5IM5A

Crystal structure of designed two-component self-assembling icosahedral cage i53-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
b'TKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTRMAGKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Designed Riboflavin synthase
publication title Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Protein binding
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, O, Q, S
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 5im5A00
1KYYA 1XN1A 1C2YA 1KYVA 2C9BA 2C9DA 2B98A 1KYXA 1NQVA 2A59A 2B99A 1DI0A 2C94A 4KQ6A 4J07A 2C92A 1NQWA 1KZ1A 1NQUA 5IM5A 2JFBA 1NQXA 3NQ41 1EJBA 1KZ4A 5IM4A 1HQKA 2VI5A 2I0FA 1RVV1 3MK31 2OBXA 2C97A 2A57A 1KZ9A 2O6HA 2A58A 1W19A 2F59A 1W29A 1T13A 1KZ6A 1C41A 1ZISA
chains in the Genus database with same CATH superfamily
1KRHA 1A2BA 4C7BA 4M9SA 4DDMA 4BLVA 3ETDA 4L0MA 1DIGA 2GHTA 2NX2A 4YRGA 2VVTA 2RH9B 2JLRA 1W85A 2JLCA 2XYRA 3VOTA 4ESEA 4R7TA 1PDOA 1C4OA 1CERA 4QUIA 4GHWA 5HM6A 4W5TA 4ICIA 3MGAA 4V0QA 1T3TA 2K7ZA 5BT9A 2GN6A 3L8ZA 3RUEA 4BQNA 5AVRA 4GWLA 1L5OA 3CG4A 5EXSA 3FTFA 4D2IA 4YPFA 4R1UA 3RTGA 1W6RA 2DHEA 3H5LA 3OMWA 2A58A 1DV1A 4FOTA 4ZAYA 2ILTA 3WR5A 1LDGA 1ML4A 4XJTA 5BV7A 3GLFB 1M74A 2UVQA 2GCOB 3UJAA 5FPHA 2R8ZA 3PFKA 3PKIA 4H7FA 1FSZA 1VPVA 4KBFA 4OUKX 3W8DA 1MABB 4CIDA 1RXEA 4HDSA 3BXZA 1JEQB 1L4UA 2DTDA 2GCNA 1PFVA 4IIBA 1XD2B 1VLLA 4OHYA 1XCJA 3NB0A 4V38A 5JALA 3KEMA 2ZZKA 3E22B 3FCSB 3GOHA 3IEIA 1I3CA 3JZMA 2A4MA 5JS1A 4MITA 4HZIA 3R7FA 3OM8A 4ECAA 2EX0A 1NBMD 2QM0A 2WD8A 5ESWA 3OLYA 4I55F 2C95A 2Z6QA 2HU2A 3WV4A 1KKUA 2BVNA 3G2JA 3EDOA 3N8KA 4TVBA 3SQLA 3EQ9A 2G25A 1A5SB 2AOWA 1EINA 2APJA 4E3ZA 5PNTA 5CFRA 3L7NA 3TYXA 5C8YB 3DLTA 1ID1A 3OEHA 5EN4A 4ECEA 4YMUA 4NJMB 3DVSX 1Z7WA 4L3OA 1QRRA 1ZGJA 2ECPA 2VJDA 2QTWB 1RYDA 2V4UA 1H9BA 3PFHA 1JAIA 3QBJA 1QK4A 2HD4A 4B17A 2PEYA 4DNXA 5IZ4A 4G0NA 1A9YA 1NUQA 2P1DA 2WABA 3L7CA 3CF4G 4TMYA 5EZYF 3R8XA 4B4DA 4B3DA 2N75A 2ATCA 3D81A 4OQLA 4PFKA 1AU9A 3B3JA 3B5JA 4ZOLB 3TSOA 5H82A 3PX7A 2QE6A 4L6CA 3AIKA 3WYEA 1MAAA 4JB0A 2PE5A 1CUIA 1PV2A 1NJGA 1OV6A 3H6KA 3SHTA 2X5KO 2I3BA 2G1PA 3HDGA 1BHQ1 3BPSA 1FTSA 4OHVA 3DA8A 2OCYC 5KSYA 3VJRA 2YIJA 1NM5C 1F12A 2G04A 3MS4A 3BILA 3OPNA 4P31A 4RSRA 3GLFE 1TTTA 4CR7A 2V0GA 1MEJA 1WTCA 1MX3A 3VDXA 3A6GA 3ZHCA 1DTWA 3AR7A 4FMDB 4FQ8A 4HFMA 4R69A 1EB9A 3TCXB 4OI0A 1XZKA 2OD2A 3RFVA 1QH8B 4LY9A 1PDWA 4L27A 1MDFA 2O2EA 2QMQA 3DT8A 5FLEX 3KAJA 1A97A 1STOA 4KE7A 5ELMA 1O97C 4QARA 4QUEA 1MC4A 2FCRA 3F5QA 2BHRA 2CJFA 5A05A 4ATNA 5IX8A 5K8TA 1W1WA 2E4WA 2C2OA 1TPZA 1K6JA 2OHHA 3FF1A 1V8DA 1EWYA 1RJGA 2AUNA 3KZCA 1DG9A 3AT1A 2WOOA 1YB4A 2PZJA 2O9JA 1DMRA 4DHWA 3DTVB 1TKBA 2RHTA 5CDFE 2GOYA 4KN6A 4PZ0A 2WIFA 3R44A 3CF4A 5FB3A 3AWDA 1E64A 3K20A 4IJ6A 1L7RA 3H2KA 1SOMA 1DARA 2Q7OE 3RRXA 4MK4A 5K03A 3KSAC 3G2PA 5HHTA 1QXSA 3MM4A 3LPLA 1YJXA 3AHHA 3BGOS 3JWJA 2ZUCA 1U9JA 3DZKA 3N2ZB 3UAOA 3ZD8A 1RLJA 4LMRA 4BVJA 3B9RA 3GLIB 2CNKA 2IDZA 3LCMA 2FMUA 1M0WA 1K63A 3A2MA 1WCWA 2JIPA 3O1HB 4MVJM 4W8OA 3NTLA 1Y6FA 5CA1A 4MRPA 4P6VF 4EI7A 2AQKA 1CJBA 2DWUA 4XWWA 1YBVA 4DMRA 1SXPA 1QYIA 3GUUA 1LPBB 3K0FA 4S0ZA 3JQQA 3TSWA 1L4BA 3F73A 1VMDA 5BVGA 1FFGA 2OQIA 4Y2TA 1ZEJA 2I7CA 3K4HA 2HLNA 4KVFA 5B1DA 3CG0A 1WUTA 2H1HA 4Z7NB 3OA2A 3ZHVA 4BQQA 2JRLA 2Z43A 1J9EA 5CXQA 1WJGA 2GDJA 3AERA 1VYTA 4BMPB 4BYMA 3F78A 4TMKA 2HYIC 1LWOA 4WK2B 2J85A 3CEPB 5ITZB 3ORYA 3KQWA 3PNPA 4RVFA 2ZI9A 1D0IA 4OJMX 4B75A 1SKBA 2D5CA 1H42A 3R4CA 2XWJI 4TSKA 3IP7A 2XB8A 4PZZA 3UAZA 4HDMA 1FX0A 3E9NA 2KLHA 4UNSA 4EJFA 1EDOA 4BFVA 3W6NA 1UKEA 2CD9A 3S1LA 2QQGA 3PDUA 2VBIA 4XVRA 2Z3VA 4FZJA 4COOA 1KEWA 2BSXA 2PFKA 3UJ8A 4BRZA 3T5PA 2W6QA 2P11A 5GQSA 4QYSA 3V8QA 1W76A 4OJQA 2C07A 3C98A 3OJXA 4MR8B 4PANA 5KJEA 1JTFA 2QD5A 4EKDA 1T0HB 2TMGA 3AFNA 4DFDA 1JEJA 3L0CA 4H0CA 2YYSA 1Y3HA 4TLCA 3W8FA 3DL7A 3E9DA 3WGJA 1PGOA 3CLTD 1SKQA 4B6PA 1AXRA 2A94A 3RREA 1PU2A 5EP2A 1VHWA 2I4IA 1E1CA 3RTBA 4QNRA 5A5EA 1KMHB 3H3XA 4YLEA 3ZCPA 2FLWA 4OAQA 1QOQB 1A4XA 4B33A 4ALIA 1AO3A 1WMBA 1XTRA 3AFGA 3B9PA 4IMRA 5FAXA 4ZCMA 4FI3F 4B2PA 1R6VA 4RD4A 4G09A 3K0BA 1QCCA 4AUKA 1NVEA 3JXEA 1BRTA 1EG7A 2W48A 1MGPA 3IJ5A 5FFFA 3ZS9A 2I71A 1UPFA 3CT4A 3CRW1 1WB9A 5ARDA 1HZJA 1WMEA 2Q3FA 3DB2A 2CD7A 3IBTA 3IOCA 2RGWA 1P73A 3ILYA 4OK6A 3PZRA 1P1HA 5DBIA 2CMDA 1YB5A 2CL0X 2C88A 1I4LD 2G3YA 3KAKA 1OBOA 4FYXA 4IZOA 4IUBS 3VSDA 3HR7A 4E5SA 1TU0A 1J0DA 2FPPA 1H4SA 1B4DA 2ODWA 1CDOA 2HA7A 2ZVPX 1M2VA 1N5IA 3F8TA 3OSUA 3RS5A 1U65A 1JFFA 1DNPA 2Q3HA 4D82A 1ZR2A 3O82A 2WIBA 4JWKA 3W7AA 2Q3BA 2X2OA 1BJKA 4XRGA 1N77A 3IP3A 1CUYA 5B36A 4OFXA 1CQXA 3I30X 3VO8A 1BFUA 3ROFA 4GE0A 1XGKA 1M7BA 4QOJA 3RYHB 4Z0PA 1XNGA 5DTMA 3WNDA 1MOQA 4CN8A 3VBCA 5LUAA 5CJJA 3HWSA 5JNUA 2UXBB 5FL3A 1T1JA 3DV0B 3WDMA 4EYSA 3ZTWA 5ALMA 1QRSA 2PBZA 4E31A 3ABOB 2OL4A 2CDBA 3A3OA 2E3JA 4G0PA 5BSWA 3F8SA 2OAP1 1G3UA 1CX9B 3AF3A 4B3FX 5HF5A 5LM3A 4M8KA 5TQ0B 1O5IA 3TZQA 4S12A 3WC4A 1P9RA 1WDMA 3G2IA 1DHRA 3B89A 2MYUA 1PVVA 5K8CA 3SYRA 3UVEA 3CKLA 1S3GA 1XZPA 1H2BA 1P31A 