5IMLA

Nanobody targeting human vsig4 in spacegroup p212121
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain-containing protein 4
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imlA00
4NZUL 5LBSH 3GJEA 3GBMH 2BRRL 3KS0J 4NQTA 3ZKSD 4D9RD 1QO3A 1RIUL 1QHPA 1A0QH 2OR9L 4LVOC 3GSOA 1F2QA 2FGZA 1MCHA 4G8FA 1A7OH 1OAYH 4LCCA 1YMMD 1X3DA 2AXJA 1EFXD 1R3LB 5CSZB 2CH8A 1T1YB 5D1QC 4X7FC 4OFIA 1YYMH 3TO2B 2HMIC 3MRQA 3TV3L 3ARVA 5DJYA 4D3CL 3RA7H 2RHEA 1EO8L 3V6FB 4TTDD 3IGAB 1KV3A 2ARJA 3ARGD 1H8SA 1IGFH 3BEWB 3H8NA 3K2MC 3KAAA 4RGOL 5I16B 2MPAL 3T4AB 1FLRH 1JZ5A 1A6ZA 1KJ3H 5HDBE 5C0JA 4GAFB 4HBQA 2BX5A 2CXGA 3G04B 4NHCL 3QUXB 2XQYG 5IW6A 1K5NA 1H3PL 1RY7B 3EOTL 2IJ0C 2YS4A 1Q9KA 2DL9A 2GT9A 5I9QB 3U4AA 4X6CA 2E7CA 1XAUA 2ESVD 1U3HC 2HRPL 4JREC 3CJJA 1KUMA 3TJHD 5C9JA 4PJ9C 2DBLH 3QFJD 3WNMA 4G6MH 3H9YA 4G3YL 3FT3B 3HE7C 4G6AD 4N0CD 1LP9F 4ZFFA 1RHFA 3I6KA 1S3KL 1C7TA 1UA6L 1Q72H 3AB0B 3HE6A 3ROLB 3K1DA 2FB4L 4L29B 4PYHA 5K9QG 2EIZB 5B38G 4GRLC 3SDAC 1EMTL 4NCC2 3BPCB 1ITCA 1ONQB 2AEPL 1HXMA 5I1KL 4KROD 5IHLB 4P49A 3UTPD 4V2CB 2ICWJ 5DMKB 2C3GA 3B5GA 3WE6B 4FQLH 3HPJB 4HWBA 4HK3N 3IFOA 1S7VA 1BQHB 4X5XB 2AK4D 3OV6A 1TVDA 4F15B 5J6GB 4UIKH 2V2WA 1ACZA 5KSAB 5HBBA 1NDMB 3C5ZC 1VGEL 5D7JD 1A9EB 2DF3A 3RWHA 1OGAB 2GTWB 4L5FH 4LSQH 5B39A 4ZNEE 4L4TA 1CICA 1SBSH 4KQ4H 4PGEA 4TOYH 1CLOL 1U2HA 3G08A 5BV7C 4IIQA 3RBSA 4LL9A 5A2KH 1YNKH 5MEPB 4RGNE 3L5XH 3V4VL 3VFTB 2VL5B 2F15A 3QPXH 4EDXA 3ARGC 3VXSA 1UACL 5D7IB 3M1BB 1Z9OA 2E7MA 1CDJA 1AXSB 5L88H 4LSUH 3O8XB 3U9UB 3I6GB 4X83A 5EU5B 5BRZB 3U4BH 3HZKA 2EDWA 3BJ91 2P8PA 3OPZH 4MD4B 5E00A 4ZTPH 4LLVA 2A9MH 4JJHA 2IFFH 1EGJA 3MSPA 1SYVA 3MJ7B 1FZKB 5ETUA 1SHMA 5F9DC 3P9LA 3MJ9H 4UB0H 4F37K 2CO6B 1GHFL 1TQCC 5E94A 5I66A 4KGJA 5TE6H 2Y1VA 1G84A 1JL8A 4MA3A 2IBZX 1T5WB 4I2XB 3GUTA 1NLBL 3NFSL 3VXMB 3VD5A 3JV6A 3K8LA 1B2WL 4WRLA 5K93A 3P77B 3STLA 4FZEH 3TJHC 4JO2L 3JVGA 1OAUL 4HIEA 4U1LA 2H41A 5DD6A 5INCB 3PABB 2ADFH 3OKYA 3S98A 1CYGA 2OR7A 4G6AC 4N0CC 1TNMA 1XGYL 4PJHA 4LSRH 4XC3H 4JPWH 4Z6AT 3CSYA 1XF5B 1DBKL 4NC0B 3UJTH 1X4YA 3ZTNL 3L3GA 4RDQF 2AXFA 3EDEA 4LOUD 2P5EA 3EW3B 5F93C 4ORGA 1RZFL 3JWDH 4TSCH 4M6MH 1PDKA 3PQYB 2XWBA 2CR6A 2RQ8A 3F7YA 1J88A 1VHPA 3DTXA 3PWLA 4XTRC 1JHKH 5H2BB 1IGIH 1E6OH 2O93L 4AYFA 2X41A 4QYOB 5GRZA 1KIPB 1NCBH 3HUJF 4RWYL 2BNQB 5C92A 3NTCL 1A7NH 3LCYA 3MJ6A 2MSPA 3PWUB 2ZG1A 3V6OC 2D7QA 4ZUWA 5D1XA 4DQOH 3KYNB 5JXED 3LVEA 2GFBA 3PWNA 2QKIB 2HVJA 1DBBL 3BH9B 3PXJA 4C83A 4OFYD 3U4EA 5F6IB 5BS0D 3DO7B 4YXLL 1W8NA 2YRPA 2MCPH 3WEXA 3V4PL 1BFOB 4N8VA 2CQVA 4N68A 3UYOD 3MBEA 1CIDA 4X9FA 3GB7B 3K8MA 4PRHB 1U36A 4ELMB 1KPUA 4H20L 5A1AA 2H1PH 5ADPH 2XNAB 4WW2A 1AFVH 5E8PA 4CDHA 1EVTC 1ZHLA 2R9HC 4NQSB 4KI1A 1GJIA 1CDIA 1U42A 3FZUC 3H9ZA 1T4KA 1Q9LA 2ZOKB 3Q1SL 2AJZB 3MRBB 3RTQA 4QOKD 4NFCA 2Y7QA 1JIBA 1WWBX 1I7TB 3SGJC 1UQSB 2IBZY 1T1XA 3M8OL 4WGVB 4YNYB 2XA3A 2YWZA 4GXVH 2YPVL 2W0PA 3IXAA 5J13C 3DX6A 4K3HA 3SOBL 1G7MA 5DUBB 3OKLB 1GGIH 4Z5RB 3DXAE 4M1CC 3MLVL 1D5ZA 4F57H 1I3GH 2Z93A 5A3IC 4KKBD 1S5IL 2CKNA 2A74B 3KLSA 3CLFL 3LIZH 2GY5A 4HUVA 1CVRA 2W0FA 1VGKB 1WTLA 4KDVA 1BREA 3F7QA 4B0MM 2X7LA 3AM8C 1PZUB 2X4QA 1LEGB 15C8L 3V5DA 4LOUC 3UAJD 4F58H 4H5SA 3VFUB 5T3XE 4PYGA 3TBVA 3AMLA 4NBXB 1LEKA 3EFFB 2F5BL 3WUWG 1ORQA 1NMCC 3HNSH 2DYPB 1R5WA 4Z76B 3RY4A 5I1HH 2A77L 1IGJA 4EUPH 4PLKD 2W9EL 3DVFA 5DLMH 4Z7NE 4DCQA 3O9WA 1RUKL 1KB5L 1MWAA 4HKBB 5IF0B 3PNWA 1F8TL 4YFDB 3VXRB 4JFYA 5GGTH 4NQED 5HHOD 2HN7B 1DQJB 1RK0A 3CLEL 2QSCH 1PX4A 2R2HA 5GISL 1VFBB 1WBYA 4LSVH 4R26H 1KEGH 1NFDE 1NGYB 3PV6A 4LMQI 3TH4T 3FFCE 1KBGH 4EBQH 5E2VH 3MV7B 4JZJC 2F9BT 2HAZA 3KGRA 4P5TC 1FL6A 2NXYD 4OBSA 5CSZA 2D3VA 1U0QA 1RPQA 1T1YA 1ED3B 5EO9B 3V5HB 2Z92B 1FVCB 5A2FA 1R6VA 4P9ML 1NEZA 3EDKA 2F5AH 4DUWA 4M1GL 1CXLA 4J4PD 1H8NA 3I2CL 4JR9L 3WLWD 4GMTH 2OX5A 3E3QE 4GBXB 1FCCA 4NHUB 3SO3B 2AQ3A 4MDIB 4WI2A 3DYPA 2BOBB 3H3BC 3IGAA 1NAKH 1X5LA 4CVXA 4G5ZH 4U49A 1CQYA 1KXQE 4DGIL 3QQ3B 4IS6B 5EN2B 3WHE0 1BZ9B 5I16A 1MIEH 3R8QA 3T4AA 4PJEF 4D8PB 3VD4A 4BSWB 3RUGE 5HYQB 3K80A 4LIQH 2FJFB 3C9NB 2BOCB 4HCRL 1CD0A 2BHZA 4LAQH 2AVGA 1DLFH 4I3RL 5K33A 4V1DD 1HI6B 1OD9A 3ZTJH 4MLSA 5EBMA 2IPTH 4KPHL 1A1NA 2AEIT 1HILA 3QI9B 4MQSB 1TTGA 3S36H 4LEXH 1I7ZB 3DV6A 5JPNB 1UB5B 5ITBH 5ESAA 1KFAL 4ZO8A 5IB3B 3UAJC 1MJ8L 4I77L 3KXFD 4U6TA 1CDCA 4TYUA 1WV7T 2A6JA 3MRNA 4YC2B 5TQ2H 2HFTA 2E9BA 3C2AH 3K7UA 3ALXA 5JUEH 3N9GL 4AH2B 5FM5M 1I8LC 4BQ6A 4YE4H 1KJ2A 1FHGA 3QHZL 2P1YA 4OLXH 5LCVL 2CLVB 5FYLE 5TDOB 5EWIL 4DN3L 5FGSA 5DRXA 4NQDE 3VXUE 3I9GH 5F96L 1V05A 4CNIB 5MERB 1BM3H 5I1AB 2AEQH 3IKKA 2APWA 5C2UB 4M7LL 5KJRL 3WE6A 3VW3L 4ETYA 2ZG3A 1BQHA 2FYYA 3MGTB 5DHYB 1OTSD 1JWMB 1YQVH 1N6UA 2W60B 3MR9B 4JG0H 4XNXL 5FGCE 1NDMA 1Y18A 4NC1C 5E2TH 5JNYA 4PRDA 4KVCH 4P5KA 1TZGL 1U91B 3GMMB 1A9EA 3MRFA 1IGYB 3B9AA 2NXYC 3GI8L 1VEPA 3ARDC 1YEEL 4LPYA 5IOPB 6FABH 4F9LA 1NJ9A 2GHWB 4G7VH 5B39G 1R3HA 1EFXB 5I1CL 3N1FC 4PJXE 5E5MA 4YXHL 4J4PC 3MCLH 2EDHA 1EVUA 2Y07L 3HLAA 4O2EB 5MEPA 