5IM5A

Crystal structure of designed two-component self-assembling icosahedral cage i53-40
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
142
structure length
142
Chain Sequence
TKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTRMAGKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accurate design of megadalton-scale two-component icosahedral protein complexes.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii (strain atcc 43067 / dsm 2661 / jal-1 / jcm 10045
molecule tags Protein binding
molecule keywords Designed Riboflavin synthase
total genus 45
structure length 142
sequence length 142
chains with identical sequence B, C, D, E, F, G, H, I, J, K, M, O, Q, S
ec nomenclature ec 2.5.1.9: Riboflavin synthase.
pdb deposition date 2016-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00885 DMRL_synthase 6,7-dimethyl-8-ribityllumazine synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.960 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Lumazine/riboflavin synthase 5im5A00
1HQKA 3NQ41 5IM5A 2C97A 1EJBA 1C2YA 1NQWA 1DI0A 1KYVA 1KYYA 1NQUA 3MK31 1KZ1A 2A57A 2O6HA 1KYXA 2B98A 2F59A 1NQVA 1RVV1 5IM4A 1W29A 2JFBA 1C41A 2I0FA 1KZ6A 1T13A 2OBXA 2A59A 2A58A 2VI5A 1KZ4A 1NQXA 2C94A 1ZISA 2C9DA 1KZ9A 4KQ6A 2C9BA 2B99A 1W19A 4J07A 1XN1A 2C92A
chains in the Genus database with same CATH superfamily
4QE3A 3MYYA 4M0FA 5AVXA 3JR7A 1A9RA 1L7PA 4YHBA 2JGKA 2YQ5A 1H2BA 2FWPA 1ZCJA 1MB3A 1S8NA 4HK4A 3D4PA 2I80A 1UAAA 1NE7A 5EWMA 2CXNA 3OQIB 3QPWA 1B26A 1P6QA 1N0HA 3MMNA 4QUHA 3RF6A 4F2GA 1DNPA 4ZXFA 1XKXA 4CQMD 3V8RA 5IBRA 1NDHA 5F64A 1VG9B 3CWCA 4MO2A 3T0GA 4F3RA 3FZGA 4LCBA 1HYEA 1Z3IX 2OWDA 2B7LA 3LW7A 3O9MA 3TRFA 4CMGA 5LYJB 2OZKA 4GU5A 2QVGA 1EFUA 3EVGA 4FOOA 4RV9A 4U7JA 5EHIA 5I8WA 3EEBA 5KYYB 1F2TA 3SKVA 4HAXA 1OV4A 2PZJA 1PDVA 2Q1TA 2X14A 3PRHA 1U2ZA 2Q5CA 3WGZA 3U44A 4R2HA 2ZJ1A 1YSCA 3AJ9A 2W6JD 3KG2A 4KLNA 3VR4A 5J1SB 1QIHA 1ORIA 2GQ0A 1F6WA 2VRCA 4QUBA 4WD3A 3X1MA 2RJNA 1KI4A 3BE8A 3HM9A 1M0EA 2FZ4A 2B98A 1NUAA 3H9CA 4RV5A 3SF8B 4V1CB 3A6JA 3MAGA 1U0HC 3QKTA 3B1VA 4LDZA 3ORHA 3L92A 4GMHA 4Z53A 6CHYA 1QWSA 1GN8A 2BBWA 1TF5A 1XCLA 5DB4A 1DAOA 1Z6YA 4AO6A 1Y8ZA 3ND5A 3WGNA 3KKQA 4TTJA 2B4QA 3U4QA 2B3TA 2XOXA 3Q15C 5CDUA 1FYWA 2CMKA 3V9PA 4LXTA 4MS3A 1A8QA 3V1MA 2ETXA 4KN6A 4EO4A 2QRLA 1AM4D 1DQNA 3I9NA 3W90A 2YUTA 3PVSA 3R0VA 5CVVA 4TXNA 1PUXA 4IIYA 4E88A 1V9LA 2WABA 5GIPE 1X86B 4F4DA 1KSFX 1PX0A 2R48A 3AG5A 3MS7A 3SHWA 3HABA 4DSAA 1QE5A 5KNBA 1JEYA 3VH3A 3DO6A 3UQZA 4H0NA 4DMRA 1KJIA 5JS6A 4HDNA 2ANCA 4JLUA 2GA9A 1ISRA 1UQUA 2ZS8A 3HBMA 4E5MA 5KX5A 4WCFC 1KDTA 3UPUA 1Y48E 1MB4A 2QN1A 5AQEA 3D7SA 3PPXA 5G0TA 1QHSA 2V97A 1QHHA 3BRSA 5TT1A 1OF1A 3CYFA 5IT0A 3K31A 1F0NA 4RY2A 2XDAA 3LBAA 1O6BA 3OTWA 4GPZA 1PEAA 3GDOA 4JNCA 3ETEA 2O8FA 3NETA 3CNBA 5ALJA 4QL3A 3FN4A 3ZDFA 3PA6A 3MZ0A 1K06A 3NFRA 5DGCA 4E09A 1B3RA 1T4MA 1Y8QA 3FPEA 3TKLA 3WMEA 5CB4A 5IXSA 4NQZA 4URXR 1D6NA 2ZRCA 5AM4A 3K0SA 2IHZA 1FVXA 1RZRD 4AUKA 4DT1B 3CKYA 4KK3A 2GCIA 2ZYUX 2F9MA 3ODGA 3QQ5A 3PHGA 4FZRA 3GGCA 5EP4A 3ZK8A 2JLYA 1P0PA 2NUPB 2R6ZA 2Z5FA 5CA1A 1GFWA 2REXB 3KL2A 4IEEA 2PUEA 4MX8A 5JXHA 2R96A 2G08A 3A2MA 4C7KA 1EK6A 2A0YA 5BNZA 3E3AA 3ZD9A 4OQ4A 1DAMA 3E1KA 2WLSA 4V0SA 4TKVB 4QZVA 3FB1A 1MH1A 2I6XA 3MWFA 1U1CA 4UOQA 3EIQA 1J6UA 1NG1A 2TRSB 1PYDA 1RYFA 1HFEL 3QPDA 3QVGB 4E2XA 2R8PA 5D6OA 5GGXA 1F0YA 5I51A 1WNTA 3C3XA 4N6GA 3CX3A 1CRLA 4KHZA 4L73A 4WINA 1XP8A 2CXXA 1W6UA 4YT8A 2W2TA 3P2EA 4DVGA 1X7ZA 2QF7A 5BT8A 4X1YA 6LDHA 5F2NA 5K0BA 2YVQA 3KJXA 1JGTA 3X44A 1ZNXA 1ZITA 4FNMA 4WESB 2WWIA 4C4YA 3AVUA 5P8WA 1OE0A 3ROTA 3N53A 5JLAA 3D3EA 4XKJA 1QYVA 2KM1A 1GZ4A 1U04A 2HDHA 1XSEA 3AJAA 3GPCA 1KJ8A 1Q7CA 4ZVQA 1GFSA 3BPSA 1SVMA 4I81A 2XT9A 2GXUA 1G7CA 1HXHA 4DJFC 1S3GA 2I22A 2PPVA 4N39A 3KOXA 4C0LA 1LSOA 1TM2A 1ZQ9A 1EVQA 3DONA 1GPNA 4HWKA 4E5PA 3WLTA 3RG2A 5JUWA 2WKWA 4OG2A 1IJBA 4PC2A 3ND9A 4QREA 4Y2YA 4J1TC 4HTFA 1GOTA 1ZSVA 5IH3A 3H6GA 4KR6A 1BE6A 1S7GA 5HKLA 3ADDA 3OF5A 1L3BA 1MXHA 3X43A 3ANTA 2W90A 1WM1A 5EP1A 5GM2A 3QRWA 2PU5A 3B5JA 4FMDF 5DO9A 3FPBA 1ZR2A 2FXIA 5L45A 2IVFA 1A8SA 5IFLA 3H16A 1I3LA 1LBTA 4RK7A 3SYMA 1TU3A 2JI6A 5B1DA 2V9PA 2X22A 4QX6A 3U7RA 3VSAA 2VTBB 2BONA 3G5LA 1L5HA 4D6PA 4US2R 3IMCA 3CX8A 4R98A 4D0RA 2I6SA 3VOSA 1DUIA 2KX7A 2V45A 3WO0A 2G1UA 5F23A 3GEPA 4L9RA 3L7AA 1UMCB 3NHUA 2ZAGA 4MR8B 5D2CA 3RS7A 3IHLA 3RS0A 2UUBB 2Z3ZA 3FYDA 1K8XB 3R09A 4RYLA 1NMYA 1Z08A 1FRZA 1Y5MA 1Z4JA 2XT0A 5CD1A 5T6MA 4WBSA 3TNJA 3B3QA 3TZEA 4MCHA 1V71A 3QU4A 4KIGA 3U4CA 2F1OA 4BBJA 4DC0A 2B20A 3MJFA 1UADA 1RM4A 3F90A 3OJXA 3RTDA 2B0CA 3VBEA 3MFQA 4FYKA 3V46A 4UM9B 3GROA 4NRDA 5ED4A 2PRZA 1L5VA 3F4KA 4TTSA 1SCQA 3ZDAA 4GPIB 4D6XA 5JARA 2XRYA 4D43A 2JBWA 4DJDC 1Q91A 3EPRA 5F2KA 1LVGA 1VL1A 3IUEA 5TSDA 4WIAA 2RI6A 1CEXA 4YVFA 3RIEA 2H2IA 1W29A 5FTLA 4KNWA 2P2DA 3JZFA 1I3OA 4PRLA 4NK5A 3DZBA 3TRKA 5H82A 3SQDA 3ERCA 1GPYA 1KS9A 3S2UA 2J3HA 1JFFA 5G53C 1HT2E 1VHLA 4FYJA 4XI9A 1JFLA 3HXKA 5LZ2A 1D9XA 2AF3C 1QZZA 1OPRA 4XEUA 3UB3A 1PT5A 4BV2A 4LHXA 2QIPA 1UPAA 2VAWA 5K45A 2EW2A 3LNTA 1BU8A 4CVNA 