5IMLA

Nanobody targeting human vsig4 in spacegroup p212121
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
119
structure length
119
Chain Sequence
GRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evaluation of a nanobody targeting complement receptor Vsig4 and its cross reactivity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords V-set and immunoglobulin domain-containing protein 4
total genus 27
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5imlA00
1F3JA 4PY7A 3L5JA 3CVHL 3O6LH 5D96B 1W72B 3D39E 3THML 4HD9A 4E9LA 1L7IL 1NQBA 2VL4A 4XX1E 1D5IL 2K1MA 1FRGL 3O8XB 5EU3B 5EOQH 1Q0XL 1WIOA 2XZCL 5HSFA 4OLWH 4IMKA 4JRYD 1FJ1B 5F21B 5I0DA 4PJ8C 2VL5A 2GT9B 5LAXB 5DQJA 4CJ0A 1WGOA 3O6ML 3C8HA 1YMME 1MPAL 3GKWH 4QHNB 1CLYL 2J88L 3SE4A 1TCMA 1S7RA 1BVKB 2BOCA 2XA8L 1Q0XH 4PJFF 3CPLA 3KYNB 4XVTL 3SDCB 4PJIF 2Y7QA 3NIFE 5DMYA 3GI9L 1B4RA 2DS4A 2DI7A 3JSSA 4J3SA 3WYRA 2LE9A 3V52H 4X6CE 1DQLH 3QIUC 4X7FC 1WFTA 1J1XL 5F88B 2DQDH 2OSLA 3X14A 1KT2B 1HDMB 5HPMA 4NO0B 2WP3O 5F1SA 4HAGA 5I1KH 2DMBA 5I8EB 5AWNL 3SBWA 4KUZH 2O93L 1K8IB 1GC1H 3QG7L 2BK8A 1HKLL 4RZCA 1R3JB 5KANG 1IM3B 2C1PA 2UVEA 5CJ5A 4ELMB 5T1KD 4WU7B 1KJ2L 5F8QC 4K3DL 5DMIH 3CCHB 3TJHD 1BVZA 3FN3A 3FOMA 4KTYA 1WWBX 4PREB 3Q3GB 2DIBA 5TE4L 4Z5RB 5ITFA 3PE9A 5IG7B 3NIDF 5LWYH 1YEHH 1GHFL 5GRVK 1ZA6A 4PP2B 5T1DH 2AXFA 3O4LD 1IL1A 4A6YB 3C09B 4L4VE 3BEVA 1V3MA 3EOAB 3VWKC 4GRWF 5T1MA 4KRPB 2KPNA 2DQJL 1FL5B 4HH9B 2QSCH 1X9QA 5IB2B 3SGDI 1F90H 3B5GA 4I2XA 4Y8DC 1MFAL 1HZHL 4KFZC 4XC3H 5F96L 3AU1B 4Z7NE 1VPOL 2AQ2A 1AO7D 3HUJF 3ZTJG 5BS0E 1Q8MA 1IFHH 4Z7UE 4NQVB 3LQAC 4HDIA 2YWZA 3IDNB 3WDIA 4CU7A 4D9LL 3GMOA 5GS0D 4Y4FC 5LGJA 4Q9RL 5AZEL 2VE6A 4C56D 4NQEE 1G7HB 5IFAH 1LK3H 3TIEB 2B0SH 5C0BB 3LKSA 2ZCHL 4HF5L 5F7HA 2O61A 4LAQL 2PKDA 4WUUB 5BCAA 4KK5D 1HXMA 4KI5D 1J0YA 1U91B 3CFBB 5BRZD 3WSQL 1A2YB 1PKQB 2MFNA 5JTWA 2VO5A 5DWUL 1IGIL 1KOAA 3FQWA 3D3VD 4MQXC 2IG2L 3BVNB 2XT1B 4PS4H 5C09D 4OGYL 4YEEA 5EORL 1DEEB 1K3ZA 1MCEA 3OR6A 4G5ZL 2X1XR 4JRXD 5IKCB 1QD0A 1G6VK 3L5XH 2OM5A 4F8QA 4OLEA 4NQDB 4TPRL 3NH7L 4LEOA 3RUGB 4LLMA 2JELH 2JCCB 1WLHA 4HMEA 4Y1AA 1N5YL 1KN4L 3OJDA 1HHJA 5I74C 5DJYB 2LAGB 4UT7L 1X7QA 2ZNXA 3S4SA 4YBLB 1IC7H 4WI7A 4MB4A 5GGVH 3ARED 4Z7WF 3BDYL 2E9WA 3SGJC 1JMXA 3RJDA 3V6FA 4CN4A 2QR0B 2FHBA 4KROD 4Y5XC 4PR5B 4KHXH 3GJEB 3QFJE 3STBA 3PP4H 1S7VA 3VE0B 1U0QA 2KUTA 3D3VA 3IJHB 4X9BA 2X4TA 3ARFB 1U3HC 4JM4L 4ODVL 3I50L 4P5TA 5IW1A 2NY3B 4OF6A 2VH5L 5AG9A 5KSAC 5FKAA 1DUYB 4DK6A 1DQTA 4BH8B 1NAML 4HKXA 3QRFM 1NLBH 4MDJA 1FFNA 2UYLA 3MROA 2WUCH 1A6WH 3TPUB 3DX9B 4YR6B 5EOTA 2HAZA 2OR9L 1KJ3H 3ROLB 3MBEC 3UBXI 2Z92A 4U6XB 3TO2A 3MBXH 3TA3C 3R0NA 1ZWIB 4OFVA 4FFWD 1WK0A 1P7QA 2VB5A 4IDLA 5LBSL 3SO5A 1I9RL 1NDMA 4JPVH 3VG9B 1MCWM 3LKRB 2IG2H 1Q9WB 1WITA 2VXTL 4F33B 4YXKL 2H26B 2CXGA 1MIMH 4ODHL 5DJ8A 3WUWA 5JHLL 1WAAF 1KELH 4LLDA 5F1IA 2NW3A 3BYYA 4RGOL 1MVUA 3KPNB 4L1DA 3WE6A 4P48A 2VDLH 4IRSB 1U3YA 5C6WH 3ZDYE 4K7PY 4GBXA 3L7FA 3RWHA 2QL1A 5D2LA 4XMPH 3GMRB 2IADA 3NBNA 4ZXBA 4HJJH 1ZGLA 1V3JA 4YDJA 5I30L 4RWHA 1IAMA 3BH8B 5TDOA 1DE4B 4UDUB 1EXUA 2YPLD 3ILPA 4XCNB 3FQNA 3RDTB 3VI3F 4LLWB 4WHCA 5DA0B 1UWGH 3KPOB 1U8LB 2VQ1B 4XVTH 4KKNA 4XBGA 1RIVH 1P4LB 4YHLH 4OZHF 2SEBA 3O8XD 2NY4D 3GSVB 4LLVB 4G80A 1U3HB 2HMIC 2K9UA 4DVRH 3G6DH 4PV8B 5C0AE 4CDHA 4JFDD 1Q1JH 2NY0D 2GUOA 5HHVH 1ZK9A 5D1ZC 3RBSA 1S9KC 3MCG1 3MV8D 5J9PB 2OXGA 4OFKA 3PHOA 5FKPA 1QYGL 2Z31A 4LLYA 1RUKH 1REIA 1A1NB 5DDHB 2NY7H 1UCTA 3BPCA 1X3DA 1IGTA 1XF4A 3P77A 4QRRA 4X6BB 1XGYH 3MLWH 3F58H 2EIZB 2FECI 1G9MH 5JHDA 1S7SA 3PHQA 4Z9KB 1OOAA 1HYRC 3FB7A 4JEGB 4K2UH 4TUKH 3JWDH 4KWUA 2ATKB 2H2PD 4LLWA 5CZXC 4HXAH 4LASH 4KRMB 5EO1A 4K8RC 2GSGB 3QIWA 4TTGA 4XH2B 1AXTL 3FT2B 4YHZH 2AJXL 4QOKE 3U0TA 3TBTB 1FPTH 2G9HA 3DETC 4NWTL 4WO4B 4G8GD 3MRRA 3RWEA 1RUPH 2VAAB 3MXVH 1I1FA 3GMLA 3P0YL 3CH1B 3U9UA 1IGCH 1PW3A 2QQKH 4JPWH 3RU8H 4M6OL 2YRLA 3ZT7A 4JHAH 5INDA 3S7GA 5JDSA 3MRHA 3QDJB 3VFWB 1IAIM 2C3GA 3FB5A 4TVPE 3N1MC 1IJ9A 3MLVL 1BJ8A 4GW5A 4WV1B 3I02A 1WC7B 5C6PB 4QHMA 1HIMH 4XNZC 4BKLB 1OPGH 3S8WA 1G7IA 3BP6A 1QHPA 2ERJB 2X09A 2OK0H 2IFFL 4PJHE 2OI9B 2RCSH 3HMXA 4ZXBB 4F37K 1MHPL 2A77L 1PY4A 1X5HA 3AXLA 4GOSA 3RGVA 1KJ2B 2XN9B 1SM3L 9CGTA 5FUCE 3EJJX 2XZCH 4R3SB 5ACZA 4DGVH 1I1YB 5ESAA 4QRTA 5GRJH 5D6DC 3ETBF 4TSBH 4MJIE 1DBJH 4X80L 3N85H 1RZJL 3SKOB 1KCSH 2IPKB 2B1AL 4I3GA 5IBUG 1M71A 3LPWA 3CSGA 1U3HA 3AVEA 4KGJA 5HGBA 3PGFH 5KTEH 3ZKXC 5FA4B 4TSCL 4U1IA 3VXOA 