1WZKA 3R1GH 2C7UB 3VRLE 1NC2D 2VL5A 3TVMB 4GRMA 2COQA 1TJHL 4PBWD 3L7EA 2VR9A 2LE9A 5D7IA 3I6LD 3M1BA 4GRWE 3GMOB 3DO3A 1CWVA 2W92A 1AXSA 4NFDA 4Z78B 2D4DA 4NKMB 3LOWA 4TSAH 3HNTL 1CL7L 3I6GA 3KLAB 3RQ3A 5BRZA 1INDL 4MD4A 3WIIH 1KN4L 1K3IA 3MJ7A 3TA3D 4RMQA 2R1YB 5J3HC 1HINH 2CKBA 4HFWA 4M62H 2NYYD 3GHBH 5IWLA 1U8NB 4PREA 5DHXB 4DVRH 3MCKB 4APQC 2HJKB 4QGTA 5GRVL 1FIEA 1J5OL 4NC2B 5E9DD 4P2RE 1H3UA 5I18L 4I2XA 4YEEA 4XC1L 3OJMB 4ZSOA 3VXMA 2Q76A 1BJ1H 5C0CB 2K7PA 2P5WE 2WUBH 2Y36L 4NO5B 4PBXA 3NPZB 3HCVB 5D71H 5K9JL 3AS1A 5INCA 5BO1H 5CHNA 2BVTA 3K0WA 5HYSG 1T7ZA 3QYCA 4ZAKA 1DEEB 4RBPH 3GSVA 5JW5B 4NWUL 2D9QB 3BI9X 3GMQB 3P4NB 4PG9B 5D70L 1XGTA 1XF5A 4IRZH 4U1NB 4GW1A 1HQ4A 4ODHH 3ARWA 3VMPA 3QR2A 4XMLL 4I0PD 5ISZD 4U7MA 1R3KA 4QXUH 5C0AA 4UQ2B 2QV2A 4HSQA 3UTSE 5FYJE 5H2BA 3MQIA 1AKJB 2M1KA 4QRRB 1PEWA 4NUGL 1EEYB 5C2BH 2VIRA 3RKDD 3GSNH 2DD8L 4Y4FB 1HHKA 2NY5L 2L4OA 3JSSA 4HKZB 3X3GL 4P2QA 1FNLA 2VDRL 2A6IB 3PWUA 3PL6B 2G5BB 2V7HB 4XGZA 1UZ6F 4NJ9L 4X9HA 1N7MH 2H8PB 2JJSA 4JRWA 4F3FA 1DFBH 5CD3A 4M6OL 3BISA 2R0WH 5JQ6L 1KLGB 4LGPB 5EOTB 4M93C 2GJ6D 3VXNA 3ALWA 4XVJL 8CGTA 1VKXA 1J86A 3VRJB 1KCSL 2D7NA 1BFOA 3U0PB 5IHUL 3WO4B 2AXHA 3PDDA 1WBXB 3DYMA 3G5ZA 1DBAH 1RUPH 4PRHA 3RNQB 1BFSA 4N8VG 5TGBB 4BZ2L 2OSLB 5KOVC 2XNAA 1T04B 3TA3C 5E8EB 5LJYH 1AGDB 1MNUH 4P9HH 1JRHH 1OPGH 1NBZA 2VLRE 4M61B 3QG6B 3SQBA 4W81A 2R2EB 5FHBL 4W4OC 3MRBA 4PJEB 2AJVL 3ZDXF 2X4RB 4LVHB 1I7TA 1UQSA 1BF2A 3E2HC 4HBCL 1J8HE 2X1OA 4G80B 3PHQB 4YNYA 3CMOL 3SDXE 3D3VD 1N6QH 5E7FA 1T1WB 4NN7C 2XV6B 5DUBA 4HH8A 4D0DA 4AQOA 5EZOL 4Z5RA 2Y5TA 1NCCL 1Z0NA 5H37H 2I26N 1NGWB 3Q3GA 2QADD 1ZHBB 3WFCL 4GOSA 3VMNA 5AZ2H 4LGRB 4AIZB 4J3WA 3LPFA 5IJVB 1N0XL 1A3QA 4KGLA 1LEGA 3W0WE 1SJEA 3HI5L 1RMFL 1MFCH 5I19H 1LP9A 4H8WL 2E9WA 1YN6B 4MCYB 4PP2B 4R3SA 2P45B 4P2OD 1PY4A 4X5WB 5DZLA 1J87A 2NY2D 1HOCB 3VFUA 3B2VL 2VDNL 3BDXA 4XP1L 1RJLB 4Z76A 2NY7L 5HYJE 2QLVB 4Y4KC 3ZT6A 3IFNH 1NBVH 4L8SC 3S97C 1SJHB 2WWKT 2OL3A 4JFFB 5JW3H 3SGDH 4QRPA 4NKOB 4LASL 1RZ7H 3V0WH 4RGNB 4KHTH 3VFPB 1CLZL 5D2NC 3VFNB 5C0NC 1TZHA 2IAND 1DQJA 3AU1A 2GSGB 4DN4L 2VSCA 5FA4A 2X4NB 1GGBL 4XPAH 5C0BB 4HGWB 1OD7A 4NO2B 1VFBA 2IG2L 4UOW1 2VC2L 1X6NA 2Q20A 1NGYA 1SJVA 1NCNA 4JJ5A 5FGBA 4K71C 1W0WB 4PJCF 2X05A 4DUVA 3MV9E 5IUSA 5EO9A 3V5HA 2Z92A 2LAGB 4JM2C 3MRIA 4Z7VF 4C54A 5IQ7L 5D1ZD 2NPLX 3FOMA 3IDMB 1CE6B 4LMQE 3CSBA 3G6JE 2DWDB 1TJGL 5J06A 3FHAA 3O6KL 3BKCH 3FQUA 4MDIA 4YZFF 2HH0L 4U7SA 4XX1G 5LGKA 3VD7A 1HYSC 3ECBB 1P1ZA 4KY1L 3SDDD 2BOBA 4JN2B 5CEZL 1EJOH 2D7MA 5DVMA 2KPNA 1JPGB 4NZDA 4Y2DD 3FB5A 2OZ4H 3FJTA 3SGKA 4IS6A 2CLZA 3GKZA 4JLRB 3U82B 3MRKB 1E4XI 4D8PA 2HJFB 2G9HB 5HYQA 3KJ4B 1BQLL 3F58H 2FJFA 3C9NA 1DVFA 2BOCA 3OXSA 1G9EA 3N1MC 3UYRL 5HGAA 1CXHA 4PPTA 1HI6A 5SWQB 2FZ3B 3SQOH 4RFOL 3PWVB 1FL5B 4K7PX 5EU3A 4RNRA 2YC1A 3BKJL 3EJYC 3QI9A 2D7TL 4OCRH 3WXWH 5ID1B 1MI5D 1AI1L 3L9RA 1I7ZA 5JPNA 1UB5A 4QY8B 3MJGX 1MCSA 3HI6L 5KVGL 1G7QA 3TBSB 5KVDL 3TC9A 4R0LB 1JZ8A 4P2OC 2BMKB 1CFVL 5FHAL 1BEYL 2NY2C 4D2NA 5EO1B 1VFAB 5GRVK 3C8KB 3MUY1 3CC5B 4MAUH 2OP4H 4GT7A 5IP4A 4U31A 4YHPB 2OLDA 1VEOA 5FV1L 5FUZL 4GO6B 1D6EB 4M4PA 2CLVA 1WJ3A 3B83A 5EUKA 3A6CH 2OTWB 3GHEL 4JM4L 3UTTE 2ZCHH 4ZUSB 5IFHL 5C08D 4CNIA 5MERA 4DZ8B 3D69B 3PP4H 1CN4A 5I1AA 1PW3A 3KDMB 4JFDA 1KF9B 3NA9H 1XH3A 2I9LB 3T4YB 4G8IB 3T3PF 3SE3A 4NM4H 5I1EL 2ERJC 3ULUD 2VO5A 5DEZA 2HYMA 3HUJA 4OGXH 4RGMB 3KYOB 4IMLB 2W60A 3MR9A 4DEPB 3MOAH 4P3DB 1BQHG 4IOFD 1U91A 5FYKU 3ZZ1A 2BXYA 4ONFH 5IOPA 3HPLA 4OZIF 3L3IA 1RZKH 4IHOB 4D94A 2OK0H 2EDOA 2QBWA 3L1OH 1EFXA 5T3XL 1X5AA 1GCFA 2GJZB 4P23D 1OOAA 4O2EA 1DQQB 3JV5A 5C07E 3V8CA 2C7UA 3EYVA 2R4RL 5I75C 5EZJB 1S8DA 4NKIH 4JZOB 1F58H 5SWZE 3SDDC 5DMGD 1F90L 3MGAA 1I1YB 1EAPB 3K4AA 5D2LE 1PAMA 1UJ3C 5DC9B 2BNUA 3P4MB 3DXAB 1Q0YL 2W9LA 3SE4C 5DD0H 1HHHB 4NKMA 2D9CA 5F9AC 1IZKA 1T2QH 5T1LD 3QB7C 2H26A 4OFDA 1LHZA 3FTGB 2HFFB 4YX2H 1DQML 4LCWD 4PGCA 1P84K 2R1YA 3MRMA 4A2LA 1U8NA 4EI6B 5IVZA 3UPRA 2BVPB 2EE6A 4K7PY 2X5PA 4V1DB 5ALCL 5GRJL 1YJDH 4FOMA 4WUUD 1KIRB 1S7XA 3NCJH 4W6WB 1PY9A 4M43H 2W1NA 1MCLA 4NO5A 3F6IA 5MP6H 2Z8SA 2YUVA 2FJHA 3HCVA 4HIXL 1CDUA 1P7QB 1DZBA 3VWJB 3S96A 1ADQL 3BYYA 4N9OB 4GKZA 2FGWL 5JMOC 1DEEA 4ENEC 4WI8A 1QA9B 1A6UL 3D48R 1B3JA 1DUYB 1LO3H 2BCKB 3GMQA 3QFJA 1ZLWH 4PG9A 1Z3GH 1AE6H 3QULB 4QTIH 4HIJA 1MVUB 1D6VL 1RUQL 3SCMD 4U1NA 3LN4A 2ZCLH 4OSUH 4WEUD 2DQDL 2JLLA 4CMHC 3RAJL 5CJOL 4LRIA 2NX5E 3HC0B 1NFDB 4D9RE 1BFVH 5BVPL 3EFDH 3FFCB 1G9NL 4F2MB 4LRNH 3REVA 5J57B 4ISVB 1OF2B 2P7TB 5E8DH 2AJUL 2CRMA 1T3FA 4BUGA 3ULUC 1QBBA 4QKXB 1YMME 3IDXH 2ORBH 4LP4A 1BD2B 1S7SB 1QFWH 4TNVF 4MAYC 2DJSA 4OLZH 2DI7A 4OQ1A 3SKNB 5KTEH 1FIGL 2DM3A 1FZMA 4QRRA 3NIFF 4ZO9A 4IOFC 1WWCA 1EEYA 3S37X 1CLCA 2AK4A 5E4EC 1UKSA 2O5YH 5DFVC 5I1GH 3UJIH 3TYGH 2VDQH 2H32H 3IDJB 5F9JA 3BPOC 1QYGH 1GIGH 2AGJH 1IQWH 3VU2A 1EPFA 2FHFA 2A6IA 3IU4H 5D7JA 3AUVA 2H8PA 3ULVH 4GG6E 1F6LL 2C26A 4X8JB 1MJ7L 1KLGA 3BKMH 1C08B 1EEUA 5EOTA 4O58H 5GRWA 3EKCA 4RAHA 2DTML 2YD8A 