5IM5A

Crystal structure of designed two-component self-assembling icosahedral cage i53-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
TKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Riboflavin synthase
publication title Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Protein binding
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, O, Q, S
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 5im5A00
1T13A 1EJBA 1NQWA 1KZ9A 2B98A 2VI5A 2C94A 2O6HA 3NQ41 4J07A 1RVV1 2JFBA 1XN1A 1ZISA 2OBXA 5IM5A 1KYVA 2A59A 2A57A 1NQXA 1KYYA 1C2YA 2F59A 1KYXA 1KZ4A 1KZ6A 2I0FA 1KZ1A 4KQ6A 5IM4A 1NQUA 1C41A 2C9BA 2C97A 1W29A 2C9DA 1NQVA 2A58A 2B99A 1DI0A 1W19A 3MK31 1HQKA 2C92A
chains in the Genus database with same CATH superfamily
1DAFA 1SU7A 4U2GA 3J81A 1QIGA 4NMWA 1B0PA 1H2ZA 1O97C 3K6RA 4PBTA 4R7GA 5EWLB 3S5UA 5C7IO 4YJ2A 4X1YB 2OECA 5J59A 2BUAA 3C4VA 3O31A 4EG1A 3UGJA 3ICOA 5EL0A 4DEVA 4MIKA 4ZCPA 3WLJA 5K45A 2C7PA 1EK2A 2E82A 4CIDA 4V3CA 1WLYA 3HCBA 2H92A 4HWOA 4DLVA 2Q8NA 4NHOA 2XRMA 4ZZ0A 1A7UA 1S2MA 1GPLA 4LSGA 4R1UA 1XJCA 3LH5A 4TXJA 3CU5A 4W8OA 1S4QA 4EY8A 1N8TA 2HO5A 3QEKA 1ESNA 3H2GA 3NGXA 4AIRA 3CUTA 1G7RA 2OM6A 4GC5A 3ET4A 1FQWA 5KSZA 3KQKA 1GGKA 1BN6A 1DFIA 2O3TA 3HDYA 3L6BA 2XQVA 4IXNA 4NECA 1IIRA 4QFCA 4Y1GA 5KNCD 3MCZA 3HKDA 1MCZA 3AERA 4ZVUA 2N42A 5JUWA 3FW1A 4PZ9A 1X13A 3K9CA 3H6KA 3KKPA 3MMXA 4FNGA 5AQEA 4V2UA 4MQEB 4YX9A 2PGLA 2FI1A 1DQNA 1D6SA 3NV7A 2A9QA 3AO0B 3GHYA 4FQ8A 2O1XA 3FWKA 4Q9NA 3BTUA 4WWHA 3WFIA 3L05A 5KU7A 1EP9A 4JKOA 5HBGA 1OBCA 4YP0A 3WNDA 3I5YA 5KNLA 2O1WA 4FR0A 4HRYA 4PC6A 1V1RA 3H8JA 1DADA 1R3DA 1YS1X 1C7RA 3V2GA 4CKXA 1X2EA 4B7CA 2XNCA 1FC0A 3A31A 4IJ6A 3PC6A 4HEQA 3RREA 2IPNA 3EVCA 1C29B 2GFHA 5B58T 2DY0A 2QA5A 3VJKA 1NNSA 2VP3A 3EZFA 1O08A 1O94A 3QVSA 1OGJA 2X0EA 3WGOA 4P8RA 2V98A 3B1WA 1M76A 3DNFA 3WP1B 1WVIA 5I9NA 1I4OA 1YFLA 1X1QA 2QRLA 1F8FA 2QNRA 4N3GA 5K0FA 1NXVA 1S6YA 1TGVA 4PFKA 4DRYA 2EFYA 2RGYA 3GLQA 2ZYHA 4BTLA 2W6PA 3F4BA 3JTMA 1DEKA 5HGXA 3QKWA 4GXNA 4M8NE 5BN5B 3DVQX 3B8HA 2HCTA 1S96A 3R76A 4CM4A 2IODA 3UFXB 4I4TF 2BL4A 3FOWA 3SYTA 1V95A 2OCAA 3Q3JB 1FSGA 3L1IA 4FQ5A 2QL5A 1QHHA 1SBZA 3ELUA 3H83A 3FPBA 1JZTA 1G6Q1 1P1KA 2GD1O 2IZZA 4IIFA 4KFSA 1NVUQ 3WIOA 1ZM4A 2C8LA 5L4NA 3BVPA 2WSYB 3GP3A 4PPNA 5C1DA 2Q1UA 2YJNA 1P33A 1K7SN 4Z7QB 2JBHA 3DMTC 1SA0A 4NJEA 1JJAA 4KX3A 1Y8RA 1KFEB 2UAGA 2WHQA 3IGFA 4OHRA 4G0PA 4U2FA 1IY2A 3EW7A 2C9CA 1OXBB 2ZRFA 5DTMA 4PLVA 5B1IA 2G4CA 2V8OA 1XRJA 4PXSA 1LTQA 4FSDA 2C1EA 3FX2A 3DGFC 1A9YA 2FPSA 3CUWA 3NHZA 3UZUA 3V8RA 3YASA 3B3JA 2R1ZA 4ETIA 5H8WA 3QMMA 2Z1MA 4ZAYA 4BJHB 4JI3B 3V8BA 2NWQA 3Q6MA 4QRDA 1N9ZA 2X4DA 4D0RA 1DLJA 3OD1A 1LWNA 3KDPA 4FMCB 4R98A 2ZVPX 4GU5A 2I7XA 3OJWA 3ESQA 1J5EB 1IU9A 1PL6A 2XKKA 3DNMA 3FFWA 3A6JA 3UJ8A 3TLZA 1E3QA 5ELMA 5J1SB 2BT4A 4ILKA 4H17A 4QQFA 2HL6A 2HRZA 3QJYA 2QX7A 1SXJB 3A14A 3BJIC 2VZ9A 4XR4A 2IEDA 3WV5A 5KYXB 4YAEA 1SK8A 2O57A 3M9WA 4YCDA 1VYHA 4ITRC 4BWGA 3PVZA 2E7ZA 3BKWA 1JV2B 2EGUA 3PVSA 4IAOA 4LNUB 3JQ6A 3B13B 3ZDEA 1E3WB 1I7PA 4BKQA 4KI7A 2Z8ZA 3EF1A 1Y9EA 3I2HA 3Q3EA 2Q7OE 3ZE9A 3AR9A 3MTEA 3G2KA 4JBYA 4BMSA 4F11A 3IC5A 3GDHA 1C0EA 1Q14A 2REQA 2Y9PB 3K8YA 1NYRA 3UMBA 1JDNA 2BEWB 4PRZA 1OX5A 5TT0A 4CMIA 4XAQA 1E79A 4EK9A 5L51A 2GJ8A 4GAEA 4AZVA 3WADA 1VPVA 1G17A 1TMOA 1W4AA 2H7YA 1JUDA 2YY7A 2PGIA 3GLSA 1JR4A 3GVPA 1JKMA 3BB1A 4YREA 5SZHB 4JIGA 3AVQA 5DHTA 4G0XA 2P65A 4D6PA 2BMEA 2G72A 4TKVB 4DV3B 4MWOA 2DERA 2BGTA 3AUYA 1ZUHA 4Y7CA 4M7RA 5ECDA 1REQA 4BS9A 3FKSD 4M99A 3C98A 4E6PA 2R6GA 3DV2A 3ES9A 3CNNA 1I0LA 4XWWA 5ENVA 4OPMA 2WYWA 2RAVA 1Y1LA 4BYMA 1QGAA 1VJGA 3I5UA 3Q9SA 3SQNA 5K2OA 2REBA 2TMYA 3FHTA 4YJKA 5LOVA 2VDVE 2ZRDA 3KTOA 4ZO7A 5LLSA 2PCLA 3B1XA 3WGQA 2YIJA 3D6FA 4B3HA 4CTOA 1VBKA 3E5NA 1U9YA 3UQYS 5JCZA 2JCVA 3L1HA 1KOLA 4WKGA 1X70A 1OV6A 3TTTA 1P62B 2XGJA 2HJVA 2XQIA 5I7EA 1QQTA 3OOEA 4EH1A 1CY2A 3M81A 4R5MA 3WRXA 3BD7A 4HFNA 3QELA 1GAEO 4FCTA 3DMTA 3E9CA 5CP8A 4FFOA 5JW6A 1QP4A 1NWCA 4IKEA 1WKCA 4J4TA 4RPGA 1OVGA 1I4DD 1X74A 5LYJA 3MELA 3SPXA 3SSAA 4IIJB 1ZJ5A 1N25A 4FFBA 2FG5A 5JXJA 3KKMA 5CA0B 3HK2A 1Q1ZA 2V7GA 1G16A 4Y2UA 3ZV4A 5IRCD 1J5XA 4DB4A 1JJ7A 2VHZA 3WHIA 2XVZA 3ZNPA 3EXAA 4V2IA 3PXXA 3GCWA 5LBTA 2NZ8A 3R3YA 4OQLA 3U3ZA 2IHUA 3BDAA 1QE3A 2DWPA 1SD1A 1UT6A 3DR5A 2AJCA 3MZ0A 2P7HA 1G18A 3LBHA 3WWCA 4DJJA 2C2BA 2IYXA 4J9VA 4MVXA 5G0UA 1UFKA 1PU2A 5L8VA 1XEFA 3WLEA 4GPBA 4MB0A 1HORA 3B3QA 5FTNA 4CMHA 4D9MA 3DBRA 3I3SR 3IAEA 4JP8A 8ABPA 9MHTA 3BE8A 1TJ3A 3LSTA 5D51S 5AKXA 3AOEC 2IYFA 1XJQA 3S55A 1E0AA 4YCAA 3DTYA 2EFHB 3UWDA 5FOUA 4FLEA 2PLNA 3WP0A 2QVXX 3K70C 4ZT5A 1LD3A 2CXTA 3S1LA 4MYDA 5F2NA 3H2IA 5C8YB 4PF1A 4X20B 4M1ZA 1LSOA 1YKSA 1E6LA 1C9NA 4LY6A 4QUAA 5JWOA 1IHUA 4DR6B 1CEYA 2KMLA 3EDYA 1JLLA 2JCXA 3G9QA 2WHRA 2WEKA 3KRTA 1W34A 5BSKA 4IEIA 4IDEA 2ZFUA 1RXWA 1WRBA 4YJHA 3SBOA 3WX0A 1VGQA 3GYGA 2NQ8A 1DKMA 2IZ1A 1USIA 3LUAA 4NU0A 3ZE6A 2GRJA 2J6BA 4ZVSA 1ZRNA 2QB5A 3ZNOA 1BEUB 3KWLA 3KJZA 5T41A 4K9DA 2JPDA 3CRZA 2AF4C 3KYDB 1G4AE 5HA5A 5C53B 1J8VA 