1VFBB 3L1OL 3MRPA 4MZ2A 3VWKB 3GRWL 4G9DB 4PJ9C 4GXUM 4HBQA 1FNGA 3U7YL 4OAWB 5E7FA 1E4XL 4H20H 5JQ6L 2P24B 1HHGA 3GNMH 5EZLB 4MCYB 3IDJB 4UT9H 3H3KA 5KSBF 3U6RA 3VRLE 2ZSVA 3NTCL 3T0BA 1T04B 5JQ6H 1DJSA 2DDQH 3ESVF 5FUZH 5D71H 4PJAB 3QUZD 4TRPL 3C60C 2MQ3A 5C86A 1MCRA 1FBIH 2A9MH 3QB7C 5D2NB 2ILLA 3FO1A 1FPTL 3SCMA 4GT7A 1U3HD 1BZQK 3HC3L 4JFXA 3SE8L 1NAMA 4OIAA 5DZOA 3KJ4C 3MV7E 4EI6B 3O4OC 1RJLA 2R15A 3AM8C 4HZLB 3MV8B 5D71L 5HYJA 1B0GB 1B4JH 3WIFB 2PYEB 1CS6A 3PABA 4LCCC 4IMLA 4PJ8A 4U6TA 2W9DL 3H42L 5CGYC 2C1OB 1LP9B 3NOIA 1Z0MA 4LP5A 3AREB 3G9AB 2R0KL 4PJ7E 4M7ZC 2A74B 3WS3A 4LCCB 5DD0L 4KTDL 4JHBA 5T33H 2AK4A 1Q94A 3HI5L 2V9QA 4X7EC 3WJJC 2JB6A 4WHDA 1ZVSA 2NY6C 4KV5F 4ALAL 1OGAA 1YEIH 4MLSA 1ZS8A 1HHIA 5D2LF 1EHAA 1QUNA 1RULH 3BEWB 4OSUH 4EI6A 3X3GH 3N1QC 4TVPH 3P0VL 3QXTA 4HIJB 4X5WB 4ZUTA 4QNPF 2Z0BA 4K7PX 4AK1A 3MV7A 3GM0A 5GZOC 1UA6L 3MGOB 2PTUA 3CUPB 5CKAA 1QRNB 4JFYB 3OXSA 4LEXH 1VB9A 4H1LB 4HEPG 3GBMH 4KY1H 3SE9H 1AQDA 3G9VA 4KHXL 5C70A 3MRNB 2N56A 5EBLB 3VXPA 3DX8A 1MHEB 1NGPL 2WUBL 3KXFE 3CK0H 2YD1A 2XN9D 4TUJA 3HZVB 2W07A 1FO0H 1WBXA 4RGND 5T5NF 3O0RL 4PRHE 1CZ8H 3DO7A 5C08B 4IRZH 4F7TB 1ITBB 4S1RL 3RKDC 4XP4L 3VA2C 1WIUA 3DX6B 5CINH 4ZPTB 5E8PB 1RZKL 1MFEL 5B8CA 3NFNA 3L95A 5DQDH 2Y5TB 1KJ3L 1JHTA 3LEYL 4ZUVA 4M6AA 4BFBD 1CQYA 5CEXB 3DRQB 4ZO6A 2R8SH 1Q9OB 4MNQD 1J05A 4OZHE 3KAAA 5MENB 1I7TA 4R7NB 5SX4I 4GG6F 1NGZB 1GVIA 1QPPA 5D70L 3RY4A 2ED9A 2ZUTA 2P45B 2D2OA 4MJIA 1KLUA 4RNRB 2YSSA 1L0QA 3U46B 3B43A 3EJYC 3S96A 3KYOA 3DO7B 1N59B 3B9KA 1IGTB 2EO1A 4YBQD 1TVHB 3DWTA 3V0VB 2A6DB 2ZUYA 3WD5H 2D0GA 1FSKC 3DUSA 3BPOC 3ZZ1A 3MLPA 5KVGH 3JVGC 5JO5B 5DO2D 4CL7A 2FX7H 4RZCB 3ZE2E 4G6ML 3U83A 4Z8FL 2F54E 2OBGA 2FH8A 3QQ3A 3KLAB 1LO3L 1ES0B 1H8NA 3CVIL 2MSPA 4U6HB 1ZHLA 4U1GB 3G6JB 2CO6B 2H3NA 1JP5A 2ZJSH 3S3PA 5E56A 5T1KA 4L3ED 1FGNH 1LO2L 2NZIA 4ZPVA 1KB5B 5JORA 5IMKB 4HJJL 1K8IA 2IFFH 1UQSA 3KPRB 5F3BB 4X8XA 4FQLH 4RAHA 2FYYA 5SWSB 3DV4A 4M1CC 5INCB 4P2OC 1JMZA 3UAJC 4BZYA 1FZJB 3SDAC 4XPFH 4OCRH 5DO2C 3QEQE 3VFGH 3HNTL 5DI8A 3JV4A 4LLUA 4TUOB 4H5SA 1KCRL 1K4DB 4M61A 1LO0L 2EDLA 5FO8B 4M6ML 3IDGA 3GRWA 1SYVB 4BZ2L 4LF3B 3BKMH 5TF0A 1FYHB 4JDVB 4ZPTA 1U8MB 4OZGA 1R5VB 3TVMD 1J0HA 1QSEE 3IT8D 1KJ2H 5EZJA 5DK2B 4ZXBD 3FT2A 4OLUL 4CU8A 4XP6L 1E6JL 5IMOB 1NFKA 3ARDA 2BNQD 4QRQB 4XP4H 3SCMD 2P48B 2BNUA 3W9EB 3C2SA 4K3JL 3OGCB 1GC1L 3AROA 3SY0A 4APQD 4KK5C 4XVSH 2A6IA 3VGHA 3KLHC 4NHCH 4LVNC 5AZ2H 2BSED 1OAQH 3EO0B 5BZWA 3ZDZE 2EDHA 4M6OH 4XMLL 1MLBA 3CFCL 5ADPH 3U2SA 3GSXA 1RK1A 3F58L 4LLQA 4MA3B 3KNBB 5I8CA 2BVQB 5IBTH 4P5TD 5CEZE 3MFFA 1AGEB 2PN5A 2E6PA 4K71C 3U1SL 1YY9C 4ZFFA 3IS0X 3RZCD 1N64L 2VNCA 4FNLH 1S3KL 3QQ4A 2L7UA 1FH5L 2GTWB 2R29H 4Y88A 1BJ1H 3JWDL 4QTHA 3PQYD 2D7TL 4FQ1L 4U3CA 3LS5H 5C08D 5TE7L 1I1RA 5J4MA 3H9SE 1NC2D 1IQDB 3HR5A 4DK3A 4Q97A 3HNSH 4X98A 1I8MB 3NN8A 2DKUA 2XWTA 4FRWA 3KXFB 2BVQA 3P30H 1JGEA 1R3LB 4OM0L 3CVHB 3BN9C 1Z9MA 3F6IA 5DFVC 5FXCH 4I0PA 3FQXB 3TBYA 3ULVD 5CBEB 1W8OA 1RZFH 1I3GH 1AJ7H 4ISVA 1BZ9B 3QIBB 4KKLD 3T3PE 4I18B 4TNVF 4GKZB 2VLMD 4ZXBC 4YK4B 4OI8A 4PGEB 2R4SL 5CEZH 1B9ZA 3MACH 4GG8B 1I7RA 5F3BA 5MEND 4U1IB 2EE2A 3VXOB 4QGYA 5H37G 1T2QL 3LN9A 5D7SL 2CIKA 3WFBL 1E4KA 2XZZA 5KANI 1T03H 1MCSA 2APTA 3V79C 5E9DD 5IOPB 1C1EH 3T1FB 3HPJB 1YEJH 3WUWB 1UM4L 4P49A 4BH7B 5EORH 3L3OA 2VZOA 5JHLH 4OCYH 2JTDA 3W2DH 3RTQA 3PWVA 3A67H 4XCCL 5IVOA 4LF3A 4XVUD 5EO0A 3LS4L 3CSYA 1ZANL 3L7EB 1HHKB 2NXYB 4GMSL 1U8JA 3X17A 2EXWD 2GEEA 4KAQL 2H32B 2BDNH 5FGRA 4DEPC 4G42A 2VXQH 4A6YL 5E2UL 5ERWA 3FJTA 5EBWA 1BD2A 1JK8A 2JJVA 1J12A 1JRHL 4XVUC 1BMGA 2ED7A 2KBGA 4ONGH 3VMPA 3GBML 1N5AA 3H8NA 1D6VH 3MRDB 4Q0XL 1LO5B 2WP3T 4CVWA 5EZIH 1XGUA 1XCTA 1IILE 4AEIH 5EZOL 2BCKA 4NJ9H 4HDIB 4X6EB 3VFNB 5IF0B 3LH2H 3QUYB 3SEPA 1OWWA 3MXWL 4JQIH 5IK3A 1T7YA 1NBYA 2VLKD 4NN6B 2R4RH 4F33A 1T66D 1U93B 5D7LB 5EZOH 5I17B 4MQTB 2EDTA 1T1WA 1MVFA 1P4BH 1JNHA 5AYUL 3MLYH 2DQHL 3MJ9L 3TYGH 3ZKND 1U6AH 1J0IA 2FEEI 2A38A 1NCBH 1RUML 2BNQB 3OB8A 1DLHB 2W65A 3QG6A 4N8CH 3VG0H 2H1PH 4PGEA 2HJLB 3ES6B 3FB8B 1RI8A 5F71A 3P9LA 5B21A 3B9VA 1KENL 4GAJL 3DXAE 5I1IL 1E4WH 2NQCA 5E4EC 4RGNC 5K9JL 3IGAB 1VKXB 3ARFA 4P5TB 3WV0A 4AZ8A 1F3DH 2CDEA 4MXQC 2EYSB 4MNQB 5E6YA 4JFDA 3BFOA 4JGJA 2J6EH 1TITA 3QEGH 4DWHA 5BRZE 1GIGH 3L5XL 2PW1A 1RULL 4OSUL 4DW2H 1LO3H 3BMVA 5AD0A 1TENA 4PGDB 2Z35B 4PJXE 3D0LA 4M62H 5IROC 4Z5RA 2W0FB 1SY6H 1V7ML 1JK8B 4PRBB 4JPKL 5F7UA 2QSVA 4LSQH 4X80H 4KZDH 4KJPC 3MRGB 3ULVL 1WTLA 4G6AC 