1A95A 2J59A 4G5XA 3I6QA 4QWMA 1XZLA 2VDNB 3GGGA 3QVJA 4UJ3A 2PX8A 1IK6A 3ASUA 1CYDA 2QGNA 4UHJA 3INGA 2ZYSA 3BTOA 3I2HA 3QV2A 4YDSA 2Q6IA 3U4HA 3OT5A 4TVSA 5JS2A 2CZQA 5DO9A 3LP6A 4DAEA 5AOBA 4UUMA 3FPEA 4O4LA 4F8JA 3MJRA 4K2HA 1SGWA 1I3OA 2A1TS 1MB3A 1VFNA 4R3UC 4H6WA 4J9VA 2I1VB 4YJGA 1KJWA 1MB9A 2V6BA 1KVUA 4RK4A 2IBMA 2GCGA 1VCIA 1DC4A 2C20A 3ONNA 2HF7A 1GO2A 2R60A 4OBBA 1DFHA 4P38A 2EFJA 5K3EA 1M2OB 3HB7A 4ER3A 4WN9A 1CDEA 2HBRA 3OPXA 4OVKA 4PLGA 2YVKA 2Z8YM 4N6GA 1XTSA 2AOUA 2AOTB 2XT6A 1MRNA 4B47A 2WILA 1C9MA 3DVRX 1MENA 2GO7A 4MS3B 3KOXA 2WJZB 4C20A 1HMYA 3M2TA 5KJ6A 2YCLA 4LG1A 4BLPA 1CY4A 2NXCA 4JT4A 2QTAA 2PXCA 3UMCA 1BE6A 1Z12A 3GGSA 4C29A 2BGIA 2CL7X 3V8MA 4DLNA 5BN3B 2QRMA 1MOZA 2O3SA 2VH1A 7MDHA 3SR3A 5MN6A 1GU0A 1HYBA 1L7MA 2ZJ8A 4EHNA 2AVNA 4AY5A 3OHMA 4BV9A 1FDVA 3L2OB 1JT9A 2Q5LA 4L5JA 4DYHA 4NEGA 4NXNB 3HN7A 1MO4A 3LC7O 1OX6A 1WPQA 4R8LA 1WTAA 4P3KA 2P2NA 3HZZA 1I6MA 2MMGA 3N5CA 3TOVA 5KIAA 2KMLA 4IINA 5AVJA 1MU0A 3I05A 1Y5NA 4Z4FA 1KMIY 3EGWA 1OA0A 3KEQA 4R31A 4G5YA 2FN7A 4GPZA 4U1RA 4XCVA 5DMHA 4QOIA 1XP5A 3TMAA 3EXFA 3DHVA 3UH0A 1G1AA 1PFUA 3FHOA 1DEKA 1S4MA 2R00A 5SY4A 4EJSC 1FIUA 4MHTA 1Z36A 1E2FA 4MHSA 4E1BA 2QT9A 2XGOA 4REOA 3A2NA 3OFJA 4CF3A 2K7FA 3OWHA 1Q7RA 2PVPA 4XYMA 1O7JA 1OX5A 1GZ3A 1X7DA 2C9CA 2WEKA 3KAQA 1Y63A 1OWNA 5CM9C 2ZJAA 2A9OA 4RTQA 4KQEA 2I80A 1PQ4A 4ZCSA 1ZOIA 1K4MA 4PO9A 1DIBA 4H77A 5EFZA 3KJNA 4HQLA 4Q47A 4TQ9A 1O94C 2VUIB 3RUAA 3B6IA 4BS9A 3CR8A 5DNCA 3W04A 5HF9A 2V9PA 3VDMA 1FVFA 1QUEA 4PZCA 5LQJA 4G1MB 1WV0A 5H3CA 4Z54A 1U99A 3ES9A 1U7PA 4I4TB 4R8VA 5EUQB 1NLUA 4G4SP 1W5SA 5KSWB 4HD8A 1D7AA 1FYEA 1TECE 2BV3A 4FDVA 1U2PA 3EEFA 5FFNA 2YNMD 3GGOA 3CX7A 3P8ZA 4JC8A 4PQEA 5IWCA 1RHQA 1XHLA 1JB9A 3CMCO 3E0QA 4I0WB 4MPDA 5AW5A 1L5ZA 4NATA 1JS1X 2YZGA 5GV8A 3QBDA 1QC5B 3PQ2A 4BO9A 2ZXUA 1PI3A 1DAFA 4ZMBA 5AVSA 3QSGA 1O4VA 5A6SB 2QX6A 2FRDA 1K66A 1UBTS 3C85A 3N87A 1HSZA 3C74A 3NXKA 3P2KA 2GNAA 3KVNA 4I8IA 3ZCUA 3HUFA 2ZKLA 3BAFA 3EJWA 1SZCA 1XF9A 2DH6A 3NUQA 5JJBA 5F98A 3VZDA 1G5IA 1NTRA 2C7VA 2HLPA 2P4SA 1HT2E 3KJXA 4YECA 3RVLA 2RGBA 3B53X 2ZZNA 4PAOA 3ADKA 3CSSA 2HPZA 3V4FA 1MQSA 1E8NA 4L75A 4OHPA 1WEHA 4FOPA 2FETA 5BRAA 3AG5A 1MAWA 4MDYA 3MT8A 3W2IA 4A15A 1TOAA 4JJKA 3VFDA 4EGSA 3LFTA 4Z0TA 3S0JA 1O95A 5ICSA 5JH7F 2C61A 1GPYA 2ODEA 2PA0A 3WGUA 3IKTA 3PF8A 2LBPA 5LFAA 4BFZA 3O74A 5CFQA 4HUQB 3KSUA 3QKTA 5HDBB 4B4VA 2ID7A 1XZFA 5DWVA 1T4GA 5GADl 1AX9A 3Q1KA 1II8A 5J1TB 2PSSA 4CLRA 3GCWA 4Q1FA 5JSQA 2X1VA 3HP1A 3HK2A 4QTZA 3ETEA 3QKSB 1Z39A 5JEEA 1W88B 4TWZA 4UU7A 2VTBB 4I1UA 2WWXA 3EG9B 4JU8A 4GP9A 3HTXA 4XFDA 2PXXA 2Q1YA 5DBGA 2PRIA 1KJNA 1K6EA 1UAGA 1C7QA 3TBKA 1N5LA 2Y67A 1FJHA 1LNZA 2WHPA 1BQ4A 2BFDB 4FDAA 4DDVA 1AUPA 3ZY3A 1QIGA 1Q0TA 1Z6QA 5AW4A 3A6PC 1UPCA 3LO5A 1NBAA 2LCFA 3ZQUA 3F49S 3FUWA 1JU4A 2JLSA 3HBLA 1NQXA 1NMZA 4N0PA 5EHIA 5C34B 1GGFA 1S1CA 1T2FA 2CNWD 3SQMA 5KYWB 1NHGA 3PUKA 1RNLA 4P58A 1NJ2A 5ALXA 2MWMA 3W5UA 1ABEA 1C4KA 1I2MA 4KN8A 4X6YA 3VU8A 2IHZA 2R97A 2AR9A 3MCTA 1EVKA 3TNFA 1GGKA 2GHIA 2GJ8A 3AY3A 3QVTA 3WKEA 4F7WA 1KEKA 4EG8A 3DCJA 2GBLA 3DXFA 4OHCA 5B55A 3GRFA 5KEIA 4RKRA 4CM5A 1WBDA 3PYXA 5AVVA 4TV9A 1ZU4A 4REMA 4XDGA 4LECA 1EK1A 4EHHA 1BKSB 2HHJA 2Q2VA 3NCTA 5I5EA 2ZJ7A 3KPJA 5K20A 3EEQA 4DR6B 5CIQA 4BP9A 3NAGA 5DCUA 3T7EA 3NRJA 4DR4B 1ATIA 1G8FA 1I7NA 1Q77A 1TMGE 2NO9A 3B20A 3EUWA 3PBKA 4NTZA 3MJEA 3CZQA 1VJDA 3UW3A 1YS9A 1Z33A 3GVHA 5BN4A 2A7XA 1ORTA 2GXQA 2ZBDA 2JGMA 3N0RA 1MJGA 5DSXA 2QG9A 1E18A 1ZWLA 2WHXA 3L8EA 1CRWG 1LVGA 1U28A 3T0FA 1QFXA 1VBMA 3Q7QA 4C89A 2BSQA 3VU9B 1JFLA 3NYIA 2WJWA 4B7UA 4Z0HO 3U2QA 1E0KA 1O6CA 1DQZA 3DDOA 4IG4A 4RNDB 3TTWA 4C7MA 2FWPA 4E7OA 1G5FA 1ZJZA 4YGXB 4LDAA 4V02A 2HJRA 721PA 4G0XA 2C1ZA 3Q15C 4MQ6A 3T06B 3ZW9A 4DBZA 3T4UA 4MW6A 1IQPA 2ZUUA 1F9AA 3KXIA 4TL8A 2GK4A 3O4FA 5JE8A 5E8RA 1C1DA 1CKEA 4ZOAA 1G0OA 1S3FA 1UBOS 4HX2A 3WLIA 3IEVA 3J81k 2EP7A 3UT6A 1E60A 3OIWA 4IF4A 1GLGA 2GM4A 3TQOA 3VPDA 1EWQA 1AKVA 2J5BA 2JFFA 4RTRA 2JFYA 4TUYF 5EKXA 3V1TC 3FFBA 1CJSA 1Q0UA 4LJKA 4TXLA 5JJKA 4GMKA 3LX4A 3W5JA 1J2JA 1B6SA 1RWNA 1TO1E 1BZYA 2J33A 2G4VA 3R0ZA 3DV9A 4MWEA 3KZOA 3C4JA 2O1WA 1ZFNA 3PHLA 2XHZA 2HWXA 2Y6VA 2C2WA 3OUZA 5K0ZA 4TV8A 1M83A 2PKWA 2OORA 4QVGA 4BO3A 1IIBA 1YL7A 5IJWA 1U0LA 4LRUA 1HQCA 1IUPA 3VXKA 1JILA 4Q01A 2VCYA 3ZE7A 2PT6A 4BJ6A 4GICA 4YT8A 3MBKA 4IQ4A 4B85A 3I28A 4NENA 3AIIA 4RZXA 4UNQA 3UMGA 5IP5A 1XFDA 2HPVA 2IHBA 2V98A 2UZAA 3OP1A 2M1XA 3C3YA 3FW1A 2XYPA 4HB3A 3D7RA 3JAKB 4J03A 5DLQC 2O1XA 3AUUA 3EHDA 2D3TA 3FTCA 2B3DA 3L8FA 3H4IA 1F4LA 4FBGA 1AH2A 3Q9UA 2ASEA 3P2MA 4WEOA 3VR5D 4DWJA 5JBNA 3TECE 2PUCA 1V7CA 1PR1A 3VTAA 4BN0A 4BRWA 3GBVA 1ML3A 2WTAA 2YJTD 3SOZA 3VO1A 1J42A 4KXYA 4LKOA 2EIHA 3WQQA 5BNIA 4COKA 5C7IO 3M5DA 4CFZA 3FCEA 2A3RA 2OLKA 3WRVA 1ACJA 3EFOB 4ZIRB 4EG5A 4QEKA 1RC8A 2MYTA 1E79A 2AGVA 3EA4A 3ESAA 1EJBA 1XL0A 3IGFA 4BAGA 3KB6A 4U39A 4EY7A 4PHFA 2PA3A 4OGWA 2AOXA 5J2TF 4LOIA 3ZCQA 2A0FA 1GGVA 2PT9A 1MIOB 4UTVA 1INLA 4JC0A 1SCJA 2CHQA 2XOXA 1XXHA 3DFMA 3IAAA 3LCVB 3N2EA 4FSDA 4KQ2A 2R8BA 