4Q3DA 4RZXA 3LY7A 3R7DA 4HLQB 4YV1A 2X2OA 3C3PA 1QQBA 4H6WA 5CK4A 2R7AA 3AKCA 1M5TA 4IW3B 3DE0X 3KNZA 4ZI5A 6Q21A 1XDGA 3G7NA 3DLCA 2AMFA 3ITKA 4XDHA 2AZTA 5EKUA 1Y3BE 5LA6A 2L69A 1LY1A 4EZBA 4ARIA 2R2GA 2O8DB 3V4LA 5F2EA 2WYUA 5FUQA 5KJ6A 4ZXPA 3EYWA 3U62A 4AYWA 2RK6A 1NNEA 2H57A 4F97A 3RAJA 4MQFA 4IH4A 1FXSA 4M9QA 1JBQA 1E2IA 3FPCA 4OL9A 4OHMA 2ZUWA 5A4MS 1ZVKA 4ZHQA 5IK2D 3AHJA 4I2NA 1EM8B 1ZLXA 2QJWA 3H5VA 4HVLA 1PUXA 2GAFA 2IEZA 1JHPA 1H0HA 4N7JA 4HDAA 2GYYA 4O59O 4WUTA 1O5IA 1I8TA 1TUGA 4PYNA 2G09A 3RT9A 4YJ3F 4GI1A 3SQWA 1DINA 2J67A 2QXTA 3P26A 4G63A 4JBLA 4CM9A 4D9KA 5TV2A 2B34A 4YLEA 4DIOA 1CW2B 1QP0A 1E2EA 1HFKA 2A5YB 3HO6A 3CLKA 3LJKA 2O3QA 3HZHA 3H6HA 4XUCA 2EARA 1ZKMA 5ALUA 4WZAE 4A92A 3NDBB 2JGFA 4WVLA 2VNSA 3HBLA 1LNZA 1KYTA 2BMVA 3WMWA 1YIOA 2ZJYA 3MWDA 3O4HA 2DTXA 5IS2A 3AOEA 4WK2B 1X7YA 4KO8A 3IAHA 4HAUA 4HNHA 3EVBA 4QJBA 1QDEA 3TTSA 3KU1A 4KN8A 3UKOA 1X0XA 4BEVA 1RP1A 3KYCB 5DLPA 5FOVA 3SCZA 1O03A 3B3AA 3PLAE 4F5ZA 3OZVA 1HT0A 1XLWA 4HN4B 4KXVA 1LZKA 1PX0A 1K8RA 2FPMA 3H65A 1E7WA 5AXAA 1KZ6A 2DULA 4EM6A 2VQSA 1YCFA 2CLMB 2HTFA 2QQFA 3FTPA 3G2JA 5H1YA 2FK7A 2RMKA 4UREA 4X66B 4JFRA 5F1KA 3B52X 1ONSA 3K9QO 1W73A 4O3MA 3BSYA 2YWHA 3TSCA 3DOJA 1AUQA 2EJCA 2QX8A 2C98A 1KF0A 4YRMA 1U02A 5FPYA 3GNLA 2Q3JA 3DDOA 5CDGA 1QO7A 3QEOA 4YA6A 5CR9A 1TVEA 5CA1F 5KMGB 3K92A 2NQTA 5I48A 5FBZA 2I34A 5I9BA 3AR8A 4BWVA 1MD9A 2IOHA 3M33A 5HFJA 5AUPB 1DGQA 3GXBA 4TUYF 4XB6B 3SP1A 1GPAA 4KSYA 1SCJA 2ID9A 3HJFA 5K0EA 1N8SA 3U61B 2GF2A 1C9YA 4FJ1A 1UJNA 2OPBA 4OA8A 4DC0A 1NC1A 3IDQA 4TOIA 1T15A 5DN9A 3CPSA 2AFIA 3C3MA 5CPBA 1AMOA 3A26A 1XJ5A 3LA6A 5DHAA 3RTDA 4H3VA 3X2SA 2QRQA 2VHWA 3GFPA 2I2CA 4W7HA 3UV6A 3IBTA 3ETHA 2FSSA 2JHPA 4EBFA 1BGWA 1KDTA 2HBRA 4DY4A 4AUKA 1EB8A 2QZ4A 1GT91 3NIWA 1KH3A 4JT2A 2AXEA 4U8HA 4MI3A 5AKEA 1TJ5A 1TKAA 3WV4A 4EQ6B 1O0BA 2DPGA 2YOHA 4I8DA 1BX3A 2NV6A 4WNYA 2RG1A 3OZGA 1T26A 4L5JA 1B16A 1W9MA 4KGXA 1Z38A 2XW6A 4RCVA 3PFWO 1X7WB 3GLHA 2OMEA 3D3QA 4W63A 2A7XA 1GGFA 4MAAA 4KO2S 1H2WA 1ZH8A 5KYNA 1GV0A 5LKAA 4AZTA 3OCXA 1JLSA 1YR8A 3T1YB 4NJMA 5LWQA 2P6MA 1EUCB 4LVOA 1ZW1A 1XTRA 2WVAA 3QX7A 2HDOA 4M9ZA 3W3AH 5MDHA 4YI3A 4F46A 3QSYA 1IVNA 3LP6A 4L74A 3D2BA 1PGJA 3EFOB 3O8BA 4UPDA 5BW4A 1PSZA 3QLVA 4LBZA 4PRLA 4RZ2A 4B32A 5K3FA 3BD6A 4R1OA 2Z6AA 3QMVA 2VHVA 4HP8A 2ZOSA 3CJQA 4S0XA 1FVHA 4WCFC 1OU4A 4NBKA 2Y0BA 4NZOA 5GOTA 4AC9A 1HY3A 3EZLA 3HJAA 3DR3A 4FHEA 4Q7EA 4Z5XA 2W83A 1YFKA 1S9HA 2H9AA 4Z54A 5GVSA 1W0KD 4MAFA 4GMXA 2I78A 2CL5A 1JGTA 2O2ZA 1UBNA 2AOUA 4JP5A 3V1LA 3TECE 1Z34A 3V7YA 1MABA 1Z45A 1QPGA 2R66A 4KE6A 2ZYAA 2PFKA 3S2GA 4RC9A 4JLVA 4WK6A 1ADYA 3AVOA 3NHLA 4J0FA 5IYZB 2HHCA 4KOAA 2C96A 4K88A 1A7JA 3O8OB 4EGQA 4OBWA 1E2GA 1PEDA 5EY5B 2J41A 3NYQA 4P92A 1G59A 1ZUNB 2QJFA 3KXLA 2R96A 4G0OA 4KX5A 2X9QA 1O6ZA 4WD3A 3L8YA 1Z2PX 3FCUB 5B3LA 2VUSA 2X1VA 3C5HA 2PX6A 5JAZA 3LKVA 4P98A 3PNYA 1SKYE 2O23A 3S0JA 1JR3E 2GK6A 3TVYA 3OMXA 1ABFA 3O4GA 3RFCA 4R9NA 3GLGB 2IF2A 1F6WA 5HKKA 3T12A 3P4UA 2WIAA 4MUAA 1UP4A 1HZJA 2FZ4A 2NPIA 2O2CA 3MWGA 1M8KA 4RAQA 1E89A 2Y6UA 5JMWA 2YVQA 3Q8XB 2JA2A 2X5KO 1NMZA 2EWVA 3V6MA 4Q6WA 3F6SA 3VZSA 4Q01A 3P8ZA 3T5TA 1XZAA 1XTSA 3ZZ0A 1P0QA 3C8DA 5HR5A 3PXGA 1G9SA 4W8GA 4R4JA 5L3QB 4DLLA 1LVUA 4JCOA 4KRFA 3IILA 4UBJA 1X7XB 2A5FA 2R25B 2VJDA 2XX3A 5FL7D 1GCGA 4D56A 5DYNA 4J07A 3K2QA 1GNRA 2YWBA 2C7OA 4LF7B 3NTQA 5CBKA 1CR0A 2ILVA 1I13A 3LPNA 2TYSB 3NB0A 4REMA 4DVJA 3QFHA 4HK4A 3PQ3A 2OCIA 5TPWA 3TLCA 3CVJA 2DLNA 5I7AA 2RHWA 5JWHA 4L08A 4OQFA 3IDFA 2BFDA 3RSCA 3SEFA 3T3DA 1E3MA 1JFRA 2BLNA 2GR9A 3PF9A 4PBRA 4V38A 5DXFA 2W37A 3QYJA 3DZHA 1LV8A 1G5RA 4LZJA 3NYIA 4NMMA 2DJ5A 3P1JA 1L4BA 3PJFA 3LW8A 4O4JB 3OZIA 2FQ1A 4BBZA 2VH2A 1PHPA 4EL0A 5MHTA 2QTVB 2DFNA 1LPBB 2R9VA 2X77A 3E5HA 1N2ZA 4ZVKA 3NONA 1L5SA 4MLDA 5ALFA 4WCDA 4HDRB 2O20A 1L8LA 2Q8QA 1Y1SA 2N1MA 4REQB 5DHQA 3EWNA 4D0SA 1BMTA 2F17A 4LXQA 4XQ0A 4LXTA 5KSPA 3L6EA 3FPSA 2QVGA 1RFGE 2IOFK 4YWHA 3OJOA 1HH4A 1YV9A 2QR5A 1I32A 1GRQA 4FINA 2B5OA 5CJ2A 1OAOC 3NHAA 4MIEA 2XCIA 1QK5A 3IIMA 2EFDB 3KFVA 4OFWA 2H06A 5ERYA 1E3SA 1T4MA 1TYAE 1GQYA 3GGCA 3VR4A 2ZTMA 1P0MA 1QK4A 4MX8A 5AVZA 4YRPA 3DTVA 1DZIA 1EYZA 5KYYA 3WDMA 1KFJB 4RA6B 1AKUA 2X8BA 1IEQA 3I9MA 3OQIB 2Q3MA 4UMVA 5CLQA 5B3KA 5KYUB 4OYRA 3ZWMA 2CDCA 3PPWA 4DCPA 1RYBA 1PGNA 3KTFA 1DKPA 6LDHA 2X86A 2V54A 3KVNA 1LPPA 1QQ5A 2FOIA 2Z30A 4NHEA 2GRUA 1LI5A 1G41A 1ZH4A 2WVHA 4P3KA 1PZXA 1Q77A 1O96A 3EXFA 3KKOA 3OD5A 1ZPDA 4Y2QA 4COOA 5LQKA 4HGZA 5FUXA 2ID7A 1BG6A 1TCCA 3L1VA 2F55A 4DCSA 2NSHA 4U7PB 1OWNA 2VEOA 5DBHX 1Z4PX 1M1UA 5CFPA 5JZVA 5K8LA 5M04A 2ZR9A 4ESVA 3A1DA 3JS5A 4EHAA 4NBNA 2OFPA 5FO0A 4QTZA 4DZTA 1N4DA 4M3NA 4YMTA 2VPZA 3H2SA 1WF3A 1KI4A 4UQOA 3SQMA 4NYIR 5EXEA 3T3PB 4Z4QA 2VBFA 2Q9CA 1NATA 4JS0A 3K1AA 1I24A 2DPXA 1U2PA 4E11A 4GDFA 1VZ3A 4PFJA 3RBVA 1C3VA 1Z47A 2JAOA 3FZEA 3QEJA 2PXAA 5BW6B 1E5XA 6CHYA 4BLSA 4ES6A 5T57A 2FSPA 4E21A 3GWGA 2EZUA 4I6EA 2O9JA 4K9OA 4M0DA 3ZVMA 2FUEA 2B8NA 1XTKA 2BFAA 1XCOA 3QA3E 1TUBB 3G17A 4Z8YA 4M0UA 2VO1A 5BMVB 2WE8A 2J9XB 