3VD7A 4OZIB 3D3VB 4GS7B 4D2NA 1XFPA 2NY3C 3N06B 3GIZH 2O5ZH 4HH8A 4YDIH 3MREB 4N9GA 3EOBB 4HKXB 4L3EE 4WI2A 3C2AL 1ULVA 2WIIA 4ORGA 1CWVA 3G5YB 3GRWH 4L9DA 1BF8A 1KPUA 3NTCH 3QI9D 4NT6B 1UB5B 1LO0H 5E2TL 2MPAH 3IJYB 3WNPA 4PFEA 2Y36H 3OL2A 5CMAB 3ZLQC 1RIHL 4HUWB 1CQKA 2Q6WB 3C87A 5HYSG 3VH8A 1CXIA 4FFVC 1JPGA 1CFNB 1YA5A 3HFMH 2HVJB 3BP5B 4OLUH 5CP3H 1HNGA 2HLFD 2CKBB 3VXSB 5FKAB 5D9SA 4RX4D 3L3GA 1JIBA 1TNNA 5DVMA 3QNZA 1CLZL 1AI1H 1DZBA 1HNFA 3MGTB 4IOFD 2ZUUA 4G7VL 2G5BA 4BSVB 4R0LB 4OLZH 1W72A 4YBQC 5IQ7L 1VFBA 3MRPB 4WVRA 1UH4A 4BQCA 5J06A 2NY0C 2YN5A 4M61B 4P9MH 3MRLA 1FSKB 3DIFA 5KVGL 1GGBH 2DBJA 1E6OL 5E9DA 3F7YA 2EICA 3IDIB 4XPBL 4JZJA 2CKBA 2H2SC 3LHPL 2MQCA 3H42H 4PP2A 1IC4L 4ELKA 3P11H 1U92A 5FB8B 1INQB 2B2XH 5DF0A 1QRKA 5IM7A 4NO3A 4G6MH 3RAJL 1J88A 3IDMB 5FYKE 1CFSB 3ZO0A 1JYVA 3RTQD 4WI6A 1VEPA 3GGWB 3CDFA 5JW4R 2CLRA 1I1AD 1I1CA 1ZVHA 1JF6A 4U1SB 3T0WA 1TETL 2H45A 2NTFB 2EYRB 5HGDB 3SE3A 4PJ7F 5HHNB 3CLFL 4YDLB 3QWRD 4NO5B 2X89A 4UMGA 4AH2A 2VWEC 3L3DA 1K8DA 4P4KB 1KJVA 3D25A 5B8CC 5FGBC 2VZTA 3T0DA 4XP5H 4YNYB 3G6DL 3UBXA 3D39B 2OCFD 2XFXB 2Q7YB 1EH9A 4JRXE 2HP4A 4G8GE 4D0DB 5HD8C 5DXWA 1E4XH 4DN3H 3QBTB 2P8PB 2AEQH 3OR7A 3REVA 3VXME 3MMEA 1LE5A 4GAGH 1AGCA 4WFHD 3PHQB 1YEEL 4MA8L 4NYLB 4BZ2H 5FM8A 4FXGB 1UB6B 2NY5L 3LDBC 3LEXA 1VFUA 1O7SA 4YHZL 1MQKL 4TVPD 2A9ML 3KHQA 5DHVB 1QQDB 4MD5B 5FA4A 1IAIH 3GMQA 4Z78A 3R1GL 3GSNH 4K2UL 2QHRH 1B6UA 2R2BB 3TBTA 5DFWH 3OAYK 4OIIH 5DEGA 1FORL 5FGCE 4PTTA 2Y5EA 5GZND 3RGVD 4XPTL 4HC1A 1BQSA 1F6AA 2EH7L 3PP3K 4R90L 5L8KB 3FTGA 3DVGB 1I8LC 1FVCB 2Z8SA 5EU5A 5LCVL 5IV2B 3D69A 4YHMH 1W0WA 4LOUD 4TULH 4NC0B 4YQXL 1SJEA 2XZQL 1CG9B 4N0YH 1GGCH 4X6CF 1N5AB 3MRDA 1MJ8H 4JDZA 1A6TA 4YC2C 3BHBA 1VERA 1LE5B 1VGKB 1INQA 5EIVA 2JB5L 4EXKA 4NZUH 5BJTA 1OLZA 4G8EA 1LHZA 2CLZB 2VDLL 5GGTL 2CRMA 2YEZA 5DJAB 3KPSB 4XNYL 3Q5TA 3NCJH 4MMXC 5K9KB 1YEIL 5CJXA 3E6HB 1MI5A 3OG6B 4G8FB 4PP1D 4GBXD 3GJFH 4M4RA 1J11A 3WNKA 4KZEH 3B5HA 3M45A 3O8XC 4ZOCA 3ULSB 2D7MA 2JK5A 5D2NC 4PBVC 4U6VL 5EU7C 2EYRA 4UAOC 4PGCB 3W2DL 4ZUWB 2KH2B 3HI1A 2GTZA 5KBNC 2XXCB 4IMKC 2ARJA 3CFDA 4HUMB 1J0JA 1T7VA 4JFFD 4Y2DD 1T03L 4Y4HD 3UDWC 4TOYH 4R26H 4NQEA 3C8DA 2P49B 1A7QL 5D93B 5IB3A 1TTUA 4R4BA 1JZ8A 3PWPD 2PXYA 1JL8A 4M43L 4O4YL 4RFOL 2CGRL 3E1F1 2OJZL 1S9WB 5A2KH 3TT3H 1XGRA 4JAMA 4M7KH 1GGTA 3E8UH 5C0FB 3BX7C 2QLVB 4K94H 1IARB 2EEDA 2J8UA 4IJ3C 1NCDL 1T22B 2C26A 1IZKA 4K7PH 4PRNA 5D2LB 3SJVD 3TGXA 3VXQA 2DQCL 1DSFL 1A6ZA 4CW1B 1Z6JT 2AEQL 3T0EA 4NJAL 3OWEA 4NQEB 3JTTA 2FIRT 1MJJA 3UO1L 1BEYH 4LKCB 3WXWH 1NC4A 4JZJC 2HG5A 4M1GL 5IWLA 3JVGA 2VXVH 2UWEB 4PJAA 1HDMA 1F4XL 1J8HB 4P3DA 3Q6FA 3RDTA 3K46A 1XH3A 2WBKA 5EZIL 4URTB 4NO0D 3U4AA 5FA3A 2YA1A 4EI5B 2NPLX 4HUNB 1J1PH 1JCKA 5E6IC 1KCUL 3DURB 3U4EA 1T6WA 1KEGL 5FF6B 1MELA 4DGIH 2CDGA 3HAEA 4I0PC 4PRAB 1JGVL 4ONFH 1T22A 4M3JA 5BJTB 3BW9A 3HZMB 4HK0B 3KNBA 2X4PB 1HE7A 4WU5B 1BAFH 5B22A 4Z7VA 4RAUB 5CP7B 3JUYA 1QFWH 4WFFE 2FATL 4MSWA 1F45A 3S3JA 2PR4H 5I2IB 3WJJA 1MAKA 4YBHA 3C6SB 4DUXA 1IGIH 3MV11 2GK0A 3TZVA 4ELME 4MYWB 3V6ZB 2OR7A 5JXEA 2AJUL 4X4MA 3ULVF 4P23C 1NLDH 3H0TB 1S5IH 1OWRM 4EQ3A 2UZIH 1W8NA 1HHHA 3N1PC 3LKQA 5C0ND 4F7CA 3O6LL 2AV1A 1EFXB 5T1LA 2NZ9D 5D2NE 4CMMA 4R0LA 5TDNA 3R06B 5MEQA 15C8L 4LPXA 1JNNH 3P0VH 1IC4H 3IFOB 2PETA 3LOWA 4MAUH 5J12B 4NUGL 2V5TA 1SJHA 3I6KB 1AGBB 3RWGA 4NQXA 5L2JB 2H3NB 4P59L 2BVPA 1A4JA 4KKCC 5BZDA 4AL8H 1M05A 4NP4H 4R96A 2PTTA 1MCWW 1BVLA 12E8H 1YN7A 3VD5A 1HILB 4UI2A 1P4IH 4XNQB 5LVEA 5HDQL 4JM2A 4O58H 1NMAL 3BAEH 2QEJA 5I1LA 5IB2A 4DN4L 1CZ8L 3ARGA 3BUTA 4M1DH 4C56E 3PGDA 3BE1H 3EHBC 3BVNA 1GHFH 2ESVA 4PLKD 3TT1L 4J4PC 1ZHBA 3CLFH 4TSAL 1R3KA 3KPSE 2XA3A 1SEQH 3VWJA 1QRND 4PG2A 3U46A 5ICZA 3O3BB 1E28B 3KWWB 1UWXH 4Y4HB 1Y18A 3LIZH 2OZ4A 5C09A 3MCLH 3O0RH 1KGCD 5BVJA 2YKLH 4X5XA 2GI7A 1EEZB 3FHAA 2EDEA 4KDTC 3MMEB 3BZEA 2L7JA 3O3AB 4I13B 4Z7QE 3LRHA 4OBSA 5K9OA 3LEYH 3TBSA 1T1YA 5HHOB 3O3EB 1BGXL 4L5FL 1KT2A 4XPHL 2NYYD 1SEBA 5FYKL 5DQ9A 2E7HA 1S8DA 1ZT4B 5KG9B 4Y5YA 1MAMH 3UJTL 1YMHA 2CMRH 1XZ0B 3X13B 4LAQH 2OP4L 1T0NA 2EH8L 3EYVA 4KK8D 3UDWA 5J56B 3UZEA 3MLYL 1AHWA 1XGQB 2UZYB 4I3SL 3UBXB 4KK9D 2AXGA 4BSWA 3WFEL 1NGXB 1U3ZA 5JA8B 3GSXB 1PX4A 2FWOA 4OZIF 3KXFA 1HXYB 3RPKA 2JB5H 5IROA 3V52L 1MIML 3DYMA 3IJSA 3IU4H 4HGWB 1MCJA 4FMKA 2CK0H 3S36X 1T4KA 3CIQA 5H2BB 5DWUH 4F7TA 4OZHB 2MJWA 5EB9A 3G5VB 3WL9A 3O2WL 1CGWA 4M6NL 1PZ5B 3EYUH 1BX2B 1MIEH 1DQDL 4RMVA 3QIUD 2DLFH 3OKOB 3EO1A 1C5BL 4GW4B 1NMBL 