4M0UA 3TB6A 1TGYA 4UTRA 5LMNB 2D5LA 2G77B 3BWDD 3QE3A 4RSMA 4MCAA 4BFXA 1S01A 4A10A 3BIFA 1QZZA 1M1YB 1RLMA 2CXNA 4KV7A 5DNEA 3ROMA 3WMRA 3M6LA 3KD2A 1NVGA 1QE5A 2CLHB 5HIMA 2AG5A 4DQUA 5TVKA 1PJTA 3BHMA 4MGZR 4ZKDA 4WY5A 2AYYA 2HV8A 1J0EA 3A70A 3DT9A 2ONYA 1OAKA 2FH5B 3C1OA 4HEHA 1NM5A 4MW0A 4J2HA 3ZPXA 1D2NA 3U39A 1DC6A 3GG2A 3HRHA 3WHPA 2HPHA 3I2FA 1FNSA 1I4TD 1YL6A 3GJYA 3IIKA 4KK3A 4WLUA 3HXMA 3OFSA 2WINI 2K4MA 3W6OA 2EL9A 1YO6A 2P2GA 2FFQA 2BHNA 2XB9A 2PPLA 2PWPA 1E4VA 3DJYA 4D5EA 1CUDA 4HRVA 1KKLA 4FW9A 4NE7A 3JQGB 1DCTA 3TINA 2HK7A 3T4EA 1TUEA 1EFDN 1K0FA 1OZAA 3D3JA 2Q5CA 4P80A 4PSVA 3BMQB 5H16A 5IAOA 4KHPB 2JHGA 1QVAA 4A8PA 1GT6A 1KHHA 4DQXA 1JMKC 5I47A 1H4QA 4UEKA 1NVUQ 1F60A 3L1KA 2GM5A 4BZZA 3MT0A 3MA0A 1KVQA 1TTPB 1W6UA 4TL6A 3IAM1 5IANA 3GLGA 1L8OA 2NIPA 4CNQA 4K6FA 3C6ZA 4C78A 4LN1A 5JEDA 5JAMA 1P1RA 5L3ZA 3EDYA 3LC0A 5LQRA 4KWIA 5LWQA 3STUA 1VSUA 2QP4A 4AROA 3O3MB 4AWAA 2BI4A 4IV5A 1YGYA 1Q0HA 1XTTA 3IH5A 1KIAA 2FJ0A 2UZ1A 1BE8A 1G6HA 3STTA 3C7AA 1SBZA 1BDJA 1JXOA 1R12A 1W85B 5KNBH 2AF4C 4MH0R 3NTVA 1TQ6A 1KFJB 2DBVO 5D1NA 1J5XA 2C04A 4KN5A 2FP3A 2JKZA 4C0BA 2AMLA 2MSEB 2WFLA 5A7GA 3IT3A 3SBEA 1NPTO 1ZLXA 1HTWA 1JJAA 4IEEA 2Z98A 3SXJA 2BEWA 4UDXX 1U3DA 1OFUA 4EMSA 5REQA 4QUJA 3G0GA 3TLCA 4EG0A 2LCQA 3IUSA 3P4UA 3A9SA 4HWPA 3X44A 3L7JA 1M8PA 3VVCA 1E66A 2D06A 3SQOA 5EIAA 5LKRA 1HSOA 5JJLA 4GUDA 1G6OA 4A1OA 3HKEA 4NBWA 3VYWA 5BWMA 3RE1A 3QUTA 4HZUA 2AJCA 2BFOA 3CF2A 2BMJA 4J49A 1USIA 1FUYB 5C8DA 5E4FA 1HOXA 3B78A 3R2JA 4G0MA 4Q12A 5D6OA 1D2EA 3ZU6A 4DT1A 1OA1A 1VL2A 1KMQA 3NM5A 4XDZA 2F8SA 3PWKA 3UFBA 5J4YA 3JQEA 1M75A 5DGTA 1R0KA 2OV1A 1WEKA 4IDNA 3HU1A 1FDUA 3RBXA 1MC8A 3VR6H 4JYZA 2ID8A 2CVHA 5C1BA 1TVCA 3ED1A 4HYTA 2QMHA 3GCXA 5HA5A 4I55A 1ZNZA 2Q41A 4JITA 3M9XA 5D51S 3CNLA 3HY3A 1RW4A 4LXTA 3LKVA 3CR3C 3I2YX 4XQEA 1XV5A 5KWSA 1RWWA 3FVRA 4EHIA 2YVAA 3IUBA 2IYAA 3OEYA 4MMZB 1OH6A 3UJ3X 1I7SB 5KYKA 2AN4A 3QUBA 4D99A 2FZLA 1T8SA 2EARA 3L7MA 4NYMQ 1Q83A 4MKRA 4B43A 1I24A 2ZG6A 1P81A 1O1YA 4HGYA 1SHUX 3L82B 3P9ZA 3WGQA 2E2WA 1PL6A 1VZ3A 3VJKA 3NIDB 1L1RA 4DLKA 3C3PA 2AA3A 4AF6A 3GIDA 3O38A 5D3ZA 1NOIA 5JAQA 1PR4A 1ZQ9A 1JIUA 3ETNA 3FG9A 4L4ZA 1E2LA 5K0LA 1NZJA 1Z6GA 3HBFA 4N3AA 3R0QA 4MINA 1NGSA 2ZIEA 2PV7A 3TAXA 1MD9A 2QYSA 4GKKB 3I9V6 2UUOA 2CXUA 1ZXLA 2JGDB 3U26A 2ZB7A 4O1IA 5DHPA 3V9PA 1NUAA 3VKWA 5H3HA 3QVVA 1OT5A 4F3YA 5BW8A 4KWEA 4HRAA 1LI5A 1DBIA 1QORA 3SEFA 3QJ5A 1Z28A 2VXOA 3UGKA 2CLKB 2HY7A 3RUCA 1RWXA 4PVDA 3PUHA 1P4SA 4XQ0A 1XI2A 1N0IA 3SXPA 2E89A 1C29B 3EULA 3ZW8A 4DABA 2VOEA 3IO3A 2IVZA 5HOQA 1K68A 1PR9A 3GLSA 1BXZA 2JLQA 3LYLA 2HNAA 1KJ9A 5FULA 1VHJA 3WXBA 4RWEA 3KTFA 4JR2A 1BOOA 1JQLB 3LIIA 4ZGBA 5IKEA 4YMWA 5AT1A 4LC1A 2GEUA 3B7GA 4XQ9A 5FA5A 3BF8A 1BJRE 3KKLA 3VH4A 1YASA 4P4TA 5FXMA 3IP1A 1QQ5A 1XZQA 1FUIA 2JEZA 1JR3E 1YACA 2JIBA 4BQRA 3AHGA 4F5YA 5KJFA 3CPJB 3OM9A 4LYFA 2VC2B 5JC8A 2D0OB 3PVCA 1K75A 4MAMA 4G4GA 3BE4A 4GMHA 5TPWA 5IVIA 5EEHA 3UG6A 4D9NA 2CLCX 3LVQE 1IBMB 3EC2A 2Q50A 5JNLA 5CA1B 4B1FA 1DJLA 3C3MA 4CIBA 5IH7A 2PSDA 2R5WA 4O4JA 2RH8A 3VKVA 2WVJA 2V7PA 2PUTA 1FYFA 3UOGA 3QX7A 5CBKA 5IZCA 3ZVMA 3K0FB 4DS3A 3HPRA 3ORSA 5BVGB 4G5QA 5DX8A 2H6EA 1LNQA 5SICE 1D2CA 1F0KA 1HZZC 1KRXA 3TG2A 4AZWA 5GP1A 1ISJA 1XNHA 2XMGA 3OZFA 1SHZA 3AERB 3MQ4A 2NYUA 4GVPA 3WG9A 1YK0A 2BKXA 2HJWA 3T5TA 4AMYA 1KAMA 3UT5A 1CJUC 3ZX4A 3ANLA 5TEVA 4F0JA 1IJFA 2R8YA 2IYWA 4M76B 4CCAA 3V00A 4QVIA 1E2DA 2DUJA 4J7CA 5CK4A 2IW1A 3WL4A 5CMLA 4HDMB 1FX0B 4OQNA 4OV6B 2QUBA 3IQZA 2FEMA 1QG4A 4R16A 5I7VA 4YXWD 1ZD5A 2IYPA 2ZTVA 2J6BA 1JQAA 1E3DA 1WUKS 3SYNA 4V0NA 4AJPA 2G1KA 5DTRA 2PJRA 2YWHA 2GZHA 3SLGA 1TEHA 2QD1A 2Y4OA 2WD9A 2IY8A 1HDOA 3JATA 4O0MA 2UZIR 1JWLA 1JU9A 1E4YA 13PKA 2AKAB 2GCIA 1BGWA 2LIPA 2WVGA 3LHSA 4B6EA 2COUA 1FSGA 4LV8B 4DWOA 1Q7BA 4JYPA 2O4UX 5B3LA 3OMLA 4XB6B 5EHQA 1M1NA 3OZXA 2CNOA 2G9ZA 1DC7A 2JFPA 3GGPA 3G89A 2F1RA 4ZHQF 1E1CB 2WSYB 1C1XA 3FWPA 1AQ6A 3FNRA 4J0KA 1BX0A 1F1JA 3EC1A 3GNQA 8ABPA 5B7PA 2I6QA 3RVPA 3SZRA 3FI9A 3A3PA 1E3JA 4TKVA 3C97A 3ZHRA 2EL7A 4WWHA 1G7RA 4M60A 2Z09A 3UF0A 1H6AA 3P0FA 1YDHA 4EUFA 3TVYA 1P45A 1RYNA 4ZAFA 2ZT6A 2YIVX 3M4YA 1Y8CA 1OILA 1BTOA 2AC4A 2GX6A 4R6XA 2JI7A 1GVHA 2Q5JA 5D00A 1T3HA 2WTUA 3IA2A 2NN3C 4QGAA 4AJ1A 2VDOB 3E35A 2Q7XA 3A1SA 2FPPB 1JSZA 4GS5A 1I32A 2GJAA 3JQBA 3R23A 2B83A 4HAUA 4HQRA 1M2VB 2P9ZA 4ZYYA 5BY2A 3MTIA 1JFFB 2AFHA 3AP1A 3CLRC 4C2AA 1QHGA 4NFLA 1T36A 5H70A 5JDCA 1O94A 4QPDA 3DL2A 1P3DA 2FK7A 3T7KA 3U7FB 4GSLA 3W4IA 3HJRA 1XPJA 4PAWA 3C3AA 1T8RA 3VR4A 2OFOA 1R0BA 5J4KA 4M8IA 2BGUA 2H0RA 2LTAA 1SWVA 3O92A 3FGNA 3ORFA 2QLNA 3NATA 4O0LA 1ZISA 2QD4A 5JJIA 3D7KA 1C14A 3F3SA 1C9NA 4HT3B 1RWOA 2BM9A 2Q46A 2VQ3A 2PS9A 1L5NA 1SUWA 2WZQA 4X9XA 3W3ZB 1Y1KE 4B34A 5TQ2B 1DIRA 1H2FA 4MUHA 1VSBA 1WB4A 1MH9A 4R0NA 5GJWC 1GCGA 1SUAA 2W2LA 1EX6A 3I2KA 5L45A 5AW3A 1QAOA 1RP7A 1U04A 2OHIA 3MYYA 3TPCA 3MINA 1PNVA 2HSGA 1UM9A 4XWYA 3F46A 1Z16A 4BE4A 2C00A 2JK0A 2WIGA 1DB3A 3ZHXA 1UDBA 3M89A 3CM0A 4JCOA 3VKGA 4LWZA 3TXXA 1QIDA 2ZFUA 4ZCTA 4K9QA 3VR3A 2VN8A 2Z1NA 