2P35A 4NDAA 4GI3A 4P3OA 2WDPA 2IKQA 4HVCA 2VJYA 4MP8A 3OSZA 1A5AB 1L4HA 2QUHA 3PGXA 5GP1A 5IC6A 4KDEA 3MMZA 2HDHA 1DFHA 3SF8A 3B78A 1BH2A 1O7JA 1XJWA 3C4QA 2D13A 3F3SA 3QHAA 2O8BB 1OWMA 1XTZA 1OROA 3ZV5A 2EP8A 3ZWKA 1U1IA 4L7QA 1TECE 4UHHA 2HI0A 4MWGA 3ZKAA 4IZ6A 3TXYA 1ADBA 1GTL1 4CL3A 3AVVA 5F33A 1I6MA 4AJLA 1DTWA 1I4EB 1CR6A 1OAOA 1X1EA 2RGUA 4XPIB 4KYIB 3RCBA 5AIBA 4IIBA 1WUYA 3M3HA 4MTCA 2P62A 3RFTA 1PYOA 2ZPAA 5AICA 1GG5A 5KVVA 2I2DA 2AN1A 2H5IA 1PJSA 3K9HA 2VZEA 4RDHA 1RZRA 4LRUA 4D8XA 4H3HB 5LWHA 2WIKA 2QUBA 5KNBH 1SXJD 2QXUA 3A3NA 3N86A 2I4OA 4ZEXA 2A7QA 2EX4A 4TV9F 2CHVA 3O1IC 3UAZA 3ZG6A 1W7AA 1E5VA 3D7SA 3E81A 2Z58A 4IDDA 4HLCA 3QKSA 1RABA 2IYSA 2OZVA 4MKHA 4MIOA 2NOAA 3E0XA 4EW6A 1LC3A 4XX1A 5B3AA 2I65A 4PQYA 4QVIA 1L5FA 3ENKA 4NY1A 3VR5A 1EJ0A 1WSWA 3GPCA 4I1OA 4F4JA 4PO1A 2Q8PA 3JZMA 4DLYA 5TSDA 2PK3A 2R62A 4QNMA 1LB1B 2Y77A 5IBCA 2XYGA 3T94A 4RVCA 2RGAA 4UZSA 3OF2A 4UEOA 3LBIA 3V6LA 3UK6A 1VYVA 1T2AA 1Y8CA 3U4QB 5A0VA 3GLVA 4MGZR 2VBIA 1B3BA 1VJDA 2H31A 3K6KA 5G4KA 4D7AA 3JQ9C 3GPLA 2PUJA 3MWYW 2BFFA 5HUJA 1CSEE 1M2OA 3PL5A 4IJMA 3VVLA 4H9GA 4HFMA 5B7PA 10MHA 1QJCA 2HWUA 4JVOA 1ORVA 1SNYA 3ELWA 2XT0A 1R5JA 3GO4A 4CNBA 3DGEC 4FGWA 2ZWOA 4D5EA 2YL2A 1C7QA 2Q5HA 3IESA 4YAJA 5C1IA 3AKEA 1XKLA 1X7ZB 4E1BA 1M10A 3AKYA 4I9UA 1E0SA 3C4JA 1JBKA 4MVWA 5DBOA 3UC5A 3F7TA 5JD6A 3R24A 1QG6A 1RACA 4XQEA 4DLKA 4E5DA 2P40A 3HV2A 5DK6A 3TD2A 1PF7E 2GEUA 3TX2A 5A4FS 2IYWA 1HMPA 2FFHA 1ORIA 1OY1A 2IC5A 4G25A 2HXYA 4ZO9A 3WK4A 5KYGA 2CJYA 3F97A 4ND6A 3CLUD 4UZFA 4JXJA 2WKQA 3H5RA 4P2GA 1WP4A 5CFOA 2XWJI 4LYDA 4D45A 4IV5A 1QKJA 4PO9A 1G63A 1YDMA 4RHXA 5AW0A 5HILA 2OENG 3I5AA 3ENZA 2B8EA 3KZXA 5M29A 1P1CA 2XLCA 3C15C 2BN4A 4NZMA 4WBSA 1Y5NA 3C7KA 5GM2A 1YT5A 2I62A 4I6GA 4XR9A 1SD5A 3DAHA 3W4IA 1NP3A 1P91A 1PX2A 3HKBB 2QMEA 2VBCA 3TLKA 1WO8A 2EFGA 2UYQA 3KCNA 3R5JA 4NABA 5EHGA 4D02A 1EA7A 1J4AA 4TVSA 1K98A 1SHLA 3BIOA 3Q6IA 4CMJA 1E9CA 1N5MA 2JKYA 4MVJM 2JB9A 3EQ6A 1Q92A 4B3XA 2F9MA 2QK4A 4LFCB 4L28A 4D6YA 4BKUA 3FSGA 4JAVC 2ZIAA 4E13A 4EHFA 5DKFA 5BUSA 4L7VA 4ZO8A 1RE0A 3PGJA 1JMYA 2JFNA 4L07A 4MUKA 3EG9A 1JHAA 4XKJA 1L6RA 1R64A 3C3YA 4W82A 3CZ9A 1JDSA 1M34B 4YRAA 4B8ZA 4LRQA 3UH1A 1W0JD 2D2FA 4O4LB 1V43A 3WGTA 4EG5A 2D7DA 3LKDA 4EHJA 2PS9A 2Z4TA 2H18A 1NLYA 1RHMA 1ZMOA 2FP4A 5DSZA 4OOEA 1XZKA 2BUBA 2GPYA 4FYHA 3OE1A 2QQ5A 3VV3A 2H1HA 4L1KA 1UC9A 3R5TA 2OCXA 1R6BX 4QUHA 2IELA 1WY5A 1N2CB 3M4JA 1Z4JA 1SBQA 1YE8A 2RFLA 5EPOA 3U39A 3WB0A 4ZYUA 4I0WB 4Y7DA 3HFJA 5EHNA 1KOGA 1HDYA 2QRUA 1PJAA 4EJMA 2Q0SA 4JGBA 1J56A 1Y1TA 1VE1A 3JQ9A 1JEOA 1BXGB 1MN6A 3IB6A 2JLCA 3I28A 3IPRA 1H93A 4FEAA 4A1OA 2B7BA 2XYQA 3KZKA 3ND8A 5GZ6A 3GP8A 1RJFA 4E4TA 1Z36A 1V6SA 3GBVA 4FHCA 4HSGA 4QBTA 1J97A 1EH5A 2DUMA 3UPTA 1IZ0A 4HNGA 2VFAA 3HFGA 3N2NA 1P7ZA 4QODA 4X85A 1D2MA 3VPGA 3LVBA 2H2IA 4K28A 4OUKX 1WA5A 1CJMA 2RHDA 1TM4E 3BSWA 4W7IA 1V3QE 2SBTA 3LWZA 3OO0A 2XTZA 1FUYB 2JH9A 1HK7A 3AY3A 5IAEA 4D3FA 3D7MA 1V0JA 2GN6A 2XCUA 1UT5A 4V39A 1QV7A 1WNFA 3TRHA 4DQLA 1KBZA 3AIMA 4MK4A 2EGGA 4IIVA 5E1MA 2ZI5A 2D3WA 2ZG6A 1XKXA 2A84A 2ZANA 3MS7A 4LJ6A 4OXIA 4WZAA 1D2CA 4MJ7A 3H8SA 1DQYA 4KPGA 1AH2A 1L5HA 1FYEA 4CLHA 3KIPA 4JP3A 2OEPA 5A4IS 1SVSA 2Z4SA 3SHTA 3I04M 4KVZA 3EVAA 5KS2A 5JS6A 1WU8A 5GINE 1NVXQ 2QAIA 4RA9B 2VRWA 1ENZA 1JTVA 1PJLA 1RMYA 2C4UA 2CXUA 2NU6B 1RQGA 2FW9A 2QVYX 2ZB3A 2PMCA 3GZNA 3OTIA 4KN5A 1MEJA 1XRRA 3G7SA 5D87A 4DG9A 2FV8A 3FCEA 4F6RA 3O8RA 3M6VA 2X8JA 3MPOA 5C5CA 1U7OA 2OXTA 5TS2A 1Y9DA 3A0RB 4Q16A 2J3IA 3I30X 4B31A 5TS3A 2DHRA 3HDVA 5JDIA 2FUG6 2A1TR 2HRCA 3HYSA 1EE9A 2P1ZA 3U4AA 5JY1A 3KSAC 4B75A 2O8EA 3CKKA 1OT3A 4H1TA 2VNKA 3DDNA 3BL6A 3KWJA 4Q15A 3G2MA 2JBWA 1G2QA 2ZR0A 4E51A 1OV4A 4BQEA 4HPXB 3T1NA 3RQIA 3CURA 1VRWA 2WA2A 3RUEA 3ICEA 1OPXA 3FOBA 4P4UA 2O7NA 4RVNA 4XDYA 5BWBA 2DEUA 4DB2A 2CMHA 3JPYA 3IBYA 2FF5A 4M0LA 4OXYA 1PVOA 4ZI7A 2H4JA 2BP7A 2IPLA 1BE6A 2E6UX 3AP2A 3DP9A 1JWAB 4JUFA 4U7HA 3TMKA 4BV8A 7REQB 8LDHA 2G5GX 4MR7A 4YUAA 2DKNA 2V0NA 3NKLA 4P4NA 1F2TB 3EEYA 2F59A 3OPYI 4OYYA 4P83A 2P68A 1W59A 1KMIY 1M6NA 4GI2A 2C95A 3QKTA 3PE3A 3OPXA 3VPDA 2RGRA 2FY8A 3GGJA 3TQCA 1KSFX 1LLCA 3KJNA 4MUJA 3GL9A 4BWYA 4QRHA 3SVLA 1P18A 1VP3A 4PIPA 4TTIA 1JKIA 1LSSA 3DCYA 4FE7A 4WA7A 3EFEA 1J0DA 4YAIA 4NXMB 2C7RA 2DWOA 2N0SA 1NHGA 1W25A 2QN2A 3FD8A 3I39X 3LCMA 3OIYA 3TS1A 3UCXA 5EIFA 4G1BA 4DYHA 4HH3C 1KJ9A 3VDQA 1F60A 1OLOA 2UYHA 4HR7A 2ID8A 5JRZA 3VUEA 4WEOA 3HNOA 2J0EA 3T54A 2OV8A 3D7LA 4QU8A 3SDSA 5EZYB 1GPBA 2HM7A 3N58A 3VPCA 4JA2A 3CH4B 4CUZA 3EUAA 2IUSA 5DTEA 1P72A 4NFSA 3R9KA 2JGRA 2OUIA 2Q5OA 1EFUA 3WK8A 1SZJG 1ZU4A 3EB9A 3QKUA 3NHRA 1N5LA 1VJ1A 3FB1A 2JBAB 4H4CA 4W4TA 3JR7A 3LUBA 3DMHA 3RH0A 3FVVA 2QGFA 1KERA 3NH9A 1U5AA 2VBGA 2CCKA 2PUBA 5A5FA 2LBPA 4POAA 3MWEA 3OQVA 4ZGGA 4Q7JB 4JWTA 2I6QA 3L8EA 1MXHA 3OFND 1Q1NA 1QWSA 3UT5A 4ENUA 1ATZA 4MKGA 2DKOA 4P7FA 2HK8A 2ZI9A 4D3SA 4ZJPA 3HXOA 2QV7A 4DCNA 3KEOA 4Z9XA 2NMVA 3L01A 2I22A 4DNPA 5LMUB 2HD4A 4O2AB 3QBDA 3Q7RA 4M87A 1ZJJA 2D2XA 3K20A 3ZEAA 1QH0A 2A4KA 3T1OA 1LJUA 4LJSA 