5F7XA 3U61B 1MO2A 5LD2B 1GZDA 1PK7A 3CH5A 1E62A 3PC3A 3IKMB 2RH9B 3EE6A 3GFQA 5IKOA 3MJDA 1D6SA 4HGQA 2DFLA 4YP7A 4J0IA 4RZIA 1KIAA 2B2CA 3BJZA 5JIBA 1T4CB 3QKIA 2R8ZA 2BBOA 1HLPA 1ONOA 2Y1EA 1N2XA 2WOOA 4ZDWA 2D5CA 1DRWA 2W37A 2ZATA 1PFGA 3HZRA 5LB2A 1I1HA 2O2GA 4QYXA 3PI7A 1KIMA 4RCVA 4JVLA 2RH8A 3QTBA 5TGDA 1E92A 1NW6A 1QFJA 2BEJA 3SS8A 3FOAA 5FOVA 4HD8A 4LHSA 3HP4A 4E07A 1CZKA 1B8VA 1D6JA 3KP1A 2C7RA 2BISA 2I78A 2YY7A 5LLTA 5AI5A 3BDVA 4AJHA 1THMA 1M0TA 3GFPA 2DEUA 3GFSA 3OJCA 1GQ2A 1SOWA 4B3GA 1E9BA 3LP6A 1Q6ZA 1WSAA 2ZRAA 2ZJ5A 2YUIA 3NHZA 3F5DA 4RADA 3FUWA 2CLSA 3IXQA 5H5JA 3ZHBA 1P1IA 2JA1A 1U0RA 1AGYA 4KQWA 4NMLA 4HNGA 2QN9A 4BCDA 1Y6FA 4JJ7A 4LE0A 3G2IA 3NHPA 4CEJB 1WR8A 3ROKA 1TT7A 2HX1A 1ZP6A 2XA1A 1NBWB 1XDDA 2R6HA 4KITB 1QF9A 1RJ9B 1GG8A 4ZCRA 3IR6A 3V8NA 4UM8B 1C8KA 3LE8A 3S70A 1FPMA 1ZA2A 3JALB 1E5DA 4XWKA 4XM1A 4N12A 4OAPA 2O0MA 3P2YA 4D80A 3EXFB 7REQA 2JH8A 4ZJPA 4KBYA 4M87A 1W8DA 4CKCA 1I4LD 1WCXA 2L2QA 4MW7A 1BOFA 4CQLA 2N3ZA 2QUAA 1HSOA 1E77A 2Y1GA 3NEYA 1H1DA 1K3TA 1VL2A 4YP6A 3A9VA 3RYIB 1N5MA 3PJFA 4YRFA 4E3ZA 4EYOA 1QQAA 4GBED 3NWJA 3KXPA 4KREA 5TARA 1SFRA 3UK6A 1IG0A 3URKA 2C7QA 5DWVA 4YLYA 3V4LA 2F8LA 1RLJA 1RYEA 1YCDA 1EE1A 2V7GA 4LRWA 1O4VA 4LV8B 3IPAA 5LB4A 3A1DA 1P2GA 3N6RA 2C3YA 4PSDA 3KLPX 3T5DA 3AM1A 3M49A 4I2VA 2CV2A 4PR0A 3OA0A 4C7BA 3K72B 2FMFA 2NADA 3JR3A 3LBHA 2I4IA 2AJBA 3Q5EA 1FVFA 1Y81A 3RVDA 4EHFA 5C1OA 2Q3BA 1GM5A 1EUQA 3IPYA 3OO1A 2HHHB 2G1JA 1N6RA 4O1HA 5TQVA 5EIBC 1CX9B 4C3VA 3M6IA 4QYIA 3I5MA 4K1LA 3IT0A 4Q3DA 4TYPA 1D4ZA 2ZU0C 4PANA 2H5EA 3IYLW 1TF7A 3EDCA 1MO6A 1UT6A 2C7GA 3IQEA 4OYLA 3WKDA 2QTZA 4N65A 1N2EA 4DNPA 3NEPX 4ZYLA 2QS9A 3DD1A 4J0DA 3IBGA 4HAOA 4JBIA 4MQ4A 2GJ4A 2VHEA 4JP1A 4O6VA 5FHQA 1HE8B 2XAAA 4DKJA 1LPMA 1SXGA 2B6HA 1UKBA 2OG2A 4Z2YA 3RRFA 1HURA 4PC3A 1P2SA 1SCUA 3M82A 4DCUA 1JL3A 1LB1B 3GLUA 1ORDA 4N3NA 4QEZA 1P62B 4PZAA 5TPZA 1QAMA 2J32A 5KDOA 2PUAA 1DFIA 5DX1A 3KEFA 1DE0A 2ZRKA 4FMCB 2VHTA 5ER9A 2QV0A 1W8IA 2O6HA 4P1ZA 1HF3A 2GPBA 3T7SA 5HZMA 5FWDA 5JMTA 3E5RA 1VFNA 5H70A 1R88A 3GLRA 3IVXA 4HMPA 4NCXA 4RTPA 1JQLB 4D9BA 2NZWA 1U7PA 4U6QA 2ZYGA 4CF5A 1MP0A 5HMLA 2NZJA 3RPEA 3R23A 1CUWA 1H85A 1J2UA 5AVQA 1H2RS 1YZTA 1UIMA 1NULA 2Y0CA 1WPRA 2I6GA 2OHXA 3IOYA 3QELA 3RC9A 3SZ3A 2FPGB 4BN5A 4XVQA 2J4DA 1HQCA 2PXCA 1CS0B 4IDNA 2MJLA 3REQA 1YOVB 3HKDA 1KPHA 1RTKA 3L7KA 3M4ZA 5ALWA 2FSHA 5EPOA 2VUSA 1EAMA 1CIPA 2WZQA 4LZLA 3T1TA 1QK3A 1U6KA 3IUMA 2C8LA 2I2XB 4ZU6X 3ZZMA 4KFSA 4EY7A 4DR5B 2R8RA 4BEVA 2QE7D 4OFBA 2OD9A 4BBAA 4BOYA 1G5PA 1Z2DA 1E6EA 4KO3S 1XRRA 1T3GA 2FPIA 1TW3A 4QASA 2J9GA 4MVYA 2AWOA 1JLRA 4XOUA 1GTG1 3OPVA 4LXQA 2Z8YM 3O93A 4HAYA 5CMLA 1T8SA 2VATA 1AQUA 3QA9A 1ZX1A 3I3OA 4KKXB 4ZQBA 5FOTA 1NJ1A 1G2OA 2C2XA 1Z68A 2B92A 2GNAA 3QTTA 1FTGA 5T8KC 4E08A 5IDWA 3THOA 3NI2A 3H5IA 4Y2RA 3T7TA 3GRFA 4WXMA 1LH0A 4KW7A 3K8ZA 5EIHA 4I4CA 3A6KA 4B1FA 1IK4A 4MP3A 4IKOA 3U1BA 3W6UA 5JSKA 4JJFA 2XF2A 3ZD6A 1R0WA 4IHJF 2ET6A 3NOOA 4KE6A 3RHTA 4AMBA 3UO8B 4BFUA 1C4OA 3KBBA 1V95A 2B4KA 1AMOA 2IYOA 1M2KA 2RHMA 3GQVA 1VMIA 4OJQA 4XJSA 4EG5A 3EUEA 2IXTA 4BB0A 4GZ6A 1SM4A 5MN5A 3EQ6A 1CR4A 2C59A 5CCXA 3SQOA 2PXHA 4OBXA 1XD9A 1UBSB 5LA6A 2JAUA 4DDKA 2ECFA 2WIAA 4YQEA 2CDRA 3HR7A 3ZJVA 1JDSA 2G6BA 2WIDA 1I2CA 1YDHA 2PMBA 4AWBA 4MVXA 3FOFC 3UMCA 4L95C 4LCJA 4ZI3A 1M2EA 1ICEA 1TCAA 1FU7A 1SU7A 3T7JA 4CT0A 3ZJYA 4MRSA 4PHGA 3FIUA 4URFA 1T35A 2NVUA 2Y2VA 4IUDS 3IPCA 1BJKA 4O4IB 3LHIA 3UOAB 1YUNA 1JEQB 3LWZA 3OHSX 3SC2A 3N2LA 2Q6OA 4A1OA 1ESMA 1Q20A 1BHO1 4QJBA 3ADCA 4ITUA 2IGTA 4ZOQI 1RMYA 4C21A 2R1TA 4RFSB 3T9EA 5DRYA 1T36A 1E8MA 1HYGA 3JAKB 2ZB2A 4NEHB 5F7ZA 5FB3A 4DWWA 4PYJA 3VA7A 5IJ9B 1JHUA 1LI5A 1RQXA 3FBTA 3TR6A 3QPUA 5JEEA 4TYNA 5DCWA 4B8WA 2PGXA 2HGSA 1XZMA 3DOUA 4EIWA 1K3UB 1F6DA 2MINA 1BH2A 2EG5A 2ONKA 3QKRB 4G01B 3GO4A 5FQOA 4EUFA 1BYIA 5JXJA 3HL0A 3OUZA 5HFAA 3H4MA 4F6LA 4HDCA 5IJ0A 1PNQA 4LZOA 1L5GB 4ZCQA 1E18A 1ODCA 1YE8A 1B8OA 2C54A 3D5EA 1WMDA 2D54A 3EWNA 4H1TA 4IKEA 2GM9A 3D8UA 5HWSA 1JTVA 3R4CA 3I9LA 4FXPA 2P40A 3W8NA 3QLVA 3R0ZA 3B9RA 1Q14A 3CX4A 2ZK7A 3R24A 4P93A 3KZNA 4MHTA 3BB1A 3L9WA 3RIYA 2JHCA 3CZ9A 5TQ2B 4DLXA 1NM5C 13PKA 5SYNA 2HHJA 3WK4A 2H9IA 1BG6A 2VBCA 4WUTA 1CRQA 4FFWA 3LD9A 1W1IA 2O2IA 2V96A 3KJIA 2BGNA 3SP1A 1KEEB 3S99A 3NHFA 4W99A 2ZDHA 3S8EA 3AUSA 3W8RA 3U3OA 2BZ0A 5BSRA 4RVCA 3E23A 4IJ5A 2VJAA 4LRSB 1JG1A 4QYSA 1Q77A 2Y1DA 5DF1A 5GP1A 1Y7LA 2JKZA 7ABPA 2CL6X 3R6LA 3P27A 1MPXA 1QYIA 4FHZA 2XTAA 3A1WA 3DAPA 3WG9A 3ZXSA 1PJAA 5K8IA 2D1FA 2RD2A 2E85A 2RHGB 3DAHA 1NXVA 3F6PA 4BC0A 4AQYB 1Y4SA 3QNMA 4RTNA 4F96A 4M0DA 2HMYB 4UNQA 2EFHB 1NJ8A 2OECA 1IY1A 3AG6A 3EY9A 2BFEA 2WYVA 3H1AA 1T3LA 1XK7A 5JAPA 4JJIA 4RKFA 1CU1A 5IMBA 4LXXA 4TL9A 3CJQA 1UZUA 5H3LA 4MKFA 3ZLTA 4U0JA 2IV2X 4JGIA 4MUNA 1PJCA 2HZ7A 4NYIR 2SCUA 3WICA 4O25A 5TF0A 4CFSA 5LSAA 1AQJA 3F1KA 1DIGA 1G55A 3S4YA 4H6WA 1DRUA 1DWUA 1T1SA 1G0OA 3S44A 3Q3CA 4Q15A 3T99A 5A9TA 2H9YA 4EG8A 1DC7A 4Z9YA 1HDEA 3VM6A 5KIAA 3VZBA 5K6RA 3QSYA 5EPEA 1J49A 4GR9A 4R8LA 1VJGA 1XTVA 5G4LA 3W1EA 5DU2A 3ZI7A 3ZU4A 4BNLA 4FDAA 5K99A 3KHSA 1NW4A 1PSZA 2ZQZA 5THKA 5KC9A 1AO0A 