1SD1A 1JXAA 3F8WA 1NY5A 2JAWA 4UMDA 4W1SA 5TQJA 2QNBA 5KKCA 1BRMA 2QLMA 4JLMA 3QKIA 4PBTA 1JKFA 3GDWA 3CKMA 3S2EA 3GHYA 1QV9A 3RK4A 4BNLA 3EF3A 4O2BF 1BEZA 2OC9A 4X63A 1AKRA 2FSIA 2ODAA 2OD9A 3BORA 5TC4A 5A9SB 1ZKMA 2GDZA 3IVCA 2Z9CA 4JHXA 5KNCH 2JLZA 5DTJA 4RK0A 3EVAA 1IPFA 3TDKA 4ZVQA 1V5EA 2H57A 3O8BA 4YJGB 3OO1A 1G60A 1ZN8A 5SZHB 4WPGA 4LVOA 4FJ0A 3OJWA 1UPBA 3HR8A 5HIAA 1V7ZA 4ZCQA 4EA6A 4RY9A 3UUFA 3HDVA 3CUSA 2C29D 2ZYAA 3D59A 3FCYA 3JWEA 3TD6A 1NJSA 1NURA 4NULA 5JTUA 2YHIB 2QPOA 1BFKA 1G8AA 1EGQA 2QP3A 3BYZA 2XZOA 2OPBA 2AOUB 4GLOA 4QFDA 5BOVA 1XMOB 5E9AA 5H81A 2NO0A 5EGNA 2H59A 3EY9A 1T5IA 3BB1A 3PR2B 4MW5A 1IBKB 3Q10A 3FDIA 3G13A 2Q5IA 4PZ9A 1K6MA 4W63A 5HFJA 2FR8C 4LJSA 1E2NA 2GI4A 4HXGA 1LK0A 4UD6A 4OHWA 1MO2A 2PMKA 3AP3A 2QR5A 1FP1D 3A9UA 4FWBA 1SIOA 4DQ0A 5AKYA 4LOHA 3ZWMA 2WIAA 1HURA 3NGXA 2BFMA 3FNIA 4G86A 4HFRA 3X1DA 1G7SA 2OBXA 1ZN9A 2XEXA 1ZSYA 4MWBA 3NT2A 4K3VA 2X41A 4DB2A 4FWIB 3NRBA 3CRQA 2IPOA 1YK1A 2XSZA 1AVTA 3VISA 1T9BA 4PRLA 3TBHA 3ZWCA 1XQWA 2VDQB 1YKSA 1RT9A 2AQIA 2ABWA 3EDRA 1UK6A 2Q1TA 3K53A 3OQHA 4BLSA 2QVBA 1IEXA 3KPUA 4L16A 1IFXA 4O4HF 5DMXA 3T41A 3ET4A 4TLBA 2NADA 3H6HA 1KSHA 1PR0A 2XW6A 4KQ6A 5EJ8A 1E20A 5DULA 1WD5A 5T6BA 2J5QA 4HI0E 4J7AA 4LRTB 4V0RA 2ZIFA 2V4ZA 2AX3A 4H6XA 2FX2A 1AT1A 1P2TA 4GQBA 4ABTA 3HB4X 1NBMA 5A4IS 4QU9A 5EJ9A 2FV8A 1ZNYA 4TSFD 3K9WA 1IM2A 1KERA 2BBTA 2G4LA 2VRBA 5CH5A 1JW9B 4MW7A 3RUDA 1F0YA 1TXGA 4AP6A 1IVNA 3IMEA 5JI3E 1E6LA 1WOMA 4JZKA 1MMFB 1XVUA 2IEGA 2NU9A 3N6XA 3QPAA 4IVNA 4BNGA 4S04A 1YB6A 2BBWA 1YQGA 3T9BA 1Z47A 1X1RA 5DI9A 3IBFA 1QHIA 5BQPA 2J45A 3CKKA 3D6TB 3PE6A 1J8QA 1LTQA 3RAJA 4QT4A 3I6YA 1FS5A 4MVJF 1GOTA 1ZH2A 1UMDA 4MAFA 2AT1A 1GN9A 3ERCA 4KX3A 2Z30A 4KMOA 3RT1A 3G79A 3H9GA 4DUZB 1RHRA 1V7PC 3JWGA 2P79A 4UHKA 5G0TA 1AKNA 4PCLA 4JNCA 1G8YA 1V5IA 1RP1A 5AKGA 3QY0A 2C82A 3OQ1A 3Q8KA 4AJOA 3R6TA 1Q50A 3GH1A 4N3NA 4XB1A 5A5GA 2BM0A 1CZNA 3INTA 1T35A 3Q7SA 5CNIA 1LUAA 5LSAA 3EPPA 1RI3A 4A6PA 2AEMA 2G5TA 3DYBA 3OD5A 2QV0A 4EKYA 1NKTA 2UUPA 4AUEA 2DHCA 2Y1OA 4DPMA 1X0VA 4AKIA 1T9CA 2FZ4A 2Y93A 1W7AA 1HNWB 2IS1A 1BN7A 4UVHA 3TK1A 1PD0A 1VMEA 4JH0A 4F2HA 1XDGA 5C4IA 4NU0A 1GRNA 3JQ9A 5BWBA 1QLWA 2GAJA 2VH2A 2RGCA 2XA9A 2YWDA 4J94A 3W7BA 4LX8A 4AN1A 3Q8MA 1TF2A 4BMXA 1XEXB 4C08A 2OXFA 4HB4A 5AKEA 4LRSB 1M2GA 2RHHA 3MUOA 4D9KA 2PPVA 3L02A 2X3UA 1L5KA 4LBWA 4D98A 4GMGA 2Z1MA 1EAMA 1NAHA 3A4YA 4K86A 2J9GA 5AH0A 2BGKA 4H7PA 3JAWB 1U3UA 2EBFX 2HPAA 4B3XA 3A4TA 5AJVB 4ZAVA 3TXYA 3C70A 1U0RA 4QYWA 2RC6A 2XADA 3IQFA 2M1ZA 5T3UA 3TZEA 5JH7A 5F5LA 1XEWY 4MDFA 3GD7A 2GNOA 4G5GA 1VE3A 4W7HA 4EFMA 3Q3JB 3JVDA 3ZWDA 4DSTA 1RC1A 4OJYA 1Z13A 4OBWA 2XE7A 1CRLA 2HEGA 5I7RA 1A50B 4CLRB 1IJKA 2ZRGA 3AJ8A 3ZBUA 1PDVA 4OI1A 1HLDA 3NBMA 2NLOA 2LD4A 5FI0B 1YZTA 3CO0S 1M2JA 2WMNB 3GUVA 2BZSA 2OEPA 1RQ7A 5FTKA 4AZTA 3OFND 2X7XA 1JFTA 3M4JA 2VNJA 2WHPB 2PX0A 5TT1A 3OE7A 5FOTA 1CNMA 4FILA 1W4CA 2VT6A 2W93A 4IDFA 4L9WA 4XFJA 2OCKA 1QZTA 1L4YA 1POWA 3ZJ5A 1WNTA 4POOA 3AY0A 1M66A 3A6EA 2VQDA 5TV2A 3N53A 2NUAA 1CY8A 3KEOA 1OF1A 5DFAA 3NHBA 3K32A 5FTWA 5JT1A 3T3NA 3HNPA 2O06A 4MZXA 1CZLA 3VAAA 1Y8QA 1QAMA 5TARA 1QDUA 4QLAA 5H0IA 3I1YA 1BKYA 4AICA 4BVGA 2JJYA 3NBAA 1C0IA 4OL9A 3VOSA 5KYYB 2VSXA 3V1NA 4Q93A 1I8TA 4M8NE 5J47A 3FYUC 2J9YB 3D6MA 3SJ7A 5C81A 2F67A 2PIDA 2CUZA 1GTMA 5K99A 4EFLA 3LI2A 5IJXA 5C52B 4YCAA 4C3UA 1E9BA 3LHIA 1EWVA 3W1VA 3X1JA 3FHTA 1FXUA 4KBGA 4AJ2A 4N3BA 1XNQB 1T9GR 1P19A 3IILA 1UOQA 4V0LA 1R1DA 1IHPA 3HDYA 4MPJA 4R41A 4JI0B 4B3GA 1WF3A 5CD9A 5BWOA 4QQRA 3KWMA 1DLJA 3S2YA 5BN4B 3V4OA 2IYFA 4RESA 1U02A 3PC6A 3R3XA 4LGVA 3BJEA 1AKTA 1KXZA 3TD9A 1XPOA 3GB9A 4PO8A 4QSMA 3Q11A 4M9ZA 4C43A 4DDTA 3EH2A 4U63A 5CLIA 4ZI2A 5IYZA 4ZA2A 2ZWOA 3RJZA 5K7SA 2ZPTX 3E2IA 4PZLA 1U8XX 1S2GA 1CDZA 3UBTA 3SBOA 5E2IA 2NPIA 2HHHB 2G8LA 4WNCA 1E7RA 2IGTA 3DEIA 1FE8A 3PC3A 2F59A 1S1MA 3D6NB 1QVZA 4RMIA 2MCFA 5HOEA 3GRZA 1GKIA 1C1DB 1M0TA 3FWYA 1DEOA 1RMYA 1RPTA 2PMFA 3C8MA 1ORDA 3PYMA 3K1ZA 3MIIA 3CBQA 3C6XA 2XNJA 2IVFA 5I9IA 4AZ0A 4E5MA 3EVEA 4UUBA 1R5NA 5L7WA 3SZOA 2W90A 3MBIA 4HS4A 5A6VA 1KH1A 2G36A 2GBIA 2JHAA 3QI2A 3AQ4A 4FW8A 4IQFA 4X44A 5SYNA 1E99A 2YYYA 5ITWA 5JJCA 2F17A 2Q4EA 4LOLA 3ZDZB 5DNYB 4YPVA 3PEYA 2CFCA 3H8SA 3BTSA 2RFLA 3AHJA 3G1TA 5EE3A 4C6RA 3ZXXA 3DPSA 1ECLA 4B32A 4WZAA 5BNTA 1E1YA 2DM6A 4G07A 5CUQA 4X62B 1E7MA 2PO7A 1KI9A 1FBNA 2A92A 3LUHA 2OO7A 3KUUA 1JBQA 2CVOA 3AF5A 3MC1A 4TV8B 4W1RA 5LBUA 4YUAA 1UAYA 3RGWS 2P2CA 4QXOA 4BLRA 5KNDH 4C0KA 3AR3A 3KG2A 1I7DA 1OCEA 3DULA 3GR6A 3H7IA 1N0UA 5ES3A 4IW3B 1FS6A 4K0RA 1Z68A 3SHWA 3MXOA 4NENB 3WSWA 3A3KA 4G6ZA 2CFIA 2YJ5A 3D43A 4O08A 4EGQA 2C1XA 3GLHB 1RQ2A 3UC9A 1OUMA 4OO3A 4Q24A 4BX8A 2XCLA 4CKXA 4JLOA 4CV1A 2H8KA 5EZ5A 3O93A 4BKRA 2Q5EA 1JDJA 4P5DA 4WOBA 3DDZX 4WASA 1FXWF 3R3SA 4JC4A 4YCLA 5AUPB 2JGEA 3N2IA 4OPMA 4YRPA 2QJWA 3WLOA 4YV0A 2G76A 2E4XA 4S0XA 3D4PA 3I62A 1L1QA 3ISTA 3N2GA 3N3BC 3ZIDA 3PEFA 1C8VB 2FPIA 3DXZA 1H0KA 4GOLD 5F78A 2JCGA 4GECA 3OU2A 4INAA 2GN9A 1JAYA 1U5CA 5EHXA 4C7JA 1UK7A 1EVZA 1QOPB 2XXBA 5AQEA 2XUZA 