5JFTA 1GGMA 3VU8A 4UTNA 2CF6A 4B3JA 4X90A 3B5IA 2C2MA 2GN8A 1L4EA 1EEXB 2ZRLA 2FQQA 3WGHA 3ZD9A 2PWYA 4YUZA 2QE6A 1GG9A 3T5DA 1WUIS 2FYTA 4H7PA 1YH3A 2NXWA 1WKBA 3NATA 1F7VA 1BU5A 2BRUC 1MQ9A 2XAUA 2HU5A 2K5UA 3PNQA 2RGNC 4IHQA 3X1ZA 2EFCB 2YXEA 2UU9B 3VPBA 4O1MA 1JR3A 2G6TA 4GC9A 4QJ5A 5COAA 2HXSA 2F43B 4D82A 1QPZA 2I3BA 1I5RA 2Q1YA 2B3DA 3RM3A 1T9GS 5IHXA 3HO1A 1KE1A 3OA2A 5D2CA 3IUNA 4XGNA 2FCAA 4QPJC 3T4PA 4R2JA 3DAOA 1U2GA 3KZNA 5IDXA 5LQDA 3KKKA 3NOQA 1NVWQ 4YMSA 3FHOA 1XRQA 1EWVA 2P41A 2Q3FA 2YRWA 3UNXA 3MXOA 2O1EA 2DWUA 3O84A 3CS3A 4BY9E 4IYRA 3VKGA 4NQZA 1IWBB 2LP4Y 5EJIA 2EBUA 2FPKA 2RB4A 1LQ2A 3C1OA 3I2JA 4N1AA 2PYZA 1CB7A 1BMFA 3FH0A 3HCEA 4L3OA 4UNNA 5I5GA 1KP3A 3LLUA 5AW5A 2XMDA 1CERA 2IX9A 4I3HA 4CTJA 2PBRA 2W90A 3KL2A 1P80A 1UIMA 2WAXA 1TVKA 5CH5A 3IHKA 2HWKA 5DLDA 3ZHSA 2O5CA 2XOKA 4QKQA 3NT5A 4W99A 3SDZA 1CVRA 2Q0QA 1BCSA 3CKMA 3QVMA 1LQUA 4OEHA 4Z7OB 1XRSB 3VR6D 5D85A 5J4KA 4FFRA 3S99A 3LUFA 2RHJA 3AFOA 4K6MA 4MYUA 2ZJ7A 1U3DA 1J0BA 4L02A 3B9PA 1F4LA 4D9FA 1J23A 2DQYA 1S3IA 1C3OA 2DGDA 4PC2A 1C8BA 2ZREA 1QFJA 2RIPA 2ES4A 2PMDA 3IPXA 3QZUA 4IGEA 5AKJA 4K40A 2IV3A 2ZI3A 1OAAA 2CZGA 2I4RA 3G88A 3HUUA 4GMDA 4TGLA 1FDWA 1U7XA 2LIPA 4KE7A 2CE2X 2AHRA 4PAOA 3OT5A 2VT3A 4D9JA 4DHWA 4AS3A 1S2DA 4J75A 5J4HA 5JZSA 5BW5A 5TC4A 1FS6A 3BCHA 4RPCA 3EVZA 3D7RA 4L6IA 1MEOA 5FBLB 1JHVA 2Y9MB 3K0AA 3BXXA 5AHRA 1I7LA 3ELBA 4OSPA 4BB0A 4F93B 3IPYA 3DVLA 1LX7A 2VJKA 4V0KA 3T34A 3QENA 4BMOB 1WQ3A 3W2EA 2QRGA 1NVFA 1H0SA 4JB3A 4AG3A 1D2AA 2BF4A 3Q8LA 4P33A 2X0IA 1PLKA 3PX3A 5B1YA 1KO1A 5ICMA 2ZI6A 4DR3B 4LJAA 5IAJA 1JN0A 3LKBA 1X42A 2FWRA 2M1ZA 1KJYA 3HDGA 2PO5A 3N2IA 1JEQA 4GHWA 1IN7A 1YL6A 2FH5B 3BMOB 4H4DA 1RJ9B 1TZBA 2BRUA 1ESZA 3BGWA 3EEBA 4JX8A 4RSHA 3ZU6A 3IOMA 2RGNA 2G80A 4BZPA 4BQSA 3AESA 721PA 3BGDA 2H9YA 3CRW1 4QTXA 2FAXA 3CVWA 5BNIA 1CK4A 3U37A 1YUNA 4KSCA 2C2KA 2OP0A 3IUMA 4WN3A 1JHDA 1GP2A 3C8UA 3ROMA 5KEIA 2VJMA 4JH0A 2CXXA 5DXJA 3C6BA 5LZ4A 1KDZA 5J2TB 1KDPA 1GL7A 2CK3A 1BCRB 4DNXA 5CFQA 2RH4A 1CEEA 4GL2A 4EA7A 2BM1A 3PJGA 5AVQA 1MB4A 2HLHA 2P9EA 2V97A 3EUFA 1B8VA 3HYLA 3Q11A 2BGGA 1Q21A 3IJEB 1TD9A 2CFCA 5BV2P 2DY1A 2XUKA 1GPWB 4IDCA 3ER6A 2FWJA 3AWDA 4C2UA 4RD1A 1NBMD 3G2LA 1K0UA 1RLMA 3SSNA 3EIWA 1L5QA 4TZTA 5B64A 5KSWB 2GKOA 3PYLA 1ONPA 4M1SA 2PGAA 2GZ1A 2B4AA 4ZQGA 1YQXA 5LP6C 1E99A 4XJXA 3VH3A 3KOOA 2IH2A 1RTTA 4FMDB 1ESEA 1ZY2A 4EKYA 3IAM1 3NG1A 3VDXA 2ADFA 4ZKDA 3N39C 3UMVA 3LPDA 4DJDC 1FTQA 4IS2A 2Z98A 1W6RA 4TXLA 4ESHA 2BISA 2ZSUA 1EFPA 3A4LA 4PAQA 1JAHA 3EODA 1H05A 5F1YA 2VQFB 1NUPA 3F5QA 1CQIB 2FLVA 2IPMA 5DI9A 3K4HA 1ZD2P 2GESA 5EQJB 4BQNA 2P5UA 4PONA 4YMUA 1XNRB 2P69A 3HVHA 3EWIA 4LV6A 4MQUA 3VYRB 2OZLA 1RAAA 3LDHA 3ADDA 2I3AA 3OG9A 1GQRA 1U7ZA 1XL0A 2YDYA 2GFQA 1EP1B 1I1NA 1Q0RA 3HXPA 3LCJA 4HWGA 4NJOA 1ZRMA 2E89A 1HNNA 4EUEA 3PX7A 5A3QA 1CRLA 4OB7A 2NSYA 4XUEA 1ZGAA 2BMAA 2IDJA 2TMGA 5DYYA 5G2OA 3WLAA 4A6PA 3NNSA 4AUMA 5KWJA 4JDPA 5KJCA 4GOKA 2OWEA 5LFAA 2DX7A 3TI7A 1Z2NX 1TO2E 1D3AA 2YC4C 1JL3A 1JE0A 2VZ8A 5IAAA 4G0UA 1OX4A 2WSLA 1J6UA 1YBMA 4CG2A 4BNFA 1A9QA 2X19A 4XRGA 2ASVA 3NWOA 4UE3S 5C1BA 4JT4A 3BWEA 5JVDB 5FPTA 2VDQB 3EEFA 4MCJA 4C20A 5C46F 4JELA 3BXGA 4RXTA 5KTKA 3AWIA 3IL2A 1UOPA 4A4DA 4MQLA 1XTBA 1BE1A 2C9OA 2OBLA 1QX3A 2V3WA 1HKHA 2ZPUA 1XAJA 3FVQA 2QLNA 5FAXA 1DIBA 2YOFA 4GPAA 1NM5C 5AJTA 4B6SA 4M36A 4D80A 2HA4A 3OEHA 4JXXA 2ZWMA 3NC0C 2XEDA 1F4PA 2EL9A 2G63A 5E6RB 1A4RA 1AV7A 2GUWA 4WOPA 1YZ3A 2WM8A 3T7TA 1LTKA 3H87A 1NZDA 4Y6LA 2F1RA 4N82A 3WKDA 3HWRA 3QKRA 5BV8A 5KC9A 3P9XA 2NU8B 5LNK1 5LD2C 4JFAA 3M7IA 4FSXA 1KPGA 4TVOA 3SD7A 5E4JA 1IEVA 2J45A 5EPUA 5HQJA 2H29A 4ZZ1A 1Y8ZA 2GPNA 2V6JA 4JT8A 3GLFB 4G97A 3SYKA 1E6WA 1UXHA 3ZKWB 1F5SA 3V8QA 3KETA 1U8YA 2VXOA 5M5BA 3W8FA 1G8AA 4FMBB 1BJTA 3R4CA 1PR4A 4EEZA 4KITB 1XMJA 1SQ5A 4OQMA 1JKXA 1LLQA 5C5IA 1C4XA 3ZX5A 3N8HA 5K8CA 2QEQA 1K0FA 1HDEA 5TPZA 3OTWA 4R1MA 3TTWA 3EZ7A 3K0EA 4L9SA 3PC8A 3KE9A 4XTRA 2IUUA 4BCDA 5LP6A 4LRXA 2BHNA 1G20B 1T5BA 4MP6A 2PANA 4NEHB 5A9TA 1B41A 3GV0A 5JTUA 3OPYA 4AZWA 1M1NB 1C4OA 1O5OA 2G9QA 3DEFA 3QW4B 2JLSA 3RRZA 3F49S 5EJFA 4WNCA 1TZJA 4O2BA 4BO2A 5CB4B 4LZZA 2JEOA 2ZB2A 5IVKA 1EGAA 2GA9A 4PG6A 1AUOA 3GAMA 3FPKA 4ZQEA 4I1PA 2DWQA 3EDMA 2AW5A 4FVTA 1CUFA 2BDUA 1JDBB 4KN9S 1U3FA 5DHRA 5FOTA 1M8GA 2VSXA 4LXHA 4W5JA 4WK4B 4YRGA 5FOQA 4FWTA 1EHCA 1AG9A 2AG8A 1IUNA 2C8KA 1YAJA 3EXIA 4O4IA 4F04A 3PP8A 5I9MA 4LCJA 4X8HA 3LQ2A 1TEXA 4JXKA 1G2OA 4E09A 1GN8A 5CT5A 4RLHA 4JB2A 3OCZA 2WG2A 4QOIA 4G4SO 3GIDA 4X6XA 2ONZA 1S8NA 4DANA 1ZNQO 5T64A 1BYUA 4C14A 5GJBA 5I01A 1AB6A 1QYXA 6REQB 1AQUA 1Z35A 2ZUSA 2YV5A 2ZJ0A 3KTAA 4IFEA 3T4UA 4KWTA 1QS0B 3LT1A 4K3UA 1RI3A 2IL1A 2Z1DA 3D3WA 3BPSA 3ZGXA 4YAGA 4NP6A 1CUHA 1RHUA 2VTEA 3E2MA 4TS3A 1V3UA 3DDUA 4HBZA 3N76A 2RD2A 1NM5A 2OCGA 4RSGA 4AWBA 4XVRA 1V11A 2K6GA 3Q3CA 2EQAA 3NV9A 4PZPA 3A28A 4RCYA 4AJ9A 5AI4A 5E6SB 1Z29A 3G5AA 2C8VA 3DOHA 4AB1A 5FFMA 1URPA 2PVPA 4UHKA 3GUVA 3HCCA 1NP6A 1M2KA 5K0SA 3WAGA 1YR2A 2F4NA 1CZOA 1JPJA 3EQ7A 1GJRA 2FJPA 2PTGA 4BFYA 2VEDA 4Q4AB 4C0QC 