3WDIA 4TULH 5DMGC 4CU7A 3TZVC 4Y5VC 1RFDH 2Z31D 4RSVA 5HD8C 3VRJA 4LKXB 4HLZG 2ARJQ 3FONB 4S2SB 1WBXA 1IC7H 4XWGL 3IT8D 4HPYH 3E1F1 2R39A 2Y6SC 1KC5L 4OJFH 5FOBA 3BRGC 1AGDA 1QRNE 1LO0H 2PTTB 3DVIA 4K7PL 1P4LB 3LEYH 3LB6D 2ESVE 3ARPA 3VFGL 5KN5B 3QXDA 2HKHH 2I60H 1A7QH 4PJEA 4LAJH 2J88L 4KK9D 1Q9OB 4M6NL 3IS0X 5C6TH 5F7EL 2R23B 3GJFH 3OJDB 3S3PA 2O5XH 4FQ2H 2P47B 4LARL 4CMMB 3U7YH 35C8H 5GGVH 1T1WA 1MAJA 1KEML 4OV5B 1DBJL 1N5AA 3B6SB 1A6VL 1EV2E 1NGWA 1IAIH 4FRWA 2G75B 4NQDB 4BQ8A 4YH6A 5CIPB 4AIZA 3MRDB 2AJSH 3JWDC 3SCMC 3UTPE 4POZD 5D4QA 1KCUH 1T20A 4U6XB 3BSZH 3T8XB 3T2NL 1QR4A 3MGOB 2X4SB 3DMMB 1UEYA 1YN6A 4MCYA 4PP2A 4X5WA 1MCOL 3B3IA 3WN5C 2YN5A 2M26A 1HOCA 5IG7A 2DAVA 1S9XA 1UWGH 3EYUL 3TCXA 3F7PC 1QLFA 1MRFL 1P84J 3UC0H 4G6FB 2Z4QB 3NCCB 2W91A 2I07A 3F5WB 5HY9A 4IMKC 2FR4B 4NIKB 5I8KL 2WK2A 3B5TA 1RIVL 1SJHA 5I73C 3V6OE 4KJYB 4JFFA 2DS4A 1G1CA 4NKOA 3I50H 4WUKL 1OWWA 1FRGH 4P3CL 2CDEA 5HGDB 3VFNA 3ULUF 3QCUL 4Y4HC 5DD5L 7FABH 4FNLL 4J3SA 1K6QL 3U0WH 3D2UB 4ZS7L 2VKXA 1LE5B 3I85A 4BK4A 1IC5L 5C0BA 4HGWA 4M7ZC 5BZWB 5CGTA 5HHPB 4WHDA 5AUMB 3BDBA 3F6LA 3F12B 4HAFA 5HTSA 1MIMH 4HIIA 4JHWL 1DN0B 4S1SL 1L6XA 4HDIB 5JXEA 4JAMA 5AYQA 4K9EL 1ROWA 4JN1H 1MHHB 4OFYA 5FKPA 4IOSD 4N90E 5BS0A 4HUMB 3TT3L 4NCDA 1H15B 5DJDB 5IQ9A 4YDJA 2N56A 3LZFL 3MREB 1IL1A 2DWDA 3TO4D 4R8WL 4C56D 5FKAA 5GJSH 1KCRL 5F97E 5HHME 4JZNB 4NZTH 5FYJL 5I1JL 3AROA 3ECBA 3LH2L 4JN2A 1DANT 3L6FA 4KK9C 5EOQL 3BZDA 1TMCB 1O7SA 4JLRA 4Y8DC 3U7WH 1L0XA 1NDGB 2IAMD 3VE0B 5F72S 4QOKA 3MRKA 4LP5A 5MEOB 4BKLB 1XZ0B 1T7WA 3TP4A 2OI9B 5DD1H 3FAXA 4GAYB 1OAXL 2R0LL 5MHSD 1HXYB 5HYEA 2CSPA 5ANME 3VXQA 1MRDL 3BP6B 3PWVA 3CDYA 5DJ0A 4OLYH 4XRCA 2NY4D 3VI3F 4NRZB 2Q86B 5ID1A 4POYA 4J2XA 4N0FA 4JPVL 5BVJA 2HWZH 5L2JB 4QY8A 4HWBH 4XNUL 4X6FA 1S7WB 4FMKA 3I75B 2XIDA 4R0LA 3D0LA 4X6EB 3C09C 3C87A 5IVXF 5I8OH 1D5BB 3I02B 5EO1A 1G7JB 1VFAA 3C8KA 5GHWH 3BFOA 4I48A 2G60H 1HZHL 4UV4L 3S37L 4HLJA 4U6HA 3GNML 1MREL 4RDQG 3TYFB 1GOFA 3ZE2E 3T1WA 2LTQB 3CX5K 5HHXL 4M02A 4X6DF 1TIUA 2EECA 3TNNB 3SKUD 3D69A 5EOCH 5DMIH 3KDMA 4QF1B 3DROA 3HB3C 3T4YA 4MA8L 3KPLB 1NFKA 3CH1B 1G7IB 2DQEH 2OQJB 4TVPE 2E7LA 3BQUB 1CFBA 2AS5M 5KVMC 4NQEA 1F4XL 3TN0B 3GGWB 2WBJD 3SDYL 1VENA 3KYOA 1RQ5A 5T1MA 5D6CA 4AIOA 4P3DA 1MFAH 3BD4A 4LSTL 5IROA 3KLDA 2V6HA 2J4WH 3M17B 2ZOLB 1YNTB 5I0ZA 4WTXA 5T1KB 3V6ZB 2PO6B 1EGJH 3IVKB 2VLRB 4BM7A 4UTBL 1GVIA 3CFCL 4IHOA 4OGYH 4PFEA 4LCIH 3W82A 5L8LB 2HJLA 2Q7NA 4P99A 1TVHB 3QUMA 1MSPA 1TJIL 5KG9A 1UWEL 3TO4C 1F4AA 2BY3A 1DQQA 5D1ZB 4ZD3L 2NQCA 32C2B 4IRSD 1J8HB 4JZOA 3MLUH 3SDXB 3GBNH 1I1YA 3AREB 4HX1B 5CCKH 2YPLE 2VDLL 4O2CB 5HHVH 5J7CC 1BGXL 4Z0BL 4KI5C 2YMXL 3BN9D 1NBYA 1CXFA 1HHHA 3KYKL 4LNRB 5FUCC 2DIAA 2WMPA 3WFHB 2P49B 1T0PB 3FTGA 2F53E 1VFOA 1U3ZA 3OKKB 1WAAE 2XQBL 5JHDD 1QBML 5KVFL 2NY4C 4NN6C 1WITA 1EUUA 3MMEB 2VL4A 3PP3H 5B3NA 4V1DA 1F3DJ 4QXTA 3RZCC 5DURD 2PW1B 2FJGB 2VSDA 3LKPB 1QR1B 2FX8H 3DHMA 1L9NA 3MPCA 1MI5B 3VH8B 1O5DT 5HYJB 4OB5L 1P7QA 5L2KE 5CJXA 1RZ8B 4HJGA 1MCWW 5DWUL 1I9IL 5GGUB 4M7KL 1QA9A 4TRPH 5GS2H 2BCKA 2DM7A 3KXFA 5IT2H 5TJWK 1AO7E 3O0RH 4XPHL 3TT1L 4AEIL 1MVUA 1KSRA 1KT2B 5HHOE 4GH7B 1R3IL 3D39D 5HI3D 1AP2B 3H9SD 4Y1AE 1JK8B 4CW1A 2N1KA 3S9DB 4H1LA 25C8H 2PYEB 4MA1B 2DMKA 3HC0A 3FFCA 4F2MA 3FQWA 1SEBB 2B4CH 1WFOA 2P8LA 4YAQB 2BZDA 1VPOH 4N8CH 3TH3T 1DDHA 1BD2A 1S7SA 5DA4A 4Q2ZA 4PBVC 3QA3B 2D03H 2PTVA 3ES6B 2XZCH 5DJZB 3G6JB 3IDJA 4JE4B 2KL6A 1ADQA 2LU3A 2DQUL 3QCVL 3KPSD 5TDPB 5D9SB 5DXWA 1FGNL 3R4DA 1J0YA 5HYFA 1CBVL 2FD6L 4E42A 2E9JA 1ZGLP 4X8JA 3JV4B 4K94C 3MACH 1C08A 2AI0L 4PJCA 4FQIH 4IRSC 1SEQL 1B0GB 1F4YH 1KNOB 4JDZB 4P23B 3BDYL 4Z7VA 2JKXA 5D7SH 4IDJH 3QEQB 1PG7H 4G6JL 3WNOA 3QUYB 3R8BB 5DT1L 3VWKD 5D8JL 3FONA 5CSGA 3UJJH 2V9TA 5HPOA 1IAMA 2ZUXA 3CX5J 4TUOB 1ES0B 3TFKC 4HMCA 2EDKA 1MUJB 1C1EL 5C09D 4K3EL 2ZUQB 3C08H 1UM5H 1QSFE 1JN6B 2PTTA 1U8QB 4OZHF 4FABH 3EO0A 1IBGL 3EO1A 5KN5A 1SY6L 3JTTA 4FP8H 2XN9B 4KRPB 3UXFA 4NWTL 1G6RL 1Q9OA 4NQVB 2BDNH 4HKXA 5DUPL 2R23A 2RGSA 5I15L 1A64A 4G8GB 2O5ZH 2K3TA 1JPFA 3C6SB 5E9DA 3S3JA 4UBDD 4XPFL 3DUSB 1FPTH 4Z7WE 4OV5A 4PRBB 4RISL 1B0RB 2EE2A 4JFOB 3S4SB 4HT1L 5DD3L 3BPLC 1AHWA 4XI5D 5D96C 4ZDHB 1Z5LB 2J5LB 1MWAH 1JNLL 5KZCB 1LO5B 1EHLL 1LD9A 5CIPA 3MRDA 2B1AH 4HUXB 4LVOB 1HNGA 5HI3C 1QSEB 5T5FL 1QNZH 2FIKB 3W9EB 4U6XA 3T8XA 4EXPX 4F80A 4Y5XC 3RGVD 3MGOA 2X4SA 1LVEA 4LQFL 2JJTC 2F19L 1CK0L 3BUYA 3O3EA 1G6RB 1GGCL 3NAAH 1KXVC 5FYKH 2FX7H 1I1FB 4I0PA 4X6DB 5ISZA 4JGJA 2FR4A 2ZP0T 4OM1H 5I1LB 1KCVH 1Q0XL 2VISB 4YWGH 3WHXB 4K8RD 4G43B 1QKZL 3U83A 5E6IC 5C07B 2X1QA 2VE6A 5HGDA 5IJKC 5F6HI 3IJSA 1C12B 2R56H 2B2XL 2VZSA 5GGRA 4O4YH 4PJDE 3D2UA 3PWJB 2MKWA 4P4RB 4QNPF 2PF6A 1LE5A 5E99L 4L8DA 1G7HB 3QEGH 4Z95H 1KPRB 3RI5F 2D31B 4PG2C 5BZWA 1JF1B 1U95A 4OZIA 1DN0A 4HDIA 2NY1D 3DBXB 2IALB 2BRRH 1DJSA 4E41D 3VWKC 2DQCL 4MNHB 1MCPL 1OT2A 4G9FD 4OGAD 1ZVYA 2Z31B 1BJMA 1H3GA 4JREB 1H15A 4BQBA 2MKLC 4GRWH 4MXVE 4PJ9B 5LGHL 1DL7L 3HG1D 2FBOJ 1KIQB 4J3XA 1AJ7L 2E9IA 