1RZRD 4ZAGA 4S35A 5FBHA 3HJTA 1JTVA 4RIIA 2EBUA 3HVKA 4D44A 3G7SA 1NVMB 2CNLA 5J2TA 1XBTA 4H31A 1T6NA 1WSBA 1XXHB 1ZINA 5B3JC 1QLHA 1AUOA 1SUIA 3QA9A 1JHUA 1H9CA 1X6VA 2JLBA 2G0TA 1MCZA 1U9IC 2I1QA 2WZCA 5BYAA 5JAHA 4LWOA 1H1LA 3HJAA 4LZJA 2ZJ3A 1V3QE 4UNPA 4TZ0A 1BXGA 3C6KA 1UWCA 1LD3A 2GLTA 2QB5A 1Z82A 3HJGA 4NBUA 2NO6A 3FYCA 1CLEA 1RI4A 3O31A 4HNTA 1C1YA 2YHUA 5AUNB 5AJWA 1YDEA 4I9NA 5ARCA 3DOFA 1KYTA 1Q15A 4QOGA 5ECYA 5EWMA 5FWXA 3P52A 1ONBA 1U98A 5B7QA 5DM70 3V4RA 2GEJA 2PL3A 4TS9A 4HADA 1YFJA 2F6RA 2XRYA 2BM8A 2OAGA 2PSFA 1UMCA 4YGYA 4UMEA 4UMFA 4YP0A 2X0EA 2DFPA 4AI6A 2YUTA 3FRIA 5B5SA 3PJDA 5HCIA 1PCXA 1KJJA 2IC5A 3CSDA 2HHCA 3PDIB 3NBYC 2BBOA 2JIZD 1VLVA 2AVDA 3EUEA 3HDTA 5ANRB 4ZVUA 3ST7A 1MZVA 1QIKA 2WWTA 1VGVA 1QGDA 1IN5A 4H7KA 4DUGD 2QRHA 1E9EA 3MJTA 1JG4A 3UANA 3DMFA 4ESVA 2IS6A 1ZOOA 4J3NA 3RHSA 1I3MA 2CLMB 2HW8A 1T9ZA 2DRIA 4DV5B 1QRUA 1AN9A 2HMSA 3G5UA 1JDVA 5JW6A 2O05A 3EMKA 1N3IA 1EGVB 3NONA 4FEGA 4I3HA 4BCCA 3GLGB 4NFYA 1RQNA 2L0XA 4OXXA 1RBZA 1RLIA 5IM5A 2QYOA 2ZSJA 4OP2A 1YFZA 2WYIA 1RBQA 4BKPA 3I9NA 2HZ7A 1NXXA 3S2UA 2A84A 1ZONA 2AS0A 2G8NA 4FYVA 3RIXA 4CCYB 2O0MA 4HPJB 4OUDA 4UM7A 4ASUA 4EF4A 5HRAA 4MOWA 4WGGA 4LJ5A 2H31A 2UZ1B 2RB5A 2J4FA 3COYA 3FTNA 3K96A 4O3FA 2CW5A 1OFGA 1VJTA 2I6SA 4HPWA 1S2LA 4QYXA 1J56A 1RPJA 1B8OA 4J16A 4MAAA 5TB5A 1U8AA 1GYRA 2YCBA 3DF9A 2OB1A 3P96A 4OSPA 4DQVA 5IXSA 4RVUA 2WFLB 3UWDA 1PNOA 4KQMA 3V1KA 2GERA 3KKEA 4PHHA 2FCAA 3EVBA 1DOZA 2AKYA 1LBEA 1VI6A 1YJBA 2BEWB 2FWIA 3EOZA 3KJEA 1KYZA 5CAEA 3MYRA 4GYYA 5REQB 2J3QA 1NT4A 3HWX1 4U3JB 2XXJA 4NU8X 3WMWA 1G8SA 1T43A 3DEFA 5L40A 2OPHA 2VNIA 5H8WA 1CJVC 2CMKA 4R01A 3CH5A 4GDFA 1NJFA 1CQJA 1EBFA 1NRIA 1RM3A 2WR8A 5IKOA 2GBGA 1V6SA 2YNMA 1E0SA 3M6XA 4P1ZA 1JLMA 5I7UA 4E51A 3HKEB 3PHIA 1R3DA 4HZUB 2B94A 3LGAA 3OOEA 3A11A 1IY1A 4AO6A 4KB5A 4PGHA 4DT1B 1PQWA 2IZZA 2B4AA 5J5CA 2WSLA 3R0XA 4XKJA 3WWYA 4X64B 5J1SB 1WQ1R 2IYYA 1DADA 1L8AA 3PHCA 1P0PA 4MR9A 4OKNA 4Y18A 3TQIA 3C6YA 2NPFA 1EFRD 4FCVA 4QD3A 4C0LA 1D8AA 1GPUA 3NC4A 3CUVA 4YUWA 2GMWA 1OZHA 2ZRFA 1Z0SA 1NV9A 3Q9SA 4FN5A 3U62A 5C5DA 1GFIA 3GQBA 5LU9A 2D2IA 4I55B 3OPMA 4R68A 4AS3A 4PYKA 1Z5UA 3I64A 3LVBA 1A9OA 2A0WA 5EEGA 3KP1A 3RS3A 4WW0A 2C5AA 4C06A 5CB8A 1RKXA 2GZ1A 1VKZA 4FDUA 4RM2A 2HA6A 1L5GB 2IPNA 4F6CA 1JQEA 1YJQA 1U5BA 4A36A 2YXNA 2ZREA 1T91A 2PLFA 4CQMB 1YCFA 5F12A 5FCDA 1U0EA 2BCEA 4WNYA 3MD0A 1T5SA 4NZYA 3R7WA 1OMOA 4RIGA 4GWKA 2AC7A 2Y0DA 3TJMA 4G8JA 1KETA 1O8BA 2ZUBA 1K88A 1BH2A 1FZQA 1QO9A 3Q7RA 3R24A 2VYND 4LZNA 4NL4H 1MRSA 4J0JA 1S5PA 1CZOA 1ZBDA 4KFSA 4QEZA 5EJGA 3VV3A 2VF4X 1YFLA 2JGJA 1Z5PA 3VYUB 1BG6A 1WMFA 3L5OA 2NXJA 3FWHA 3NH6A 4G3XA 3V4LA 5LD2B 3CRMA 1EE9A 1IL0A 4NMHA 4FKMA 4M0LA 4JA0A 1RE0A 4N5NA 2ES4A 5IVHA 2R7NA 1FU4A 4XLZA 4ZD6A 2ICAA 4X91A 1IEQA 2G6BA 1W94A 2O50A 4YCMA 3IDQA 5EIHA 5T3YA 1GCOA 1XQ6A 4FZ3A 4V0KA 3T6KA 2XECA 4KGDA 1QVVA 4NI5A 1SKUA 1EG2A 1C3JA 3I0NA 3KLOA 2H4JA 4NBLA 4R2XA 1POXA 1GUDA 2CNWA 4MIKA 4QPCA 4YV7A 3T12A 1ZC3A 4IGIA 2AG0A 4L1KA 2EZ9A 3PUVA 2V8OA 3AZPA 3TLGA 4G4SO 4QUAA 4X24A 2ZJBA 3HKCA 2NVOA 5H5JA 4MCJA 2HDOA 3LKDA 3WA7A 1S2IA 1Z63A 1EXMA 2P9FA 1ENPA 5FPTA 4QDKA 1VB3A 4BMSA 4TQGA 4XWOA 3F98A 3N86A 1Q7TA 2FSGA 1ODTC 1Y7LA 2F8LA 1H2RS 1IY0A 1JHAA 1LLDA 1SNYA 1T3LA 2I1WA 2WA1A 3I52A 2E9SA 3IHLA 3ISJA 3O1JC 4BC1A 4EF6A 1F6WA 3SI7A 2N47A 2C78A 4UOEA 5H02A 3D2CA 1BFDA 3NTQA 2WAMA 2PMEA 2IHVA 3M9LA 4O4JB 4OEHA 3WRXC 5DHSA 3K6SA 5G4LA 5BUZA 2FJPA 2NP7A 3MB5A 2B37A 3TRHA 2QTMA 2J7KA 2MSCB 2QMZA 4YCDA 3REFA 3BDAA 2FWBA 5BUCA 4PTLA 1CZHA 2BGGA 1JG7A 3LAWA 5GOTA 5ILQA 3ET5A 1FEZA 3ZZMA 3E2MA 5JAZA 1AHHA 1VXRA 3NO4A 1EYZA 3F7TA 3N8GA 4IGKA 4C3VA 4HSEA 3ODPA 5BSTA 2QYTA 1UP6A 4FFDA 5FNVA 4DCVA 4YAGA 2XKKA 3QNWA 2C2ZA 2XDWA 4NCXA 1YR8A 3UZUA 1W5FA 1QHEA 1JAHA 3UT5B 4CFSA 4PRZA 1QGED 3RVDA 2XLCA 2BHTA 3Q7IA 4LVNA 4D57A 4Z9YA 4ONEA 4KPYA 3LK7A 5I7AA 1YR7A 4HRYA 1I94B 2WU3A 4KQIA 2PUEA 4YJ3F 4EIWA 3T3IA 3A2LA 1DBQA 3KUXA 2VOJA 3I5UA 3ZG6A 4FEEA 4X92A 4ZEVA 3F2IA 3JARA 1D09A 4KIFA 3GL9A 1R0WA 2WNIA 3PRJA 3SS9X 3WISA 4I08A 1H8HD 4WZ6A 2IXDA 4RHTA 1SIUA 4D8UA 2AEJA 2D7CA 1JP7A 4K0KB 3V3KA 3UMYA 3EGDA 3JATB 3VKUA 4F4CA 2GT1A 4N8EA 3CLKA 4P2GA 2QN8A 3OJLA 2VF2A 3DVAA 3G9TA 1YZVA 3SFTA 4LI3X 1RSZA 3H5TA 3GRCA 5HS6A 3GRVA 1W9MA 4GZ6A 1IHOA 3IDSA 1QIEA 4ZVSA 5LZ9A 1Z2OX 2AR0A 2Z04A 3U6BA 1M1NB 3FVTA 5TF4A 5I4KA 2Y68A 4HATA 1J0BA 4A0QA 1HQYE 2PIAA 4GOOD 4EPVA 4G97A 2OMKA 3JQ8A 1C1XB 3DL4A 4KCGA 4M3NA 5BOSB 3KQKA 2Y66A 4HNRA 4UOQA 4LHVA 5ALRA 1ZM3A 1TW3A 2GAAA 3CZ5A 4TKVB 4ZALA 2H5EA 2A2ZA 3A0RB 4F1JA 1R8JA 2R62A 1VHTA 4L4YA 4NXMB 3U9LA 1SO8A 2I7TA 2NUPA 2VEDA 3LK6A 4V24A 3RVQA 3VR5A 1MC1A 3GN2A 3NW9A 3DAYA 4GPBA 5HMMA 4G1VA 2X14A 1GFZA 4LYGA 1G66A 1TE2A 1D7OA 1SCQA 2R1ZA 4QECA 3WY9A 2OHFA 1SVIA 4JEUA 1V9CA 2V9ZA 4MWCA 3E9CA 5EL0A 4Y6OA 2I7DA 4EK9A 3I4LA 3ELBA 3ZHSA 4L7QA 3DBRB 2AFHB 5ENDA 3W8EA 1KBOA 2FEKA 1T36B 2V03A 3K05A 5HTKA 3A6KA 4X1OA 1W2HA 1K2VN 1QQTA 3U3ZA 3FKJA 3SXUA 2P27A 3Q98A 3TWOA 4ZZIA 5AW0A 3TBFA 5JTTA 3N8DA 5FH9A 4EKNB 5LDGA 2MIIA 