5LLDA 4XM2A 2FMFA 4YRTA 1T4CA 2XMRA 3BZBA 3KKZA 4DXHA 1LLFA 4QDTA 5DHUA 4MGEA 4ZVTA 4E5KA 4HDMB 1G42A 1UDWA 3QNMA 2VOJA 4CCWA 3NRCA 5C1PA 5DHSA 5K3SA 1ISHA 5K05A 3TRKA 4C4RA 4LECA 1YZGA 4QDJA 3U0BA 1VGRA 2BR3A 1U2EA 2DTEA 3IQWA 5EE0A 3QX8A 2F3RA 3R40A 2WT9A 2FN9A 3LDGA 5HTOA 1PJCA 1G5PA 1YRAA 2HJHA 3TXXA 4Q4CA 5F3WB 4LRTB 1NZJA 3ZU5A 5IZ4A 3LQ1A 3HM9A 1I3NA 1HA3A 2FEKA 3HR4A 5JH7B 7GPBA 1C7FA 1GYQA 4B85A 3AFGA 4BLTA 4MVJI 1QH1A 3CLTC 4Y1RA 3TYXA 4DDKA 3BFVA 2Y05A 2EW2A 2HA2A 1FX0A 1RWVA 2PRZA 2RHBA 2ADOA 1ZIDA 3T35A 3WGLA 4WFKA 4MA5A 4IVRA 5KYWB 3PEFA 1C8KA 3JQRA 1FJXA 1ST2A 3BMCB 3R5HA 1CQXA 3S2SA 4K81B 2R7MA 3QWBA 2PMBA 3FLMA 3LUCA 4IJ5A 5C3UA 1J2TA 3A6HA 1DDGA 4YHBA 1M2JA 4LFAB 2GZRA 3PEEA 2ZCUA 1A2OA 1CUZA 1FTWA 1TAGA 2PXCA 2QW8A 3HRKA 4L51A 5I9TA 1UAAA 1MAAA 3H9BA 1T2UA 1JJIA 2B20A 3HCNA 5C5DA 1OLXA 2ZVQX 3T3IA 2QY6A 2B1QA 5B1HA 4J2HA 5EQTA 4F71A 4BNDA 2ZIXA 4TLEA 2WPDA 3F8WA 1F0KA 1G1MA 4J29A 5SYMA 3SC2B 4X93A 3TMYA 4DVGA 1IG3A 1I3MA 4Y6QA 4CV2A 5ICSA 1T9HA 3WLLA 1RJGA 3PR1A 5LQAA 1NJGA 3NXSA 4DNFA 5K5EA 4P86A 4G07A 4BNGA 2AQIA 3QG1A 1B76A 4O4HA 2WE7A 1Z7BA 4U9UA 2X14A 2F8MA 3IV9A 4JLKA 4OLAA 2TS1A 1ZICA 2Y1EA 4CKEB 3ZLJA 3RR2A 5JZBA 1Y98A 3T1TA 3ELYA 1PWXA 2HRBA 3N7AA 1XZBA 3V8NA 3VR3A 2AJTA 1QDUA 1Z2DA 1M2NA 3VZDA 1U3WA 4FTWA 4M7OA 4QASA 3K0KA 5AHOA 5FPSA 1PGPA 1US8B 2GBFA 3CRQA 4DA9A 1N6KA 5BV7A 2H85A 1D6NA 3E1GA 3G68A 4WKCA 3ROGA 2VJAA 2ZB7A 2IXGA 1CUIA 1U0GA 4HNVA 3K30A 1C14A 5KNDA 3GRZA 4BMZA 2P1RA 3O74A 5AVRA 1EX1A 1T10A 3RABA 2PSDA 1K4YA 1RRMA 2ZQYA 5J40A 4J1QA 2Q28A 5TXGA 4CT5A 4S05A 3GFOA 1KO5A 3L43A 4IO0A 4AWXA 2ZRQA 4U7GA 3L4KA 4JBNA 5KTSA 4C7XA 2VRBA 1RXEA 3QXCA 1Q3KA 5KOHB 1D1SA 4M8LA 4EYQA 1G6HA 3PNBA 3U9LA 4RVSA 5AW1A 5ALGA 5E3JA 1BFUA 1NIPA 1XQVA 5HCIA 2DTDA 4KH0A 2ZU0C 1T5DX 2PGJA 3K1JA 3KZCA 2YWJA 2ICAA 4BNZA 3K71B 3QOXA 3VPHA 1YZYA 3PUZA 4ZCLA 3MQFA 3V48A 2Q45A 1WBJB 3AHFA 2P5SA 2KWIA 3QIAA 1D0SA 1HDOA 1TC1A 4PZEA 4S1VA 5HIAA 4RAOA 4TKUB 5IJAA 4BNTA 2XZTA 4QJ3A 1YOVB 3N6VA 5A04A 2POQX 2C4VA 2ZE6A 4C7BA 5B7GA 5J23A 1LDEA 1IRIA 1GNQA 4K6KA 3SKXA 2O54A 1Y9AA 3HB5X 2ECFA 3PJEA 4L0MA 5F98A 3GFTA 4NFLA 2UVDA 2YVAA 1N9KA 2PD6A 1X19A 5BSVA 4MWBA 2PYDA 2A9RA 2RAPA 1C1XA 3OEED 3KSMA 5CLIA 3PEYA 4CF4A 2XCTB 2D2IA 5DMHA 3IBSA 1CB0A 2ZSDA 3GC6A 4ER3A 3BMQA 2Y1DA 3MGBA 4BECA 3IQFA 3O47A 5CH3A 1DJLA 2QSUA 3BCUA 4QJ4A 1HO3A 3REQA 4BCBA 1YK1A 1D5WA 4ETNA 3PR2B 5JCPA 3UG6A 3C3BA 4TM7A 2WYHA 4AN0A 4G26A 3W9SA 2GWHA 4O2BF 1WUKS 4RIGA 5CYPA 1XPJA 3VH2A 1YGPA 4L8YA 4CM3A 3M82A 4AZ0A 3T5AA 2D1TA 1CRPA 2DBZA 2R5NA 2FNAA 4ND4A 1I51A 2F8LA 2IYOA 4OGWA 2VHUA 3NHPA 3ZWWA 4O4IF 2Z3ZA 4I66A 4RK4A 5H4HA 4Y2PA 4RZ3A 4EBBA 5BSGA 3F9IA 3WY9A 1M75A 5L4SA 1IM5A 2ZCJA 4NSNA 1PNTA 2CXQA 2FWMX 4I08A 4NU8X 4DIDA 2B0JA 4JJKA 1NF8A 2WFLA 1F5NA 1IBCA 1EK6A 1L7MA 3GRAA 4EYEA 1CWUA 1RWNA 1UFVA 3CPHA 2XCSB 2PH7A 3I9V1 4EGAA 4RTNA 1X8JA 3I76A 3GRCA 4IZIA 3BRSA 2IHJA 3TOSA 2XKBA 3CIOA 1CUBA 4QO7A 3V7WA 4EF6A 1GPUA 3D6MA 2GD0A 4S1PA 3KVOA 3RKSA 1IJEA 2C03A 2J7KA 2MR5A 1PQUA 1LLDA 1P74A 2D0IA 2HLDD 2GHIA 2NZWA 2PO7A 2VKTA 1YBFA 4FZVA 3STYA 3GT3A 3JXEA 4V1CI 4DQDA 1NNI1 4G0WA 1QOPB 1YMUA 1P1JA 3WJ7A 2J8ZA 4TV8B 3U4HA 1NASA 5IN5A 3TG8A 1PG5A 1GGNA 3A2MA 3L0YA 5AKIA 4F3NA 2Z08A 5GM1A 1E3DA 1MIOA 1MENA 3COPA 3Q7EA 4YPFA 3D4OA 2Q6LA 2OBFA 3HLYA 1KEKA 1R4MB 2WHPB 4IX1A 3QPWA 4J4HA 1KJJA 2BGJA 4DY6A 4C4PA 4DDVA 5GAJA 1V8DA 2BR5A 2Y27A 3CWZA 3HJRA 1UDCA 1EM6A 1PR6A 2C5GA 4NIMA 1ISGA 5JSYA 1T0IA 2QMQA 4LDRA 3MRVA 3B6JA 2WIBA 2J4CA 2GZAA 1VL2A 1QG4A 4HJXA 1E32A 1WV0A 2BSXA 5F78A 2IVFA 1S0UA 3EIXA 3IP6A 2P67A 3JQAB 2OHXA 2FSFA 3U7RA 2FPIB 2ZDGA 1J49A 2ECQA 1SG9A 3L7LA 4KXXA 5I9SA 3W8DA 2Z2XA 4H08A 3JRWA 3FAZA 3G82C 5A2QA 2VJBA 4PYRA 3PNVA 4KRGA 3UHFA 4LF8B 1T9CA 4UD6A 4OHBA 3C8ZA 3O26A 4MCHA 3DHYA 3PDIA 5IJXA 1P1HA 1V4NA 4JITA 1KVSA 1J0XO 1I2MA 3WLQA 4YI5A 1JEDA 2GZ2A 3GVHA 4RTRA 5BXQC 4GX2A 4D9GA 4ZEWA 1QB7A 5I7WA 1YB6A 4GQBA 2GZ3A 2J46A 4Q3LA 1QTQA 4WASA 1A5TA 2XXBA 1C0IA 4FJ0A 3EGIA 5E38A 4K6CA 4OATA 4B33A 1A9XA 3EPJA 4MW6A 1IBKB 5IDQA 2R1VB 4RACA 1TAQA 1CE8B 1UWKA 4LVCA 2C9MA 4N7BA 3RVNA 4ZHSA 3MJ4A 2Q41A 2EZ4A 3TK1A 2Y1WA 3GDFA 4W6QA 1ZO8A 3K4PA 1ISPA 1LU9A 4ASUD 3WWYA 4HHEA 3FSEA 3RBZA 2OBNA 3DAGA 3LQRA 4BMVA 5IABA 5JXHA 4DA4A 1Y8AA 4UHCA 3ZIAA 2H2GA 2AK2A 3HEMA 2I2FA 3M6AA 5BOSB 4AKHA 4RD2A 1NAHA 3TR0A 3LQYA 2JFHA 3PQ6A 2ABWA 2J48A 4E46A 2JIZD 2VCEA 3X1YA 1TK9A 5EWMA 4MWEA 1M73E 3P97A 3LHSA 3UYLA 3WMFA 4AJKA 3V1UA 1VSBA 1ARZA 2PV7A 4A8JB 2CBZA 3UFBA 1V5WA 3CF4G 4AI6A 3QI2A 4A6DA 5ALVA 1RYYA 5HKBA 1IZ7A 3H1AA 2IXAA 2Q21A 1DB3A 3BSFA 4PANA 4QBHA 3F7MA 4OM7A 1MH9A 5F7OA 1GADO 4IICA 4RM2A 1QF7A 3PQ5A 1WCYA 1BAPA 4BLVA 3AKDA 4AMBA 1DI0A 3EVGA 2W2PA 4R7ZA 4IMIB 1W1IA 3DFFA 1TL7C 2GASA 4O4HF 4YR7A 1E1KA 1UWVA 4JLPA 1MT0A 4ZPXA 4CXMA 1DAKA 1GYPA 2JA1A 2J0UB 3PZBA 2E0IA 5IM5A 1U9JA 3HACA 2HEIA 3HMKA 3K8QA 4MTLA 2X3UA 4TLBA 3J80A 4IF4A 2HR1A 4Y2HA 4FU0A 2AL7A 2J4FA 3ABZA 1SHUX 2GZMA 4M1WA 1WWKA 3KJQA 4WJLA 3KHTA 4ONEA 4EI7A 5LQMA 1L3CA 5JMTA 4TTPA 