2J7LA 3ARGB 4G6KH 4QRPE 4AQOA 2XKNA 3HPLB 1TJGH 1G1CA 3FT3A 1EERB 1CF8H 3QXAA 3ZE1F 3AY4C 4K71B 4MJID 4YH6A 2FJGA 5C2UB 1G6RL 3BI9X 4DUVA 1A4KA 4K3DH 4K9EH 1BLNA 1U8NB 3HMWL 2BDNL 4X6DF 4RQQB 3LB6C 4F2MB 5ID0A 4X6CA 5IR1B 3OGOE 3UC0L 3QDGE 1CICB 2IALB 4GRWH 4Y16B 2DDQL 3ARDD 4ZUTB 1YYLL 3C5ZB 4JM2D 5D93C 3U4BH 4NQCE 4TPRH 2Z8WC 3SO3B 4OF8A 4AY0A 2UZXB 2V5RA 2GT9A 5C07E 1G7JA 3MLRL 5CWSA 5E8PA 1WT5C 4LSDA 5EFIB 5TH2B 1ZGLM 5FO9A 2V2WA 5I76A 4WW1A 1V3KA 1NAMB 1CXLA 3SE8H 4JFOB 4AEIL 2MPAL 3I2CL 3HN3A 4N90E 4PUBL 5J6HB 4HFUH 5EPMB 2ORBL 2EH8H 4WENB 1NKOA 5EG6C 4A2LA 5CLWA 5HYIA 3VXPB 1PSKH 4HUUA 5DRZA 1LEGB 4J1UB 2ZUXA 2YBRB 5KAQG 2A73B 4F7PA 5FAAA 1PQZA 2X4QA 3RFZC 2X9XA 4R97C 2R1YA 3SJVA 4MXVF 3NACH 2OK0L 4IM8A 4PJGE 4WUUA 2KZ1B 3LS5L 4R7DA 4OZGF 2CDGB 1DR9A 5TGBB 5DEFA 1FYTB 4C54A 1F97A 3P11L 4O2CB 4JM2F 4S1DC 1AKJA 3WLWD 5IMLB 1IVLA 3SGKA 1A1MB 3OXRA 3VFPA 1TZGH 4FFVD 1J8HD 4OQTH 4F57H 5HI3C 5KVEH 4R9HA 2EZ0C 2LFGA 2HG5B 1WBZA 3UZQA 1MSPA 4K94C 3T1WA 4IIQA 1CLYH 2J88H 3OJMB 2YSSB 1NGQH 1P7QD 4IRJA 2F5AL 3L3JA 3MLSL 4LGSB 4V2BA 5FDWB 2AQ1A 4AT6A 4Q2ZB 4FMFA 3EFDL 1LO5A 3WMSA 5DJYA 4H20L 5KOMC 1JZ4A 3OV6A 5CEXA 2ZZUT 4KQ4H 1OF2A 2EYTB 3BWAA 1JRHH 4XZUB 2XOTA 3QJFA 4LGRB 2D0HA 3C5SB 5HHMD 5GJSH 1WICA 1MWAH 5FUCC 5CBAA 3ULVC 1FG2A 4CDGC 4R4FH 4OTXH 3EGSB 5D7IE 2NY5H 1JTOA 4X4XA 2C9AA 3LSOB 5J7CC 4O58L 1AHWC 1IGFL 4PJHB 1YDPA 5I8EA 5DJ6B 1D5XA 2ZPKH 5I1CL 5HPMB 2V2XB 1RUPL 2NY1B 5DJ0B 1LK2A 5GSRB 2G9HB 3TT1H 4HIHB 2E6QA 4JGUA 5E00B 5B39G 4MJIB 1YN7B 3REVB 1YEKH 4KKBD 1HHGB 4LASL 1I7TB 4R7NA 4P57A 5GGRB 5KS9F 3FO9A 2LQRA 1JPFB 5FYLH 3MA9L 1BEYL 1VADB 3RWIB 1AGBA 2GJ6B 3GHEH 1B2WH 1XEDA 5IQ7H 3ZL4H 4YHNB 4PJDE 1VESA 4GKSA 5JLZA 1ZLVK 5HI4D 5GGSB 5BVJB 4P2QD 3V0AC 4ONHA 2MCPH 5KVFH 5FYLE 2FNBA 2V2XA 1A1OB 1BOYA 4XMKH 4NBYB 1QRNE 4NO5A 4Z18A 3P30L 5J57B 1HKFA 5ISZD 2QQNH 2XRAL 4I2XB 3EDEA 5J9PA 4G9FA 1DP0A 1J7VR 4M7LH 5KJRH 5IW6B 4X7DC 1RJZB 1QFWL 4MXVE 1Q94B 3VD4A 2D7QA 1IEHA 1PEZA 1XGPA 5I1IH 3VFMB 1ORQB 3HC4H 5KVEL 2XQBL 4G5ZH 3WO4C 4DFHA 3GBNL 3WIHA 5KAQF 4ZTPL 5C07B 5E2VL 3IFNH 4RAVA 4M7ZB 1OGTB 3MRQB 5EOQL 1RURH 4I3RL 5EU6D 2AXGB 3UX9B 4ELKB 2ESVD 3VGAB 5B3JF 1FHGA 2P8LA 1ODAA 4FFZH 1T20B 4ERSL 4Z7OE 2XWTB 3F7PC 3A6BL 1QBBA 3DUUA 2Q7YA 4PRHA 2IFGA 1YMHB 3MV7B 3O3UN 2XPGA 3QWRA 4L4TB 2EIEA 2GUOB 5D7JB 1JHLH 2BP3A 5F1NB 3RQ3A 1R3LA 1P2CB 4JQXA 2Y07L 3O11A 4MXWH 5F8RC 2VDQL 1NL0L 2YPVH 4PJBA 3MLTB 2W38A 1RZGB 3C60B 1G7PA 4PGJA 2CR6A 4LLAA 4O5LH 4FQIH 2A9NL 1IGYB 4JLRA 4QHKJ 4RMUA 4UT7H 3AS1A 3X11B 2JJUA 4YGVA 1Z3GH 2AV7B 3TT3L 5HY9A 2GIYA 4TRPH 2IGFH 5I8CB 1W72L 3SGKC 2H32H 3ARXA 2KQNA 4H1LA 4I4WB 1BIHA 1DSFH 4J7RA 5KSUB 5DFVD 4L3AA 2IBZY 4ZUSB 1IM9B 4P3WA 4ODVH 1KCLA 3CXDH 4IHOA 4HV8B 3G5XB 2AK4E 5D72L 1J87A 5T5FL 1RQ5A 5GS0H 1U6AL 2AJYH 2W1NA 4X5WA 1GPOH 3SOBH 4PJCA 4RGNB 2FATH 2DMKA 4OZFB 3Q2CA 5J11C 4RWYL 2AS5M 3EDKA 2ZG1A 1EJOL 1HH6A 1OARL 2EH7H 1UZ6E 3J7HA 5C9KA 4LSPL 1DQQB 1YQVL 1ZVSB 2OJEA 2UYLB 1UENA 1HH9A 3H6JA 4I9WE 4EN3B 3MA9H 3VXNA 2R0ZL 4ALAH 5J6GB 3D5OF 3BW9B 3RVVC 1RUAH 4PLJC 4FHBD 2CMRL 3QZWA 5LGKA 2XY1A 5DVLA 3QULB 1JWUA 3MGAA 1RZFL 3QNXB 1D5MB 4OLXL 4R6UA 1F4AA 1HHJB 3IFNL 3PABB 5CJQH 3GUTB 5HGGS 3QO0B 3IVKB 2CDEB 2EYSA 2VDPL 1MCOL 3OSKA 3G6JA 5DRZB 1JWSB 2GK0B 3TZVB 5JXAL 1JZ2A 1J8HA 3DO3A 4I0CC 5I16A 1T83C 1F2XK 4JM2C 5FYKD 4RX4A 3S4SB 4RFNB 1QBLL 1UQSB 3KPRA 1JHLL 2VXQL 3SHSA 5JOFA 4NRYA 4OZ4B 2HRLA 3OKEA 1QA9A 3UTQA 3KPLB 4IRZL 4TUJB 3D0VA 2WINA 3GSRB 3BD4A 5JMRA 3C2AH 3P4OB 3OAZH 5DRXB 4LVHC 2O5XL 5DHVA 1KSRA 1YNTA 4MVBD 1GH7A 4J6RL 4QF1B 4Y89A 1CDBA 4QXWA 5FECB 3HRZB 3FB6A 4PB9H 4KDWA 1BQUA 1S9VA 4EUPA 1AR2A 1DUYA 5FYJL 2Y4SA 2OL3A 2F54D 4CNIA 5KN5B 2VDOH 3OKDB 4O02H 4HG4K 5BXFA 5C0RL 2JF1A 3WEXB 1F42A 4HGKC 3OF6D 2QV2A 3TM6A 4Q0XH 3M17B 3MC0A 5BVPH 1AI1L 3K1DA 5IBLD 5FV1L 4L4TD 2JIXA 1S9YB 5HYEA 5EUKA 2WK2A 1WBZB 4TSAH 2X41A 5L8JB 3O45A 5KZCD 3EIFA 3OX8A 3QJHA 4NHCL 1EEUA 1QO3B 4PJHA 2D7PA 3KPRE 2OSLB 4C83B 4J3UA 2AABH 1ZT1B 1AR1C 3NCYP 5K93A 1OTTC 5TDOB 1NAKL 2IQAA 4JAMB 3C60D 4NM8L 1YNKL 3NIDE 2PO6B 2HJLA 4UOJA 1MCQA 3L7FB 3RWHB 4D8PA 1DLHA 2DLIA 3FAWA 1JZ6A 5HHMB 1L9NA 1FL3A 5D5MA 4H0HB 5FCSH 4K3GA 5JZ7C 3VRLF 4RGMC 1FG2B 4H0GA 4N90D 1A1NA 5DDHA 2XTJB 1ND0A 4HIJA 4AT6B 3WDJA 3E3QC 5F9JB 4UB0H 1VEMA 5HDBF 4CVXA 4XCYB 3MRIB 3D25B 5TE6L 1HWHB 3GSOA 1AJ7L 2I9LA 2YS4A 4XPBH 5D7KE 2GJ6A 2JLLA 5E4IA 4ZNEA 1F58L 2O61B 1UVQA 1EHXA 3IFPA 3QHFH 2VLKA 5GGTA 3NFSH 3IAPA 5ADOH 4OUOA 