2IBTA 3V5NA 1U3WA 1HMPA 4RQBA 3L40A 1NSTA 2IIQA 1NDQA 1A5SB 2C97A 1O03A 3NQ41 1IHOA 2XTNA 3CRNA 4KQXA 4MQEB 3T9BA 2P9HA 3WMWA 1R8XA 2FSUA 3BHMA 5I4KA 1LCIA 3IP1A 2ZBVA 1UKYA 4ME6A 8GPBA 5AKYA 3D7RA 1G3RA 3F46A 2IPMA 5ALVA 1HLFA 2IW1A 5LVAA 2HC9A 2FUNB 2MSCB 2HT1A 4PGGA 4RQUA 2V0CA 2AH5A 3O8RA 3C8DA 3ZV5A 4MV0A 4YV1A 4EVIA 1KZ4A 2EL7A 1GVNB 5ALYA 5CK4A 3HDTA 5J59A 3TG8A 3O8QA 4Q37A 1DAKA 1MKYA 1XTKA 4GT1A 3A2LA 5F4BA 5JQGB 4B40A 4MNTA 5AD1A 2XT6A 4Y9RA 3SJCA 3GLIB 2QN6A 1CUBA 2DHCA 3P94A 3PUVA 4G25A 1P80A 2RG1A 3PGMA 4JQOA 4RQTA 3K35A 1FRNA 1W5FA 3KX2A 1FFXB 1YA8A 5ICFA 3E84A 3BHJA 5BSKA 2P5SA 4D8WA 4JKIA 2QR5A 3VPSA 2YFQA 1LS6A 4XIYA 1N9ZA 2IY8A 3U37A 5IHPA 4JSRA 2Y4OA 4LWPA 3DZFA 2P4HX 4XVHA 5HUHA 4YV2A 1E2FA 1JR6A 4EK9A 1ADCA 1MV5A 3S2ZA 221PA 2WSMA 3DXZA 4LNAA 4BNUA 3Q3EA 1R8SA 2N46A 5G4KB 5GOZA 3QHQA 3FOZA 3UN1A 1SZCA 3UXEA 3I8XA 2DKNA 2LCIA 1ULBA 1QK5A 1Z26A 4Q7EA 1TM3E 4H4EA 5JANA 3K1JA 4ZWNA 1FK8A 4EGCB 2BBSA 3WIDA 1W4RA 3L02A 3WNZA 4RSGA 1NUQA 2IOFA 4GKBA 1W5TA 2OBBA 3IJEB 4IHKA 1MFZA 4MRNA 5IVPA 3PFFA 3MMXA 1DS6A 2EKBA 4HDMA 3WZLA 3MSCA 4XW2A 3VZCA 3RFCA 4UZSA 3NM6B 1RI5A 3PXCX 1SZJG 1AKQA 1GCAA 1JB1A 1NJ6A 4DCPA 1R4MB 3E3MA 3T1NA 4Z5XA 1V45E 1A9TA 2XGSA 2KMLA 2C1XA 2NW6A 1NC3A 2ZRFA 4UPEA 1G64A 3PX7A 1DC6A 1JR3E 2XNKA 1IG3A 1QDEA 1JJIA 2OC9A 3OPYB 3JQFA 4ZT6A 1TLTA 1VPLA 1UWLA 2AC2A 3HLYA 4FYHA 3WDMA 3JWGA 1T8YA 5ALUA 5E38A 1CNFA 4UW9A 2P1DA 3BZWA 3R76A 1R0KA 4H7PA 2HIAA 4D81A 2YY6A 4UM7A 4EEZA 2B2NA 1QONA 2GB4A 1UDXA 3GJ7A 2AW5A 4EQ6A 2J3EA 1YQEA 3L7LA 1RQRA 3TBHA 5FTJA 1I0ZA 1ZGAA 2GILA 2PRIA 3AFHA 4Q66C 5FPKA 5M29A 2D4AA 4JOCA 5JYEA 2HJSA 4X1IB 3IAM1 1Z7BA 4J7AA 5CHEA 1N7HA 5IVHA 1QGYA 3UK0A 4BKRA 4V0MA 2A58A 3HY3A 5EUCA 4DB4A 3H87A 3IA2A 1L4YA 2IDZA 4D26A 3WDLA 1GITA 2HKIA 4AZVA 2OK8A 3T95A 4BEWA 3M3HA 4BE9A 2JZOA 4PNZA 4TKLA 3UHOA 1ORRA 5C8YA 1F5NA 4HQ6A 4IWXA 3E5HA 4GRDA 3MLAA 3W5HA 1GEGA 2Q41A 3QX8A 2H2FA 4NYMQ 1OWLA 4GI7A 4NU8X 3WKBA 4D46A 2ORYA 1FUKA 4EUHA 3CB2A 3HMKA 4HGPA 3STUA 3TXXA 3LQ1A 3A9SA 1CQJA 3O4FA 3Q87B 5FQNA 2J0VA 2BZSA 5JRDS 4J1SA 3TINA 3E1GA 1WG8A 1YIDA 3QVOA 1RWNA 1ZGHA 2C8VA 3VHQA 4KODA 3LHDA 1E2NA 3OCVA 1KJNA 2C95A 5HPYB 1SR8A 2FF7A 1LDGA 3KAQA 2XCLA 4O0LA 2VWHA 3E9NA 4EW1A 2JCBA 2GKSA 2V03A 2JIOA 4ZZ0A 5KMGB 3TTWA 4BQPA 3DHEA 4CF3A 3JQ9C 3OC6A 1EUYA 3LUCA 4U2DA 3ASYA 4M8IA 3TCNA 2PZEA 4NCAA 2AFIB 3PK0A 2IYYA 3R5KA 4NP6A 4M1EA 2D2FA 4WK6A 1ZI8A 3O6VA 3STHA 2NO4A 2V7QA 3VJRA 2HRZA 3PEYA 4RZ3A 2Q1UA 3CLSC 3GJSA 2AZMA 2DHRA 4P4LA 4XPIB 2ZYTX 4D79A 1VMKA 4M7OA 1KMMA 2JNWA 4A9AA 4CM7A 4PRZA 1GXSB 4QU9A 3CUSA 4B44A 1FJXA 4D0LB 5TF4A 4R3WA 5KO2A 3E8SA 3MWGA 2H63A 4O3FA 3T7AA 1HQDA 2WUFA 1QG6A 5CRIA 3S2SA 5BOSA 1JHRA 4Q3KA 4FLFA 3WYNA 1TKCA 1ZOSA 1JLKA 1NP7A 2R6R1 1AS2A 2XTMA 3BYZA 3G3EA 2XXAB 2A9RA 3I32A 4HL6A 1NG9A 4PZDA 1UOQA 2DBQA 5CFRA 2D00A 5AXDA 1Z8FA 2Y1CA 1F51E 3DZCA 3SIXA 4EUNA 1DV2A 1NI3A 2EJVA 1WMEA 2QBYB 1TZJA 2H5LA 2PBRA 3WNVA 1TA4A 2B3DA 1A50B 1RQ2A 1D4FA 1OWNA 4PN3A 1ID1A 5CM9C 4NI5A 3F6BX 5KVVA 1DHTA 2PX2A 1T3ZA 5BUZA 3F71A 1RD4A 4UCWA 3RVOA 1QQ6A 3ENZA 1BD3A 5BN3A 2NAPA 1PYGA 2GYYA 2KE5A 3CZQA 3ZHUA 3LOQA 2O8BA 3RRNA 3P45A 1ZGJA 5CVCA 2WU4A 2NVWA 4YDRA 2PJUA 4B6PA 3ORQA 5HA5A 3HUDA 4RS3A 1RXYA 3L1KA 2L18A 4TWZA 2TMGA 5C3MA 3R9XA 3QUCA 3UNXA 3W4JA 4PC1A 1PNOA 3DE5X 3SYTA 3PQ4A 3WK5A 2VQ6A 4AZ3A 3DFKA 4BVAA 3PP8A 1XRPA 2F3PA 2NTVA 2DXIA 3K2BA 2CY0A 4HH0A 1LY1A 2BHLA 4B3IA 3O8NA 2MHCA 4DYDA 3FSEA 5DE3A 2B61A 1PZFA 2VCEA 2P0EA 4QO7A 4EG7A 3JPWA 4AKHA 3E4DA 2DT5A 3T7DA 4R2XA 1JS1X 2HO5A 5CB4F 1HK7A 3FZQA 2X0IA 5AK0A 5B3JC 4HDRB 4JLBA 2NTJA 1EG7A 1WXXA 2R85A 3G85A 1N6KA 1A3CA 3ENVA 4TSRA 1Q7RA 3PJGA 1G8PA 1GA1A 4F12A 3I45A 4I46A 1G9SA 3SHVA 4Z7OB 5IULC 5IWCA 2ATEA 4ZYWA 5A7GA 2JCSA 1E2QA 1FS5A 4RHXA 3Q5GA 3QX3A 1QU2A 1JR4A 1EK5A 2AI1A 2LBPA 2DY1A 3JQ7B 4L5BA 4LDJA 3MXTA 4P3KA 3R77A 4MVWA 1ZCZA 1VL5A 1YL7A 3FPJA 2NU8B 3UG6A 2C5HA 2G07A 4JXXA 4OQZA 1KP3A 2GD1O 2FVYA 4MYCA 4KNVA 4BO1A 1M66A 1T2DA 4JA2A 4PSAA 3A9WA 3JD3A 3LPMA 4B6QA 1KOLA 4B3MB 3V1LA 1JSLA 1P5ZB 2RBGA 1GCIA 3T7IA 2VK2A 1P33A 4M0LA 4ZO6A 2J46A 4BFTA 1SXJA 5T6BA 1UBGA 4RF4A 5JR3A 3RYTC 4X5OA 1H93A 2OOKA 1IHXA 2V6BA 3DZHA 5DP1A 3V7WA 2MIIA 3QK7A 2P9CA 3VO9A 2OLKA 2QD5A 4FCVA 4BRSA 1CEEA 2HU8A 1XP5A 3GT3A 4BJ3A 4ZOLB 2NIPA 2CWWA 3FHJA 5DT9A 3U9SA 4UAUA 5DXJA 3GRZA 4D96A 1XMSA 4YI3A 1ZIYA 3UVEA 1WB6A 4MUKA 4G0WA 2C2WA 1KYWA 3ZCQA 3GJTA 1KVTA 3K09C 1O3YA 2G17A 4J7UA 2Q45A 4P3PA 1W4LA 5J5VA 4YCLA 3VZRA 1EVKA 1O58A 1FU4A 1XLTA 3O84A 2W83A 1T26A 4QJ3A 1A96A 2XW6A 3R9WA 1L4GA 1Y42X 4K6KA 4KBFA 1JG4A 4TN5A 4PTLA 1R5JA 3IVRA 4WLEA 2F43A 4IDBA 2R0QC 3HG7A 3L8HA 1C3VA 3T06B 4OREX 4OSPA 5HF5A 2MR6A 2R1VA 3ZHQA 5K0GA 1KOGA 5AW4A 2IYXA 2Z9CA 3HEAA 1BCSA 4OI1A 1JVBA 3FUVA 1DLJA 4FQ5A 4DG8A 4FYYA 4QGSA 4C0QC 1YDFA 3K1AA 3W4IA 10MHA 4ER3A 1VB5A 2GZ1A 2PYIA 3EZ7A 3ASUA 3AGPA 3DCJA 1AQIA 4F5DA 1PDWA 2J3DA 5BNIA 4J0FA 2AEFA 4V2UA 1FFAA 2XCIA 1NXXA 5CW1A 3GJZA 4NNOA 1UKEA 4Y6QA 5BQPA 3TLCA 4ZGGA 1O8BA 2YR0A 1EJ2A 1I5RA 4DANA 2JCXA 4ML3A 2JFVA 1MG0A 2UYOA 4ZO7A 5LNK1 1N77A 1QU3A 3RVLA 4RDHA 4CM5A 1NQWA 1GGJA 