1L4GA 2AVNA 1R0YA 2PMEA 3GJ3A 5AHXA 2FPPB 3FSJX 4RV5A 5FYDA 4IHJF 1XF9A 2L2QA 4CMGA 1NVAA 3H99A 1KVTA 1YIAA 1DC7A 2VAMA 1WZCA 3SFZA 3P2MA 1XTTA 2G71A 2H1FA 3MBIA 4PWYA 5ALYA 1KY5A 1PZFA 3AF3A 2YJ3A 4G1CA 2WILA 4AMUA 3FCSB 4Q9IA 3VO1A 2P6OA 3SHQA 2RONA 4EUKA 3AC0A 5MN5A 3HL4A 3TLJA 3QVGA 1ZMXA 5KOIA 1L7DA 3RYIA 3FOEC 3U1VA 4MVCA 2GKGA 2QU7A 2QS9A 2WC1A 3ZHOA 3NORA 4AY3A 1W36B 2J5KA 4J9UE 2V7VA 4G36A 2Y0PA 4LHYA 4C6SA 4Y9SA 1BDBA 1N3BA 3IXQA 4CTNA 2R1TA 2C8JA 4MVJA 2VPWA 3EPKA 3LBFA 4HL6A 3I34X 4R2XA 3U7QA 3GP5A 2VYND 4U02A 1VCOA 1WMSA 3G1WA 3ZBPA 2XODA 4OHWA 4OBXA 1GSAA 3NTXA 2ZYWX 3V1MA 5CVDA 4NBLA 1D4ZA 3G0DA 1SU6A 1MNAA 1F12A 4FEEA 2B9EA 4G5YA 4XVCA 5A9SA 4US2R 1B7GO 2R79A 4FYKA 1IQ0A 1V26A 4BX9A 2RJOA 1ZONA 4RUKA 3ZVNA 3GA0A 4JL8A 2OILA 1EFKA 1V9CA 1R6AA 3QWHA 4GLJA 2DSTA 1GD1O 1PI3A 4KQIA 1DFGA 2PL3A 5IDVA 4W9NA 4MARA 3LBNA 2WSSA 5K0ZA 1QM5A 4GGPA 1A5BB 1AGXA 4U4AA 3EK2A 2PUTA 2ZRJA 1CY1A 1UMDA 1XAGA 1UOQA 2DUJA 3FI0A 4ALLA 4ZYZA 5DNWA 4R1QA 3UJ7A 2DBRA 5EE1A 4C87A 1T2DA 4M1QA 1UK8A 1X8XA 1WCWA 2R8EA 1VHLA 2CUZA 4GOXA 1JIUA 4NMHA 5AJWA 2XT9A 5A62A 4YUVA 5I4CA 4MOWA 2QL9A 2AUMA 2H2WA 3W4JA 4FHFA 3L07A 2AVDA 3LM8A 4KKVA 1XEXB 1J9EA 3G3EA 4OM8A 1DRKA 2CKMA 3ZI4A 1UJBA 4TLDA 2HBYA 5JS1A 3WGVA 4G56A 4C07A 1WMFA 1SH7A 3D81A 2C42A 4V3BA 2QZSA 1KJNA 1I3OA 4ZODA 2B98A 4AUEA 3C39A 4KDRA 1YA8A 1YQGA 2W42A 1U7PA 1CY0A 4NLLA 2XBUA 4UUAA 3TQSA 4LF4B 2BIFA 2XH8A 2M32A 3DOIA 3LLMA 4W5NA 1YZVA 4XYEA 3ZUGA 4E14A 3ETNA 4TKLA 3HDQA 2I9KA 4QT0A 1XPUA 3BE5A 4IG4A 4XJSA 3K8OE 4NOJA 1SBNE 4UVEA 4MWCA 3WK5A 3WRYA 2DT5A 2VDOB 3COYA 4YT8A 2MYTA 2PBZA 3TIFA 1BXKA 2O2EA 4P7JA 4R5HA 3OF3A 3VV2A 1G8KA 3FMVA 3I04A 2HQ1A 3PHLA 1NZFA 2W48A 5DYTA 1GUFA 5H81A 2GNAA 4C5AA 2IXBA 3IJPA 4AYTA 3LYLA 2HB6A 3AUXA 2DUNA 4DQUA 2YKGA 4EATA 4EVRA 3TNDA 3VAYA 1ZD8A 3O8NA 4PC7A 4BUCA 2IPAB 4LRYA 2BCGY 3K1YA 3LRXA 1D8TA 4UZEA 3DONA 1ZSYA 2I4MA 3NBYC 3N6XA 2DWCA 2O5RA 3QUTA 4EB3A 4JKYA 3H9UA 3JWIA 4H6XA 2FDCA 2G5TA 1W87A 3SVZA 1FLDA 3C70A 3LQFA 5IULC 3CJRA 2IS1A 1RHJA 1XWIA 1WX1A 3ITDA 2HA5A 3TFOA 4E12A 2G0TA 4NAHA 3KUDA 5GQSA 1YZNA 2G88A 1VSQA 4L9WA 4YRZA 4HAIA 2JC3A 2NPFA 2BE9A 3F3KA 1FQOA 3EAFA 2HJSA 2VRCA 1I36A 1KORA 2RC5A 3GU3A 3UXHA 1PNQA 1DEOA 1PYGA 2ZJZA 1BJRE 1YCDA 4NDZA 3DA8A 3K0CC 3UAYA 2BGNA 4MW2A 1BQ3A 1DTEA 2BLLA 4YJFB 3FB4A 1BSVA 5DM1A 4LJKA 1PP4A 1W4LA 4WZBB 3AV3A 4J7XA 1YIDA 2E4XA 3R8CA 3HXLA 3EOAI 2D06A 3VZQA 4JLJA 5BSUA 3EBOA 4CIBA 4E5VA 2EFJA 4HDNA 2CXPA 2QLFA 5DNEA 2JFPA 2Z9BA 3VRHA 5M3BA 5B6IA 5CJJA 3NOXA 3PYMA 4DJAA 1EWKA 5J2UB 3UAVA 2ZUUA 2O8NA 1B3RA 4KQ1A 3KV3O 3PC7A 4HZUA 2UYYA 5C37A 4DFDA 1CJUC 1NYLA 3FYDA 3IKVA 4Z1MA 3RS3A 4I6JA 4AX4A 5GZ1A 4PYIA 4PG5A 3TD6A 2E1RA 2GJ4A 3M4NA 3MHTA 5ALPA 2GH1A 2KSQA 2RJNA 4U39A 3WWDA 1R6XA 2Q0HA 3L18A 2RE8A 2PUEA 3EDRA 5LQJA 3LZCA 4K9MA 3KKQA 1QRTA 3D8RA 1OWPA 4A2QA 3M8KA 4OMUA 5BNTA 1NVTA 2QZ9A 4LV8B 3IOBA 4J2TA 3QY9A 3GJZA 3RC7A 2FR8C 1Z7YA 1KE2A 4CEIB 1T5OA 4UM8B 1ND6A 4RORA 3LX8A 3WGZA 3G1TA 4R8SA 1T0HB 3EFBA 1JIQA 3ZCRA 4CMKA 2IYUA 4TRNA 1AM4D 4P7BA 1YB5A 4RIIA 3KQSA 5DCYA 4V1CA 2X1MA 3HYRA 1WY7A 1HE3A 2I8LA 3O92A 4FGLA 2FFQA 3TDNA 3NRJA 1HQCA 1PBNA 1SO8A 2IGTA 3L0CA 4M1TA 4JJEA 1S3GA 1TTPB 4RMGA 1LBSA 2OHFA 2VJLA 1ZP6A 2HWWA 2VC2B 4JSTA 2VJOA 3SOPA 3DLBA 5I47A 1PQPA 1PZGA 1JNXX 1I5EA 2G5CA 4EY3A 3H1EA 3V7FA 5HRAA 5DFAA 1VKRA 4KTTE 5UKDA 1ZJ4A 4E5NA 2EV9A 2JEZA 5TQVA 1RHRA 4JOCA 4AZ3A 4I55B 4UBNA 3ZY4A 2G08A 4QUIA 4F85A 4XSGA 4ZMBA 1FVOA 1XVUA 3TBHA 3MLBA 3MQ4A 3VKUA 1JA0A 1WB9A 1JHYA 1ZIPA 2PSJA 2R6CA 2WU8A 3HB9A 3V8VA 1PEYA 3FY4A 5ADWA 3M1YA 1OXTA 3QE3A 1DEHA 3KCQA 1C9MA 2BEVB 5B2FA 4ZA2A 1OYOA 4ZYLA 3GNTA 5IC5A 1V48A 2FQWA 1ENPA 3GFGA 4QEDA 1KTIA 2ZEJA 4K9QA 4ZOLB 2RGGA 1RIIA 2PPVA 1RCTE 2ZRHA 4N3CA 4BP1A 1C7ZA 1XCGB 4JLOA 4MB2A 1MG5A 1OLUA 2VJNA 2A3RA 5D3MB 2RI0A 5JD4A 4GYYA 4B6FA 3K0CA 4BE4A 4QGSA 1IAVA 4O6VA 4RHUA 2Q2OA 1Z6QA 1U8ZA 1W1UA 4LJYA 4DIFA 1TI7A 5BY2A 1WQ4A 1FRFS 2GF9A 4C2BA 1QC5A 3I52A 1IXKA 4UC0A 4LY9A 3HPRA 2OB2A 2W6JA 1OZ0A 3PTLA 4DUYB 4MVJF 5DO9A 3EVNA 2OV4A 5G41A 3G9XA 3JD2A 1A1VA 1W52X 2B8JA 2V1UA 4M8IA 4F8JA 4IJKA 1M6VB 4ZDKA 1TCVA 4OK6A 4DV5B 2B7CA 4RFVA 4G4IA 2P2NA 2CSUA 4M0CA 1GILA 3CF6R 3BF8A 3C1AA 1Z25A 5I7VA 4LPSA 3MMSA 3BXOA 4Y2GA 5BPFA 3F96A 3ODGA 1N6PA 1A9SA 1SR8A 1H22A 2JIDA 3H2JA 2VN8A 2OTCA 3LCUA 3NP9A 3UJPA 4AO8A 3DMYA 2YYAA 1Z83A 3D43A 3IMGA 4MYRA 4JJZA 3TMAA 4CN9A 3E3MA 4HYYA 4Z7NB 4OSOA 4NFYA 2O06A 1MTOA 1M2EA 5AOVA 2P0YA 2ZXFA 2UZ1B 1LCIA 4F9EA 3G0HA 4DCTA 2QUZA 1JZSA 1PVVA 4O63O 4TZ0A 3A58B 1P17A 1PJQA 3HDJA 4M6WB 3TIXB 2GPJA 3E7FA 3MPUA 1SC1A 2R1UA 3DC7A 2PM8A 5DGDA 3SJ7A 3WB2A 2QPOA 4WESA 2O7RA 5DRTA 1GCIA 3LLCA 1AK2A 4LK2A 1KK2A 4UD2A 1OBOA 4JBIA 5REQA 2VDUE 2XQJA 3DMRA 1OH6A 1PJ2A 2FZCA 4LDQA 4ZAZA 3F73A 2PPLA 3GRYA 1Q0UA 3CO5A 4GRIA 3I4FA 3VSEA 2IWRA 1VL0A 2G76A 2WD7A 5EJEA 3RADC 2REOA 1E5LA 2DHQA 5EXXA 3HGQA 1OPRA 5H16A 1IPFA 1AKQA 1TM3E 3L1JA 4IMRA 3ECSA 1ULSA 1M67A 4WVFA 3CVUA 2SKCA 5DULA 1GWNA 2BZ1A 3AF4A 4P0TA 4UEJA 2WJWA 4KPUA 2E49A 3AJDA 