3E8UL 4YGVB 5DJXB 4JZNA 1FLTX 5J1AB 1BBDL 4LCUA 5BV7L 4D3CH 3SPVA 5C0GB 4KV5F 4XAWH 1MLBA 5JLZB 4RMSA 1W72A 3MV11 3KVQA 3LQAL 1OQOA 4HKJB 4GRLB 3VI4E 1J0ZA 3V4UL 1WT5A 4BKLA 2KKQA 3MA7B 3QEHB 3RWGA 5IESH 3DNKA 1CXEA 3B5HA 4RGOH 2MPAH 5BOZG 2CGRL 4GAYA 3D3VA 1HWGB 1KN2H 3B9EA 1HXYA 3MOQA 3TIEB 1KJ2H 4XI5C 5AG8A 1T89C 1RJYB 2P42B 3O4OC 1EHXA 1HN1A 5EFIB 5IHZB 1XGQB 5GSVB 4NT6B 1T22B 2NX5B 4NRZA 5IK3B 4PJGE 4XB7A 3ARBC 4YGAB 2AJYH 1H3PH 4WV1B 3EOTH 3QT2A 4OT1H 4OFKA 5JQHC 3Q6GL 1MEXL 3RGVC 5C0FB 4MLIA 1INEH 1I85C 2F54D 1EBAA 1S7WA 4X6EA 4R96B 1H9VA 5DVKA 4MB5A 5BV7B 5AYUL 4X80H 3I02A 1G7JA 2RBLA 5C0DA 4JO3L 1OTTD 4P2OA 1AQDB 4A6YL 5A43C 4S1QH 5D2NE 3H2WA 3MLSL 4JY5L 1BLNA 1OW0A 2GCYA 4DK6A 2BK8A 2E27H 4WJ5B 5FO8B 3NN8B 4QHUB 3TNNA 4L8BB 4X99B 2GJ6E 3FCTB 5CINH 1MF2H 1QG3A 2FLRT 5IIEB 2J6EH 1XMWA 5BJTB 1EMTH 4U1KB 3P4OA 3QFDB 4LVEA 3ZKND 3WJLA 4TTGA 5HVHB 2OQJA 1T2XA 4KC3B 4KAQH 3BQUA 1Q94B 4CVZB 3SKJL 1ORSA 5EU6D 4PIRF 2VXQL 3GGWA 3WLBB 2IANA 1UCBL 3ESUF 1FORL 2V2TA 1TQCB 3ZL4L 1NPUA 3K3QA 4LKCB 1XGRB 5M95B 4XXDA 4D9QE 1A1OA 2VAAB 4L3EE 3V6ZA 2PO6A 3IVKA 1L9MA 2CKBH 1JGUL 1JGEB 4MJIB 4DWHA 4U7KA 4A6YB 2W65A 1E6JL 5AZEH 5D1ZA 3KNBB 3GSQB 4FTVD 5CJBA 3RIFK 5B3JE 3A6OA 3IRZA 4F9PC 2R8SH 3AREA 1PZ5B 3O4LE 5E4IA 2L0DA 4XVSL 4KTDH 2LVEA 3V4VH 4O2CA 2XWTA 5HGBB 4Y2DA 1UACH 5DVNA 1CT8B 4MMZC 5I8EA 3RY6A 2IAMB 1E4WL 3S35X 1XCQA 1YN7B 1U8KB 4XB8A 3V9FA 3HAEA 1MFEL 1RZIB 3WYRA 3GMRB 4OD1H 1BPVA 1I8IB 3BMWA 4LU5L 4ZPVA 2FATL 5HDLA 3RPIA 4WENB 3NZ8B 4D0CB 2FJGA 1HSAB 3STZB 2AQ1A 3LKPA 2VLJE 1QR1A 4M4RA 5CP7A 5HPMB 1MI5A 3KYAA 3VH8A 2LAAA 3BOVA 5HYJA 1T7YA 4GG8B 4GKNB 4JANA 2DL2A 3WIHL 5EUOE 3S88L 2VITB 5HI5C 2IADB 5GGUA 4P0DA 1OTTC 1X5JA 3BP5B 3FO0H 3O45B 4H26A 4XPGH 3ME0A 4NPYB 2DMBA 3EYFB 4EOWL 5EZIH 3A0OA 1JGVH 3IDIB 1FNAA 3RX8A 4OF7A 1JK8A 4ALAL 1HHIB 4ZYKB 3RWFB 3H9HB 2WWMC 2PYEA 3C60D 1UENA 2FX9L 4H1LG 4F7CA 2NLJB 4HLZH 3ZKNC 4XBEL 5C08A 4YHOL 1SEBA 2YEZA 1RZFH 1KCLA 1E4XL 5ADOL 4Q9QL 2LQRA 1RZKC 4MQXC 1JCKA 4EIZC 1FSKC 5CLTA 3BO8A 1LDPL 3ARFB 1V7NH 4ZO7A 2DMCA 3NPSC 3LKSA 2B20A 5D9SA 1TTUA 1J1OL 3GMNB 1J10A 4X7DC 1T03H 3NTCH 1ITBB 3JV4A 5EA0L 4LSDA 1B0GA 2DQHL 1KNOA 3WS6A 5T3ZL 4P23A 1JYWA 1T83C 2B5IB 4MXQC 2UV3A 4PLNC 4MHHG 2EDJA 4WNQB 3GRWL 3EYOA 3QEQA 3NACH 4HW6A 3QUYA 1SMAA 2DQTL 1ZTXH 3QQ4A 1VADA 1YYLL 2CR3A 5LXGL 3MBXH 1GZQB 2FBJL 1MELA 3EUUA 1HCVA 4AEFA 3V4PH 3FT2B 1X5FA 1A3LH 4JCLA 5CSBA 4DAGH 1MUJA 1NANI 1TITA 4BK5A 3HMXA 4TVPL 3KPPB 1CU4L 1P4IL 2JIXB 3FT4B 4QO1A 4H20H 1AY1H 1U8QA 5T1LA 1YJDC 4KKLD 5EORL 3RWCB 4LCWA 1NMCB 2XN9A 2H45A 2AW2A 4NQVA 4IRJB 5TE4H 1GXEA 1VACB 1XF2B 5L6YL 4G8GA 1HCFX 3C6SA 1IM9D 2IMNA 1P4BL 3GDBA 3V7MA 4E0RA 3DUSA 4F7PA 3OAZK 1HWHB 4ZTOL 3U6RB 1FFRA 1J0HA 3M8OH 1AQKL 2H3NB 4MNGE 4WUUA 5DURB 3S4SA 1S7UA 1YEDA 4HPOL 4WHTB 2OL3H 3NH7H 1Z5LA 4X6BB 3O3UN 4L8CA 3FB6A 3LKOA 1QVOB 3FB7A 4HUXA 3ZT7A 1KTDB 1R3JA 2OBGA 1QSEA 2FIKA 3W9EA 5IVXA 5A40E 4P5TB 3T0EC 4M9PA 5TQ0H 3CLFH 3NIDF 4O2FB 1EAJA 5D7LE 1K8DB 4MA7H 3MNWB 15C8H 4YO0B 5IB5A 5GSRB 1I1FA 4XHJD 4HFUL 4X6DA 5DK3A 3L7FB 2O61A 1WICA 3ULVC 4N5ED 3T0XA 2Q8AH 5MEQB 2W9EH 4C59B 2PNDA 5JIPA 3G6DL 2VLME 4QHMA 1SVZA 3PWJA 2YPLB 4OM0H 5IMLA 1RK1A 3KPSB 3QIBB 2KDGA 2JF1A 3W2DL 5FM4A 1YA5A 1KPRA 2D31A 2ZJSL 1JF1A 4ODSL 1ETZA 3T04D 1OAKH 1Q1JL 3ISWA 1QQDB 5GS0H 12E8L 3DBXA 5KSUA 2F53B 4ONGL 4U0RB 3MRGB 3THMH 2BNRD 1YEGH 1YNLH 3UBXA 3LPGA 3UZVB 1FO0L 2Z31A 4L4VE 4K23L 3TCLB 5EPMB 2CMRH 2EXYD 3S35L 2R29H 2NY0D 5T33H 2AJXH 5DJXA 4P9MH 5DMJB 1PVHA 3OR6A 4KKLC 4BFBD 2DKUA 3R0MA 5SWSD 4JR9H 3OF6D 2ZNWA 5TPWL 3T3ME 5JPMB 2X10A 5IW1B 4PJGF 1U58A 3HKFA 3SHSA 4HWEH 4NUJA 3FO9B 1MAKA 5L2KB 4KXZH 1I3RB 3EOAB 4HKJA 4P4KB 5H8DA 4PJFE 3T08A 4O9HL 2WQ8A 3BEVA 3FO1A 1YY9D 3FB8B 5B22A 3QPQC 3MA7A 4QTHB 1AO7B 4NRXB 4XVTL 1A02N 1HHJA 1HH9A 3LRSB 2DOCA 4Y1AB 4AK1A 2ZPKH 3OKNA 2PXYB 4NNPL 3VGBA 5KSVA 5IHZA 1FO0B 1XGQA 4OUUA 4UT6L 5EC1A 4F33B 1EUTA 4UV7H 3PXHA 4EQ3A 4HC1L 3BAEH 4WV1A 4ZOCA 3HC3L 4HF5H 3GMPB 5DA0B 1IT9L 4R96A 3SY0A 2QR0B 4NN5B 1QLRB 1NC4B 2Q6WA 3L5HA 1OWRM 4QT5B 4Q9CA 2CD0A 2HFEA 3KR3L 2JCCF 4XHJC 4OTXL 4GAJL 4UTAL 1LGVA 2X09A 4LVNB 2I27N 1IFHL 1MQ8A 2WWKO 4N5EC 4WWKD 3VXSD 2MFNA 4WJ5A 5FO8A 1JRHI 4OF3A 3NN8A 4HQQL 1LDSA 5TF0A 3FCTA 5EWIH 5HJ3A 3IJYA 4Q0XH 3RI5K 4CVZA 1OSZB 2RCSH 4KVNL 3WLBA 4M7LH 5FEBA 4PJ7E 3VGDA 4KJWC 4LDEB 4APQB 1OP3H 1XGRA 1EBPA 4YR6B 4Q6IA 4PJ8D 1N59A 1NCDH 2J12B 3NZHH 5BXFB 4XNXH 3JWNC 1T1ZB 3GI9H 1QSFB 1WBZB 4JO4H 4MB4A 2NY1B 1I7RA 2V17H 4OF8A 1JGEA 3BGFB 3MRJB 4YHKL 3GI8H 4MJIA 1I1AB 1J1XL 2H9GA 3T77B 3IAPA 5BMFL 3OZ9L 1LO2L 1YC8A 3NIGF 5E95B 4NQXB 3KNBA 3T2QA 1NUGA 3ZDYF 4JRXD 4NDMB 4LSPL 1PZ5A 4C56A 3KPQA 3OAUL 1FGVL 4Z7WB 4KTYA 1M6OB 1TJHH 5MENB 4OF6A 1PSKH 4OZHA 3TPUB 5DEFB 1YY9C 3RNKB 2XOTA 4X7TA 1GC1H 3B4NA 3WV0A 2IAMA 5MI0B 5ITFB 5DJ8A 4I0KA 3VGAB 1KN4H 4RQQB 1H8OA 4PY7B 5C8JB 1FN4A 1JWSB 3IDYC 4R2GD 3GMRA 2CJUL 2DQFB 3HAEG 1U8LA 3NZ8A 4D0CA 5ACZB 1HSAA 3NCYP 2L7JA 1U8JB 5I18H 3EYSL 4DGYL 1D5IH 