3R8FA 4G1VA 2ZWAA 3ZDBA 1YT5A 5EWJA 3CB4A 4P8RA 5CDFA 4ANFA 4RJLA 1KY3A 2A67A 2XHZA 3HWSA 4G5QA 3S7ZA 1XHLA 3PC6A 5EVCA 5KSPA 4YN3A 2C0CA 5A4IS 1UL1X 5CDYA 3K1YA 3OZIA 3UMVA 1ZSYA 3VDQA 2QN8A 3ZWCA 3UC9A 3LXUX 3PNVA 2BEKA 2WZBA 3NYRA 3AR4A 4N5IX 4OPMA 4ZVUA 3NTRA 5FTNA 2FHPA 3J81A 1PVVA 4DA7A 3A25A 2DWPA 1V5FA 2H31A 2FEOA 4OP2A 2M6SA 3TNYA 1DV1A 1UEXC 2Q4OA 1VG8A 2W6JA 3H9JA 4PPNA 2WTMA 2GSDA 3FNHA 5KDDA 2NV2B 1PTJA 3CY6A 1HZJA 3KUCA 3UJ3X 2W6NA 3C7KA 1BDHA 3I5AA 1TYEB 1YZGA 4NV3A 3RSHA 1GTJ1 2VDUE 3S27A 2C8KA 1MVLA 3HUUA 3MT9A 1EWYA 4O2AA 5DPMA 1EZ1A 3IMEA 4MKRA 1WLYA 3GWZA 3STWA 1ZH6A 2GXSA 1GYRA 3H0CA 3MD9A 1RLUA 1CQWA 2H4YA 3EXAA 3A31A 3PNSA 4QXQA 2J0SA 2I87A 3PXBA 1I13A 4V0OA 4IOJA 1ODTC 4BO0A 3EVCA 2VPYA 3LQQA 4LHYA 5TT0A 1F9AA 1S9DA 3D6VA 3PF9A 1XMIA 4OVKA 4P7FA 2V54A 4U7PB 4X71A 5E1BA 5E1DA 4II7A 2GMWA 1KK0A 2GBPA 2IYNA 3RFUA 5HS4A 1OZAA 2JC3A 4A26A 4J1QA 4XQ9A 2PGAA 1RHQA 2ATCA 3P5BA 5DTMA 4G9EA 5CFZA 3RGWS 4A92A 3D0QA 4OMCA 5ABPA 1RIIA 4L8LA 4KDEA 3KZMA 1CB7A 2LPMA 3AY0A 2GASA 1NGSA 2GTIA 4Q03A 4BMDA 3TZQA 2PZKA 3WFZA 3EVTA 1OI7A 1SB9A 3T7EA 1U0LA 3COYA 3ECAA 4YRBA 4P22A 3K5PA 3LRPA 1NLUA 3G9QA 4A16A 3RRZA 4RJKA 121PA 4H7HA 5TV2A 2ONZA 2Z8XA 3P2JA 4QOJA 4QUJA 4NZZA 1RHJA 1P5RA 1NVBA 4KXQA 2G1AA 4WHMA 2H18A 4TL8A 4ZIRA 3CUVA 3L41A 5CURA 2FSVC 4ZYYA 1AJEA 3G5UA 5FLKA 3AY3A 4ZGBA 3DOFA 1ZK3A 4YIKA 4QBKA 4XR4A 5FXMA 1Y4UA 4Q7MB 5K0CA 1N3IA 1UKVY 1N1DA 4P3XA 5BPHA 4A0HA 3DZGA 4F45A 3DFUA 4YP5A 4HHEA 1ZY2A 2RI0A 1UBFA 4G8JA 4IW3B 4B83A 3A3PA 2ZDQA 4UBKA 1PQWA 4HP8A 4PLTA 4INZA 1SVOA 1E2HA 3RBAA 4D5EA 5CIYA 5UKDA 2YICA 5D3QA 4YR9A 1GUZA 2GD2A 3EQ7A 5KWJA 4UUPA 1R6XA 1QFYA 4BNIA 1IU9A 3RK1A 1F0KA 1P2DA 3RAPR 3ACDA 4NPHA 1YDMA 1KR5A 1OVGA 1YD7A 2K4MA 4DDWA 4B3TB 2IYPA 5BV7A 2C1EA 1J23A 3TD2A 2JLWA 3GD7A 3UK1A 2BKAA 1C4KA 3HTXA 3UWDA 4UMEA 3PIDA 1W1UA 2D2VA 4YAEA 4AS2A 3RLFA 3ICQB 2W4QA 2REOA 1E2PA 2VNSA 4RSRA 2JCGA 3CIFA 4B43A 4HVCA 1N2ZA 3U40A 3LBIA 3KAPA 2OHVA 1T2CA 2PEYA 5IDXA 3Q8KA 4O59O 3IEVA 5JXIA 1JXAA 2ISQA 2V7WA 3ESAA 1D2MA 3KNZA 3QVWA 1O4WA 4AIIA 2JEYA 4BJ5A 4RF5A 4XSHA 4MWCA 3WQHA 2CNWA 3VU9B 4A2PA 2BGWA 3EA5A 4J4TA 1KFCB 1V5GA 2DZDA 3DZKA 4MYHA 2ZYSA 4ZQIA 4BMOB 1G21B 1T0HB 5B3KA 2IXDA 1KQOA 4I9HA 2PGNA 1RWKA 2C61A 1CQIA 1C9KA 4TTIA 3HB0A 3I6BA 4QU5A 1PS0A 3KPJA 4PR3A 2FJPA 3ELDA 2LR0A 4IJUA 3OPYA 5H81A 3GAZA 1I14A 1HDXA 1C7QA 4YJDA 4E5YA 5A0VA 1PV1A 3JQRA 3HZOA 2EIHA 3DDHA 3NJ8A 3VXKA 6NULA 3F8SA 2SBTA 3I9V6 4KN5A 3DVLA 1PWYE 4FDUA 1Y7IA 2VHZA 3RFVA 4DLKA 1R4MA 4AB1A 1KI7A 2PZ8A 3LUPA 5CCBA 2Q3EA 4HWPA 1GAXA 1R10A 1CDOA 4QOHA 3AEKB 3QX9A 2LGJA 2XNCA 1J09A 3UANA 4B75A 1IUPA 2E4VA 2DGDA 4HDMB 4X3CA 2A9FA 3RV4A 2GSWA 2WU1A 1IEQA 1ISJA 2BW0A 2RGGA 2RKBA 2JATA 3KE9A 1VHQA 2LE0A 2VXOA 3TOSA 1RQPA 3AEXA 5CBKA 1QH9A 4EJ2A 4C20A 3CJRA 3AW9A 1L4FA 2PRJA 4ZAZA 4CMIA 2VT7A 3GQBA 1MENA 3I8OA 1N57A 3K6KA 1J5EB 1WCYA 3RTAA 4BP3A 4HVAA 4OQPA 2IUUA 4GSKA 1PG5A 3BTVA 4RKYA 2JLRA 1YZLA 5T41A 3WADA 4LA4A 4E31A 4GX2A 1MX3A 5B55A 1QV6A 2F2TA 3EIXA 4ZRDA 3NONA 2IZ5A 3FKSA 4R1OA 3VR4D 5JU6A 4F6CA 4KUGA 1XFDA 2FOIA 2X42A 3FYUB 2A9JA 4L8VA 1E89A 4HDQB 4LECA 4UOEA 2PSJA 4TLBA 2DPYA 1FDTA 1WMBA 2YWBA 5KOJB 2D1RA 5JCJA 2UYHA 3N2ZB 1CJCA 1Y3BE 2E55A 4Y6SA 2RONA 4ZI5A 2XUDA 1R6UA 4QPNA 4G4SO 4XB1A 4YRTA 3FMVA 1LJLA 1NX9A 2VDWA 3A9TA 3VNBA 2YVLA 1IQPA 5ENVA 2PDAA 2VHUA 4P32A 3A1TA 4TUYF 4BPRA 5HJ5A 3QM1A 2I2WA 5KYTA 3VI4B 2C2MA 5K3OA 2NWQA 3LT1A 5AVTA 2E49A 4OX9B 5L8VA 1MEEA 2XMGA 2QTGA 1RYMA 1E96A 2O3UA 4P31A 4XXHA 4BQOA 4F9FA 2XCRB 4P82A 4RTOA 1KDVA 3RVKA 4C88A 3GNQA 1QANA 1R15A 5EA2A 4B4OA 4CF4A 2CE7A 3RSCA 1F4PA 3DEAA 1V1RA 1BXRA 1QM5A 2C42A 3EBPA 4TKUA 3ZTYA 5BSFA 2N1MA 3EGEA 2L42A 4GPEA 4UBNA 2YYAA 3ZDXB 4YPVA 3AZQA 1KI9A 2Y1OA 5BV1A 4UTZA 3HGMA 3GT4A 4R2MA 4BLTA 4QOSA 4TZ6A 5E9QA 2P41A 2JRCA 3W6PA 4Q9AA 3SXUA 1TD1A 1I0LA 1GFIA 5CBPA 1N2BA 3QUQA 4MA5A 3HR4A 1QMPA 3AUAA 4HGNA 4HNQA 3WHKA 3IX7A 4ZDIA 3GT7A 1KK3A 3ZOZA 3P19A 1J22A 1BQ3A 3WGUA 3UCXA 3N3AC 1LRJA 2ADFA 5KPDA 4CCWA 4WLOA 4YCMA 3FPGA 3ZDRA 1EHIA 2FN8A 2GDJA 5FUYA 3SSNA 4EPVA 4ESOA 4GXTA 1QHYA 3FPKA 3PCXA 3OF3A 1F4LA 2YV1A 3FFTA 1MJ5A 2Q1SA 3CUUA 4ZCLA 2FLWA 3EGOA 1W6RA 2A30A 1ENOA 3WYGA 2PYDA 3ZHZA 1XN4A 3EVZA 1YL5A 3WJAA 1W36D 2CCKA 3TH5A 1MGOA 5F98A 1G8KA 3GJQA 2V5VA 3JZAA 4YJFA 4K6CA 3K15A 1U0EA 3R9IA 5JD5A 1G17A 1WU7A 1XE3A 7GPBA 2FETA 3Q40A 2YWXA 2CUZA 2H3HA 3HCFA 3KR1A 2RGNA 4P35A 4IXNA 1IZYA 1DC4A 1P8JA 1JMVA 4QSHA 3VNUA 4I5GA 1G8GA 1CNMA 3KZCA 4Q39A 3AONB 4A7PA 2VHWA 2VQEB 1ISPA 4BQFA 3CF0A 3DBRB 2LNDA 5I5EA 1FDIA 4MGZR 5KJEA 2Q8QA 1DUVG 1JQ5A 5IRCD 3LPCA 3HNRA 3JASB 2D3TA 4WADA 2ZSKA 4YT5A 2TECE 1ZHOA 2X0DA 4RVFA 4OQQA 2YNMD 2CVPA 2FVXA 2VP2A 4R1QA 1PR5A 1Z0AA 1VA5A 3BK1A 4NCNA 3LUAA 1YKSA 4FMDB 1U7OA 4CL2A 1BKSB 3OSZA 2F59A 3H2KA 1YU9A 3PQ5A 4EB0A 1IQRA 3PYMA 3VSDA 1HV8A 2PT9A 2ZI9A 1D0IA 4KXFB 3M6LA 3WAKA 5DOZA 4DV0B 1MAWA 4FN4A 5C1BA 3DDSA 1UZNA 4C1BA 1T36B 3T3OA 3VDNB 1OT5A 3OE7D 2WFLA 2BUBA 2YC4C 1R0ZA 4BMPB 3U3XA 3FDZA 2QG9A 3S1SA 5TVKA 3M4XA 4MEJA 1WMAA 1QCZA 3GK3A 4ISBA 4GI1A 3H2BA 1U9IA 1CS4C 4K6OA 4IH4A 4L0DA 4AUNA 