2R9HD 2CXKA 4XNUL 4YUEH 3WIHH 4LVNB 5GIRA 4YHIA 3FCTA 2GJ6D 3I9GH 2PXYC 4Y4HC 5EIQA 4PLKC 5DJDA 1ORSB 4PJFE 2X89D 5EIIB 4NRZB 5FM5O 3KS0J 3R06A 4D3CL 4YHYC 2ATKA 2N7BA 3HUJA 3FMGH 3PQYE 1Z5LA 4R2GB 3K2UL 2Q87A 1OY3B 4LHUA 4ONGL 4MWFB 2JJSC 3IF1A 1T21B 4JO1H 1E6JH 1IAKA 5J3HD 5IKCA 4QHLA 4E0RA 5CMAA 4XMLH 4A6YH 3N9GH 5HYJD 4CVZA 4NT6A 1F13A 1RZ8A 5AZ2L 2VQUA 5ESQB 3DYOA 3QH3A 3FQWB 4YXHL 5DTFA 4LLQB 4XC1L 2NY6D 5HHVL 1T21A 3IXAA 5CILH 5LJYH 4LKXA 1QFWM 2OTWB 1IKFH 3M1BA 2NX5B 3T0EE 2P24A 5DHYA 2IBZX 2K3TA 5E03A 1EHLH 1CD1A 3SKJH 4NM4L 5C0EB 1QFUL 4LCWB 1G7PB 2CK2A 2IAMD 3MUZ1 5GGVY 1VEOA 3Q6GH 3TC9A 4V1DA 4U1MB 2DYPD 5ESVA 2VC2L 4FXKB 2AAVA 1MPAH 5E2WL 3UTPD 3RX8A 1X4XA 1QFWI 5DTFB 3VXRB 4OZIE 2ZKHL 2W9DH 3TZVC 2ICWJ 4M3KB 4PJEF 4BK5A 3IDJA 1MEXH 1AGEA 4D0BB 3TFKC 1KCKA 2J8HA 3D2UA 2WV3A 3DUUB 3KLDA 3RWGB 2C3XA 2B4CH 1F00I 4MQXD 3HI5H 3HE7D 5IEKA 3IDXL 1I3RB 3DGGB 3GZKA 5DHYB 4X7SL 1DBBH 3VXTB 2Z4QB 2A83B 3ZYIA 3FO0H 1M7DA 4PV9B 3RUGA 5F7MC 3QEQA 3QFJA 5FHBH 1LO4L 3PNWA 4YXLH 4MHHI 3HUJB 3LZFL 1F2QA 5FOJA 5FUOH 1CI5A 1ED3B 3B6SB 1ZHNB 4PLJD 2CUMA 2EEAA 1DEEA 4KMTL 4ODHH 5TQ2L 1R3KB 2C3HA 1M7IA 2IH1B 4ZUUB 5AUMA 3W5MA 3QEUB 3VFOA 2LV4A 4KRNA 1NCDH 5IB5B 5I6XC 3EYUL 1ZHKA 4HT1L 4S1RH 2ZSVB 3VFVB 4PR5A 2NR6D 3D18A 1A7PH 1J9CT 3ELAT 4OT1L 3NFSL 3GK8L 4LRNL 3KYMA 2EDOA 3HAEB 1BFTA 1NGPH 4GAFB 4UINH 2RFXB 3L6FA 4LSRL 1EV2E 3UPCA 3TV3H 1UM6H 3I75A 3RWCB 1GCFA 2R2EB 4UZGA 1A7PL 5SX4H 4APQC 3VFRB 2DD8H 3FN0H 3ZDXF 3HG1B 3BHBB 3ET9F 2G2RB 2D31A 2X42A 4OLYH 3K3QA 2Z91B 2ICES 3HC0B 2IADB 2AXHA 3CFEB 4MNQE 3D18B 3FQUB 3NABL 2DF3A 2HWZL 1XT5A 1A8JH 5KS9B 3QI9A 1MCNA 3NA9L 3MRJB 1P53A 3UTQB 1WVZA 4U1LB 4WEBL 5KW9L 4ZSOB 3CFKB 5C92A 4IEFB 3QUKB 5IIEB 1T1YB 3VRIA 2SEBB 4K7FB 1DANT 5ALCL 3WNLA 5ANMB 1HINH 5ENWB 1S7XB 2BFVL 2R2HA 4DVBA 2BHZA 4M8VA 3A6CL 3QIUB 1EO8H 5H8DA 4FQXA 4NCC1 3S98A 4Z7UA 1FVEB 1KYOJ 5DHXB 2R0LL 2MHAA 1QR1B 3QI9B 2XZQH 3HLAA 1S78C 3AREC 1XF4B 2X4OA 2G75B 2K7QA 3RNQA 4Z7WB 1CDGA 3QPXH 5I71C 4PLOB 4FP8L 4NN7C 5EUOB 3GMRA 4G8EB 1M05B 3TLRA 5DD1H 4JRYA 2GJJA 4DTGH 3DVNB 1LD9B 3EYQC 2AK4D 3P0GB 4G8GB 1CCZA 3Q6GL 3TN0D 4Z8FH 4L8SA 4PGCA 1QEWA 1LVEA 2VDMH 2Y5TA 3A6OA 2VQ1A 3ZE2F 5I66B 4GLRI 3WKNA 4JJ5B 3SGEI 1EPFA 5E1AB 3RNKA 3VFNA 3QHTC 3F5WA 3RGHA 5FYJE 3MX0A 1C12A 3ZE0F 3VXSE 3ZKQD 1DDHB 3WFZA 3BZFB 4MGXA 4HS8L 1EUUA 1ONQB 3LRGA 3AUVA 2X4RA 5HD8D 4WWKD 3GGWA 4F58H 1VFOA 5DRWB 1IT9L 4HULB 5EBWB 4UT6H 1I9IH 5L2JA 5JPNB 4HCRL 4MAUL 3MUY1 1A0QH 3K2MC 1FO0B 4G3YL 2XQYG 5JHDB 1II4E 1A6PA 4PJIE 5CSZA 3CSBA 1MIEL 3X12A 4BYHA 4ZOAA 3BT2L 5TPWL 1KCSL 1KB5H 1ACYL 4UT6L 4NOBA 2CSPA 3H0TA 3MRFA 5ADPL 1I1AC 2DWEA 2XNAB 5DRWA 1CYGA 5KSBB 4HWBH 4U33A 1YECL 3FQXA 3TBYB 3RY5A 1TPXC 4JREC 3NZHH 1EFQA 3BP7A 4P2QA 1G7LA 4YDKH 3V7AG 4JZNB 3RL1B 1OTSC 5IFHL 5JA9A 4POYA 2V2WB 1LEIB 5HHNA 1DN0A 5I1DA 3NCEB 1IBGL 3V5KB 5GJTL 1EO8L 2HKHL 4S1QH 2R1WA 2GFBB 4PYGA 5ILTL 5TF1L 3ULUH 4UV7H 4QRSA 1BFVL 2R0WL 4PGDA 4Y16D 2EDWA 3LKQB 3QCUH 3BYTA 4QXGH 2OTUB 1TJHH 3BQUD 2BY0A 1BWMA 1U8JB 4WHTA 1CFNA 1G7MB 3BD3A 2B20A 2I9LB 1JPTL 5BZWB 2ID5A 1YNKH 5T3XH 1J1OL 3DSFL 3G5XA 4PG9B 4RBPH 1AR1D 1NEUA 1RJLB 1ES0A 1AO7E 1VENA 3EO1B 3CXHJ 3MV9E 1JPST 2GTWA 1KTKE 1IC5H 1L7TH 3ALPA 4F7EB 2LTQC 4LCUA 5DD5L 4ZFFB 1VACB 1DDHA 1VDGA 3S9DB 3RWJA 1P7HL 1NBVH 3MO1A 4M7JH 4P4RB 2HT3C 2BOBB 4GRLB 3OB0K 1K4DA 2R0KH 3MRCB 4JZOB 4X6FB 1OAYL 5GGSA 1DEDA 1N7MH 3RA7L 3C5JB 2PW2A 1AGCB 1FFPB 3QI9C 1T5WB 2DB8A 1KIPA 2XG4A 1XGQA 1QKZH 2HH0H 3S34H 1OP5K 3QUXC 1ZA3A 2F15A 2O5XH 3H9HA 4W68A 5FHBL 5C09E 2YA0A 1U8OB 1AC6A 2E9JA 4NKIL 1DQDH 5F7WC 5F6HJ 5F9AC 4N0UA 4KAQH 1T0PB 32C2A 2IH3B 5D1ZB 3RWFA 5F97E 3IAGC 2JK5B 3HCVA 4RIRA 2KDGA 4N0RA 1SEQL 4RFOH 1ITCA 3VFOB 1UG9A 2YPVL 2J8UB 3L5WB 2ESVE 2ZUVA 1MCLA 4XP5L 1MLBB 3OMZA 2I27N 3CZFA 2IGFL 4U0QB 5IGXH 1NFDF 3WFHA 3QEHB 4P9HC 4Y16C 1JZ3A 3TVMB 2PXYB 1P1ZA 4S11A 3P73B 3KYMB 1NFDB 4JM4H 1AFVL 1YEEH 2V6HA 4JFFB 2I60H 1F6AB 2ADIB 4LPVA 3VFRA 1RVFH 2AW2A 1NKRA 1HEZA 1EHLL 4KKBC 4E5XA 3U0WH 5GGRY 1PD6A 4NZDA 4ODTL 4D0DA 3LB6D 4PRIA 3C9NB 4LDLB 3V9FA 1A3RH 4UNUA 1M7IB 4OD2A 5DSCA 5IF0A 2PCPB 4QNPE 2R69H 4PLNC 1CDUA 3T1FA 5I6XB 3RPIB 5DQ9B 1JPTH 4FXGA 5JW4Q 1JZ7A 5JHDE 4M7LL 5KJRL 2JCCE 2CIKB 3EOTL 2FL5A 1NAMH 3TJEH 4EVNB 4LCYB 3VXMA 2R0ZH 4U49A 2BY1A 4KK6D 1QOKA 4QTIH 3WS6A 1A5FL 3PWJA 2P8PA 1Z2KA 3MRCA 4JZOA 2RQ8A 1K4CA 1WV7T 2FH6A 3GSWB 4ZUVB 2B1HH 2BJML 4LSSH 3OQ3B 5E94B 2XA8H 2WAHA 3IB4A 2X4OB 4Z7WA 5HYQA 2WINB 1KJMA 3GSRA 