5JOFB 3BP4B 3MRRB 4FZ8H 1CICC 4GKNA 3TLRA 3RPKA 3LV3B 1NGZA 2VH5H 3NCBB 4I9WD 3QO1B 4OQTA 4RZCB 3VH8G 5KVEL 5DHVB 1V8HA 4IIQC 3QDJD 5D1XD 1FG2B 2J1KA 3BH8A 3EYFA 3MNVB 1A9BB 3BZ4B 3QO0B 1UZ8A 5CZKA 3DGCR 4N9GA 4R90L 2PN5A 1SVCP 1IGML 3RWFA 2B1HH 2VN4A 2UY6A 2QQNL 3MBED 5DF0A 4WFED 1RI8A 4BQ9A 2WIIB 1C5DB 1OSPL 4DKDC 2QEJA 3SJVD 2ZUVA 4Y5YA 2G2RB 4UIMA 2EKJA 2NNAA 1BMGA 5K9QI 4F7EB 3CUPB 4PJ8C 4PLOB 1NAMB 2WBJA 3ARFA 1QLEL 5F21B 2XKUA 2Y5EA 3MRHB 3WIHA 3E2HB 1WQVT 3PGDA 1ZV5A 3GMNA 3WKNA 4QGYA 4JFQB 3UP1A 2Q8BL 4LIQE 2VXTL 3D85D 4OCSL 3JVGC 4KI5E 4JHBA 1NLDL 1CFSA 5FUCE 4M6OH 4WNQA 1RU9L 3HI1A 2A6KA 3ARQA 3LRHA 1GZQA 3X11B 1IM3B 5C86A 1BOGB 3FQRA 4WW1B 1K8IB 1FH5H 2EDYA 3FT2A 1TZIA 2HT2C 2HTLD 4PJ5D 4QWWD 3UO1H 3HFMH 3L5WA 4PJGB 3KPPA 3FT4A 5CP3A 4MD5B 5CUSL 2AEWA 4QRQB 5KSBF 3L3KB 3QDME 1OGTB 4DVBB 3X17A 1YECH 4R2GC 5IBLC 4Y4KB 4FXGB 4IRJA 1QBLH 1OTUD 3E6FB 1VACA 4B53A 3QDGD 5IGXL 1MHCA 5IB2B 3UTOA 1JMXA 3KPMA 1XFPA 1L0QA 1BX2B 4GKSB 2UWEF 1RHHB 2H3NA 1EERB 4J6RL 3CMOH 3INUL 3O11B 3N85H 4TUKL 4Z8FL 4WHTA 5EZOH 3V0VA 3K4DA 5D1XC 3S4SG 4ODVL 1QVOA 1K2DA 1FDLL 4XZUB 5K9OB 1KTDA 4JFEE 2NXZC 3QXVA 4K2UH 1RUAH 4KUZH 4ODWB 1T0NB 3GO1H 2B4CC 5FYKD 1XGUA 1AGEB 4TVSa 4JM2B 4KUCD 1K8DA 1HE7A 3MBEC 4G6KH 4YXKL 3H9SA 3MNWA 5TF1L 4Y5XA 2DQJH 1NCTA 3VXPB 3O2DA 4BZYA 1CF8L 2GAZB 2X1WL 5DRWB 4L3EB 3C60B 3H7BB 4WW2C 5D72H 2VDNH 4HJJH 1LE9A 1FL3B 1UXSB 2MMXA 4XP1H 4MCZB 1J9CT 3NFNB 4LF3B 4NGHH 3I84A 5ICXB 1AIFB 3RTQC 3ZHLA 5DRZB 5J9PB 1CDBA 3EOBB 1DUZA 1QEWB 4L3CB 3V52H 1MFBL 2APXA 4MZ2A 1J1PL 2R4SL 1IGCL 4OLUH 2XZQH 2BY2A 1X5YA 1OB1B 3O4LB 3W9DB 2DKSA 3G5XB 3KPSA 2ZUWA 3QIBA 5DO2C 4NZRL 5LBSL 4YBHA 5C1MB 3GBML 5J12C 3IETB 3E6HB 1OP5H 4JDTH 5EBGA 2HLFD 1EO5A 1EFQA 4MWFB 2YA0A 3QUXD 4OZGE 1GGBH 4XNMA 5SV4A 3TBWA 5GS1C 1A7OL 1YEKH 3MRGA 3MX0A 2QTEA 2YRZA 4PJFF 1BAFL 4FG6C 3GFUA 1X5HA 5EZLB 1YYML 5EPMA 3VWKA 5ALBH 2GUOB 5JHDE 4QWWC 3UBXG 1MLCA 1EEZB 3H0TA 5IQ7H 3H7LA 2VABB 4F8TA 1NFIA 3RA7L 1TJGH 4Z7OF 4XP5H 3O6KH 5EU4B 1AH1A 5F88B 8FABA 1IGFL 5CEZH 3P11H 4CADB 1R5VA 1TETH 5EUOB 4P4KA 3AXLA 2AV7A 3O9WC 4WHYG 5D5ME 4TUJB 4HWUA 1FLRL 3FB8A 1QFWI 3WMSA 5CKAA 1XF3B 4NRXA 4PRNB 4YK4C 4WU7B 1HIMH 3D39E 3LRSA 1BQLH 1ZA3B 4KWUA 5DDHB 1S7TB 2PXYA 2GSIB 5DJ6B 3U2SB 4DJMA 4R4BB 3D0VB 5KSAD 3DWTA 3ZE0F 2EICA 4W70A 3ZKXC 3BKJH 3D87B 1OGAD 4AENA 1WLHA 2CRZA 2QR0A 5JOEA 2DBLL 4OIAA 3OB0H 1NC4A 4G6ML 5HHNB 1NQBA 3HI6H 3U0TB 5KVGH 5KVDH 4QXGH 4CJ1A 1CFVH 2FIRT 3D6GA 4ESKA 1RURL 3MROA 4Z0XB 4OKVA 1FVDB 3HR5B 5E8NA 4IBLT 4UU9B 5DJCA 4Z7UE 3QUMH 3OG4B 5FUZH 1DEDA 1F3JB 3WNLA 5FB8B 1YY8A 3O8XD 2JB6A 5J1TC 5BRZD 3X12B 4NSKB 2YA1A 3V79C 1CTNA 4FQLL 4HEPG 1GGYA 3I3BA 3ARXA 4UIKL 2HLFC 5I1EH 4OZFB 1L7TL 2H2SD 2EDTA 2VDKH 1MJUL 4ZXBB 4HS8H 2GTZA 5C09E 4L5FL 1WBZA 1IAII 1YEJH 2OTUB 3MRJA 3VXMD 1MRCH 1SBSL 4KQ4L 3S6CA 4TOYL 1F13A 2KH2B 3HZYB 4JKPL 2EIEA 5C0EA 3ZE1E 4NQXA 1YNKL 3RL2B 3VXOB 3MLPA 5IMMB 3L5XL 1J8KA 1JGLH 4LLUA 1ZWIA 3IAQA 3QPXL 2E8YA 3RP1A 4WFHE 4MNGB 3WHE1 5MENA 3RBGA 5L88L 4LSUL 2VMFA 3TPUA 5DEFA 3LHPH 3RNKA 1F4WH 1Q0YH 2CUIA 3U4BL 3OPZL 4CN6A 4KKCD 4ZTPL 2VUYA 4PRPE 3O3AB 1D7FA 3HNVL 4FQHB 3PQYD 3MJ9L 4RQQA 4PY7A 4UB0L 5C8JA 1DQMH 5FECB 4AT6B 1JWSA 5TE6L 3L3HB 4H1LH 2A83B 5D7LB 5DQ9B 4ZUVA 1U6AH 3OKEB 2EYRA 1NUDA 4PB9L 1A5FH 2UWEB 1FNEB 1M1SA 2Y9RT 5ACZA 2EDBA 3CU7A 5F3BA 2PW2B 4Y19E 4LK4A 1U8JA 1EDQA 3OKDA 5CZVH 5F1IB 5GRJH 4R97B 1CLYH 2BNQD 4FZEL 3KLHD 6CGTA 1K85A 4XH2A 1KTLB 1BIHA 3IU3B 1AGCB 2EZ0C 3ZYIA 4F9LC 3QO1A 2ADFL 3QQ9D 5CEXA 1I8MA 3FL7A 3OR7B 1FG2A 4EDWH 1ADQH 4LSRL 1A9BA 5F71A 3DJ9A 5TH2B 1MAMH 1IVLA 5C0IA 4JPWL 1I8KB 3DUUB 5IR1A 3QO0A 4Y5VB 3TZVB 5ILTH 1IGTA 3UJTL 4LLQB 2X4UB 1JTOA 5SX5H 3I3EA 1DSFH 4ONOA 4P46B 2IEPA 3S36X 5DGQA 3O8XC 5IBUB 5ACLA 1DLHB 4PRHD 4TSCL 4M6ML 2DQDH 2APBA 2OXHA 4E41E 1VFMA 3RAJH 2G2RA 2FECL 1PX3A 1BOYA 1T0MA 4G9FE 4L4VB 5IWLC 1JHKL 1CGSH 1IGIL 2H2SC 1E6OL 4F7TB 1NAMA 2DM4A 1NCBL 5IB1B 4X0KA 1FIGH 1WSST 4XAKE 4NM8H 1SBBA 1A7NL 4JFQA 3MLXH 3QXTA 1JWUB 1Y6MR 2FHCA 1EH9A 4JFHE 1UM6L 5F44A 3MFGB 4I1NB 4DQOL 1M7IB 1MHPH 4ODUB 5ICYA 4PJFB 3BWUC 4ZAKC 4JRYE 3JTSB 4FTVA 3TIDA 3ZDZF 2MCPL 3X11A 1IAKB 1IM3A 3RWIA 3P30H 3ILQD 4UT7H 4WW1A 5F7KC 4XXCA 1AD9A 4KKCC 2H1PL 1BQSA 3HZVA 5ADPL 1AFVL 5CIPH 4MD5A 4PJBF 3SEPA 3WN5B 2ADGB 1JF6A 4HIHA 1DE4A 4WY7H 1IARB 4QRQA 1KC5H 2VXSL 5DQJA 5CWSA 3DLQR 1OGTA 2ATKB 2HVKA 2QHLA 3KPOA 2DYPD 3HA0A 3VFGH 3X14B 1FV1B 3E6FA 1GH7A 1P6FA 3O2VH 1PLGH 2DICA 5DS8B 5I73B 1T6VN 1JVKA 1E28A 2EYTB 2J88H 2PUQT 3O6FD 4GXVL 2X4OB 3CK0H 4GKSA 1KELH 1ULVA 2F74A 1RHHA 4LBEA 4Y4HB 4IOIB 4PJIE 4RMWA 3VXRD 5IMOB 5BW7A 2ZSVB 3EAKA 1I3GL 3K8KA 1KEMH 1NGXA 4M3JA 2JJSC 3NFPA 4M7ZB 2Z35B 4K07A 3WCYA 5DC0A 2GW5A 3GSRB 4XZUA 5K9OA 4X4XA 5F6IC 3MV7D 1D3CA 5EU6E 2JCCA 1A6TA 3P0VL 3DV4A 4PJ7B 4GS7B 4F58L 3TF7C 1NBQA 1G9MH 4UINH 3VRIB 5ESQA 5DRWA 4L3EA 4YDIH 3C60A 4XPBL 3HNSL 4HWZA 5EIQA 4GBXD 4I13B 4ZUUB 3W81A 3V7AE 3MUZ1 3MO1B 3LSOA 5DLML 4MCZA 4LPXA 5E5RB 4LF3A 1AIFA 4KJPC 5DRZA 