3NAZA 1YZUA 1AXEA 1N6PA 2E9SA 3L7IA 4WWHA 4ZCTA 5BV2P 5DVZA 1KMQA 3QE0A 2BCEA 3R5JA 1Q3TA 5IT4A 1MJNA 4WXEA 5CB8A 4A8PA 1WOYA 1UQTA 2V5AA 2Y76A 3BAFA 5DSZA 3BGVA 4EGFA 3OURA 1UM9A 3QVMA 3GLHE 2XJ4A 1QFZA 3SWWA 3H6KA 3LX4A 5F33A 5BMOA 1OWPA 2H1VA 2BFCB 5LA6B 3O2JA 1FNMA 1OJ7A 3K4HA 1TEHA 3KELA 3V48A 1OFTA 2EX0A 3HB7A 4LRTB 1E4OA 1V8DA 1U0SY 2V6JA 3B8EA 1NBMD 1N2SA 5EYPB 1VPVA 2I4LA 3N07A 3TG2A 3GLGB 4Z9FA 1FMCA 2PY6A 2YBDA 4RA6B 3A6GA 1BQEA 3L7JA 2QQ0A 1KBQA 3CBGA 2H2DA 4RY8A 3BWVA 4B46A 3GV0A 1CY8A 1Y1LA 4UHEA 5DNYB 2J07A 2ZSJA 2VPWA 3QHPA 3WJ7A 2Q2OA 1KVSA 2JAWA 3QF4A 4XJXA 3ZQUA 1RBMA 3A1VA 4M1YA 1QAQA 2QA5A 2YWEA 3FPAA 2XUGA 1WF3A 1L8OA 2R3SA 3U0BA 2R97A 1L5WA 3EF1A 2Y1WA 3GRUA 3HHPA 4NYMR 2FQ1A 3RAFC 5AK3A 1AKYA 4TMTA 5AOBA 2Q4DA 5IT9A 3RGGA 5C34B 2QLMA 3EYAA 2V58A 4HQKA 1QHIA 1SQGA 2Q1YA 1TFUA 3I0MA 1X2EA 2BMJA 2JAXA 4Y67A 5LJIA 4LJRA 2AUMA 1KP2A 2G7ZA 4YRIA 4E46A 1OFVA 3JQ8A 4ZRNA 2ZAMA 1NYTA 3NGXA 1NTRA 1IJFA 1N9KA 4WJKB 1WULS 2BGTA 5FEUA 1W7AA 5DGHA 3PUJA 5EPUA 5ULLA 3OAAD 5HXAA 3AH8A 1FMJA 1K5DA 2O4UX 1RPNA 6REQA 2ZXEA 2I8AA 2NLOA 3PD7A 4JT4A 3RHSA 2Q50A 2VQDA 1W48A 1YI0A 1XTBA 2PKCA 4JVMA 3IMFA 4JLAA 4MPJA 3KJEA 4RD4A 2GN2A 1UFVA 3EYWA 3C5VA 4CTKA 2LP4Y 4CJXA 1EWQA 2VYVA 3T54A 2GN0A 4EG6A 1H66A 4GQIA 1TYCA 5DSXA 1WMSA 3MQ4A 1VGQA 3IEIA 5HK8A 2G25A 4OHXA 5CFNA 1II8A 3LH5A 4YRPA 2ZUFA 1JSXA 1T34A 3FYUA 4S3MA 1P39A 2CFTA 4J90A 3KUUA 2JL1A 3HM2A 1OY1A 1WKBA 3K0BA 3ONNA 3QXCA 4YO7A 4ZVKA 1ZH0A 1USKA 1X94A 2HA3A 4M0KA 3KYCA 3HN6A 3D43A 2DQSA 4ND1A 3SOZA 4BP9A 2ZYRA 1FQWA 4NATA 1OFHA 5F1YA 1O95C 3WDSA 4BZWA 3AI1A 4HT3B 4NXMB 4WX2B 3LLMA 3LP8A 4N0MA 4UEQA 2GAIA 3T41A 3EODA 4DLUA 5E4TA 4Q4AB 2Y27A 4OQXA 1XJ5A 4PAGA 3IP9A 3M6FA 4YWHA 1S9HA 1AS3A 2J5QA 4XDGA 3SBDA 3GLFE 4DIBA 3QLVC 1U2TA 1N8TA 4BYGA 5DLQC 1Q7TA 1GPDG 3CIOA 1FFSA 5ALZA 2QPAA 5U4QA 5KNDA 2PNJA 1WXWA 4MUJA 3GUZA 4PO9A 4OHOA 4RQAA 1NE2A 2AKAB 3CV3A 2UV8A 4JLNA 1QRTA 3V4SA 1VSBA 4F71A 4LMRA 4BJHB 3A4MA 3N5CA 1UEJA 5AICA 3SM3A 5C32A 4FX2A 1CYDA 5FCDA 2NUTA 3TEJA 3HXLA 3Q5DA 1DCKA 3UEOA 4NQRA 3AERB 1O6FA 1QO0D 2Y71A 3ITKA 4NOMA 2F3UA 4JB2A 4NL4H 1M2FA 1NVGA 1JLHA 2C3PA 2IGBA 4G5OA 2ECKA 4JT8A 5A9SB 2PH3A 1PJ4A 3E3LA 4FGWA 4IH9A 2I6FA 4N5DA 3VYWA 3HACA 4EQZA 3AZPA 5AKLA 3R6GA 1QYWA 2FX5A 1RAEA 4ZCIA 3T1VA 2BR4A 2DBZA 2DPXA 4C0SA 4B79A 4CNQA 1QRDA 2I55A 4UHKA 2C0PA 1A2QA 1SUSA 1GCUA 4QBHA 3VTFA 2P35A 3QE2A 3OEEA 2CW5A 1FJGB 1JG6A 2NT4A 3R7LA 1MMFB 3UHAA 1WETA 4OJYA 1ABBA 4IDQA 4BNXA 2VDMB 2WAYA 4FQ8A 4CGYA 3QYAA 1JKMA 1P1BA 2G1PA 1J2EA 1V8BA 4Y9SA 1Y1RA 2QW8A 4B3BA 1YR6A 4X7PA 2PMEA 2A0XA 2GFHA 2Q3JA 2HOQA 3OT5A 3K1ZA 2RHOA 3PCRB 4FFOA 4TM7A 3ONDA 2JARA 5DCLA 4L78A 4A8JA 2HIMA 3OQNA 4KFCA 5F35A 1FW6A 3K94A 4RXUA 2BGLA 1HDOA 2JPDA 5CLQA 3ZYCA 1NQUA 3DPSA 4W5WA 3DD5A 1XBTA 4ZU1X 5J4LA 4M89A 3ENKA 4F85A 2QM0A 1ZH2A 5BMVF 1KU0A 2R8YA 2ZXUA 2C5SA 1TIKA 2ORIA 2YV4A 3OU2A 1ESDA 2OHJA 1G3QA 1G2PA 2V1XA 3VH2A 2E4WA 1A82A 4KXMA 4ARBA 1GTZA 1RRPA 3AUXA 4YFYA 3Q6MA 2YV2A 1QH8B 5DHTA 4X8MA 2OORA 3L6UA 2VNJA 2WICA 2DPGA 1J33A 3BFVA 3UBMA 2AFHE 2RCYA 2ZG6A 2VYFA 3IOBA 2FX2A 4RMNA 3I39X 4XCQA 3ZWAA 5ILGA 4N8DA 3F3KA 3D9QX 3L79A 1KSHA 1S7CA 4DA9A 4U4AA 2BGMA 2FNAA 1NW8A 2VLIA 1ORWA 2IFTA 5C5EA 5BNTA 4MITA 3KM0A 4MDHA 1DDOA 2NXNA 3P9XA 3TOCA 3W77A 2J09A 2AFHA 3AR3A 2OHIA 3AHEA 1A2KC 3TE6A 1KDOA 1W46A 1AHNA 3VAZA 5BXYA 1X7YB 4I55F 3RVPA 1G60A 4RK4A 1JFFB 2FKNA 2V4UA 5G1OA 4RJIA 3KSDO 4IX1A 1CDDA 4KQGA 4F2DA 5C5CA 4XH9B 2O57A 5M7EA 4C22A 3AVOA 4XUCA 3LVFO 2NP7A 1X87A 4HUQB 4PYIA 5ALMA 2ZIUB 3CJTA 4HB3A 1E3WA 1UKZA 2A9VA 3WLMA 2COUA 4D9FA 1D0VA 3M9WA 5F51A 1S2GA 3GPIA 4EJSB 1ODFA 3NBYC 4GGOA 1XTIA 1RM5A 1CP2A 2EFCB 1BKDR 1U81A 2APJA 3JZIA 3SZUA 1UBNA 4JUAA 3GA7A 3COJA 1U2QA 1AUOA 1D04A 4O2AB 5FFMA 5T4EA 3IXLA 4DLTA 5LZ7A 4XFDA 2YDXA 1T5SA 3HSKA 3WK6A 5J4KA 4WCFB 1RI3A 3MT7A 5H9VA 3CH7A 3PUWA 4CEIA 1HNWB 4JI3B 1OUMA 5DBFA 2WNHA 3FXAA 4JCCA 1DG9A 2IYQA 3PITA 4F92B 2GX6A 4N0QA 4FNAA 4G6ZA 2AS0A 4UCXA 3PC7A 1ZCFA 2C4VA 2C4HA 3D0OA 3OWHA 5DYIA 2HCBA 4DKXA 3BDIA 2GUWA 1OA1A 3NBMA 4JVNA 3T5GA 3QMWA 1GPJA 1LBQA 3NO4A 1Q1EA 5IW8A 4X8HA 1MH9A 2PS9A 2DPLA 4AG3A 3OZEA 1VYHA 4RV4A 4M9CA 4F4CA 5A2QA 3E7PA 5B64A 1R3DA 1KEZA 1MT3A 3OY7A 4CCAA 4EECA 1A1VA 2KBEA 3UTCA 1E0SA 1RJGA 1RI4A 1L9XA 1SRRA 2EGUA 5DNDA 2JIMA 1C1XB 3RS2A 3WRXC 4BFSA 4CR8A 3EN0A 3EXG1 1SOVA 2P3LA 4MVJP 1M54A 4H3KB 3VKVA 2O8CB 4D4KA 3NIFB 2I7TA 4G1MB 1N2CB 1Q7GA 1UBHS 2YRWA 5EJIA 3WRWA 3D2CA 3H04A 3OA2A 4RELA 1YZYA 2E2WA 5JSYA 3C85A 4DGSA 3CHYA 1CFJA 4JK3A 1QP4A 2J08A 2DUJA 3PPIA 5EINA 3STXA 4NFLA 2ZBGA 4UVDA 3UPDA 1G2QA 1WBBA 1QGZA 3VUFA 5HIIA 2WOJA 1BWQA 3KKEA 1P3JA 1ZNYA 3LX5A 3SE7A 3KTOA 4Q1BA 3TQIA 5JADA 2EKQA 5CTAA 3DDCA 3VR3A 2WTBA 3ZZNA 5JAZA 3OLQA 1NPDA 3FVQA 1Z13A 2GEJA 2ODQA 4IS3A 5FWAA 3U56A 2CC2A 4R81A 3UAZA 5EYPA 4RY0A 1DAHA 3H19A 3VYRB 1HKHA 2IK8A 4RDXA 1SZPA 4QWWA 4UMDA 3BQ9A 2AKYA 5C51B 4II2A 2BFCA 3DTVB 1OWOA 4YO8A 3DE0X 3ECSA 3DL0A 1E63A 1UM9B 4DPLA 3LY7A 1ISHA 1Q0ZA 2NNWB 3H8SA 2IYFA 3QP9A 4IJWA 4GOXA 1ZRMA 5IWAB 4WZBB 2CBZA 2H1RA 1QE3A 4CUJA 5ECYA 1GZ7A 1O6GA 1ECLA 4S04A 4ZOLA 