3EIXA 5D5QA 7REQA 2I91A 2P30A 4KR6A 1EVIA 1TO2E 4KEAA 1GTL1 1YVUA 2D74A 2G7MC 4MSUA 5H3LA 1FFEA 2IYLD 2Y27A 3GCDA 2Z5FA 4MEBA 3JYOA 3AU8A 5KQMA 3G0OA 1GUZA 1KI3A 3C3XA 4WI1A 1X8XA 5DXJA 1CJTC 4CE6A 3HS3A 2PZLA 4B35A 3ZVKA 3Q0IA 2AFVA 2F3UA 1S8NA 5EINA 5C35A 1H1TA 5CPBA 5JSFA 2CHVA 1Y3DE 3LF1A 4YCBA 1DP4A 1X92A 5AHXA 3V80A 3AUTA 3U7QA 3MINB 1PL0A 2G82A 1TZCA 1UM9B 4BO6A 2B61A 3O8OA 2C9YA 1O6GA 3ZJ4A 4MRMA 4LRQA 4PS0A 3ZK9A 1Z0FA 5JBQA 1SY7A 2CC2A 3B2EA 4P82A 2Y1XA 3C14C 3ENQA 3ONEA 4A2QA 2CF6A 3HJNA 1QPZA 3H9QA 1VG1A 1F8XA 1RI5A 1AB6A 1NBHA 2PZMA 3DE2X 3GG9A 3GOQA 3HE3A 3QLTA 4BFUA 3E5RA 4QE3A 4BVKA 5B2EA 2WLTA 5AMXA 1BNCA 3VSEA 1VYHA 5JWRA 5KDDA 1XYVA 2PEZA 1BMQA 4Q37A 4N3GA 3T5DA 1L7DA 2NXNA 4WOCA 1ST3A 1E9VA 2I6GA 2ZRDA 3UOWA 2FMFA 2IBSA 1NC3A 3EASA 4FD3A 4RXUA 2DFVA 1JH9A 2KLBA 2X5NA 3OECA 2VP3A 4TSRA 1RZVA 4YBRA 3UTDA 3WHIA 3ZU3A 1UF9A 4XPZA 2VYCA 2WIDA 3MB8A 4KRFA 2FPMA 1G17A 3JQFA 5K8JB 1XROA 4QXPA 3P9XA 4UU8A 1W0KD 5K3SA 2OBLA 3ESBA 1V1MB 1QF7A 2I29A 2XA2A 2Z4RA 2BH2A 1U3WA 1RI1A 2NPOA 1VMKA 2VF7A 3BFPA 2B78A 1GV1A 3ANTA 5I9LA 2X7JA 1CRQA 4P2BA 1VDMA 4PZEA 2P7IA 2XE8A 3W8NA 2Q4TA 3UPUA 3QGMA 1DVRA 4IIJF 4IZ6A 1XCPA 1JJFA 2HSWA 2X5JO 4PZYA 3SJZA 2IEAA 4GZ5A 4HS9A 1ZDMA 4YVFA 3TVTA 4B2IA 2XKAA 1TAHA 1WD7A 1T15A 4U02A 1RMQA 3FTEA 2P1ZA 3CJRA 1C9DB 3AKEA 4NX2A 4NG5A 4OG2A 3V8NA 4RDHA 2WJAA 3WNQA 1UDXA 2G7ZA 2OM2A 1W9HA 2EJBA 1OE0A 5JIBA 3FOEC 4E46A 3U81A 2X23A 1ODSA 5LQKA 1NNI1 1D6JA 3LNTA 3GARA 4C2TA 1RKQA 1VHLA 3DCIA 2VI5A 1J00A 4HN9A 1W59A 5IULC 2WNSA 2FKNA 2RG1A 1PSZA 1QSGA 1I13A 1QVRA 1OIWA 3ZDRA 2ET6A 1S9HA 2Q3DA 1TCBA 5LN1A 1SMKA 3HKDA 1V4BA 3WNZA 1JJVA 1T29A 1SXGA 3NJ8A 4FXPA 3E3NA 3HXKA 2IOHA 5HTOA 3A6DA 2W4MA 4KBYA 1Z4JA 1G59A 2C7GA 1YB7A 1VBNA 2N9UA 3CEJA 5E2BA 1UT5A 2FG5A 3LBNA 4CQJA 4E2YA 1Q1EA 4AD8A 1TF5A 2L69A 4X41A 3KJIA 2AR7A 4LXHA 4H16A 3DDCA 5H9WA 1EWTA 3GMTA 4M1OA 2F9LA 3ANNA 5IHXA 1WBBA 2QR2A 5LQMA 4N40A 5ICCA 2PS3A 3SKVA 3ZLUA 1RWPA 1H2ZA 1QX3A 2IP2A 3MWJA 2OT3B 4O33A 5D3QA 4QNMA 3ZJTA 2VYVD 1X1CA 1E32A 2NU9B 1WX1A 1QFJA 2E4AA 3KVVA 4NESA 2FZCA 5BSKA 3SM3A 2JGAA 4CTMA 4L6IA 1ONSA 4O2AA 5AVKA 4L76A 2NU8A 4DYVA 1KEVA 1QANA 4D56A 2CVPA 1M8GA 2X9VA 1D5CA 1UMDB 2NZ2A 3E5HA 4RNCA 4DNFA 1D9ZA 3ZC3A 1N6PA 3ZZUA 5CW2A 4IMIB 1E2QA 5EIEA 3EGOA 1VMIA 1SBTA 1EVYA 1MBZA 4WBSA 4WJKB 3SSMA 1YR9A 1SXHA 3SWWA 3OJFA 3MWKA 2DT8A 4K1LA 5I6DA 1AM4D 3QQPA 1ADFA 3IA7A 1P9LA 4HLUC 1H93A 1RPNA 3D0QA 4H3SA 4PLCA 3THSA 3QMWA 3DT6A 3L6DA 1EZ4A 1CUXA 4BTLA 5C0OE 3T1TA 2QW1A 4B71A 2AD5A 1AUQA 1DMSA 3IQIX 1AS2A 2X4DA 3N8IA 4NMLA 4PLZA 4AQDA 4CL0A 4XIIA 1ECFA 2QY9A 3U9SA 5G3ZA 3DTVD 1X1SA 3DBHA 3PXUA 3ZZNA 1NFFA 5F23A 1CR2A 1XXHE 2KQUA 3TAHA 3MLAA 3K16A 3ZCXA 3DMHA 1LQ2A 3H2IA 7ABPA 4X7MA 4LSWA 4LPKA 4EA9A 2BT4A 3W5IA 3HNRA 2PX2A 2JIMA 2ETVA 4I14A 4BY9E 2EKQA 1RXVA 3VC1A 4LJ8A 4ENQA 5BSEA 1PSDA 4YCNA 3LLSA 3ZBTA 3EBLA 5UKDA 4RTMA 3D4BA 4LDQA 3M5WA 1R9GA 3ZE2B 1CUFA 1GKLA 2BDUA 3EWAA 5KYVA 2V96A 3WO0A 4DQDA 5JH7B 1Q0QA 3QUSA 2QVGA 4BFSA 1P5ZB 3ICCA 1DC3A 3FPCA 1ADBA 2IQIA 2CWWA 2C5FA 1D6NA 2VJCA 4RANA 4RBNA 2GZDA 5C80A 5C8ZA 3I5YA 2VAXA 3LUAA 5CFMA 3AHCA 1NONA 1TZ2A 1X1AA 3ZY6A 5C5EA 5AW7A 4XD2A 2LGJA 2A3NA 4JEHA 4JJGA 3PDCA 4PPGA 4QBIA 1E3WA 1MFZA 5GZ1A 4FGSA 1KDYA 3H75A 3WAKA 2AOVA 1KS2A 2GTPA 2D1YA 1PG0A 5EMLA 2RGNC 1ODFA 3KLMX 5DBHX 4JI3B 4KHZA 2JFOA 3RIEA 3L7DA 2J5XA 2DMRA 2XT0A 1WZEA 3PHBE 3GLGE 2NUAB 1E6KA 1N5RA 4GAEA 4ZMSA 4JKYA 4RVGA 4CDRA 2XITA 1EUYA 1ZXXA 2BTQA 3ABZA 3KLBA 4UE6A 1Y8QB 4X00A 1XPUA 5BW6B 4F5EA 1YF3A 2PH7A 3G49A 5T41A 3FKSD 1WW3A 4NPHA 3TIVA 3NIBA 3TPFA 1KZYC 2PLWA 4IIGA 4LJ6A 4RVHA 4AKTA 2J9ZB 2W6ZA 4HSGA 5G0VA 3JAMA 1B23P 1UWVA 3PFCA 4BNIA 3VYRB 4IMPA 3RVRA 3GZNA 4ZAWA 1WDKA 5E95A 3WWOA 3ZEIA 4H7JA 4LXYA 4MUXA 4YXWA 2JGNA 4QBHA 1XCMA 5FI3A 1J70A 2O14A 3L7KA 1AHPA 4URZR 5IDXA 3IAUA 1USGA 2HA0A 3ZU4A 2FTKE 1LBQA 4PWZA 4MGIR 4PYLA 1XQ1A 2B69A 4PV7A 3UWMA 1W44A 3P2JA 4LCEA 2IPLA 1QF9A 2AC2A 4Z9BA 4B5KA 5T8KC 1UBLS 2JGLA 1CULC 2P4UA 3BICA 5IYZB 2QTGA 4JFRA 1RXSA 4P54A 3EIQA 4JENA 2Y4NA 2DLCX 5JHGB 1M6VA 4CEHB 1AJEA 3TW0A 2FW7A 2HLDD 4DSUA 1H6BA 3C0KA 2IXTA 3GW8A 4PFSA 3RQSA 1NLFA 4N0DA 1AHNA 4N12A 1IZ7A 2NP6A 1DXQA 4K6KA 1L8LA 4OQMA 1HT1E 3QUQA 3RIGA 3SLKA 2B4RO 4NONA 5B6PA 2BFPA 4H35A 1EIZA 1OX4A 1TLFA 2QTVA 1Z4MA 1AMUA 3KDAA 4MQLA 4AZ0B 1VI2A 1U1EA 4C4TA 1KU6A 3H86A 1S8OA 2EG9A 4WFJA 2BONA 4D8WA 2Y8EA 5BW4A 3DM5A 2AIRA 1KYIA 3W06A 1NE7A 4WZAB 1BU8A 1ST2A 5G41A 3SHOA 1ZJ4A 4D02A 3ADBA 1IY2A 1PFGA 3KT8A 1GZ4A 4BJ5A 1VLJA 3KZMA 4KQXA 3WB0A 4RK6A 5AW2A 6REQA 1G7CA 4BDSA 3GRKA 2ZSBA 3AJEA 4KXMA 4EJ6A 4DDWA 3UV7A 5G0UA 3VHLB 4WAUA 1JBKA 1V1JA 3R4VA 2IE0A 5CXSA 2AN5A 3P0EA 4I6JA 5E7JA 3I39X 4XSVA 3BMCA 3W5DA 6ADHA 1RQRA 4Y9TA 3HZHA 2FU5C 3NMUF 3MNFA 1XRMA 5CH3A 1CIJA 1GPNA 1Z2PX 4AFNA 1FXWA 1DKOA 2X19A 3ZDEA 4QUBA 1NZDA 4WK0B 4QFBA 5AHOA 3V8PA 1ABFA 4TPKA 1VJ0A 2JZOA 3ILHA 5ER9A 3N2GB 2FPIB 1ZD3A 3O75A 2FDCA 5WRFA 5EIOA 4IJWA 3O73A 2P6RA 3VX4A 3DGFC 2E6UX 3PWSA 2PGAA 3GBSA 3FPHA 2JPDA 3ROKA 3RCBA 2XWPA 1FYVA 