3EOBA 1QEWA 4L3CA 2DQGH 1IC4H 1ZGLB 4KKAC 3BIBX 2NY6B 1S9WB 5GGTL 4Y88A 2OJEB 5EDXA 1A7BA 3O4LA 3W9DA 3L95B 4XWOD 3G5XA 4P3CH 2QSCL 3QCUH 4R7DB 1W72H 3AS0A 4S1DD 3EBAA 4KMTH 4LSVL 1KEGL 2J7LA 4EBQL 1KBGL 4N1EA 5E2VL 3MLYH 3BVNB 5CBEB 5EBWA 3QI9D 4JHWH 1PG7W 4I8DA 4LCYB 1NUNB 3ILQC 3T65A 5EZLA 3QH3B 2ENSA 3O3DB 2B8OT 2F5AL 3CVIL 1EEZA 1NMAH 3MFFA 4EUPB 2BP3A 5I17B 3WDJA 5FDWB 3PHOB 4M3KB 4DUXA 1PQZA 1S5HB 4XPTH 4R8WH 1ND0A 4X7EC 1CFQB 3LQMA 3MV8E 1IEHA 1C5CH 4LDOB 4DK3A 4CADA 3D1MC 1ZLSH 2BVQB 1FNFA 5FV2A 1MIEL 2YD4A 4PP1D 5EOQH 1ZLUH 4TUJA 5F1KC 3DSFL 4LQ1A 4JQXA 4LLWB 2ADIA 4FN0A 3QDGB 4P5MA 4PRNA 5H94B 1IM9A 4WU7A 2C3WA 5KBNC 3OKMB 4LAQL 1DLFL 3T0EE 3KPRB 1H3WM 2XPGB 5DDHA 5JHLH 2GSIA 3VG9B 3QUKA 2IPTL 4U1IB 5A16B 4DFHA 4M5YL 5AWNL 3D0VA 2HA1A 2DKMA 5EC2B 2J8UE 3S36L 4LEXL 4E5XB 1JNJA 5FGBC 1G7PA 1T21A 43C9A 1YPZE 5ITBL 3RIAK 3RX5A 3EJJX 4MQ7A 5IKCB 4OD2B 4L1HA 1S9KC 4XCEB 3BZEB 1PJ9A 2X70B 5HHNA 3ULVE 4OCMC 4RFEA 4H25B 5TQ2L 5JXAL 3C2AL 4GBXC 3SO3C 3BD5A 3TVMD 3KHQA 3WFZA 4YE4L 1X5XA 4UU9A 4ZG1A 2OS7A 2FEDD 5FAAA 4LGSB 3S37H 4RA0C 5I1IL 3SGKC 4ELMF 3I9GL 1CE1L 1BM3L 1F3JA 5FB8A 4X98B 4YHNB 5GS0C 2YPKA 3RHWF 3X12A 1DVFC 1TCRB 2WNGA 2YXFA 3AS2A 1BECA 4OZFA 1YQVL 4U1MB 4JG0L 3QXAB 1QPPA 1F4XH 2F8XC 3DX9B 3MJ8B 4KVCL 4ZXBA 4PGDA 4YPGB 4PLJD 4Z9KB 3QI9C 2XG5A 3RZCB 3QISA 5DRNA 3QXWA 4FHBD 1QSZA 3QDMB 2YZ8A 2AJ3B 6FABL 1AR1C 1CGWA 2BNRA 5C0CD 4G7VL 3HAEH 3CFEB 1XGPB 3HZYA 5JO5A 2ICWA 1FNHA 3MCLL 1WC7B 3ARSA 1FYTE 2DJ4A 3RL2A 3VXOA 1VB9A 5LWYH 1IEAB 3R1GL 3VFVB 1RUML 2C4FU 4HXAH 4FFYH 4MX7B 3A6BH 3QIWB 3TBTB 2ATPB 4CBPA 1JPST 1YUHA 3HRZB 1XR8B 5SWSA 1G0DA 4WEMB 3OF6A 4PJBB 1CCZA 2VDLH 5KSBA 3GSXB 1M05B 3PGFH 4TSAL 4MXWL 5L0QC 1BGXH 1QACA 4PV9A 3LDBC 2XTJB 1UCTA 2YMXH 3WIIL 1FFQA 1UVQB 1HINL 1GPOL 4JFEB 4M62L 3O6LH 4U6YB 2EXWD 4JFPB 3SE3C 4I0CC 1XT5A 3BZFB 4XBGB 3L3HA 2MWCA 4WFFE 3LS4H 5DQ9A 5JIKA 2XQBH 4OLWH 3FMGH 4RIRA 5DUMH 2UWEA 1XR9B 2R1WB 2ICCA 3WFEH 3GK8H 1AKJD 4YHZH 4QRRD 5KVFH 4XCFH 1ZSDA 3IFLH 3MLRH 5F1IA 2DLGA 2WUBL 4Y4FD 1REIA 2HLAB 4FQ1H 5LGJA 2BFVH 5D71L 2NTFA 3PL6D 1AGCA 5FO7B 5M94B 5BO1L 3ULUH 2CDGB 2Q1EA 4M1DH 2AV1B 2AK1H 5IM7B 1RZGB 4OB5H 3N0PB 4YIQA 5IEKA 1WFTA 2X2YA 2EE9A 2PCPB 1RJZA 4LNVA 5KANG 5BOPA 5L9DL 1UKQA 1I8KA 3DUUA 1LK2B 3FN0L 2YKLH 4PJAF 4IRZL 3BWAB 4LLQA 2X4UA 3HMWH 4P46A 5JA8B 3RWEA 4DKAA 1R3IH 2VOTA 4ODHL 4TTDC 4YLQT 5E2UH 3R06B 1JUFB 4WWKA 4OZGB 1D5MB 2IH3A 3OQ3B 3MZTA 1WCBB 2VQTA 4QXUL 3HZMA 1KJMB 2DLHA 1U93A 4J8RB 4L4VA 4YHLH 1A47A 4X6CE 4E9LA 4O02L 1VFUA 3OXRA 4F7TA 1FZJB 2YK1H 3CZFB 5IB1A 3GSNL 3HMXH 2MTPA 1ZT1A 3HHRB 5LQBH 4PJ8A 5C3TA 1JWUA 3DVNB 1N7ML 5LVEA 2PR4L 1I7UB 1DFBL 3MXWH 4NNXA 2R0WL 3LN5A 4ODUA 3OGCA 2UZIH 3VFMA 3BPLB 4PJFA 1Q9WB 5IFAL 5D5MB 5DJ2B 5HYSA 2IQAB 4AG4L 5KS9F 3JTSA 5D93B 4CJ0A 5I2IB 1GC1C 1JNHB 4JRXA 1IAKA 2ITDB 2VXUH 1RUPL 1NL0H 5E5UB 5D8JH 5JZ7D 1N64H 4LRIC 1L6ZA 5HHQB 3MRPA 2ADGA 4P9HL 5K9KB 1JRHL 1OPGL 2Y06H 2ADJB 3QCTH 2ATKA 3V95A 3GSNB 4KROC 1ZT7A 4KQ3H 4KZEH 4N0UA 4I5BB 3IAGC 3D18B 5EG6C 1X5GA 4L4TE 4GMSH 4X9IA 1JE6A 3S5LA 4NWTH 4JFFD 1T6WA 2IPKB 1N6QL 2BSTB 3LMJL 4AMKH 2P48B 4Y16B 2MOVA 4RGND 4IOIA 3QEUB 5D7JC 3C6LB 1J7VR 2ZSVA 5F89B 3T0DA 3VXSE 1KJVB 4RISH 1I75A 1EIBA 2DQIH 1H3TA 5C6PB 5C0BD 1ZHNB 5DD3H 5AZ2L 3GSRA 3QNZA 2P24B 3QDJA 1CD9B 4J3TA 4YFLF 5C70A 4OF5A 1MFCL 3QXUA 5I19L 1XF4B 3Q6FB 4FQJH 4G9DB 4EIGB 3QRGH 4DZBA 2X40A 1FFNA 2N7BA 2NMSA 1Z0MA 4S11A 1TENA 3IXTB 4QHNA 3VRIA 4J1UA 4LQFH 1CZ8L 3WXVH 1JZ3A 2F19H 3F65A 4KHXH 4ZUUA 3SJVA 4H88L 2KUTA 3KPTA 1QZ1A 4HHAB 3BIKA 3MO1A 3IFNL 1NBVL 3VG0H 5IMKA 4ETQB 5EULV 1G0XA 4MQTB 5JW3L 5FA3B 1T5XA 4MB3A 2EE3A 1RZ7L 4Z7QE 1Q0XH 3KJ6H 1S9WA 4KHTL 2Q87A 4I18A 4PV8A 2OJEA 5DGRA 3GZKA 3L95A 1E4KA 1FQ9C 4PJHE 4KMQA 5LAXB 4Q9BA 4WHYH 3BGMB 1IEBA 4XPAL 2B2XH 2IMMA 3KYMA 4QRSA 4U3CA 3D85A 1RVFH 3IJHB 3GMLB 3EIFA 4DKFH 3BVNA 5TFSH 3ZO0A 4X4ZA 2P5EE 3PWPE 5CBEA 4EKXA 4PRPB 5CBAB 2V7NB 3ARBB 1MY5A 5GS1A 1MCRA 2CIIA 3QH3A 3O3DA 1YEIH 2MHAB 3G6AB 2GITB 5IBTL 1QTYT 4XNYH 2CK0L 5I17A 5FDWA 5CEZD 3CFDA 4PJ5A 3BKCL 1VDGA 4K7FA 4Y19B 3WNPA 1S5HA 5AG9A 4M8QB 1EJOL 3CFKA 4OLVH 5IVNA 2R0KH 1P7HL 5I8CA 2OZ4L 4DGVH 2C1OA 3MLTA 4I9WE 3L3JA 5JDSA 2BVQA 4G7YH 3VJ6B 1YPZF 1A6WH 1GZPB 2C1PB 4HXBL 1IKNA 1WK0A 3QDGA 4PRIB 4PY8J 5H94A 1DR9A 3O6FB 4OUOA 3B9DA 3V4UH 3OKMA 4P59H 1A6AB 3KPRA 2XPGA 3H6JA 1WIUA 4U33A 3SQOL 4XP6H 1LNUB 4U1IA 4YHYB 4U2ZA 3FOLB 4WI4A 4OCRL 2VLKB 4XNQB 3QUZB 4E5XA 5JXEC 2BXZA 4KH2A 4X8XA 1CGVA 3EDDA 4GQPH 4JFZL 4L9LB 1ZLVH 1V7MH 5E56A 5IKCA 2F58H 1KYOK 2X70A 3TM6A 4EVNB 4W6XB 1C5BH 1R3LA 43CAB 4PJAB 2E6PA 4H25A 4MAUL 2FWOB 2OP4L 2FEEL 3MC0A 3TO2A 5HDBF 4O51B 3CFBB 3P4LA 1KG0B 2WLYA 1MCQA 5B38B 4M7JH 3A6CL 2ZCHL 1KB5B 1DQDH 3DXAD 3V6FA 4JEGB 4YHNA 3DI3B 3NA9L 1MJJB 4JRYB 1MCBA 1X44A 3BEWA 4HK0B 4NM4L 1N26A 4YDKH 5JTWA 4G42B 4UAOC 2H2PD 1UC6A 5E08H 1S9YB 4U1MA 2Q7YB 3OKOB 3MOAL 3MJ8A 2VXQH 4ODTH 3BKYH 4OZFG 3WD5H 3G04A 3QUXA 3NGBB 4RRPA 1OAZH 2FH6A 5T3XD 1I9RH 1RZKL 3KWWB 3P9MB 