4A27A 1JMKC 3LUKA 5JWRA 2OLKA 1NW9B 2QTBA 1V8ZA 2ZXUA 3EZ2A 4Q4HB 4WLVA 4WXRA 3KB2A 5F64A 3R2JA 1BJKA 3UM9A 2JJYA 4MNTA 1QTRA 4JUCA 4DYVA 5SV2A 2HU7A 4B6RA 4LHVA 2QYTA 2OA0A 1UBEA 1KK3A 4PCUA 3IIEA 1DWOA 3PV0A 4M1YA 1HE4A 4JJ6A 4MPRA 1V5EA 4PU0A 5JAUA 5JADA 2QSYA 3KOXA 1ESDA 1U3GA 3DM5A 1ABEA 5KHLB 1P81A 1SQ6A 1G4HA 1MT3A 2OV2A 1IZZA 3KXPA 5DASA 2PVSA 3L79A 1Z5ZA 4LE0A 1GLGA 1S2LA 4MW5A 2B37A 4QO8A 5AXCA 2F8TA 2X5XA 3OM1A 4YCNA 1J2YA 2NXEA 1F2UB 4BNNA 5JNLA 3GI1A 5F12A 4S1WA 1T5TA 2BFEB 3WL8A 4AX8A 2R60A 4ED9A 3LC7O 5G1OA 1GV1A 1T1IA 3HYCA 4WA8A 1B6SA 3QVVA 2DRIA 1RAFA 2VSQA 5TDHA 2WKRA 2ZSKA 5JRJA 5K4AA 4ZZ3A 1KYVA 2ZZNA 2GX6A 5C35A 1YRQA 5TJHA 4BFUA 4GE3A 3EZ9A 1RIFA 3L7KA 1KO4A 1OI2A 3HB4X 3MN1A 3VU3A 4YRRA 3A6ZA 2HJRA 2Q1WA 3TPFA 1NR7A 3PC2A 4AT1A 2NU7A 5BUZA 2UV8A 3IT2A 4PS1A 3ZCQA 4DEXA 4FBLA 1E1DA 1ISMA 2LIVA 3BT7A 4RIEA 2C1XA 2RH5A 2BAGA 3ASZA 3AUSA 4C08A 4BC0A 3N2GA 3I0ZA 4M83A 1F6BA 2BM8A 3E7DA 4GKVA 4EPRA 3AIKA 1UKEA 4XARA 4B9AA 3SFTA 4WN9A 1AZSC 4YAUA 2E9SA 2I1LA 1W4CA 3I9FA 3UO8B 4MRSA 5CAEB 4C5CA 4DLRA 1WB5A 2HSGA 3A10A 3OZRA 1WHTB 3LO8A 4FYIA 2IYAA 5DTIA 5KNCA 3QUAA 3L49A 3SNHA 1P5HA 1ORDA 2QRKA 4I4TB 1C8LA 3TKLA 2IDMA 4ZVPA 1XUOA 4WXEA 8GPBA 2R751 4QM7A 1DO2A 2WTBA 1KR5A 3DQZA 1XE3A 3IKJA 4FE4A 5F3DA 3RTBA 4C29A 5BWCA 5HKOA 1R0ZA 2WABA 3QU4A 4UMDA 1MAVA 4CUJA 1YVDA 2PKXA 1PT5A 5CM2Z 3BCSA 3WWEA 5KZMB 4QM6A 3EA0A 4YUXA 2VDJA 3F0TA 4L8VA 4M8KA 2R4UA 3LLVA 4DR4B 3KPWA 1I9CA 2C4KA 2YTZA 4I1SA 4WLOA 2Q1XA 4LV5B 2BMFA 4U9IS 1SXGA 4G86A 1VI6A 4Y1RB 4BXOA 3FNQA 3NKFA 3SR0A 5MFZA 3LYHA 4XB2A 1E9SA 1DHRA 3PT9A 3ZZMA 4M1MA 1G5IA 2J3QA 3JQAD 3OMLA 2YWEA 4M76B 1ZGZA 5CPFA 4V0SA 1CRZA 4WOCA 1W88A 4RGVA 4YXWA 1A4XA 1L7AA 1NN1A 2GCPA 3GGPA 2VH5R 4P4SB 1NQUA 1GUZA 3MRXA 1Y63A 2W58A 1Q2XA 4HEHA 3SEZA 1YR7A 1TEZA 3GW8A 2O8CB 2IHNA 4EAAA 1MVOA 4NYJR 4XJVA 3CWQA 3OP1A 4A16A 2WQ6A 2AQ8A 1SXPA 5EMMA 1IJFA 3OE4A 4NC9A 3HKEB 4BVLA 4OMFG 2H1SA 2AXNA 1GDDA 3A2NA 1KMHA 5FTWA 3F78A 1V25A 3DFUA 4B81A 3M1AA 4MGIR 3GZTB 2YZMA 2BEJA 3ZD6A 1Q19A 2FN4A 4D9BA 1TLFA 3RDPA 3WL7A 5IVPA 3OESA 2PQ0A 4LTDA 3DLTA 2OBMA 3CONA 2ZBEA 2JCSA 2OAGA 3HYNA 3NVDA 1CEXA 4NF2A 2YJTD 4OU4A 4PM4A 1E4OA 2P9CA 2FEOA 1KP9A 2YDXA 1OR8A 2D5AA 3KLNA 4IYJA 3REGA 4CKCA 2DB3A 4DZZA 2QY9A 3KO8A 2WMNB 2XGOA 2G04A 4RMJA 1EIWA 1O54A 2XUHA 5T4HA 1OJ7A 4XYGA 5JV5A 2P6RA 1GAWA 1WXDA 2D4HA 2QVLA 4EKNB 4PLHA 3AUKA 3X43A 1Z3CA 2Q5JA 3H75A 3L8HA 4UNIA 5C9ZA 1YL7A 3ZX4A 1TYZA 4OXQA 4BC1A 3FMOB 4L50A 4AECA 4Z6KA 2JZOA 4GGMX 4GXRA 2GM5A 3MGGA 1CDOA 4B74A 3COSA 2C5FA 3SYMA 1UJ6A 1Q95A 3TM5A 2WIGA 3GEGA 4CKBB 2ZUDA 4IILA 4PQGA 1RZVA 2Q4BA 1UBFA 3DE5X 5HQ3B 4UTVA 5B4TA 3JALA 4DGQA 1JAZA 1QF9A 3ORHA 1V71A 4MWTA 4DUPA 3R5SA 1EFRD 2JJ2D 1NRIA 1I01A 1K97A 1P9NA 3BTSA 2XKJE 2B36A 3UHOA 4HV4A 2YJGA 4M1OA 4UXHA 2I4TA 1MFZA 1Q0ZA 4FEGA 3IMFA 5K3BA 5JNRA 5KQRA 1IOVA 1KZYC 4CLOA 4UMFA 3ZBUA 1KJIA 5CX1B 3DAFA 1E2QA 2P8SA 4NOKA 3S27A 2K7FA 3HLTA 1H9AA 3OQJA 2XUQA 2FN7A 3UG7A 3DHNA 2CN1A 1MMFB 1UDXA 2C88A 1J0AA 2NXCA 2NUBA 3DPUA 1ELOA 3HBAA 1EVIA 2PQ6A 2Q3CA 1KY3A 2FXVA 2X3FA 1E3EA 2QR3A 3A32A 4N39A 1KY4A 4WFJA 4PAGA 5H59A 1SXJE 3U3JA 1B8OA 1SCUA 5TEWA 2NTJA 2QD4A 5T6MA 3NJ4A 1D2HA 1DG3A 4PTYA 5JI2E 4BBAA 3RJ5A 1W36D 3FKSA 1GL6A 1W5TA 2RBKA 2FLWA 4JSRA 4P54A 4R2KA 2DPHA 3SZRA 1QZ3A 1YB4A 1J20A 1N9GB 5BURA 3GRKA 1TFRA 4I4LA 4L76A 3GDWA 1V1JA 4DAOA 5EMHA 1ULBA 2P2LA 3A1TA 5DHFA 3SIWA 2MCFA 2GYUA 1ZQ9A 2H16A 2XXJA 1SHJA 2KLBA 2CKDA 1GRVA 5BVGB 4MYTA 1N5RA 4G0MA 1II9A 3FCOA 2PY6A 3IHLA 3CCFA 2DC1A 1SVUA 3L82B 4FYJA 1RWPA 3W5CA 3DBHA 1EI9A 3CBQA 3WWOA 1NUUA 1HOTA 1T3TA 1GAQA 4ZIRA 5KCZA 2PKRA 3AERB 3IXLA 1L5YA 1O3YA 5FL3A 3EF0A 1BQ4A 1ADFA 1HZZC 4ND8B 1ZOLA 4UDYX 1NDQA 5FUWA 3KR2A 3RUIA 2HBQA 3RYHB 1TKBA 4MW9A 1QR6A 4JMPA 4TL7A 4BMPB 1Z33A 4N5IX 1U0FA 4INJA 4EO7A 5A5GA 1DLIA 4DUGA 3DYIA 2AUTA 1J2EA 2WFMA 3ZDQA 5IUJC 5JJLA 2X15A 2AZDA 4UHBA 3OFKA 2GFIA 5IXYA 3HNRA 5FNVF 4ID9A 1FUUA 1JYFA 1NUAA 4AQDA 1WW2A 3BIJA 4DHEA 2HF7A 3D1JA 1VFNA 3EGVA 3K15A 3O9VA 4DRXB 4ZK2A 5IASA 5GONA 2NUAA 4FSHA 3OM8A 3PD1A 2W43A 3HO8A 3PUVA 4RULA 3BMNA 1JQJC 2NSJA 3COVA 3Q7IA 4O1IA 3CR8A 4X8MA 3RVLA 4EUSA 2CFRA 1NFFA 4HT3B 4MGYR 3UMSA 5K8UA 1PV2A 1PWHA 4TYPA 4E7PA 1ILEA 1R5NA 1M2FA 4HFRA 2BTQA 4N12A 1JHUA 5IKOA 2P27A 3VAAA 4MA0A 3WDKA 3KL4A 4OHXA 2Z5FA 1U2SA 1XP5A 2G8LA 2IPXA 4HH1A 2NZYA 3WQRA 2VPTA 3T7RA 4EYKA 5EWJA 4F84A 1L7QA 3N8GA 4NH0A 2CDBA 1MPXA 3C3XA 3GMTA 1IHPA 1L1EA 4IOJA 4AJIA 4BRZA 5A4AA 4N9QA 5TVKA 4LFBB 2O59A 1T6BY 3NGMA 2YS6A 3VZCA 2VNIA 4DGSA 4Z4EA 1IONA 3ERCA 4NBRA 2ZYIA 4F38A 3UMMA 3H04A 1KWGA 2PRYA 1XCMA 1MZVA 2NU9A 2JFXA 3JSXA 2HV9A 3ENNA 1PFUA 3FDZB 4YJ3B 5KNDH 1BC5A 3BOSA 4KPEC 4ZCRA 1K7FB 1E5DA 4BGVA 1ADCA 3DE2X 1VHWA 2AI2A 1VQ1A 1WULS 2HAEA 3W3AD 1FEZA 1UPTA 3NEYA 3IDOA 1ZIYA 1Z82A 5HFAA 3A1WA 3KQPA 2ZTSA 3PWZA 3T1QA 3GFVA 1N6OA 4V03A 3WE7A 1OGYA 1JHMA 1H0KA 4CKYA 4NJEB 3DO8A 5CLJA 1Y8RB 1NURA 5A7GA 2R6FA 5LPNA 3FA2A 1INLA 1YACA 4PZDA 4G5QA 5L95A 3E22A 3H7AA 4HS4A 3KZMA 3WK9A 4BQQA 4BNYA 4Q93A 2GN9A 