1G42A 1RWQA 1M6EX 4LHEA 4RWZA 4TQAA 1NMSA 5LZ5A 4BRUA 1U0BB 2VFAA 3DLCA 3GFQA 3LVFO 1C30A 1DS6A 3ZE9A 2WDPA 4RORA 5KOIA 3D64A 3FH0A 3GO4A 2A1UA 3HCCA 1NR1A 2HBQA 4YUZA 1GFSA 3I53A 3VJMA 5J2TB 5LDDC 2R4UA 4QPZA 3EXAA 2V8BA 3QLUA 2YQ4A 3IKJA 2C58A 3K0CC 3F9CA 2HIGA 3HACA 2WG0A 4LZAA 1FMJA 1LFAA 2YMMA 3K8YA 2BEJA 3U49A 2XX3A 4CM9D 1UP7A 1R37A 1BXGB 1OI3A 1VSQA 3V6MA 4KK4A 3W8RA 3MWYW 1VIYA 4AJ4A 1PLKA 3UJ6A 4LF4B 3LLUA 3RYFA 3SVZA 3OF2A 3ZD7A 1LS6A 3ENKA 3FWZA 4EKEA 2V97A 1F8GA 3DUWA 4N0EA 5FWXB 2VLBA 2ZJ2A 3G17A 4Y1RA 5EWMB 4OYYA 3DE3X 4XSGA 3U3KA 5C8XA 5CDUA 3MGCA 2E18A 3GC6A 4MQUA 2C2BA 3VH3A 1KPGA 4B5LA 4F38A 1U1CA 2CK3A 4EQ6B 4I19A 4LMAA 3VNAA 1UMCB 1S4QA 2GPSA 4RYDA 3P7MA 3ZCSA 2HA2A 2F1IA 2DX7A 4JP2A 2JD0A 1THTA 3Q3EA 4MW4A 1E3EA 2C31A 4URWR 4UVGA 3R75A 2B9VA 5JCZA 3UMFA 5AVUA 2H9AA 4LYYA 3D6FA 3HSKA 1L3CA 3TL2A 1T6ZA 5TX7A 1R00A 1CB0A 2HGSA 4CRWB 3LS2A 1O89A 3JPWA 2ZTUA 2PT7A 4GR9A 5K2OA 4BLWA 4B87A 2P9EA 2VT2A 3PZBA 2JVKA 2VHCA 2XVAA 3AVWA 3N74A 1KMMA 5KQGA 4I6EA 1E6UA 5HKBA 4L08A 2WHEA 3T9DA 4EVSA 4ARZA 4FB5A 5E6RA 1JRLA 4BMVA 4O6VA 1Z7YA 2VQ6A 1KU0A 2ZB2A 1XXLA 2XODA 4G81A 5DBOA 3V1YA 2JBWA 3U7JA 3R0VA 2H48A 2PTHA 4R0MA 5KPDA 1O9GA 4OUDB 3PNQA 4GKVA 5F9MA 3WGKA 4XIFA 3LRTA 5J9FA 3ZLJA 1G6Q1 4CMKA 4RUKA 4FGLA 1RAEA 3ME5A 2ZK7A 1JHDA 4C1NA 2J9XB 3FA2A 2M98A 4HDAA 1IBCA 2WF6A 4TL7A 2QX8A 1D2GA 5DOVA 1ZJ6A 3QOFA 4TSFA 3BIOA 2ACVA 3TEJA 2I2XB 1PGQA 4H6PA 2JHPA 4OOFA 5DM1A 1V0JA 5LCXA 3PI6A 3RB8A 3PVSA 3TKLA 4DV2B 3B9QA 1XEFA 1C0EA 3S8YA 3I9FA 4DVGA 1M0EA 3X2FA 4GE3A 1X13A 1HDXA 2PFGA 3OZBA 3QTLA 5CAEB 1Q57A 2PGDA 2X0IA 3M1IA 4F45A 1YQXA 1SOAA 1YI0A 3NVMB 4DV6B 1XO1A 4JXZA 1P4GA 1VECA 3W6ZA 1XRQA 2XMPA 2ZOSA 1NIPA 4X6UA 3RBZA 4B7ZA 1CQJB 3EMVA 2ACWA 3HYRA 2XQGA 3PEVA 4D97A 2QUJA 1SXIA 1R4AA 4R7ZA 4NZ9A 1SC4A 3K30A 2GVZC 2GVNA 2MTBA 1Q6YA 2QPTA 2ZS9A 4P7BA 4QHYA 3WL3A 4RF3A 1LLUA 1E58A 4I9GA 5AXAA 1VPLA 3U7EB 2JA2A 4XCXA 4UZSA 3L4BC 2CB0A 4L4UA 4U7HA 1EXDA 4QGHA 1A04A 1QLJA 3SR0A 4ZEMA 1ZJWA 1T2AA 3JPYA 1PE0A 4BMNA 1AG9A 1YZQA 1ZH0A 2AFHE 3LPNA 4HQFA 1M8FA 1U8TA 4MR9B 4R1SA 4AY4A 4FB4A 5GVSA 1JQJC 3R0IA 3QUAA 2IZ5A 3GVCA 3DDNA 4IUYA 3ZWBA 4H3VA 1NU6A 3F90A 1M1XB 4IWXA 4QXRA 1Z6TA 4XVHA 3UA3A 1BA2A 2ZJ6A 3GQBB 2X9LA 4AC9A 4TWJA 2D1RA 3CFYA 3WGZA 3PJGA 1K7FB 4NC9A 3EVCA 1WB6A 3LDAA 7GPBA 3QPCA 1Z4PX 3N2YA 4ZJUA 3DOCA 3ZV3A 3W5AA 1ZM7A 1K98A 4ND7A 2QRQA 4PHCA 1U5BB 2AHRA 2WY2D 2OQVA 3UOAB 1UBNA 2C98A 3JW8A 3ZW7A 1CR4A 1H69A 3W4KA 1VBFA 5B6IA 1YVEI 3ISVA 2CXXA 3L8DA 4HLDA 4RTSA 1YZNA 3EBOA 4RTOA 3TEFA 1YBFA 4LMPA 2BUAA 3IE2A 2PU7A 3DEJA 3BREA 2CJWA 2ERYA 2WIKA 3MHPA 5EPUA 1JEYA 4OXNA 2NOAA 3EIUA 4HVAA 1EX9A 1AS0A 1A9QA 2NVBA 2C8JA 1MPXA 2GPJA 1I2BA 5HSGA 5C31A 5KOYA 1TJYA 1ZLYA 3HB5X 1P7YA 2QR3A 3LQRA 3U31A 4QZVA 2O1EA 1PV4A 1GA4A 4OY3A 4Z2AA 1WBJB 2CYBA 1ICEA 4J6FA 3HCWA 1FFXA 4A8JA 3FZYA 5F1PA 2DR3A 2RB4A 4OJNA 1Z7BA 4GX1A 3D8RA 3OFNA 5KTMA 1IPEA 3T34A 1QHHB 1UPAA 1K8QA 1XN4A 1JNXX 2YHAA 3NGLA 4D4IA 4WBNF 3QUCA 4NZPA 3SU8A 1F2DA 1JWBB 4CW7A 2R1UA 3O4JA 4B46A 3FNEA 4RHFA 4CMIA 2AN9A 5HZKA 3U1BA 3K1JA 4HY3A 1ZHOA 1TDJA 4Q3DA 4QQFA 2QBYA 4MUBA 4ZO8A 3ZLTA 4DM4A 3TLGB 4PLHA 4P4NA 4QT0A 2XKBA 5L9AA 1RM5A 3RO7A 4KO1S 2J32A 3HKCB 4NECA 5GJVC 1FXSA 1DUVG 1UMBB 2OAEA 4HNQA 5HR5A 4W9NA 5EJIA 2Q9CA 1XQVA 1OVGA 3AYXB 2P62A 1ZCZA 3IJEB 3CWZA 3OWXA 4TMFA 3IQGX 4EG7A 2R8OA 3MTJA 4FNAA 3S3TA 2ZI7A 2R6ZA 3OX2A 5EA2A 4C7KA 5EJ4A 3A6LA 3D0KA 4Z9FA 4IRMA 4FS3A 3U44A 1FP4A 3R9XB 1I4WA 2FQYA 4HEQA 4D25A 2O0JA 2V74B 5EOVA 1NW3A 3A6HA 1FSPA 5B2FA 1MEOA 3ADDA 1V16B 2XE6A 3G0HA 3AV0B 3K6SB 5COQA 3V2GA 2VEOA 1IULA 4R40A 5IABA 3TQTA 1DELA 2JW5A 4HAIA 4XTRA 2A67A 2N3ZA 4B3TB 3QYFA 3FOFC 4CR8A 1R4MA 2D4HA 5LC1A 4EABA 1MFPA 4LFBB 4BGEA 2OVBA 2WYHA 3R5TA 5FNVB 2R1VA 3UN1A 1ZRSA 4OI4A 4AJKA 1U6KA 3FMVA 3R3YA 1YOVA 4MVJH 3B12A 3MCVA 2H2IA 4BUCA 3N6RA 4UTNA 5KC9A 2PL9A 4QJBA 3EEOA 4N41A 2FGJA 1R0RE 1B1AA 3QFRA 1RPAA 1W5EA 3BZWA 1E8DA 3IP9A 1DQNA 1LC3A 2Y92A 1RAIA 2IUEA 1QIMA 1VXOA 3JARB 2QQ0A 1B41A 1DCFA 1UKAA 2RMKA 2W2OA 1NBME 3BCHA 3IMKA 4F9EA 1ZWKA 4K6MA 4BVHA 2J0VA 3F6YA 2P6MA 1G5PA 3F6SA 3UB3A 3GRAA 2YKGA 3EGDB 4I50A 1L3IA 3DFIA 1A5TA 5H83A 2HA3A 5G1OA 3OI7A 3W9BA 3EN0A 5A5FA 1RWKA 5KSZA 1G9TA 1X1DA 1F06A 3KKKA 3DVAB 3LMKA 3V2UA 4JXXA 4U2EA 4X6LA 2QMOA 3CHYA 5M7EA 2P9YA 4AN4A 3NAQA 2OCIA 3B6KA 3I8XA 1PT6A 4Y2VA 4EGCB 4NPAA 3LUDA 3I3SR 3OIYA 1O2DA 2GZ2A 2Q0QA 3JQ8B 4LOJA 4RPKA 4JUDX 2YDXA 4DR2B 4ZHQB 4YQEA 3KQNA 4PQFA 2H9YA 1QG6A 3B70A 1N7GA 4PN7A 3IR5A 2EP5A 2XTZA 1JDSA 2PUHA 4TT3A 3TOCA 2IKQA 5JV5A 4P84A 1B2LA 2HWWA 1GUBA 3DR5A 3PB3A 1AK9A 1VLMA 2NUPB 3FI0A 5JSZB 1Y9EA 2BZ0A 4HEJA 4KYVA 2GKOA 1IOVA 4NOLA 5DT9A 3RSGA 1S6YA 2HQOA 4OM7A 2J3HA 2I3ZA 2OBMA 1GTZA 3HC7A 4ZGWA 3BIWA 4NFSA 4LGMA 4C2UA 4J43A 1ZESA 1KJ8A 2VXCA 4P3NA 1IYZA 4LHZA 5GVRA 3PRHA 1K5DA 5KI6A 2O8BA 2QZPA 2BMWA 3VAZA 2ZUEA 1JA1A 4I4CA 5FBRB 3GLRA 3EZLA 4KQ1A 3NEPX 3RFCA 4YI5A 3CH7A 1GNLA 3TKAA 2M9MA 3HY4A 3KQUA 1RZRA 2AI1A 3SXUB 1GNPA 2WPNA 1UP4A 4B0PA 3I01A 5GTDA 1MORA 3HLKA 5CGQB 5F76A 