4KKBC 2OK0L 3L1OL 3EO9H 5HGHB 5KS9B 4ELKB 4R0LC 1N2RB 5E1HB 1P7QD 2C3VB 2V2XB 3VWJD 1QP1A 2ED7A 1AGBB 2MQ0A 4NKIL 5A2LH 1F58L 1WWWX 3QIWA 3JV0A 2VLLB 3TBTA 2B0SH 5DEGB 4YHIB 4UZGA 3FT3A 4ZOEA 2V5MA 1XR8A 1VERA 1P2CB 3DX7B 4PJBA 2PYFB 4XVSH 5DD0L 4OQTH 3UTQB 1FAIH 3GSXA 3VCLB 2R2CA 4PLKC 2EO9A 3ROLA 1NANH 4YX2L 1ZT4B 4L29A 2EIZA 1UVQA 2NY3B 3WFDH 1OP9A 3FFCD 1X4XA 5I30L 3BPCA 1ONQA 2EYSB 1J0IA 3BZFA 5FXCH 2E7LC 5FYKE 1IMHC 4N8PA 5CJQH 4RGMC 3FQXB 3NABL 2VQUA 1BD2D 1E0OB 5DMKA 1JNNH 5IB4B 3TNMB 2BRQA 1A14L 4DEPC 3HPJA 3T1FB 3WUZA 1YJDL 5IROC 4X5XA 3NPSB 5J6GA 3NCJL 2FATH 5MP6L 1NMBL 5KSAA 1A2YB 2VTFA 1NH6A 1OLLA 1OGAA 2GTWA 2ZUUA 5GGVY 4JB9H 1GRWA 5GPRA 2A38A 3FO2B 3WIHH 1OT1A 2PCPA 2EDEA 1Z3GL 1AE6L 3W11D 3VA2C 3QNXB 1WWAX 4MNQB 1OY3B 1TVBB 5I6XB 4L4JA 3WLWC 3BWAA 4MGXA 4KK8D 4EOWH 3VFTA 3WS3B 1LWRA 1UH3A 4OF0A 4X4MA 3R06A 1JUFA 4QRUB 2YR3A 2FL5B 4UUJB 3RHWK 4BFEA 3EFDL 4LPWA 4LRNL 1MCNA 1WCBA 4K94H 1HYRC 2A1WH 2V5SA 5E8DL 2CRYA 4KXZI 2W9DH 5IBUG 1N5YL 5KW9L 3O8XA 3U9UA 2CUHA 3MUHL 3IDXL 4J8RA 2ORBL 5EU5A 2ZCKH 1INQB 2JJWA 1QFWL 4OLZL 1CS6A 1QOKA 2GQHA 2X6MA 3H42L 4K3DL 1FJ1B 1FZKA 4U1JB 2O5YL 3CZFA 2VDQL 1QYGL 2YZ1A 1GIGL 1ZEAH 1IQWL 2AGJL 5CP3H 4YUEL 4FQCH 4PRAB 3DVNA 1T5WA 2YA2A 3MV8B 4BELD 3ULVL 3SKMB 1HQRB 4JCMA 3U1SH 1KYOJ 3BKML 4PUBH 4O58L 4EN3B 3P77A 5CJXC 4FQXB 5DJ2A 4TULL 5EA0H 1CD1B 1RFDL 4NQDD 3VXUD 3OG6B 5I2IA 1CI5A 5T3ZH 3PABA 4EQ2A 3SE8H 3HC4L 5DSCB 3T0EB 4ZNCD 4S0SD 1BJ1J 1LQSR 4HPYL 3K4ZA 1YYLH 3P73B 4OJFL 3DMMD 4OAWB 5HHQA 4ERSH 1LO0L 5K9KA 4XMPH 2ADJA 4MZ3A 1VA9A 3LEYL 5GJTH 2Z91B 4U1GC 1YPZB 3EGSB 2I60L 2VXVH 3CFJB 4G6FD 3O3BB 3PQYA 1B6DA 5C6TL 1M71B 1B4JH 4FQ2L 5JR1L 3O2DH 4PB0H 3U7YL 4I3GA 2IPKA 35C8L 1OTSC 5GGVL 3S5LG 1OAQH 2PETA 4Y16A 5L6YH 4QYOA 5EU7C 1KIPA 3C6LA 3N50A 2BSSB 3D2UD 1IAIL 2BNQA 3W5NA 1KJVA 5D7IE 4MD0B 4HPOH 2AJSL 3Q5YA 3KYNA 3LS5H 4U1SB 1KCUL 2UVFA 2APFA 3BSZL 2QKIA 3BH9A 1IE5A 2W0LA 3CVHL 4G9DA 3DO7A 5IFJB 4XHQA 3S3SA 3X3FH 3IXTA 3VFSB 3ZSTA 1ZVHA 3WUWB 3GB7A 4I2XE 4ELMA 3RDTB 4ZSOE 4LEOB 3OAYH 1PFCA 4HS3B 1RSFA 3VXME 4HHAA 5B21A 4Y89A 3RJDA 4DFIA 4ETQA 5DVLA 4HFUH 4NQSA 3QIUB 5FA3A 2NYYC 5DJAB 1FYTB 5JW4R 1JV5B 3I50L 4XCNB 2ZOKA 5D7KE 1FRGL 4MS8D 2AJZA 4FFZH 7FABL 3MUGB 4XVUD 3U0WL 1CDGA 5LAXA 3BGMA 4GAGH 1G6VK 1AHWC 3OKLA 1MIML 3CVHB 5FCUL 3ABZA 5F1SA 4F7MB 5E6YA 1ACYH 1QO3B 1MHEB 4G8FB 1U3JA 2X9WA 3K2UL 4HMDA 5C0AE 2MHAA 2A74A 3G6AA 4LCCB 2GITA 5JIIA 3ZLQC 4Z7NF 5FYJD 3U9PH 3QBTB 1VGKA 4M03A 2ICES 5GJSL 2R15A 2EEDA 1AGFB 1X5KA 4NZTL 2OCFD 3MRQB 3G9VA 3F7VB 4M8QA 2FLBT 3C5JB 1CDHA 2K1MA 4RMUA 5I0DA 1FCGA 5DJYB 4I0PC 2J8HA 1FVEB 4P2QE 1UJTA 3EFFA 1HK6A 1PKQE 3VJ6A 1PG7X 3U7WL 2DYPA 3RU8H 4XP9H 1NFDF 3N06B 3NCFB 5L7XH 4FXLA 4PRIA 5DD1L 1ZVSB 3O6FA 3RKDC 3RY5A 4HKBA 4NJAH 5IF0A 5FGRA 1A6AA 1ZA6B 5C0JB 3BQUD 3VXRA 1LNUA 4EI5B 3TN0D 2EDDA 2HN7A 1OARH 3W39B 4K8RH 2VLKA 4PRHE 1G9MC 2EDRA 1K5NB 4NQCE 2HWZL 5L8JB 2XFXB 3ALPA 5T1KD 2PO6D 2A73B 2GT9B 4HWBL 1B9ZA 2VLRD 3AS3A 4X6CB 1NGQL 3MV7A 3D9AH 1U8IB 5I8OL 43CAA 4PJAA 5C9JB 2IQ9L 1ED3A 4HG4K 5GHWL 1FVCA 1O7VA 2G60L 3RUGF 2UUDH 3LY6A 4JHZA 1J8HD 2K9UA 3VGFA 5C3LD 4BSVB 3CFBA 1SM3H 4BA8A 3ARED 4ZFFB 3I6KB 4GAJH 4GBXA 4NHUA 1II4E 4TN9A 1KB5A 3FN9A 3HE6B 4MS8C 5EOCL 1URLA 4HUKB 4O00A 1MJJA 3UCRA 4XVUC 3QQ3A 1WT5C 1HXMB 3CXDH 5EN2A 1BZ9A 2DQEL 2OI9C 3SBWA 1ZLWK 4G42A 3AMKA 4BSWA 2Q7YA 5FF6B 2VN7A 1ZS8B 2J3SA 3W0WD 2UVEA 2J4WL 5I71C 1LP9E 5IV2B 3E0GA 1EGJL 2QADC 2V2WB 4OI8A 1R5IB 3QDAA 2YUZA 3P9MA 4LCIL 1KLUB 4RRPG 1Y0LB 5B39B 1WFUA 5KS9A 4L4TB 1CICB 5GZND 5HYJD 3CD4A 2DJUA 1J1XH 1N2RA 2V2XA 4FXKB 3WKMH 1AGBA 4PGEB 4OI9A 3G08B 4IEFB 3RVWD 3MLUL 5IB3A 4IIQB 1QHOA 4QRPE 1P53A 2VLLA 4QEGA 5DEGA 3QHFH 4YHIA 5HHVL 1P2CA 3DX7A 1OW0C 3UTQA 2LTQC 3OB8A 4AH2A 3VCLA 1ZT4A 3NOIA 2PYED 5TDOA 2JELL 4HCRA 4YBLC 4HUNB 3HZKB 3AC0A 2P8PB 2EYSA 4LLVB 4WI7A 3WJLC 3BQUC 4X9BA 2WINB 1VEMA 5ETUB 4PJXF 4R7NB 3P9LB 5IB4A 3ZYZA 1WIOA 5E94B 3TNMA 3T1FA 3VRLF 4WEBH 3H3PH 4WI6A 3MGTA 5DHYA 2YD7A 2PO6C 4JPKH 1JWMA 3GUTB 1A2YA 3JV6B 3PUCA 3GMMA 4GRWF 1IGYA 2I5YH 4DGYH 2MQCA 4QHKJ 1NAMH 4TRPL 5D1ZC 3BRDA 4HIEB 4U1LB 1FBIH 2IH1B 3CXHK 3O0RL 2P46B 2DI9A 3QNXA 5CGMA 3DARA 4MNQA 5GGQH 3U7AA 1DCLA 3AREC 3GJFK 3PF2A 5DR5H 3QEQD 2XT1B 3QUYD 3WS3A 3TVMA 1DN2A 1P69B 2YN3A 4UUJA 4DKEH 1CGTA 4Y2DC 1DBMH 3L3GB 2AXFB 3QG7L 4XMKH 3GMOA 2QQNH 3PWPB 5F8RC 2DN7A 4Z78A 1K4DB 3RY6C 1HKLL 2B4CL 5DTFB 1VPOL 3KLAA 2XWBB 4K3JL 2HFGH 3AY4A 3VFRB 1EXUB 5HVFB 2D03L 1FJ1A 2XN9D 4KRPD 3DTXB 4W68A 4U6VH 2XZCL 2R69H 1QFOA 4NCC1 3MCKA 2HJKA 3F62A 3VDCA 1HEZB 3SE9H 3PV7A 4IJ3C 4G8GD 1QLEH 1ZKAA 2QL1A 4JKWA 4TQEH 1HQRA 4YQXH 4GQ9H 3G5VB 4QXWA 5GZNC 3MACL 2VDOH 4FQIL 5C0CA 5CEYB 1F4YL 4U2YA 4AIXA 4EN3A 4FQXA 4JQIH 5E03A 4ZUWB 1IQDB 2XG4A 4HG4J 1CD1A 2GFBB 5KZCD 3PWNB 1PG7L 4MYWB 1GGUA 4C83B 3VFWB 4JFDE 5DSCA 2NXZB 1GAFL 4HK3J 1KENH 1QSED 5JW5A 3DRQB 3P4NA 1KOAA 5ELIA 3WEXB 1IKFL 3P73A 3HUJE 4OAWA 2WW8A 4MA1C 1TCMA 1C8PA 2P43B 3MA9H 1KPUB 2HMID 4FABL 1V3JA 2Z91A 3NCYS 