2GJSA 4B8YA 2VTEA 4MQMA 4RH3A 3FH0A 5KU1A 3HXOA 1MBZA 3GNLA 4L0QA 2JJ2D 1CERA 1JYFA 2H54A 4MS1A 5F5XA 3A2KA 5BYBA 3T9AA 3JQ8B 3GEGA 2GPSA 5ERXA 4BVJA 2G09A 2OCIA 4ZJYA 3W8FA 2OXRA 1BXZA 1K6JA 4M0CA 5FPPA 1FFCA 2GETA 1G1MA 3AW8A 4AKTA 4L22A 4AIRA 2UVPA 1MDBA 2Z2XA 5EI5A 2BJWA 1GUDA 4HNSA 2X8BA 3JWPA 4HY3A 3M1LA 4ND3A 5JAUA 3L2OB 1I6KA 1GEEA 1PR2A 4LTMA 2XYRA 3PJDA 3IXMA 3W2IA 1RBZA 4DT1A 1TO2E 1W5SA 2GAFA 1Q21A 4NF2A 6YASA 4LDRA 5KVCA 4D56A 2ZXFA 1E5LA 4JBYA 4FC6A 4YCJA 1GRQA 5IABA 4YJ3B 1GUFA 4FEEA 1T29A 4LDNA 4MROA 4FI3C 1R3UA 3GFVA 2VZ8A 1BMDA 3L7YA 2OMEA 4OOFA 4S05A 1D1QA 1JG3A 1EFVA 1GPH1 1NBIA 3GA5A 4UHJA 1GQOA 4CEHA 3DNMA 1QHHB 4D42A 4R0MA 1AK2A 1NW9B 1NMQA 2EQ5A 2JDID 3GLGA 4GP7A 2DFDA 4D3SA 3NG1A 2WQ7A 3F7OA 4WV3A 4MVJH 2CJFA 1XN1A 1CUCA 2XGMA 1M5TA 4ZZ1A 4KR2A 3EB9A 1E4EA 4MINA 2CK3A 1XJWA 1SUPA 2C07A 3TAHA 1U28A 4DWJA 1SURA 2WYWA 3NC4A 3GPLA 1JALA 4AZ3B 2P9TA 1Z16A 1JYSA 1O89A 3H5OA 3HN2A 2XYHA 4KG7A 2IHKA 1TVMA 3BXZA 4YACA 4LJ6A 4YJFB 1AY0A 2J87A 3GLGE 2RDMA 2W2LD 3D64A 5JFTA 1P2VA 4JS0A 1TU4A 3NVDA 4FJ0A 5FWXB 3NPAA 2NACA 4J49A 1E1QA 1Z5NA 3K9BA 2LZ0A 4QBIA 3SZRA 2HK9A 1ML3A 2VYQA 4HS4A 4JMLA 1WPGA 2NX2A 4MYDA 2B8NA 4YRJA 4JT9A 3IBTA 4Z8XA 5EQJB 5BRNA 3RKSA 3JQAD 4F60A 2PWBA 4BV3A 4AP5A 1G18A 3VC7A 5T3UA 5JFOA 3SGLA 2XOEA 4O4LF 1MNQA 1TYDE 3ZG6A 1SC6A 5B6IA 1UWKA 1Z62A 2B5WA 1E2DA 4N41A 1MD9A 1RSZA 5DHPA 2YOHA 1JDPA 1FX1A 2BLNA 4QOGA 1EP3B 2XVMA 1QO0A 1E66A 3I64A 3KPVA 2F6RA 2PRYA 3KSUA 5ALTA 3VSBA 2JD1A 5E9AA 1QB7A 3M5DA 1TDJA 1HLGA 1VJCA 1QTIA 3HBLA 1JEAA 1RW4A 1ZN8A 1BCRB 2WP8J 2VSQA 3N6XA 3R3JA 2QN2A 4OHKA 4UNRA 1G8MA 3D02A 4Z1OA 4F91B 5EHGA 4DMHA 1Y6ZA 1JT2A 3UTDA 3DBRA 1ZGCA 1SXJE 4XVRA 3ETCA 3BK2A 1YS7A 2O2ZA 2UZ3A 1YS9A 2XHEA 5H0IA 5KREA 2FRDA 3OC0A 2BFDA 3UT0A 4L9SA 3DTNA 1MHPA 2HW8A 3IGFA 2JLXA 2BWJA 4HSEA 3HEMA 4WA7A 5H83A 4DADA 3TRIA 4DSZA 3NDIA 1QIJA 1U7HA 4MIKA 1VA4A 2AFIA 5I9MA 4O8ZA 5A3QA 1P7ZA 1UXHA 2NPFA 3S8MA 1ZYUA 1J2YA 1DEHA 4ZARA 2EYQA 3EISA 4M8SA 2VDWB 4L51A 1U2DC 1UP4A 2EW1A 1JKIA 1UK7A 2AMVA 1XZBA 2GXQA 1WV1A 2J6BA 3KQVA 1YJQA 2Y1FA 4N03A 4NG4A 4PBRA 4UU7A 3HUFA 5JAOA 4O4IF 3BD8A 2F8TA 2HMUA 2XQJA 4HZUA 4EPTA 2W2VA 3GDWA 1EX9A 1TT5A 4H59A 4J7XA 3UYKA 2XEDA 3B2QA 3C1UA 1H4VB 1R8JA 3AHCA 1WXHA 3UW3A 3QWIA 2V98A 3RTCA 2FMTA 3I2KA 3W3AH 4K2HA 2ZI7A 3SS7X 2X5NA 5EJ9A 2NXCA 3JQFC 1W87A 1WEHA 1E5VA 2X1LA 4O2AF 2FUCA 3N8NA 3PENA 1N1MA 1N0WA 3UKDA 4EP1A 1W36C 4M9RA 2VF2A 3M5CA 3V8EA 3ZCSA 1KRXA 3VYVA 4PNEA 2YWRA 2HCJB 1PUJA 3QEKA 1WSWA 2AD1A 4WN9A 2C3OA 5CVDA 2O19A 4ZCMA 4F4UA 5FFNA 3UHPA 5JCOC 1TX4B 3CXRA 4EG0A 1PZGA 4UDYX 5FL7A 1WP9A 4F5YA 4XQGA 1MC4A 5IAKA 4ZP1A 4LSMA 2A0WA 3ILSA 2JFUA 3GBPA 4K6GA 4WERA 5D7NA 5ERYA 5KNBD 2WRZA 3UXHA 4FU0A 3P9QA 4R54A 4R2IA 4Z0HO 3FCEA 2Z2IA 4EY3A 1QGED 2PN1A 3H9UA 5C8ZA 1U0OC 3ELWA 4C78A 1JDVA 1NSFA 2PT7A 3HS3A 3TTUA 1YRBA 1D3AA 1BXRB 3KEMA 1ECGA 4TKUB 4TL7A 4EQ6B 5KYXA 5L4NA 5ESRA 2BHSA 4IIFA 4Q9KA 1UMDB 1TM1E 4MWOA 4OATA 4HX9A 4PVCA 4AWXA 2ZI5A 1KXJA 5AR1A 4G0OA 4RENA 4NMMA 2DR2A 2Q4EA 1CCWA 3M9XA 3PXEA 3ISVA 1EP2B 3GWGA 1LC3A 1S1CA 2WAAA 1EXMA 5CA0F 1RIFA 1H4SA 3D3JA 3N59A 5BR8B 5JY1A 3EY4A 1P1JA 4HAIA 4C01A 1VSQA 2YZNA 5FBVB 4HOYA 3RK0A 2X3UA 2E4XA 1AN9A 1DRKA 1FTQA 1UMDA 4EGJA 1YZQA 3E9RA 3HKBB 3PHCA 5DZSA 3WWYA 5CXUA 1OTXA 1U4OA 2QP3A 1S5PA 3L0SA 4UM9D 2OYCA 3FF1A 3DE2X 2IXGA 2O8BB 5JZSA 1R0CA 2CLMB 3G0BA 4O33A 3OFVA 1QGDA 1IEXA 1QKIA 3HA2A 5HGJA 1KKUA 4GBGA 2WJAA 4A2WA 2AX3A 4FB5A 1UCFA 1HYQA 1S6YA 3MNFA 4ZHSA 4LF8B 3Q9SA 1TD9A 3W3AD 3EX7C 2JFHA 4U5XA 1OAAA 2PSHA 1Z3CA 1MO4A 1GU0A 1NVDA 1SZDA 1ZNZA 2OILA 2QMHA 3EIWA 3M6UA 2C4NA 5H80A 3RTBA 5KNDD 4XEHA 3WYBA 1TXGA 1U3CA 3TAXA 1RPJA 1Q1ZA 1RP1A 3ZXXA 1IMJA 1QAOA 2R2GA 3WWDA 4QTYA 3HHEA 3I9OA 4YREA 4YYZA 1PT6A 4DTIA 1Q0PA 1KA9H 2XNSA 5A1TA 3G9TA 4GC5A 1U6IA 4B6EA 2GAJA 1S89A 2HPHA 3F7MA 1V7QA 1U0JA 1HBJA 2WMYA 3KKKA 4MJ7A 2CNNA 2HPVA 2JVIA 4NZMA 1ZOPA 4OJNA 4XD7A 4ZOCA 3KQLA 3DHVA 2W42A 1BGXT 1H5UA 1J97A 1N5LA 1O9GA 5KNBH 4MLZA 4EG1A 3K9FC 3O2QB 4P4GA 1G2IA 2H4FA 4IDPA 4Z0NA 5JQGA 4Q3EA 3LQKA 1ATZA 1SEPA 5F73A 4DDMA 3D4NA 4HNUA 2O4CA 5JJCA 1OI3A 4GUDA 1W0JD 1LTQA 1TM5E 3C1AA 5KSZA 3QE4A 1EU1A 2VVTA 1QUEA 3HKBA 1H2YA 5DNVA 1CR1A 1K2WA 4KVGA 2H0RA 2ZTVA 3PJEA 4PO3X 3D6HA 1SVKA 4MUIA 4PNHA 4W5TA 4L4ZA 4GP9A 5IAAA 4XDHA 2PGDA 1CQIB 3IEMA 4KO1S 4ZMSA 1RVDA 1SJ9A 3EC7A 3HXTA 1R12A 3JD2A 4KXXA 3WK7A 3WS7A 5FX2A 4OLBA 3K5IA 5F3WB 4O4HF 4RHFA 1Q95A 2QVLA 2X23A 3P0IA 5AVWA 2W2QA 1I0IA 4EG3A 1Y5NA 4E03A 3GJ0A 4XJTA 1ACLA 4QTXA 3DAYA 1ONPA 4YH1A 4MUXA 4PICA 1KOFA 2HA4A 2RHHA 2XA2A 4CDRA 4Y9TA 1WKVA 1BCRA 3IIIA 2O1WA 3AOGA 3WFJA 2D1SA 5JO0A 1FL9A 5EESA 2IZ7A 1TKAA 1V8ZA 3H7IA 4WL0A 2I3ZA 5JAMA 4H15A 5IDYA 2BL4A 4MIOA 4YYEA 2OVBA 4DZZA 4UTRA 4LUCA 2F48A 1GPAA 4HKTA 4JOBA 1LW6E 2WPDD 3NP9A 4I6GA 4JJZA 5ELXA 5JXWA 5JALA 3AESB 3KLMX 2SCUB 4TMZA 3IPXA 3A14A 2XSZA 1VB3A 2ZS9A 4CLOA 1JKFA 4DQKA 1RXWA 4G23A 2PZBA 4IY1A 4HH3C 4U7GA 3ZD7A 3CE9A 4L57A 1VKOA 5HIMA 4K9NA 3SU8A 1OIXA 1USGA 2EDCA 3PV0A 4PLGA 2YXDA 5E95A 5E8RA 5EKTA 3I2HA 2LDXA 1T2EA 1RR6A 1N8SA 4JJ8A 4JXKA 4PX2A 4XGKA 5EE0A 4C6SA 