1AP2B 4V1DE 4G42B 1GGUA 1I8KB 2R1YB 2MTPA 2DQFA 3N1GC 4YEFA 4EBQH 3ILQC 1P4IL 1QO3A 3HZVA 4DZBA 1CR9H 3C6SA 1X5JA 4I9WD 3PHSA 2OL3B 4CNIB 2P42B 3EYQD 5E99H 1A1MA 1JWMA 5JUEL 4QOKD 1BVKA 4PJGA 4MQ7B 1GOHA 5IB1A 3WIIL 1A7QH 5C07D 4WO4C 4YXLL 2NXZD 4LSQL 4NZTL 3MRNA 5C0GB 1JWUB 5CS7A 4D94A 2FDBP 2VZ3A 4UINL 2H2PC 1EXUB 2FCBA 3ILPB 4XCNA 5GISL 5IQ9B 1JNHB 3QXWA 1IEAA 4NFDA 1MI5D 4DOHE 3ZE1E 2ZNWA 4KHTH 3KPRD 3X11A 3MV9B 5E5MB 3LKPA 4OLVL 3MBEA 2Z35A 3HE6D 2ZOKB 1YNTB 2HFTA 4Q2ZA 4GBXB 4HG4J 1XMWA 3GDBA 3BT2H 2XI9A 5EPMA 4XXCA 4PJEE 4XP9H 5F1IB 3MLUL 4XHQA 3GHEL 4NRYB 4OZ4A 1DQQA 2VLJA 1VGEH 2BC4B 1N2RB 4MQ7A 1LNUB 5TE4H 4C59B 3ZT5A 1HCVA 3ABZA 4G43A 1Q9LA 5D1QB 3SKUD 5EC2A 2DTMH 3U7AA 1Q9WA 4U05A 2NY4B 1MAML 1U42A 3INUL 2HFGL 4CUCA 5JIKA 3SE3C 1EEYA 1KB9J 4UV4L 5DJDB 2J4WL 1ETZA 2WSKA 3V5DA 3BGFC 3NVQA 5MEQB 4JQVC 4I18C 1HOCB 1BBJA 1RZIA 3V6BR 4D9QE 3VXUE 5J12C 5C0AB 3WLBB 2A2QT 4U0RB 3UTSA 4J3XA 3RVVD 2BFVH 3EYOA 5HDBE 3OGCA 3QHZH 4AEHH 1PYWA 4F15C 3WBDA 4OKDA 3NPZB 2P8MA 4Z6AT 5GIRB 4FZEL 3S5LG 4RWYH 2W0KA 5J11B 1U8PB 3HTLX 4KUCD 4WDIA 1I7UB 4HLZH 4Y5YC 1B6DA 4FQQA 1EEQA 5IVXF 3F12A 1Z9LA 1MHHB 4P9ML 4XGZA 4X0KA 4ZOBA 1NC2B 3H7BA 3VG9C 4GKSB 5E8OB 3WXVH 4CVXB 1FIGL 4JN2A 3HMXH 5ICYA 5L2KD 4HXBL 3O4LE 1LE9A 3BQUB 3TA3B 4DN4H 2J1KA 4JY5H 1RHHA 4U2ZA 1A6UH 1I9JL 3U0TB 5C6TL 3TCLA 1NGXA 1A14L 4HIHA 5ADOL 2UY6A 3U7YH 2YUWA 2DQCH 4ACPA 1CK0L 4L9LA 4HPOL 4APQA 2PYEE 5MEOB 3EZ8A 4ZTOH 1DN0B 5BW7A 3TZVD 2EXYD 5KSAB 2VDKH 3CC5A 2VDOL 2VLLA 4WI3A 1FO0L 1NANI 3V5HB 2YXFA 5CD5C 3G5VA 4AYFA 5JPMB 3V6OC 2JCCF 3NH7H 4N0CC 3T77A 5GPRA 1S7QA 3WEXA 4KTEH 1A7NH 5IT2H 1C7TA 1MFNA 4Y5XA 4YHKH 1SYSB 3BJ91 1ZA6B 5EWIH 3MOAL 4G7YH 4QHLB 3HCVB 3QCTH 3QRGL 5GGVL 4D8PB 5D1XA 3BZEB 4QYOA 2IEPA 3L3HA 2DM2A 3E6HA 4ETQA 4JB9H 1TZIA 4HS3A 4L4TA 4IJ3B 1GGIH 2AJYL 5HHOA 5I9QB 3F6LA 2BMKA 4XPAL 3DJ9A 2MOVA 4ONOA 4R4ND 3IDUA 4C4KO 2YD3A 3TH4T 2P1YA 3K8LA 4YX2L 1IGYA 1CGYA 4ISVB 1AO7A 1K6QH 4QRPB 4HWEL 2JJTC 4U6YA 3C60A 1RZGA 1U36A 2V9RA 1A7BA 4FTVB 2VKWA 4FG6D 1HSBA 1OARH 2VC2H 1UACH 4YE4H 4JHAL 2FGZA 1LK3L 4QXTB 5L88L 3VD3A 4TTDD 1CLZH 1OB1A 2EDRA 5IIEA 1X5IA 1TJHL 4KZEL 1T7ZA 5F1NA 4LAJH 1D3CA 3T0EC 3F12B 1EGJL 4AIZB 5LBSH 5K9JH 3AAZB 4XBEH 4DZ8B 4PJ9A 4RGOH 3O9WA 2ZKHH 2RCSL 3MJ8B 4ZDHB 3UTTA 2PXYD 3HLAB 2YN3A 1SHMA 4XXDA 1NBZA 2D31B 3CZJA 3HRZA 1IQWL 4NOFA 4OGYH 1XGTB 2VABB 4E41E 3ARUA 4PY8J 3F7VB 5SX5H 4YXKH 2DLFL 3E2HB 4Y4FB 5I19H 4XRCA 1MJ7L 4YC2B 2PYED 4BQ6A 3F62A 4HUXB 3LV3B 3CFKA 5I1LB 5FIEA 4ENED 1G6RH 3AS2A 2VLLB 5JW4N 4P9HH 5A3IC 2GJ6E 3GMQB 5TPWH 3F7QA 4XX1G 1MCHA 2X4TB 4LCWD 2FBOJ 2HJKA 5J1TC 4JJHA 1HKLH 4ELMF 1N7ML 2FGWL 4JQVA 4FQJL 1JHKL 4XVJH 3BH8A 1AKJD 3JTSA 4OD1L 4YHPB 5FYJH 3VXUD 2C4FT 4CKVX 4Z7VF 1T1XB 5CLTA 1HWGB 4XP6H 4YDVB 2X9YA 3VCLB 2E27H 3HE7C 1D9KA 1RZJC 1P7KA 4X4ZA 1U8QA 1N0XH 4P46B 4P46C 1RMFH 5JW4M 4U1HB 1MCBA 3ARVA 4JPIB 1P7QB 1NGYB 3W9DB 3HE7B 1YEDB 3F8UB 3QR2A 4NKMA 2DJSA 2VISB 1H3PL 1KPRA 3ZL4L 1IAII 3TPUA 1NANH 5F70A 4NQDA 4HJ0D 3RL1A 4QKXB 4PJFB 1ZMYA 5DR5L 2X1WL 5HI3D 3OKLB 1I3GL 4XAKD 2NY6B 1WCQA 2BHYA 4L4TE 5I16B 4PTUB 3ARBC 4Y5VB 1C16A 2C3VA 5E8NB 2UWEA 2Y06H 3GKZA 3FQTB 2ATPB 4Y4KD 5I66A 1AGFB 3T65A 3OHXA 3HNSL 4X7CC 5C0FA 2OTPA 4OIIL 2ZCHH 1OPGL 1A6WL 1RSFA 1MI5B 4NWTH 1OT1A 5I71B 4P5KB 1FP5A 3B9EA 1A6AB 4GRMB 4LSUH 1IEAB 3OJ2C 3UJIH 1A3RL 1Z5LB 5L0QB 3MLVH 1MJUL 1N64H 4AENA 5GGRA 3LHPH 4NPYB 1JGVH 4ZAKC 4YJZL 4KDTA 1KELL 3RIFK 1TDQA 4FP8H 1N6VA 3QPQC 1NC4B 5JUEH 1A7OL 4P9HL 2YRPA 4MNQA 1I1AA 3EYSL 1G0XA 3FQTA 3V5KA 4J4PD 3T0EB 2EO9A 2MKLC 3P40A 3REWB 5DJ6A 5D96C 4OFYD 2FJGB 1OSZA 5F7FA 2P8LB 1OD7A 1Z9OA 3WO3B 3MV9A 5IW6A 2R56L 2YK1L 4IOIA 5D1XC 2ICWI 3KJ6H 2BRRL 5F9JA 4PJDB 3V95A 5F9WC 3SBWC 4FTVE 5IB4B 4XNUH 1RIVL 4QHUA 5FO7A 5FUOL 3QDMB 4Z0XA 1Q0YL 1KB5L 4Y16A 3S96B 3MRQA 4FG6C 5GISH 1DL7H 1LEKB 1GZPB 2Q3AA 3ALXA 2R56H 3T2QA 5C0RH 4KV5E 5FM5M 3RI5K 1T7WA 2JJTA 4OCRL 2WIIB 2NZ9C 3U30C 4K7FA 4DVRL 1H15A 1BD2E 4LSRH 5FO8A 2BNRD 4BSWB 4UDTB 3IETB 3BZFA 1UKQA 2DQTL 1CDJA 3NGBC 5LXGL 4BQBA 3O9WC 4FFYL 4XNQA 1SJVA 5KS9A 1DTUA 4ZFOL 4J4PA 5DD6A 1J5OL 4JKPH 2DIJA 3MBED 2X1OA 2DTML 1YJDL 1XF5A 2WZPD 1H0DB 5E08L 2BSRA 5I1JH 3OAYH 4OZHA 2X4UB 2CLVA 4HJ0C 5TQ0H 5D70H 3GMNA 1S7WA 5I1HL 5T1MB 3OKNA 4YHML 3HB3C 3MBXL 5ACZB 5FGBA 1CDCA 3PNWB 2Y06L 2Q8AL 2VLRE 3V6OE 4UTAL 1OF2B 1X6LA 3LN4A 1B4JL 1GPOL 4PTTB 3BP6B 5TQ0L 3OZ9L 3IETA 4NQVA 2QQLH 4OGZA 1MFCL 4UOW1 1W0WB 3HZYA 4YFDB 1P9MC 4PB0L 3PL6A 4OZFH 