1YPZA 4FP8L 4WW2B 1M7DB 5E8PB 3DURB 2CDFB 4M7LT 1Q9LB 1BIIB 4UQ2A 4KTEL 3RTQB 1YQ2A 2O5ZL 5C07D 1FPTL 1AKJA 5EIVA 1CG9B 2IF7A 5SWZD 2ZZUT 4O5LH 3IXAB 2KQNA 4Y4FA 1BJ8A 5J11C 4HKZA 3PL6A 5J12B 4TUKH 1MWAL 2G5BA 2V7HA 3IKCB 2XWJB 3WS6C 1QFPA 1A7PH 4P23C 2B1AL 2R1XB 2Z93B 3V0AC 2AABH 1UH2A 1Z9MA 1QNZL 4U1SA 2IC2A 3QUYC 1T2JA 4HUVB 5IFJA 4ACPA 1FNGB 3RUGB 2Z8VC 5FYLL 1U3HD 3B9KB 2X4QB 2P8MB 4BZ1H 3U0PA 3O6MH 2KZWA 4PJ9D 3SDXF 1P5VA 5AAWA 2QSVA 4OD3H 2FX7L 2ZUQC 2C4XA 2C9AA 3RNQA 3RDTA 4H5SB 4AEHH 4LEOA 4YDLB 4HS3A 4X7SH 5TGBA 3TBVB 3QWQB 1CIUA 1LEKB 4G8EB 4OM1L 2OSLA 1KCVL 2VNCA 1T04A 1ORQB 5E8EA 4KRPC 4YWGL 3QIUA 4XNZC 4M61A 3QG6A 4RCAA 2R2EA 1BBJB 2QQKH 3DOSA 2X4PB 4DCQB 3KS0H 4GRLD 2FNBA 2R56L 3MUGA 5H37G 2X4RA 3QFJE 3PNWB 3HR6A 3GM0A 4OCYL 4G80A 4YK4B 1OM3H 3PHQA 3QEGL 4Z95L 3RVXD 4JG1H 2ID5A 5IHBA 3T2OA 1H5BB 4NZRH 4DW2H 3CVHA 4XP4L 2R2HB 1ZANH 2J5LC 3ZKMD 4UI2A 3CXHJ 1WBYB 4F7MA 4WCYH 2NX5D 1A3RH 4AL8H 3PV6B 3C5ZD 1AXTH 5F1OB 1MHEA 3BMVA 2C3HA 1ZHBA 3VXUB 3ZKXB 1FL6B 1LILA 1SYSB 3PDGA 1I4FB 1FNSH 1BAFH 4XBPB 3SO5A 5IJVA 5B8CB 3NMEA 5JA9A 1A7RH 1AGFA 5TE7H 1NEZB 3LEVH 1RZJH 4QRRE 4MHHI 1LMKA 3F7VA 4BQCA 5JDJA 2AK4E 2E7HA 3C5JA 1KIUA 5CAYB 3OL2A 5FGCB 5F9WC 4NYLB 1FVEA 4XAWL 3DRTB 4CVXB 4ZNEA 5INDB 1RJLA 2D7OA 1JPSH 2OMNA 4PD4K 5IESL 2WANA 1ZVSA 1Y6KR 4PJXB 1KN2L 1RIHH 1S7RB 2ED9A 3WSQH 1KJ2L 1ZA6A 3ZKQD 1H3VA 1UM4H 3VFPA 4EI5A 1LEIB 4M8VA 1T80A 3MODH 4Y7MA 3W39A 3G6JF 2GSGA 4PS4H 3K81A 5FM8A 4KZDL 2X4NA 5EBMB 3P0YL 2XTLA 4GRWB 2AJYL 1A1NB 2XFXA 4NO2A 5J56B 4OT1L 2EDLA 4HZAA 1HILB 2A73A 1QRND 1INEL 5KAQG 4XCYB 2FSEB 2Z31C 1X7QB 3DV6B 2D0FA 4OZFH 1U8IA 4MJID 1W0WA 3TPKA 3BT2L 3EYQD 5ESAB 4PJEE 4X80L 4B5EA 3IDMA 2VWEC 1CE6A 4S1QL 1JZ6A 4BSVA 2A6JB 3PP3K 3MRNB 4P2RB 4L3AA 2I9TB 5E7BA 1LK3H 1RURH 2E27L 3LB6C 4JHAH 1KJ2B 2P5WB 3MOBH 3RIFF 5CINL 1JPGA 1MF2L 1NCWH 2J6EL 3OJ2C 1I3UA 3QAZC 5DRXB 4XCCL 3UEZA 3UROR 5CD5D 3BE1H 2X9YA 4KAQL 3RVXC 2HJFA 3V2AR 2G9HA 2YXMA 5FF6A 3S8WA 2ZKHL 4WO4B 1ZS8A 2FYYB 4S1RH 3ZKMC 2NCMA 1BFTA 5IV2A 4XTRD 1L7TH 1R5IA 5SWQA 4M48H 2FZ3A 1Y18B 5JNYB 1MJUH 2CKBL 4P5KB 4PRDB 1FL5A 4WV1C 1MPAH 3MRFB 1OHQA 1KLUA 1Y0LA 4JO1H 4POZC 2NTSP 5AZEL 4FXKA 1NJ9B 1R3HB 3UTSB 4JKPH 5E5MB 4JFFE 2R8SL 3TBSA 3HLAB 1BF8A 1CGYA 2XXCB 2BMKA 3LQAC 4KTDL 2XXMB 2E6QA 4GRMB 2DLEA 2XZAL 3DECA 3CC5A 4WVRA 3SDCB 3L7EB 4YHPA 1KB9K 3IDGB 1NGPH 5C0BE 1BVLB 1D6EA 1HSBB 2OTWA 1JHLH 4ZUSA 5HVHC 4DZ8A 2GK0B 3HNVH 2R9HD 2CKBB 3CX2A 2WINA 3N1PC 4HFWB 1DTUA 2I9LA 4N90D 4R7NA 3FZUD 4UILL 5BS0E 4OD1L 1YEFH 1CGUA 4G8IA 4GSDH 4PREB 2QHRH 3O2WL 3B8YA 4JVWA 4Q6IC 3ARFD 4IMLA 4PB9H 5CILL 3GKWH 1KGCD 5HHMD 1JPTL 5D2LF 3IF1B 4ZSOB 5EOCJ 5E8OB 2Q76B 3O41B 5J6HB 3EYQC 1WEJL 3V7AG 3QRFM 4M1CD 4XPGL 3FO0L 4TSBH 1J05B 2IH1A 5CHNB 4LHUD 5EZIL 2GJZA 4QOKE 1JGVL 3WFBH 5M7QA 4ZAKB 3GSVB 5GRUH 3FQNB 5A3ID 2WLZA 1XGTB 5EZJA 3TWCH 2VR4A 4RFNC 1KTKE 2AXGB 1EAPA 1TQBB 5DK2B 4CRPA 2FH8A 3PIQB 3P4MA 4GW1B 3DXAA 1HQ4B 1Z6JT 5CD5C 3PWPA 4PD4J 3MZGB 1K4DA 2IAMC 1A8JH 3WJJA 5DTFA 2JIXD 2XYCA 1R3KB 2R2BB 1D9KB 1A21A 3VFRA 3MLWH 1JFQH 1MCFA 5C0AB 1EXUA 2HFFA 2CIKB 2WP3T 3TBYB 2VDPH 4NP4H 2ENYA 1V7NL 5CEZE 4EI6A 4KU1A 4IRJD 2BHYA 3T0AA 5J0BA 1HEZA 3W0WB 2BVYA 3A67H 3LAFA 2BVPA 4EXKA 2VIRB 5F9OH 2R0ZH 4JPIB 1HHKB 5GIRB 5T3ZD 4OCWH 2GYSA 2EH8H 4P2QB 1W0VB 3G5VA 1T03L 2Y23A 1KIRA 4I4WB 1PKQB 4XGZB 5CEYA 2D0GA 4KFZC 1UM6H 2A9NH 4F3FB 1IQDA 1A22B 5CD3B 5BZDB 3NACL 4N0YL 2WBKA 3VWJA 1ZTXL 3VFWA 3FRPA 1NCAH 3VXNB 3MBXL 3DRQA 1DUYA 2A2QT 1VKXB 4P5TD 4TVPD 3BW9B 3QULA 3Q48A 1A3LL 2ITCB 5JW4Q 4DAGL 4NQEE 3RGHA 3G5ZB 1TNNA 1RULH 3JWOH 2RFXB 1AY1L 2KQMA 2WUCL 4NQCB 1UZ6E 3JBG7 1M7DA 3DURA 4Y5YC 1NFDA 1N4XH 2CDFA 4NC1E 1XIWB 4GG6F 1NBZB 4ISVA 1OF2A 2P7TA 1BZ7B 2VXSH 1BIIA 5TE4L 2ZUYA 2DLFH 3MV9B 2XA8H 1OVZA 1UB6B 1L7IH 2GK2A 2WBJC 3ARFC 4LLYB 3SKNA 1NEUA 3HS0B 5CGYD 1CG9A 2I24N 2WV3A 5DVOA 3U30B 2YPLD 3BESR 2EO1A 4D0DB 3QIBD 2OL3L 3NH7L 2Y5TB 3IKCA 2XWJA 4R6UA 1BP3B 3DI2B 3Q3GB 2B5IC 2R1XA 3DHJA 3LD8B 5D6DA 2X89A 1PBYA 2F53D 5TQ0L 4Q9RL 4X7CC 4CUCA 1CR9H 3ZDXE 1FNGA 1TTFA 3RUGA 3MLZH 4MA7L 2DDQL 1UEMA 1QFUH 3B9KA 1KB9J 2P8MA 3L5JA 4ZFOL 1SJEB 4LKXA 2EIBA 3P0VH 4S2SA 1LP9B 3BN9C 4R4FH 4R3SB 1FE8L 4V1DE 1IILE 4G8EA 2BY0A 4XPBH 1MFNA 1ZAGA 5F3HB 5HDQH 4NO0D 1P4LA 2Q8AL 2OM5A 3B9VA 1BBJA 5L2KD 4IRJC 3OGOE 2X4PA 4P4KD 2OL3B 4YHMH 4QRPB 1IC1A 4I3SL 4J7RA 4CDGC 3KXFE 4OM0L 1MCJA 5E2WL 3OJDA 1WVZA 1AO7D 1MY7A 3RRQA 1LO4H 4B41A 5C7XH 4CMMA 1TZHB 3AU1B 1H5BA 5FA4B 2ZNXA 4Y1AD 1OAKL 5GS0L 4HV8B 4QLRA 2PXYD 2ED8A 3B6SA 3THML 2F8OA 3IDNB 1YEGL 1YNLL 4ZFOB 3UTTB 3BHBB 3U36B 1B6UA 2G75A 4JJ5B 4NQDA 3VXUA 1SYSA 3ARDD 2CMRL 1I4FA 3LEXB 4XBPA 2R29L 5B8CA 3MRIB 1BD2E 5T33L 2AJXL 2VDMH 4ZFGH 1JHTB 3FOMB 1NC4D 5DFTA 3CDCA 3CVIH 4ZOBA 1FC1A 3DMMA 5D1QB 2BJMH 2ZSWB 4NYLA 2JK5B 2QQLH 3FQUB 4N0RA 4HWEL 1M7XA 1YEHH 5EU7E 1P1ZB 4D9LH 1BZQK 2Z4QA 3DRTA 5INDA 3F5WA 3EOYG 3FB5B 1NSNH 2VQ1B 4GLRH 4DOHE 4RMVA 2CLZB 5CJ5A 4N1HB 4JKKA 4PJCE 5CGYC 3F7RA 3ZMRA 4PJXA 4KJYA 4Z7VE