 1FU4A 1U80A 1O6FA 1ABBA 5C1IA 3ZV5A 4ASUA 1LDBA 2FGJA 1S2NA 4K3VA 2CT8A 4K9KA 1IWPB 1MFPA 1HQKA 3TZBA 3GEPA 1SG9A 3EGXA 2YZKA 4I9NA 4QEZA 5FYDA 3HWSA 3T7SA 3TM4A 2ZYIA 5G3ZA 5K20A 1AO0A 3KKKA 1C3LA 1JIVA 3EXFA 3QOYA 2PKQP 1QIHA 5CURA 4FB4A 1NR1A 4B48A 2JKVA 3RS0A 2E5WA 3S27A 3UMMA 1MQ9A 2H1SA 2RGNA 5HKBA 5EWMA 2P11A 2X3YA 4ZV4A 1DUVG 1GWNA 1P8AA 2FI1A 1E1MA 2PWZA 3TLGA 1QRDA 2FG6C 1IEQA 2ZYAA 4Z9YA 3PXUA 3SBXA 2PJRA 3EQ6A 1X77A 1TAQA 4UHKA 4XXHA 2ZYSA 3LY9A 1LDNA 3RS7A 3EUAA 3OX1A 3WYAA 1DIGA 3ZD8A 2BGWA 3H11A 4ENWA 2NAPA 4K6FA 3KC2A 5CX1A 4C3VA 9MHTA 3BGVA 2J08A 2A0WA 4RD6A 5JRZA 3R8FA 3NHSA 2D0IA 4C2UA 1FFAA 1QXSA 3NKLA 4FFDA 4CCYA 3BDIA 3HLKA 4PRYA 4JP2A 3QEMA 1BXGA 3I34X 3PZBA 1G0OA 4Q0MA 4MKHA 3M34A 3HADA 2I54A 4UXJA 4O2AB 4ZVLA 5F23A 2O9JA 1HL3A 2YIDA 1ZMRA 3ACCA 3AESA 3LUJA 1QCDA 2WSBA 5YASA 1CUDA 2VI5A 5GP1A 2QLFA 1TRHA 4DLVA 2EKLA 4ENSA 2P5YA 3H5OA 2PJZA 3PUYA 4FR5A 4MH0R 4RD0A 1TA4A 1KH1A 2X0NA 3ABSB 4RY0A 5I7HA 5AJUA 1TVMA 1AUOA 5TF0A 4BGDA 1KZHA 4K40A 1KZGB 1SXJC 4WZAB 4XQEA 2DPXA 3FPLA 2XDWA 5ADWA 5LYJA 1DTEA 3RC3A 5EVCA 1Z5GA 3INYA 1PZNA 1EZ4A 3R6WA 1ZPDA 4G8JA 3E2PA 3LCCA 1SC1A 4PGGA 4C0BA 6PFKA 3G0DA 3U44A 4RANA 3UJ9A 2XUGA 2CF6A 2E55A 3G2OA 1BXZA 4QFDA 5F7XA 4HQ6A 1P6QA 3K94A 3QPAA 4JBGA 4JX8A 5EP1A 1GYQA 2A84A 2JI8A 5EP3A 2DKFA 3FPFA 1N78A 1Q77A 2F3RA 3EXG1 4QU0A 2R7MA 4JBYA 1F4VA 3GB9A 3QE2A 1GFZA 2W43A 4UATA 1RHQA 3GLUA 1F20A 3OM9A 3OOSA 3Q0EA 4YRNA 4GM1A 4HDRB 4LSGA 3A3NA 3I9MA 1W0KD 1WETA 3WLEA 3THXA 1WXEA 4N7RA 3FKQA 4F4UA 1LQ2A 1NE2A 1CIJA 5CJJA 4MRMA 4UHDA 2ZKIA 3L0PA 3PWSA 5GONA 4RTSA 1BKSB 2GN9A 4MWBA 2VYND 3IOMA 4QUEA 3FGNA 5KTSA 2O8VA 4MA5A 1U0LA 3GRAA 4ZDJA 4LPSA 2BH2A 3GV0A 3UJ8A 3EARA 1UKCA 1HPLA 3A3KA 3OPQA 4NV0A 5DHQA 4B2YA 4DABA 4DF3A 3KSMA 4UE2A 1IPFA 1ZJYA 1S02A 1T91A 1V2GA 2A2ZA 3OPYB 3OFKA 4KE7A 4CKWA 3RAEC 4HH0A 5DIFA 4AJIA 3U6KA 2NTEA 3DEKA 3KS9A 2IOQA 3E5RA 1JILA 3UBTA 1LWNA 2REQB 4DM4A 1R6UA 1FF9A 3KR9A 3OP4A 4JH0A 3U2QA 1TU4A 4DQUA 1TEZA 1RSZA 1Q57A 3CVWA 2IH2A 4JB2A 1GR0A 1HH4A 4Z54A 1EFHA 4JBIA 2XQGA 3H5WA 2AXEA 4QOEA 4QPJC 3PHCA 1POWA 4DKXA 3NORA 1YNOA 5LXTB 1J23A 4K0KB 1XZHA 3PVCA 3WQRA 4CPDA 2DWUA 5JD3A