4CIWA 2WYOA 2G9ZA 3DEZA 3VDMA 5CJ2A 3BRWA 3OX2A 3VGJA 1BE8A 2B35A 3JARA 4S24A 2PXXA 3S0JA 5HBGA 1HNXB 1AZWA 3G79A 4DC9A 4ETWA 1CULC 3AR5A 4BNFA 4BTVA 2HA0A 3MTBA 3LUJA 5CVUA 2BY4A 1KYVA 4MKIA 2R4QA 3NOXA 4JBGA 3AF5A 4ZIRB 3A37A 3LCUA 4B32A 3G2LA 1KEEA 3M1IA 2XUJA 3H5RA 3ZV3A 5DRTA 4QLBA 1DKNA 3BMOB 2PUHA 5CIQA 2OBXA 1B3BA 2PO7A 3LC2O 3ONWA 2FGJA 4NCBA 5CFMA 2AOXA 2GN9A 1ZXBA 2YZKA 1KAGA 4FZVA 4E32A 2OD2A 3PQEA 3BCRA 4DARA 1Y4ZA 1JE0A 3HL4A 3ET5A 1DMSA 2PX3A 1II9A 3MT0A 4QUKA 3V1TC 4YJ3A 1BCSB 1XZPA 3JYQA 2EJWA 3MWYW 2BSAA 4E4TA 1L7DA 2OT3B 3Q3HA 3N7AA 1EFDN 1NYLA 2P9FA 3EVFA 3C7CB 4ITRC 4KK4A 1ZWLA 4PVDA 3V7YA 5KJFA 3LCRA 5CDTA 1AO3A 2F43B 2QZ4A 2CMGA 4OH7A 4YJ3F 4AJ9A 1VRCA 1K8YB 3KDSE 4KXNA 2A5FA 4UTXA 1EQUA 1NV9A 2ZR7A 4LPKA 4BC1A 1PS8A 4I36A 4L3VA 4EDHA 5LQUA 3I9V1 5K8JB 5HX7A 4ZEOA 4E15A 4XTRA 2RG7A 4OL0A 1BKYA 2UVPB 4MOWA 1P1HA 2O2XA 3BM5A 4TQGA 4IRMA 4NCJA 1F3OA 3C4VA 3RU2A 5HZHA 4JB8A 3WKAA 3CXUA 8ADHA 3S3TA 3LQ4A 3E2PA 2VDQB 2X5OA 4ES6A 5EEHA 1PR3A 1Y6JA 2ANBA 2CXQA 2VNHA 3FAZA 3GLHB 3IP6A 3BIXA 4IOKA 4JIGA 3ZVKA 2FDCA 4FOPA 1A9PA 1FFWA 4BKUA 4MMXB 3ETLA 3WLKX 2VJLA 4M4SA 1ARZA 1AV7A 4K7JA 5ALFA 4NX2A 2ZT7A 3REOA 1NHWA 2JKYA 4QTZA 3W5CA 2RGRA 3ZQKA 3VVLA 4WZBA 1VBFA 4LJ8A 3UUWA 1SBCA 2PKRA 1F1BA 1GWNA 5DHRA 3OJFA 4PZEA 4RPJA 1TZKA 1ZKMA 2A4KA 5AT1A 5EWJB 3MRTA 1EFRD 1L4BA 1LQUA 1C1DA 2OEPA 3BF7A 3OIWA 2PUGA 2JJ8A 2QM7A 1E1CB 4IFTA 3U19A 3ANXA 1E4EB 3WLFA 4EYGA 1TQ2A 1ZO8A 3DTVA 2GHRA 2O5RA 3WB2A 3WQSB 4KGVA 4LV6A 4WEOA 5D1HA 4E3WA 5EJGA 1R6BX 3QU5A 5F9MA 5BO5A 1SVSA 5IC5A 3VR5A 3AO0B 2ECQA 3BD9A 1S4QA 4N3AA 1R2QA 3LDFA 2AF4C 1H9AA 4LE1A 1SUBA 1EFVB 1OXMA 1T8PA 3B1ZA 3K1TA 4HN9A 1EHYA 2G04A 3O95A 5HF6A 1PE0A 3PQ8A 4D41A 3OPXA 1R1DA 1JFVA 4MLPA 4BLSA 1P72A 2GM3A 5KVAA 5CHYA 4MRRA 2C9ZA 3KB8A 3WMRA 4LF7B 4D98A 3JVVA 1BS9A 1ZDMA 5FL7D 2WTUA 2VJKA 1TM7E 4FX5A 1OYWA 4KRYA 5DW0A 1R9JA 4G0NA 4H3SA 3U26A 1NY6A 4E0BA 4MJLA 4BLQA 1N2CA 2QTHA 3AEZA 2ZIAA 1XU7A 2H1WA 4IV5A 4E7PA 3T12A 4C0AC 4ZKEA 1K5PA 1HQYE 3DWGA 5JBIA 1L7BA 4EHLA 3ZJUA 3TZ6A 4HAUA 5JZ9A 4IOLA 2FPIB 2HF9A 1RCTE 2L19A 4Q3AA 4BWVA 4FM9A 2XBMA 1K08A 4IJQA 4I5DA 3L1UA 3IQFA 4B5LA 4L08A 2J7PA 3PDJA 4MS1B 4TVKA 5DYYA 5D6NA 4MUHA 4FHGA 5JRJA 3TBFA 4QXOA 1ENZA 2QYSA 3AV0B 3M83A 4B31A 1I32A 2HQBA 3KZVA 3EHEA 1RWVA 1K0FA 4ZCSA 3PJRA 1X8JA 1CS0A 3O74A 3G1WA 1CUVA 4WNIA 2ZS7A 1I94B 1O5OA 4XIIA 1UDWA 3SC6A 1AHHA 4J2TA 4QT4A 5JDCA 3H2IA 2CXRA 4NY1A 4Z4EA 2G0TA 4K9PA 1PNTA 3FSGD 5HTKA 5FL3A 3K6JA 3BB3A 5T57A 1GR0A 2ZPAA 3GGDA 2V0NA 2ZREA 2PR2A 2WSBA 4NULA 3FHCB 2H1FA 5ILQA 2DMRA 2XQKA 3JY6A 3ICVA 4Q7LA 4DGQA 3LOPA 3P9CA 3N0RA 4ZO4A 2IHUA 5BV8A 3QPAA 3RVRA 3SY8A 1VI5A 2J0QA 4KUEA 4RKQA 1E3WB 4GMFA 4PQGA 2YJ4A 3WYDA 4HUQA 3IDSA 3Q9NA 3T5CA 4C14A 2HJHA 2QTAA 4TOIA 2IELA 3DLAA 1DQZA 3Q9LA 4CN9A 1YR7A 1A76A 5BOSB 1AX9A 2JD0A 5LIPA 1BVRA 4XX1A 3EGDA 3ZN2A 2AZTA 4JGBA 2PNFA 1QG4A 2WVAA 5EIOA 2FRVA 1U3VA 1XXHA 3CS3A 5I9SA 3UF0A 4C4TA 1XDZA 1ID8A 1M1NB 2IYAA 3LC0A 2P90A 2PMCA 4LY9A 4UUNA 4LYJA 3OX4A 3PFHA 2E4UA 3PCTA 1TAQA 1U9ZA 4NFSA 3W0LB 5HKBA 4I50B 1OKKA 3BMOA 4WCDA 5AHOA 2O8CA 4LG1A 2YHAA 2X15A 3ZLVA 3L7OA 4JENA 4BV9A 2I2FA 4A4DA 3MWLA 5K6AC 5EZ5A 3CQ9A 4OSOA 1IJKA 3Q7QA 3W79A 2H4WA 2KLHA 2Q49A 2CF6A 1KYQA 1A8PA 1DKRA 1FC0A 1SGWA 1TUGA 2CFIA 2O7SA 2IX9A 3DOIA 5GONF 2EWVA 5I6DA 5L7WA 1PL0A 2ZWVA 1NNEA 5ITSA 1VMAA 2H2WA 4DIOA 5EIXA 1J0XO 3OO0A 4MUFA 1N3YA 5IKEA 3RIGA 2X6QA 3DE6X 3O1IC 2QLNA 1I2ZA 5CLHA 2ZJBA 2C9MA 2QRJA 1T9BA 2M98A 3U4MA 3WLRA 5FWYA 1T9CA 2AK2A 3TD9A 1SG0A 1DIHA 2AXNA 4WOBA 1NVXQ 5B2FA 3N2IA 3EDOA 1QYXA 5C81A 2PUDA 4LOJA 1FNNA 4OB7A 1IXYA 1HRKA 3NBFA 2JFOA 3QWFA 2IL1A 4WCFA 2IU0A 4A23A 4DV4B 2ILVA 4QDTA 4BO8A 4CLOB 5GJVC 1JHZA 3F73A 3AM5A 2QBYA 3LXXA 1RCFA 3HRKA 4EHNA 4ZAYA 3SR0A 2QUBA 1J9ZA 2I33A 3JALA 4R9VA 1OYVA 4AMVA 4EA8A 3UGJA 4PBSA 3A3NA 2VHCA 4MS4B 5DIFA 3HVUA 3UWPA 4CCSA 1TJ3A 2VK4A 1ZEMA 3L3BA 5ENDA 1OXXK 1TMKA 4GH5A 1WCWA 1F4VA 4I66A 2VT6A 4L8FA 3F6SA 1IOVA 4IZOA 4V3CA 1A69A 1DJNA 2O2CA 4X91A 4ZC1A 2B1GA 1WD7A 4PONA 4UNNA 4FKZA 5GZ1A 2NOAA 1GTRA 4ZRMA 4D44A 3D3QA 4RIFA 4XPIA 1I2BA 1PGQA 5BORA 4TV8F 5AW0A 4Z1MA 4RBNA 3EDMA 4N3CA 3QJ5A 4ZQCB 5GINE 1Q0QA 2NVOA 2ZAOA 2RH4A 1W34A 2ZUUA 5JYCA 2GK6A 1WZUA 1LDYA 4AX4A 4YGXB 4KYVA 5TRTA 3HYLA 5JZBA 1KAHA 2NUTB 5JMPA 3RJ5A 4QNMA 3QBTA 3PA8A 3L06A 3X1JA 1F48A 2P0AA 3ANYB 1C0PA 3BEDA 1ZMBA 1QH8A 2A84A 1MX5A 1PI3A 2GBIA 4TUYB 4CTJA 4G2NA 2CNKA 4Q3LA 1PR0A 1IY2A 2G4VA 2VYVD 5GZ6A 4Z4QA 3ILHA 4D4GA 4QATA 5DX8A 3K70B 3RSQA 3PE6A 1B6SA 2LKCA 1GSOA 4K8RB 4ENWA 1FJHA 1QZ3A 1U5AA 1EP9A 4ZTUB 3PSAA 4MHOA 4LI3X 3SLKA 1XRSB 5JS8A 5LQDA 1QH1B 2JAOA 3TSYA 2OGWA 1CQJB 2CFOA 1WUJS 3PD0A 3CLKA 1I6MA 4RAOA 5HR5A 3F5MA 3PEEA 3AR9A 4RZXA 4CKBA 1WP4A 1EBUA 4A8JB 2Y0DA 3NJ4A 4LJYA 4DEVA 2VO1A 2CLFB 4ATNA 4WOPA 4LRQA 3TSCA 3WAJA 1MW8X 4MSUA 5C8YB 1KEVA 1GG5A 1VL0A 1X9HA 1XA4A 2EJCA 2ETVA 4IHAA 4F4JA 5K3EA 5KNLA 4K81B 1PKXA 1RC1A 1XZLA 3OPNA 3VH4A 1ZRNA 2CYBA 4OBWA 4W8GA 4WFQA 4C5CA 4EPWA 1SC3A 1ORVA 4Q1FA 1B0ZA 1L5SA 4JYMA 3LUFA 2GJ9A 5AXBA 3QEBZ 3HVHA 1QDLB 4FE4A 1XHFA 5GMOA 2RHWA 1Z5OA 2I8LA 