4EP1A 3AP3A 2CVQA 2FZEA 1TIKA 4YP7A 3RS0A 5EJ4A 2NSLA 1L4YA 5JPCA 4PN3A 4PFSA 5CYOA 1R4NA 3PDWA 4CMEC 4FOLA 4RKYA 3LYUA 1R0WA 4YRJA 2LWIA 4C06A 4QDZA 1HT2E 3GDOA 3L3BA 3LO5A 3ABRB 2OPHA 2OV6A 4FW8A 1V7PC 4LBVA 2DFDA 3OZWA 4LOKA 1QRUA 4Q6BA 3AYXB 4JUAA 4A36A 3GQBA 2WQZA 1GUYA 4ND2A 1Z56C 2XF2A 3OLXA 4FYVA 5AUQA 3BIXA 1Y89A 3EGEA 2OQVA 3ST7A 5IK2A 3TNYA 3TZEA 5IJ0B 5JJKA 4CMAA 2YCLA 3A4TA 4N9WA 4YECA 2DOKA 4ANFA 2J9YB 2VUUA 3IUSA 2BZ0A 2L17A 4UFPA 4MUNA 5B5SA 5IJ9A 1ZUIA 1KGSA 2QM8A 5CA1B 5EXTA 1TB4A 5DJ5A 1ZRHA 2Q07A 5GJCA 1DPFA 3WISA 1A8PA 2ATVA 2YVKA 2Z09A 4RJKA 3RIXA 2DR0A 2PL9A 2REQB 1GR1A 2WSMA 3N8NA 3IEUA 4CMIB 3Q98A 4TUYB 1W8DA 3ICPA 1QIFA 3MM4A 4I5EA 1DO8A 1QHNA 3IP5A 3E2IA 4X1IB 3KS9A 1E66A 3O03A 3E4CA 3IQZA 3Q3IA 5FAKA 3D6UA 1II8A 3EAGA 5JNVA 5THXA 1R74A 5ESRA 3D9QX 3DV0B 5HK8A 3GWZA 1KHTA 3HCAA 3BILA 1QCZA 1HG0A 1PCXA 4M9RA 4PCAA 2ANBA 5TY0A 3T0GA 1YVUA 1ZSNA 1XCBA 2P4SA 3DWFA 5K3AA 4BMNA 5JPDA 5JQGF 1EK1A 4TROA 5F7ZA 5CMLA 3W2IA 4NZZA 3SHOA 1HDXA 1IOZA 1WR8A 3ACDA 3ANXA 4XJTA 5CXQA 5D5HA 2QNIA 1LBIA 3UJCA 1COWD 4YYZA 3RG8A 3G9UA 4DQVA 1T9KA 3DUFB 4OLFA 1C9EA 3OP4A 4FB4A 1ZWLA 4ZGBA 4CIXA 5K8VA 4RETA 4KLRA 4I3FA 3ZBTA 1GZVA 3W3ZB 5HIKA 1TJNA 2DHDA 1JS1X 2Z5LA 3ZJUA 4FDTA 4KQJA 4LC1A 5EGNA 1YU6A 2CL7X 3LMKA 3WLHA 1GCUA 2WMOB 3I8OA 4IIDA 2W2OA 4P9NA 5E2BA 5GOZA 1PR0A 3EN0A 5BSFA 2XB6A 4DR5B 4PLZA 4UFNA 4FCCA 2XGMA 4NOMA 1K68A 1G3UA 2DBVO 3L02A 3ZHUA 4F2DA 5KQGA 1QRSA 2LXNA 3ADKA 3MJEA 4EHDA 1ISIA 2W0MA 5KCMA 2XMGA 3EQ9A 2HDWA 1KEEB 2MSWA 1TJPB 3H4VA 4ZQCB 3RU2A 5TMPA 1IEXA 2W2XA 3DOCA 5F7XA 2H17A 1R8XA 2ARKA 4UHEA 4Y2RA 1UBSB 2D5LA 1B93A 3RSSA 1OGIA 1XF1A 2IHBA 5TIIA 2VQ6A 2IS2A 5IMBA 2QRMA 4GR9A 1VIMA 5CG2A 1ZD3A 5IUKC 3PS9A 4GYWA 5BSTA 4E94A 3LUHA 3KD3A 3CGWA 5A71A 1X14A 2Q9UA 4URWR 3IVRA 3UB2A 2CNWD 2XTNA 2V9PA 1P75A 3DJFA 3DLPX 2GJKA 3JARB 3R3WA 4JB0A 4UVHA 4BU1A 1P3Y1 5I8WA 1N2IA 1WVGA 1KMNA 1GLNA 2AN3A 4G8DA 1WHSA 3FYTA 1P0CA 2IOQA 2ZQ5A 3CGGA 3NJRA 1Q0PA 3OBBA 3S5JA 1VECA 4ARCA 3B9BA 2JI4A 2ORED 3RS8A 4D6XA 4M2LA 3OKFA 3B2QA 4C7VA 4OX9Y 1OA1A 1YTLA 2FW6A 2FHSA 3L8FA 2ZI7A 4FBGA 4PINA 3MS2A 4X71A 5AR1A 1X9IA 4X8LA 3SMQA 3TNLA 5IDYA 5HWSA 2GEBA 4B4VA 1PGQA 3OETA 4RGBA 4DEYA 4XD2A 3COZA 4HB2A 2IDZA 1MPTA 3ZQ4A 4QDKA 2UYCA 3OQHA 1WS6A 3W77A 1EXWA 3LGAA 3MT9A 3HMQA 2W6IA 3OOWA 5FWXB 1P5FA 2ZBRA 3V4RA 4FC7A 2F3UA 3BIWA 3HG7A 4QYIA 4WFIA 3ZE2B 3CXUA 1WMBA 3F4KA 4GBED 2FUG1 2OV1A 2JGDA 1EVJA 1S02A 4UXJA 5DB4A 4XIFA 4L5IA 5DOZA 1X80A 3WIVA 4Z4HA 4GE0A 4ISBA 1JT9A 1IJBA 1VKNA 4MPJA 5EIEA 1ULHA 3H4IA 3D8TA 3JQCA 4BB6A 4G8JA 3GMDA 1HKUA 1ZX1A 3IPLA 1HETA 5IPFA 3THXB 5GONF 3IV6A 2VXBA 3ONNA 3U4DA 1NI3A 2G8NA 2EP5A 1L2TA 2TSYB 1HC7A 4OJKA 4AP6A 5JH7F 1PJZA 2HRDA 4EHLA 3LV8A 3E03A 4TQAA 1HLGA 3U3KA 3RC3A 1H65A 1ZEJA 4XIIA 2EKDA 3NNDA 2YRXA 1JTFA 1C7IA 2IW1A 2QPAA 3C3DA 5E0OA 2DR2A 3EGXA 2BR4A 1MA0A 4TSRA 4Y6PA 4F06A 2D2VA 3EUWA 1KNXA 4HXEB 4ZQFA 3RS4A 3HUFA 3GEEA 4E5SA 4OF4A 4ZTZB 2YW9A 3HZRA 5L45A 4BUJA 3PSAA 1RRFA 4TS9A 3ZEIA 3KR1A 4NCJA 4U6SA 2I76A 1LF0A 2J3DA 4RW0A 4Q7LA 3HZOA 2H1OA 1QCYA 2QRVB 3W34A 2Q5FA 2VI5A 1BVRA 3R6TA 4RBNA 5CRIA 5EKTA 3UATA 1E7YA 4Q9JA 4QOSA 1IN8A 1FNSA 3H4MA 4FWIB 3ADCA 1Q5PA 4ALMA 5LMNB 3KB8A 4P36A 1SB9A 1YULA 2DUWA 5FL7A 3KU4A 3PQFA 1R4ZA 2J31A 3FJ1A 4GZ5A 4JDUA 2UXBB 2GM3A 5HM6A 3HL0A 3RSGA 2VAVA 4YMVA 4ITVA 3CVXA 3X1WA 2PFGA 3LFUA 2HEGA 4MVJH 1MB0A 1X7YB 2FMUA 2I29A 3CRMA 4HCJA 2QRHA 3H11A 1K2VN 5F1OA 1JA9A 4JJ4A 4IQ8A 3FDFA 3GLGE 2YV3A 3E3OA 4BO1A 1DRWA 2DSNA 2R7LA 1XFDA 2XZLA 3V9PA 3MRTA 2HY7A 1QFZA 4BO5A 3FYUA 5EWLA 4OHZA 4AP5A 1W0CA 4X1YA 3CNBA 2EKQA 1RPNA 4HYEA 4DMRA 2AH5A 1CR1A 3LDUA 3ULKA 3DQPA 5T8KA 3PEWA 3H9JA 3G8BA 1ZXXA 2FW7A 3MYYA 4PO8A 5J9FA 3RD5A 3T7EA 3PD7A 1EP2B 4XVUA 3I4CA 4ZVQA 1I2ZA 1A50B 1GUDA 2GHQA 5DF1A 5K0JA 3PRYA 2QG6A 2B3TA 4G8BA 2BJWA 1M1YB 4OIMA 4I8IA 2GXUA 3WMXA 2ZRNA 1Y6GA 1NAIA 1TQ8A 2FPOA 4UEQA 2H11A 2BKEA 2PSEA 4FDAA 4MEJA 4RK6A 4XIJA 1QO0D 4BVEA 1ZOIA 1T3ZA 1NBIA 1VLQA 2I66A 3TSWA 1ANKA 4IWYA 3BCRA 3FKJA 3OY2A 2ST1A 5C4GB 3ZWCA 4EJ6A 1ZM3A 3NR2A 2ZWAA 3AFHA 4NAUA 4OXKA 3VC1A 4C4TA 4MUIA 4FYYA 2JAPA 4FFNA 2NXJA 2B4QA 3EPRA 1FLVA 2B8WA 4HWRA 4MQEA 4WCVA 1ITZA 1Q44A 4KL8S 5FFNA 4JY7A 1MC1A 2Z4RA 3FM9A 4J0KA 2AFIB 5COBA 4DKXA 1KFBB 2ZUFA 1MX9A 2GVZC 3AHIA 4RVFA 4F5DA 1VL5A 2AR0A 4QU5A 1E0KA 4RH1A 4UCFA 1OKKA 2CMDA 2O4CA 1E5TA 1GQFA 3OZTA 3SZMA 1E69A 4QYMA 3U16A 1K3UB 1G8JA 4N5NA 16PKA 1SHZA 1BWRA 1OHHD 1KJZA 3DL4A 5LLTA 2VAXA 3GGGA 1R3UA 5HBRA 1B8NA 3R44A 2UUBB 2E4ZA 1NN3A 4H3SA 3U6BA 3GLHB 3GFSA 1LPAB 4NBSA 5KAPA 3WICA 1TQ6A 2CDRA 1NOJA 2R86A 3OCWA 4NQRA 2V5AA 4UTOA 5ICFA 4F60A 1I6LA 3OTOB 1RQPA 1U3UA 3O73A 3IAS6 5CITA 1U1GA 2FDXA 4OBEA 3RLIA 5FTJA 2N46A 4DQXA 1XMVA 4UBOA 4TV9B 2PNJA 4Q47A 3PUJA 1PSWA 1WKVA 1J33A 3LK6A 4RD4A 5U4XA 1NBME 4LYGA 5BN5A 4WL0A 3H1FA 4A2PA 1XG5A 2R00A 1WOMA 1A9RA 2X4GA 4IZHA 4EELA 5MFPA 2AYXA 5A6VA 3BAFA 2LNDA 4Q1FA 4KXUA 4E22A 2ZDQA 1GL3A 3PHGA 3THOA 3PDJA 4U3JA 3C1TA 3PHJA 2GZDA 4L6AA 3VU1A 3Q8KA 1T9DA 1WL8A 3BA1A 1C3EA