4P0TA 7REQB 3TQHA 2QT1A 2P6PA 4E0BA 2WU1A 3GCGA 4PZAA 5HBRA 4BFTA 5F51A 4CG1A 5C1PA 5K6AC 4EDHA 2ZKIA 4U5QA 2Z5LA 1NP6A 4GSYA 1GRVA 3SLRA 3TTTA 5HGXA 1YRAA 2YJGA 1OLUA 3UJCA 4N7MA 3HEAA 4XWKA 3RF7A 2MYNA 2XEDA 5K05A 1EHYA 2YYAA 3HP4A 4HQ0A 4LIPD 1P1KA 1LX6A 3JD3A 2CNBA 1SVLA 5JVDA 4NCAA 4EO9A 2VA9A 1FYXA 4M2LA 2PWAA 4L15A 1LW6E 5CHYA 4BAZA 4HB2A 4RELA 5DRTA 3U7QB 3GMIA 1YSCA 5JY6A 1MJFA 3O8OB 3TTXA 2DFLA 3P2EA 4GXTA 2ZIZA 4R1PA 3RU3A 4MRMB 2XGSA 3T3OA 1QGUA 1BJTA 1R8XA 2HBZA 2EZ8A 2W37A 2WT9A 5C1DA 2H16A 2FXVA 1XDDA 2J67A 3EXG2 1JDBB 3CNHA 5KWVA 3QEJA 3T99A 2HWUA 4X3CA 2ZT7A 3UMVA 4MV4A 1X80B 2H1IA 1RQPA 2HR1A 2JIZA 2Y0EA 4TMZA 4WIAA 1CEXA 3KM0A 4DUGA 1AGNA 2BELA 4WKNA 2MSLA 1I1OA 3IUYA 1Q0ZA 2JHCA 3LQYA 1BOFA 4J1QA 2F55A 1ECGA 4XRRA 1OWPA 3LDFA 3LT1A 5BXQC 1TNDA 1SUCA 3FFAA 1DKNA 2R48A 2XRZA 2CL6X 1TLLA 2H2FA 1M10A 1NUTA 3LCJA 4P0QB 3O21A 2PAAA 4UREA 1JPNA 1FQKA 4KQWA 4JBWA 4FGJA 1U3CA 2YINC 4AJEA 4Z51A 4AS2A 4D3ZA 1GM5A 2P2DA 4LBYA 1ZITA 1C5KA 4IIJA 2VJQA 4URHA 5CR9A 4FDTA 4Q3BA 4DEVA 4OU4A 1YXMA 3N8HA 4UAGA 4W5WA 1PZFA 2RGNA 5F5XA 1KC3A 1NNLA 4M99A 2Q9AA 3ABRB 4FT4A 4D1YA 4HWTA 1C0PA 1VP3A 2FOXA 1HDGO 3L43A 1YI8A 3QH4A 4U9HS 1NVVQ 3BB3A 3F4BA 3MS2A 3OCCA 3QF4A 1P4AA 4UDNA 5MGNA 4F12A 3GJ0A 2HI0A 2OCBA 4ALKA 4KR0A 3N3AC 3SJCA 1KFCB 1OBHA 3T3PB 1DKUA 3RNOA 3KYBA 2ZCUA 3SQWA 3AP2A 2A9JA 3HKDB 1A2OA 1AA9A 2NZXA 1HA3A 1QDEA 2YRXA 3P9NA 4H9GA 1I7LA 2A86A 3QYJA 4YR7A 1RKBA 2Q6KA 3H5AA 5ABPA 5BRJA 4P92A 3I45A 1A7KA 1TRHA 5GGXA 2HADA 3GJ3A 1ZMBA 3LVRE 3TFWA 4ER5A 1SUBA 3T7SA 2FW8A 1AGYA 4WZAE 2H5JA 1BX1A 2XNKA 1MNAA 2BAGA 2BMDA 2W83A 3EF1A 2WUGA 4MA5A 4OKIA 3PXGA 1I80A 1V6AA 4DOMA 3FHJA 1I5RA 1EFRA 1QTNA 2IYTA 4MGHA 4B4OA 4DLZA 1X15A 1CF9A 4HX5A 1Z45A 1EEHA 4EUNA 2C2XA 2ZSEA 3VM6A 4RD3A 1GG2A 1DPFA 3KOZA 1SHLA 5HCUA 2H5LA 5EXEA 4XM2A 4MUAA 1A69A 2QL9A 4O2AB 1HG1A 1MIHA 2NU8B 3H0CA 1VLHA 4M0FA 3STWA 2DFDA 2WD7A 3IUEA 3I9KA 1I7PA 1J4AA 1WKBA 1NLZA 3CRNA 3L0DA 1C4XA 1P7CA 1I2ZA 4WKPA 1GQSA 3K2EA 1RADA 1PS0A 1Y8RA 2R7LA 1N5KA 2YV2A 1EFLA 3UQZA 2GEKA 2VDJA 3VAYA 4B8YA 1J2UA 3ND8A 1EESA 2C2HA 4FCCA 4ARVA 1RACA 1W5BA 1FMCA 3TR5A 1VRVA 2VYNA 3B9BA 1ZGAA 5EQTA 2PWYA 3TLAA 3QEMA 1I10A 1HLPA 1M6NA 4I1RA 2XNDD 3SS7X 3NC1C 3S4YA 1KP9A 1XF1A 2QSYA 1YDMA 3E9YA 1HWYA 1SIBE 4OFZA 1ZH6A 1LJUA 2LKCA 3DC2A 4EEKA 3EXIA 5AK6A 4EOGA 3A9CA 2CV2A 1T5BA 4MICA 4MCIA 4YS6A 3DBHB 4AJ9A 3DTYA 5EP1A 4DCJA 2J09A 4XM1A 5FUYA 1MB4A 2D5AA 4D8VA 3O4HA 1J21A 4GWGA 5K8LA 2Q3EA 2ENWA 4HVTA 3G5AA 3DLBA 4J75A 3CU5A 1I51A 4O5OA 1UJCA 3S2FA 4ID3A 4U0KA 1Z38A 3DBIA 3F7MA 1E1MA 4Y2RA 5EYPA 1P5HA 2D0IA 4C9BA 1GL6A 1JI3A 2WTNA 1BDBA 2C99A 2X0JA 3K6RA 4RK1A 4RJIA 3RYIA 5JBIA 3LUCA 1SURA 1BS9A 3K35A 4RTPA 1KP2A 1YHZA 4K9OA 4V0SA 3TQCA 3DFFA 3OQIA 3N59A 4H3HB 1BYUA 1SUFA 4JUBA 3JWHA 4QOHA 4W5JA 2AMYA 4BBZA 4YUYA 1WUHS 2BFNA 4KIJA 5B1EA 4FPXA 5AKXA 1NXTA 4CV2A 4IIUA 4D4KA 1MDBA 4E3WA 3U19A 1RHMA 1L5RA 3C45A 4X93A 1YS1X 3H2HA 3BH7A 2QGZA 4MLCA 1YD7A 2Q1UA 2V45A 5K6RA 2BTEA 4R1MA 4PXAA 4RQUA 2DG2A 1E3WB 1W93A 4E5PA 2BLLA 2ZPAA 4NU6A 4RZSA 4M98A 3NHPA 4FFSA 1M1UA 2G9VA 1HKHA 3EC7A 4O2LA 4CHGA 2WFZA 1IQ0A 1P2UA 1RWBA 2IUTA 2JEYA 3KV1A 3NT4A 2QMEA 4N6NA 4LK2A 3UK7A 3LUJA 5HBGA 3LDUA 1PYDA 3QPDA 4ZANA 1BXRA 1TYBE 4Q18A 1L2TA 4EPTA 3V4VB 2BTQB 1CLUA 3L6RA 1IB0A 1ECCA 2WQ6A 4EYQA 3BA1A 1HT0A 4EPYA 4BMZA 1AURA 4KZKA 4ZDKA 2HJHA 3TG8A 4U8HA 2IYNA 1PL7A 2JCXA 5KQRA 3JVEA 3GJXC 4GPAA 2JCYA 2HH9A 2NSHA 1JHZA 2W8ZA 4IIHA 3GZNB 2EX1A 4UHBA 2DF8A 3KOOA 1OYVA 5EHZA 1LK5A 1PYOA 1WXDA 1DC8A 4R84A 4GI7A 4TMTA 1H8HA 2PMDA 5LMUB 3RFTA 2EWVA 2FEAA 2AG8A 3PKZA 1YZYA 5K0FA 3PSHA 4HFNA 4KXLA 5ALQA 4LUCA 5KQSA 4Q9KA 4IDOA 5ECDA 5CVTA 1WZIA 2VDKB 2WYOA 3VYTB 2IWHA 4Z8XA 5HJ5A 1OIVA 4CLOA 2B34A 4XE5A 1K97A 1G9XA 1M2FA 2XMQA 4MV5A 5GY7A 2QRVA 3A32A 2RG7A 3KLNA 4UE3S 4WNIA 2YV4A 5ALFA 4RKEA 3FPLA 2Q7DA 3W7VA 3RFXA 5IT9A 2ZBGA 1MH1A 1TL7C 1M1ZA 1AMOA 2L18A 4MYCA 1DIAA 1Q74A 3QU5A 2H1CA 4M87A 5KNBD 3GP8A 1KYWA 1JIJA 1R9MA 3TRDA 3AFOA 1MN6A 3K2BA 3G2LA 4B3MB 4M8SA 1ETHA 1NVWQ 1OX4B 3EMBA 3BF7A 4NBSA 4XUCA 3L7AA 1A0OA 5JECA 1DQYA 1OHHD 1P1CA 1HTTA 2GJ9A 3UK6A 5DKFA 5DVZA 3WGHA 2PKEA 3M6WA 3QKUA 2DC1A 3DEHA 3LF2A 3ZWWA 4D0LB 2GHQA 2I76A 3CIFA 1H9AA 4YV2A 1FTYA 5U4XA 1UKZA 2GN1A 3L6BA 1SPBS 5K0JA 5LA6A 3EVFA 4D43A 1UZMA 1S2DA 1CW2B 1VRCA 5AVYA 2P0AA 2DBYA 1Z5GA 4ZV7A 1E1KA 5FEMA 3G8BA 5THKA 2Y1EA 4EG3A 4Y2QA 4J0HA 5G1NA 4URUR 3B7PA 1JF8A 5FI5A 3ZD9A 1QO0D 4LSZA 2JFXA 1JSCA 1Q0PA 4GMFA 4HC4A 3VU0A 2P6UA 3ZGVA 3QVWA 1SQSA 3MCWA 1UQRA 2WUWE 5AVQA 3DE6X 4BO1A 6REQB 2H2WA 5EXPA 1G2QA 2HRBA 2PX6A 3QKWA 4P5EA 3DFUA 5TRTA 2I6TA 3V7UA 1XCGB 3V7YA 1XL1A 4J7XA 3HN6A 5F64A 3BMCB 3QI7A 1WXEA 2J4CA 3GJ5A 3RVOA 4K9SA 3VR6D 5LYJF 2IE8A 4HYEA 2DULA 3QVUA 2GK3A 3B48A 4IQ0A 5IC5A 3ZIAD 4ARSA 4LQLA 5ADUS 5DNAA 1ZCFA 2OHXA 4X1YA 1ZGHA 1VPWA 1KH2A 3ETHA 4NNOA 3HDJA 5BQOA 3L4BA 4YCSA 1YJCA 1QWSA 4K8OA 4LJ4A 1NW4A 4W1QA 5L3QB 1VTKA 3SKXA 3RAGA 1J06A 2Q5QA 4WNAA 3WLEA 3KJZA 3TRFA 2AX4A 1FLAA 3ROPA 3WBBA 5JD3A 1V2HE 3L8MA 3PC4A 3RH0A 1I1HA