3LIIA 1TJPB 5EN4A 3NHYA 2Z6VA 1MF7A 1SA0B 2FFHA 2AT1A 1Q17A 5BWNA 2JJQA 1OFIA 1M8JA 1ILEA 3E48A 4S1NA 5I4BA 4I08A 1K27A 4HWTA 2I7XA 1YQXA 3BN3A 3T0IA 1PFKA 3PF8A 5FHRA 2UZAA 1GO2A 1K86A 3MUFA 2H07A 4QLAA 4B2LA 5H9WA 1RZVA 2I3BA 5DEOA 5A9SA 1M1YE 4UREA 2VIIA 2XNDD 5GVSA 5LMCA 1A5BB 1DWQA 4RCZA 4ABTA 3OKPA 2K7ZA 3L0YA 3MAJA 5CVJA 3WLHA 5CD9A 2JJ1D 3MOSA 3VYSB 5ALKA 5BN4B 5AW6A 1OH6A 1J8YF 1FXSA 3H86A 2BDEA 1RS0A 1Z7WA 3AB8A 3IVMA 4KB5A 2JAHA 3SKXA 3G89A 3RJ9A 3TQRA 2M9MA 5BP7A 5AVOA 2OV2A 3OQBA 1SBIA 3F5FA 4XASA 4B9EA 5BW8A 3K9CA 3FHTA 4FSDA 4BUJA 4ZMBA 3FMOB 4X6LA 4GX5A 3U4GA 5IVKA 5DOVA 3VPAA 1NSYA 4DY6A 1K6EA 1OROA 5HKKA 5K0ZA 2BF7A 4H16A 2N9UA 4QVIA 3BS4A 3GLFA 4X7RA 4HMOA 1NKTA 5I7VA 1U9JA 3G68A 1S8AA 4FSXA 3GT0A 4KOAA 1Z2CA 4EMTA 3ZE9A 1A9SA 1ESNA 3CNNA 3HEBA 2ENWA 3DO5A 1KDRA 5EUBA 3B36A 1UODA 3R7BA 4HNVA 1FB5A 1G8SA 3KU1A 1DRJA 3KYCB 3ZVRA 3AXTA 3N58A 1JU9A 2JEZA 1KO1A 3CNOA 3INTA 3MPUA 4IWYA 3IMKA 1VE9A 2HJ9A 3PNQA 4L3WA 4TS3A 5KU7A 1JR3A 2DFTA 5JNVA 3QVTA 4UASA 3ZCUA 1U1IA 1RQLA 4M9SA 3BGWA 3TVDA 2R44A 4CV2A 2DTEA 4HRYA 4C0KA 1GP2A 1G4UR 3BWXA 1TT5B 1RWQA 3TVTA 2HXGA 5AM5A 1GTVA 3P26A 5SV2A 4AG6A 1FMTA 3NU1A 3ZDDA 1XJQA 3HK2A 4JI7B 1O87A 5D84A 3W3ZB 1Z2EA 4ZVSA 1T2VA 4ITVA 3G7UA 3OSUA 1TU0A 1OFGA 5ERGB 4TMXA 5CG2A 3FDXA 2VOJA 3NHJA 1SCBA 4KWTA 4CL0A 4JI8B 2WJWA 2EYUA 3O3NB 3SEFA 3SJBA 5LR6A 1RXCA 2FB9A 3THSA 4GQAA 4DV5B 1G38A 3K3PA 3VKHA 3V2UA 1H9BA 4KEAA 3VSEA 1L7EA 1PHRA 1I30A 3DOCA 2BFDB 5TNXA 3T3GA 4B9AA 2PVSA 5KVSA 2XB9A 3BHNA 4TKVA 5HOQA 4URVR 5KOIA 1PJ8A 1YS1X 2I34A 3BAZA 3I1YA 2ZSHA 3PX2A 4GC9A 4R2KA 2R87A 1TJ4A 2D74A 1K92A 1O2DA 1XQ9A 3SICE 3ZGYA 2OENG 3IJPA 5EE1A 1TAHA 4KWHA 4KXVA 3BILA 3PC8A 4O02B 2FJ0A 5A71A 5J4HA 5IS2A 1GL6A 1Z4QA 3ISTA 2V7EA 3JPYA 3OETA 4J91A 4PYRA 4BFVA 2JFGA 4GEKA 1MG5A 2L69A 3Q6IA 1M0WA 3FMIA 4ND4A 1S02A 3R4VA 2FAXA 1F20A 1V6AA 3FHOA 4RLSA 2JK1A 3IP8A 3HI6A 1FS4A 3QF4B 5CNMA 3CMMA 3WXMA 3I2YX 2NZ8A 3QKRA 3ONEA 4U9HS 3DF9A 4C2BA 5CB4B 1BMTA 5J58A 3WLOA 1JEJA 4I8DA 5CLFA 3CWZA 3U3KA 4JQZA 3OU7A 1CDZA 4B3JA 4EDFA 3K9GA 3OFKA 4RA6A 4F1KA 2E4YA 3GF4A 3GEBA 5CA1F 1G4AE 1KJWA 2RJOA 3WLAA 4QOIA 3JAKA 5BUSA 1P61B 2R1TB 1FYEA 4LYFA 1T5OA 3PXDA 5FOXA 3UAGA 4JWTA 2Y4NA 1SBNE 1S0UA 1X7WB 3GAAA 4QDOA 3I83A 2XXJA 4Y2HA 1YH3A 3PPYA 2CD7A 3IAS6 5B53A 2WTXA 1BMQA 1BVUA 2WF7A 3BGIA 1MQAA 2EZ8A 1TPYA 4RY9A 3WLJA 4UFNA 1ZL2A 4E6EA 4UE2A 3YASA 1PQYA 4JXJA 1ZD1A 3VZSA 1RKBA 2EGGA 2ZPUA 2P8JA 4CBVA 1OR8A 2WHRA 1T13A 4W82A 1A95A 1SELA 3H5TA 2OBYA 1YJCA 1Y9JA 2DWUA 3QVVA 4MS3B 2MWMA 4RTSA 1X7WA 1EWKA 5CFPA 3FDZB 3V3TA 2DFVA 2PRKA 2FEMA 3JS5A 3ZW8A 1CY1A 1DXQA 4S1WA 2QR2A 1C7RA 3FR7A 4Y2PA 1WOMA 1XZAA 2HJGA 3DULA 1W4CA 4B3HA 3E9CA 2QU8A 2CNBA 4GKVA 2CN1A 4LZAA 2ID9A 4JT2A 1PTKA 1SQFA 4Q4HB 5AQ1A 1JDJA 2DQKA 1J0BA 4NZPA 2BM8A 4BGUA 2Y9MB 3LFTA 1U90A 3FWZA 3P8ZA 4DLRA 1VE7A 4X66B 2BM0A 3OQ6A 4MCAA 4WXHA 3OCYA 4MH0R 3FMPB 4K9SA 4N40A 3PUXA 5F5LA 3DC7A 2Y77A 3OIVA 1C7FA 2EGHA 2IOFK 1L3CA 1S4MA 1SRQA 4HWRA 3PXXA 4E11A 3P71T 1UBMS 3QXXA 2O2JA 5L7TA 3KOOA 4DV7B 1ZN7A 1SQ5A 3TB6A 5IVIA 3A0UA 3AZOA 1M75A 1Y9EA 4PS0A 3RODA 3MRSA 4DEYA 2YOFA 4FNOA 1EVLA 1EFCA 4TWAA 4OXKA 5D5PA 8LDHA 3OQVA 1KWGA 3A3KA 4TPKA 4OY3A 1YQDA 2F55A 3A1FA 1UDBA 3E7FA 2VHJA 4QFDA 4ZYUA 1XELA 3A2NA 3C3KA 3V8BA 3KSBC 5D87A 1JEQA 1N6HA 2RJ3A 2WVJA 4ILEA 4O4IA 5CNJA 2H00A 1XQYA 5CR9A 5EXPA 3TMYA 4V3BA 2FPGA 3OTOB 4FN5A 3FVVA 4TWIA 1FUUA 1YNSA 4EUKA 5LIRA 3B85A 4B82A 4LXGA 4UAVA 5I7RA 4F93B 1DBPA 1ULHA 2GNPA 1KQNA 5KJ6A 5KOJA 3DT8A 2VNAA 4B6OA 1BNCA 4YC7A 2WMNB 1TZ2A 4KGXA 4BX3A 3N86A 3JD4A 3HCPA 2BI4A 1Z6ZA 2PBLA 3JQEA 3ETGA 1CXZA 1W0KA 2OD7A 3RI3A 1YBMA 5FBWB 1RQ7A 5M5BA 1U4SA 3MHTA 1B7GO 3BIOA 2A9QA 1C7EA 4TTVA 4ZTZB 1HYBA 1XKTA 3IRVA 3FBWA 4MUMA 5GV7A 2BZ1A 1FF9A 1ZJ4A 4DJJA 1VPTA 4TS9A 5AJXA 4TRJA 3T61A 3B8HA 1SCUB 2J7PD 1TEVA 3LU1A 4MWGA 3H2ZA 5H4HA 1BU5A 4INJA 2IYWA 3UMRA 3D1LA 3FFXA 1NOKA 3GQBB 1IHPA 4BVLA 4CMIB 1JR2A 5FA6A 3EZLA 3H1GA 4PAQA 1RXEA 1NQTA 4QJIA 4MZDA 3TLMA 4AZSA 3DXYA 3AVQA 3F8TA 1WPXA 1AOXA 1EWTA 4GR5A 1KEWA 4RIGA 3SMVA 4W9NC 1YR2A 2C99A 4KRFA 2QTMA 4YASA 1U3TA 1J8QA 1R37A 2P3OA 4BKPA 5KTMA 4LCEA 3VZQA 5KOYA 1QHFA 4ND7A 4KVAA 2W2OA 2HQ1A 5BSUA 2VDKB 2Y6UA 4OLFA 2ZT8A 5BN4A 2CV1A 3FROA 5DKFA 3CRQA 2D0OB 1ECFA 4JASB 1YACA 1WEKA 2J7KA 3B20A 3CW9A 3FOBA 4P3YA 2J45A 4ZAWA 1AUXA 4ARSA 3DNFA 4D9KA 4DG9A 1IDN1 3LJKA 4TXMA 2QK4A 5JZVA 4CQNA 3ZHXA 1G21A 1XPJA 3B6KA 4JLWA 3NGLA 2GI4A 2VTVA 3QELB 3T4XA 1Q1NA 5DSTA 1XTTA 2BJVA 2ZGVA 4C2TA 2WU3A 2JAPA 4KN9S 1I7NA 4CI9A 4CQLB 5HKAA 4TSFD 4TXLA 2XNJA 5CH5A 1MHTA 2ZWOA 4O3MA 1SA0A 1O97C 2HRQA 1RXVA 1QIFA 1XU4A 3LGAA 3L8FA 4K1XA 4K9KA 4LTNA 4W1SA 2HQSA 3L77A 4BTLA 1NRXA 3A6HA 1AF4A 1GPLA 1DKOA 1FCJA 2X2OA 3ZHCA 4UMVA 2J4FA 1IM2A 1VMDA 1W73A 2FW7A 4R1SA 1RM0A 2HF7A 3NUZA 4XDYA 5AHRA 5GGYA 3TPFA 2ERXA 3BDAA 5ADHA 1RJDA 3GFFA 1M6NA 3CLRD 1YF3A 1AD2A 1E9RA 2YL2A 3PNBA 4NBWA 1UFKA 4MW6A 4CEJA 1PWZA 2W8ZA 3W5DA 1JDNA 3U6BA 1XHEA 4AKEA 5A5GA 2YIDA 5BWBA 1POXA 4HNHA 3K2QA 5JYDA 7MHTA 1LDBA 4ALKA 1X7YA 5JQWA 1FY2A 4BVFA 1U2SA 2Q6KA 4H7IA 1ZM2A 2HLDA 3WKEA 2YJ3A 1QH1A