1WZKA 3SQOL 3HG1E 1IRAY 3S36H 4Y5YB 5C0CB 1KXVC 1JI2A 1PX3A 4NQSB 5KVFL 3UTOA 2MWCA 4UU9A 4HF5H 1A3LL 2X5PA 1AD0B 1UEMA 3VMNA 1BP3B 4MXWL 5EFIA 5I1EL 5IESH 1DANU 2VIRA 5GSVA 1D5IH 1M7XA 3VWJB 1CGSH 1F4HA 4JY6B 1PZUB 1CLOL 4WFHE 4YDJB 5EA0H 4EOWH 5I18L 2FD6L 4LBEA 4G6FB 1AXSA 2AK4B 5HHPA 2XWJA 1KN4H 1INDL 3WIHL 4F8TA 5I1AA 2ITDB 4WW2C 4O4YH 8CGTA 4NWUL 1JGDB 3S35H 1ACYH 5T3ZE 1QA9B 1OGAB 1ZT7A 3QNYB 3U4BL 4QYOB 1JN6B 2Y07H 2BNQE 1HSAA 4Z7WE 4HMDA 4IBLT 2AJVH 3KGRA 4KVNH 5IHZB 4PRID 5M7QA 3FFDA 3UP1A 3PG2A 4KY1L 4K7PL 1JWMB 3CU1A 5A16A 2XKNB 3HPLA 3MJ7B 4HCRH 3X3FH 1LP9E 1RZ8B 4E5XB 4PRPB 4WHYH 5IHUL 3MFFB 3K4DA 5C2BH 3RIFF 4XCEA 2V2TB 5IOPA 4WW2B 2EIDA 1R24B 3PWPB 3C5ZC 3E6FA 5IQ9A 2PYEA 1AGDA 5DMGC 5DC0A 5BMFH 1XF3A 2H8PA 4HGWA 1U8HB 2WLZA 2NXYD 2WQ8A 4KI1A 3QZWB 3D9AL 1A9BA 2YD7A 3DGGA 1BFOB 2GCYB 1WUNT 4JLRB 5B39A 3EAKA 3CVHA 5HGAB 4P2QE 5I1HH 2YD8A 4XCEB 1DBMH 1M1SA 1OTUC 3QISA 3ARPA 3RZCB 1LNUA 1C5CL 4MJ2A 3BMWA 5FA3B 1A02N 4U2YA 5JDSB 3BRGC 3I3EA 3S37X 5DUMH 4LSVL 4YX2H 2ADFH 1TXKA 4PRAA 5T3XL 2XIDA 1RPQA 1MAJA 1DBKL 5KSBE 1T5WA 1HYSD 4N5EC 1A7RH 3GO1H 4J3WA 2HRPL 2IALA 5E2JA 4YPGB 4PJGF 5IW3A 3UPAA 4DQOL 2HVKA 3WCYA 2VDRL 1CTOA 1EIBA 5FM4A 4H8WH 1IE5A 3WFCH 3QXAB 3HB3D 3S6CA 5LAXA 1FNLA 3ZKMC 2NW3B 1ADQL 5ETUB 5FF6A 1XIWA 2AI0L 4L9LC 1P2CA 4OGAC 3ARFC 3V6ZA 5DJ2B 3ZTNL 2VDQH 4FQXB 3BOVA 4P5MA 4XP1L 3SE9L 3PXJA 5JO5A 3W11D 3B9AA 5CFHA 1ADQA 3MLTA 4BQ8A 1YQ2A 4KZDL 1MFDH 1CBVH 5AWNH 5IB3B 2MCG1 4HJGA 4JFOA 2AI0H 2UZIL 5F7DA 2CH8A 2FHFA 4HKZB 4ZFGH 1LD9A 1HQ4B 2H9GA 5BS0A 1P4LA 2HYMA 1I3VA 3MODH 5I74B 2C7UA 4G6JL 3KJ6L 3K4ZA 2AEPL 3MRRB 3DXAB 3HC0A 1D6VL 3HNTH 3KPPA 1YY8A 4JPKH 3AS0A 1RK0B 3PF2A 4M43H 1YEHL 3V4VL 2BXZA 5IJVB 4DFIA 5INDB 4PYHA 1EBAA 2H6PB 1XAUA 4KQ3H 3BP4B 3C8KB 3SJVE 2OYPA 4B41A 5SWQB 4NIKB 1G9NH 3QCUL 4QXGL 4JQXC 3VRIB 4JFDB 5D8JL 3H7BB 5DJZB 1F8TL 1UXSA 3RVWD 4XCYA 2H41A 4UDTA 1QVOA 4PRIB 3BEVB 5CILL 3WJLC 3EOAA 1L7IH 2BY2A 3QDMD 3MRKA 4LLYB 1FC1A 2Y6SC 1N3NA 5D7LD 1TVHA 3SDXF 2DQHH 1CE1H 5FYLL 1PGRB 1WAAA 2EKJA 3TIDA 3QUXB 4LPTA 4N5UA 4XB7A 4PREA 5DD1L 4RAUA 1QLEL 1OP3H 1RFDL 4NQCA 2UV3A 4RFEB 2GQHA 3DNKA 4OLXH 3RVUC 1MHPH 1FLTX 1HOCA 1NCBL 1RUMH 3I02B 3DUHA 1GGCL 3FFCD 2BXYA 3G04A 5KOVC 4S0TD 4P23D 4XMPL 5T3XE 3U9PH 3OG4B 3ARBD 2HT4C 2YK1H 2HLAA 3H2WA 4ZNEE 1YEGL 5BO1L 1T0MB 4NKDB 4Z7VE 4NCC2 4RIRB 4MD0A 1QBLH 3BEWA 4Q6IB 4OF3A 2E7BA 4TNWF 1OAKH 5CIPH 5GRWA 3CFBA 1P69B 5FYJU 2YPKA 1U8PA 1BOGB 5HYSB 1NDGB 1KLUB 1EAPB 3PGCB 3QUZA 1WJ3A 1UT9A 2X4PA 4L3EA 5C1MB 3DARA 4J23A 1S5HB 1N26A 1ZLSH 2QJDA 1G7HA 2EXYC 3HNVH 2BVPB 1KIPB 4NFCA 3CNKA 3QIBA 1I7ZA 3N9GL 4NZTH 5E8OA 1CK0H 5TE6H 1H8SA 4OF7A 3VFSB 4OI9A 3X12B 1UZ8B 2ITCA 3S34L 3VFTA 2VXSH 2E8ZA 3ZT6A 4X9GA 4IOSD 4GRLA 5GRZA 2BRRH 2HKFL 5CSBA 1I7UA 2DRUA 1BQHA 5E2UH 3BRDA 1KIQB 3M8OH 3L3OB 4MLIA 3BN9D 3BSZH 3QQ4B 5C0BE 3UTZA 4YDLC 1JPSL 35C8H 4FXKA 5DZLA 3UJJL 3JBG7 7FABH 3ARGD 1HI6B 2AK1H 3NGBB 4DAGH 1JTPA 2NCMA 1G6RB 2CGRH 5T5FH 5GS0L 1ZSDB 4NN5C 5SV4A 4HK3N 4N0UE 1Y6KR 3V4PH 1N4XL 5A16B 5I8KH 4MB5A 5EN2B 1PKQE 4NM8H 5IM7B 4UTAH 2C4FU 5A2FA 1BAFL 1CICA 3SDCC 2A1WL 3QRGH 3R8BB 5IEKB 3VGAC 3QXDA 4UQ2A 5DC9B 3B5TA 1DLFL 4LPUA 1QSEA 5F9OL 5HYQB 4OD3H 4PJAF 4PJ5D 1BFSA 2QQKL 4JPWL 3NA9H 5JIHA 1BZ9A 3DMMA 4G8IB 4ZODA 4MA1B 5I75B 1I85C 2AJUH 2UY7A 1B0GA 4NO0A 5EN2A 4GG6E 1DLFH 4ZYKA 2IPUG 1INEH 2A77H 3RBGA 4GAJH 5MEPA 3SY0B 4XPTH 1T0MA 4J3TA 3OKLA 1EVUA 1V8HA 4NKDA 1B2WL 4DKAA 1JVKA 5TE7H 2ZG2A 1JYXA 1PZ5A 4WW2F 6CGTA 4HV8A 1TVBA 3V4UH 3MACL 3BKJH 4JRYB 3MNVA 1JNLL 3P2TA 3KYNA 4EXPX 5I75C 4D0CB 4JHZA 4PJEB 2RHEA 3UJTH 2J2ZA 5DD0H 2Z93A 2R23A 3I84A 5CAYB 5E94A 4RA3A 3E6FB 1MY5A 3HE7A 1D9KC 1RU9L 1WQVT 3LS4H 5IMMB 3EW3B 3WN5A 5KS9E 5L0QC 1T89C 1I8KA 3IRZA 5I9QC 3CJJA 1LEGA 4J1UA 4JFZH 5FYLD 2HLFC 2FJHA 2QADC 3SDYH 3LKSB 4F80A 4LCYA 1CL7H 3VE0A 4HXBH 3X13A 1YUHA 3MOQA 5CSGA 1UM6L 4NN5B 3JV4B 4TUOA 5GGUB 1AHWB 1U91A 4OQ1A 3P9MA 4PD4J 4Q58C 2Q20A 1AD9B 1MWAA 4OGAD 4HWBL 4W4OA 1KJMB 4W4NA 4JJ5A 3GM8A 1ZANH 5I1CH 5CEYA 1HI6A 1QQDA 1OM3H 4P4KD 5F7KC 4N1HB 2W0PA 2GAZB 5ID1B 2VE6B 3RPIA 3ARBA 1KBGH 2DBLL 2YC1B 5AD0B 3PWLA 1MNUH 4H88L 1WBXB 1IC7L 4OZIA 1KN2H 4MJ6A 5I73B 4N5ED 5HDQH 1HEZB 1RD6A 3Q48A 43CAA 2A0LD 4FQXD 5K9QG 1S7SB 4LHJB 3S5LB 4QF1A 5I17A 3B8SA 4HEME 2BX5A 3O4LB 4H26A 43C9A 3QO1A 4LNRB 5L6YL 2V17H 3PP3H 1VKXA 2ZSWA 3WHXB 4JANA 4M4PA 3B9DA 3AAZA 3MJ6A 1KXQE 1C8PA 4LQFL 5FKPB 3H3PH 5EH1A 3G6AB 2ARJB 2VR9A 3CFDB 4IDJL 3OKEB 1OTUD 4Q6IC 4U1KA 1P9MA 3B9KD 2WBJB 1VCAA 3GSNL 5AZEH 5CBAB 3QJHB 1FFQA 1E4WL 1S3KH 2AXFB 2NR6C 5E5RB 1FZOA 1KCVH 5L8LB 4JN1L 4PRHD 1DUZA 4MJ6B 4LK4A 3I50H 3FQNB 3DXAD 4NSKA 3OBAA 3ZHLA 4BSVA 5JLZB 4Z0BL 3GUTA 4BFIA 4C56B 43CAB 4P0DA 4N8CL 1AKJB 3QUMA 1BM3H 3RWCA 4HS8H 5BXFB 2J8UE 5DUPH 3U7WH 2EKSA 3ZTJH 5HGHB 1H3WM 4H8WL 4JY4A 3ORJA 4RFEA 4XNXH 2H2SD 3FHQA 4O2EB 5IBUB 1UXWA 2D9CA 4EN3D 1A6AA 3N0PB 1MJ7H 5E8EA 2Y9RT 2JIXB 1CD8A 3QT2A 3FMGL 1S7TA 3BWUC 4Y8AA 2VDML 3QA3A 1C08B 4NNPH 3B2UC 3O81A 4U1KB 1MHHA 4GRWE 1NFDE 3O2VL 1J8KA 1V7MH 1OQXA 1GAFH 1Y6NR 4LCIL 2YD9A 4ZS6C 4BUHA 3MGOA 1ZHKB 3S88H 4YO0B 2CO7B 1TETH 2B4CC 1FCCA 1RAMA 1LO2H 4KKCD 2P5WE 1FCGA 2VZUA 3IDMA 1QG3A 3TNMA 5FOBA 3FB8A 4H8WC 3O2DA 3H9ZA 3SO3C 1PYWB 3BIAX 4ZTOL 5I19L 1FYTA 1YZZA 4IOFC 3P9WB 1PFCA 3EOYG 4OF5A 1CICC 15C8H 5AEAA 5F6IC 3SDCA 1UCBL 3E3QE 2EYTA 3BWAB 1CXFA 3UAJD 3MFGB 4PS4L 2F5BL 4NQXB 3FOLB 5F7LB 3UZVB 1CFTB 1H3GA 5JR1H 3KR3L 4ZQKA 2Q6WA 3MUHL 3QDMA 4Z0XB 4NCDA 4C83A 3FCTB 4MHHG 1J1XH 4CMMB 5B4MC 3B3IA 2UWEF 5GGQL 4D0BA 4K94L 4Y1AE 3I6GB 4E41D 2CRZA 1FE8L 5C71A 2I07A 4NZRL 5MP6H 2HT3D 3LQAH 4YAQA 4OIBA 3TWCL 1TVDA 4E0RB 4JFPA 4OUUB 3DIFB 4IS6B 5C8JB 2YD4A 4H5SB 4K07A 4AQ1B 1RFDH 2XY2A 4ZO9A 4PJXA 4W6XB 5JXEC 4WWKB 2Y7QB 2HN7B 1W0VB 1ERNA 1IKFL 3WN5C 1K6QL 4EI5D 5GRUH 1BJMA 1NUNB 3SCMB 4N0FB 1ZHNA 4NRXB 4RCAA 2QHRL 7CGTA 1TTFA 3U79A 2DL9A 3NCCB 2EDXA 4EIZC 2H1PL 4ZPVB 1KIQA 5JORB 3RVXC 2HTLD 4FQ2H 3T8XA 2VLKB 4NNXA 2R1XA 4S10A 1OW0C 3OZ9H 5DURD 4BA8A 1AIFB 3MJ9H 4FA8A 1KPUB 3CDYA 3O6KL 1IM9D 4YGVB 4X5LA 2B8OT 4CMHB 3W39A 1PVHA 3NCJL 3ULVE 3WHE0 2X6MA 4ZAKA 2FZ3B 1FIEA 4NUJB 3KDMB 3B2VH 3QQ9C 4QWWD 1TQBC 1CL7I 3F5WB 1CFBA 4JFXB 3SOBL 1R5IA 4TQEH 1VSCA 3CAFA 1Y0LB 3ARQA 1M6OA 1FIGH 3CMOH 4WI8A 2IPKA 3RZCC 4WHTB 1NGWB 4U1MA 3SQOH 2CUIA 2ADGB 1AIFA 3IF1B 2VMFA 1MCKA 1EZVX 1T2JA 1MCFA 3O3EA 4HW6A 1U8QB 2PW1B 2NW2A 3U6RB 5DI8B 5JR1L 1FFRA 2FB4H 4OKVA 4L4VA 4U0RC 4LRNH 3T4YA 1MRFL 1C1EL 1FNSL 4Z95L 5DHVH 1AY1L 3IDNA 1ZXQA 4LKXB 4UT9L 4JG0H 4M5ZL 1NMAH 1AGDB 3GIVB 3SCMC 3NAAL 4NKQB 4OV6F 5DD6B 3T0ED 4NKIH 3FB5B 3BP7B 1ZT4A 5KG9A 2AQ3A 2X2YA 4Z7UB 4WWKC 5BS0D 1KFAL 2EC8A 3PP4L 4NQSA 1WZ1H 5DSCB 1K9TA 2PCPA 3MRBB 1MLCB 5KSVA 3QPQD 4OCWL 1X5LA 1VA9A 4GXVL 4XB8A 4Y5XB 3BDYH 2GKIA 1IEBA 1LILA 2W65B 3EDJA 4XPFL 4M48H 3WL9B 4XWOD 4QRUB 2F5BH 3Q3GA 3Q5OA 5C0NC 3SKMA 1I1YA 2CJUH 1F3DJ 1J18A 3K81A 2PYFB 4GRWB 2DJ4A 1MNUL 5IV2A 4G7VH 3KS0H 3LN5B 4N68A 4OCNC 1CT8A 1NBZB 3GMNB 6FABH 2N4IA 4H1LH 3VGFA 3FONB 3P4MA 4MDIB 5HVHC 3BN3B 5BVPL 3QDME 3NN8B 4JHWL 4N0CD 3O45B 3GMMA 2LTQB 3AU1A 3OKYA 4OD3L 4XWOC 3W81A 4RFNC 4GKNA 3GSUA 1AD9A 1FH5H 2OQJA 2EDYA 3Q1SH 4HKZA 1VFAA 2I5YH 1U2CA 2DLHA 2WM0A 1J10A 3AM8A 4X99B 1JYWA 2FECL 1R0AL 4KU1A 4EUPG 5FYKH 1SM3H 3JWDC 2WWMD 2GHWB 2BHUA 5E6ID 3UXFA 1A7OH 4NQCB 1NCWL 2VN7A 2MHAB 1MREH 1QR1A 3THMH 2PW2B 5TDPB 2DQEL 3TCXA 4HAFA 3H9SA 2RB8A 5A2JH 4PJ5A 5L9DH 3QIBC 5DEFB 4JFQB 3VFVA 4AM0A 4DGYL 2VERN 3K2UH 4P2YA 1YPZE 3MLSH 1JNLH 3WLBA 5IB5A 4W81A 1R3IL 1FVCA 4JFHD 3SDXE 3PDOB 3QFJD 4PTUA 4CADB 3DX6A 4P2RA 3DBXA 4MXQD 3MYZA 2QBWA 4JFYA 2JKXA 1NLDL 1B0WA 3MLZL 1GJIA 2CK0L 5C0AD 1BZ7B 2YMXH 5BQ7A 3O2VH 4ZTPH 3QUYA 5FV2A 5KSVB 4Y2DA 3PJSA 1HHIB 1CDYA 2AP2A 4FQHA 1I1AB 2DQGH 1KIUA 5JOPE 3C09C 4XGZB 4K3JH 4V2CB 4NBZB 1G7MA 4KUZL 5C08A 1Q1JL 4GKOA 4KMTH 1D5BA 2XWBA 3CFIC 4ZS7L 3K80A 3EBAA 4R96B 5CGMA 4PJHF 4F58L 2H26A 4NNYA 3ROOB 4PJBF 3I6KA 4D9RE 4L3CB 3TO4B 2DQDL 5H35A 1XGYL 2E7MA 1OSPL 3ARDB 4QRQA 4HWZA 2CIIA 1NFIB 5F9WB 4Q9CA 1QRNA 3EKCA 5K9QI 1OAZL 2QSTA 3CLEH 4AEEA 3ROLA 3W0WE 3LQZB 2RGSA 5F89B 4QCIA 4U6HA 3IJHA 4PJDA 4UBDD 3IDIA 1JPSH 4S1QL 5BQ7B 4LRIA 4X4XB 4DCQA 2WWKT 1I3UA 3MYJA 1QSFA 3GB7B 3KLAA 1OAUH 3VA6A 1AXTH 1G7LB 2VXVL 5KSAD 5KSBA 5DK2A 1OVZA 1KUMA 3MUGA 3NZHL 3RZCA 1IAKB 2IWGA 3QPXL 3TBWB 5INCA 4WI4A 3SDAB 4PRNB 5EOTB 4LP4A 3PUCA 1CGTA 3CXDL 2ZCLH 2ITCB 3VFTB 4QHNA 3AXLB 2IBGA 3RGVB 1JPGB 1VHPA 3RIAF 3VW3L 4MAYA 1R5WB 1U8IA 4O51B 1UACL 4YE4L 4WJ5B 4JVUA 1BFVH 1KC5H 3CX5K 4IRJB 3RGVC 3CX5J 1S5HA 1EJOH 3RHWF 1QSZA 1SBSH 3BDBA 4GRLC 1SVZA 3WUWG 1SYVA 4NZUL 3U36B 4NBXB 5E00A 4PJ8B 5IHZA 1IGCL 3LMJL 4F37F 1KPVA 3O4OB 3KJ4B 1TCRA 4OZGB 1TJIH 4K9EC 3D6GA 1V7NL 4YAQB 2UUDH 2X70B 4MWFA 3MJ7A 1JHTB 3S36L 2DM4A 5EC1B 3L3KA 3G5YA 4OCSH 2HFFB 2YD2A 2YOCA 4LCWA 2HLAB 2ZP0T 1EZVY 1I75A 4P2QB 4ONHB 3MZGB 5J13B 5E5UB 4JCMA 2XNAA 5JOEA 3LV3A 4NC2B 1GAFL 4LCIH 4PPTA 1JPFA 2WUBH 5E2VH 3S35L 4KKLC 4HWNA 3X3GL 1RK1B 4MD5A 1MFDL 1CBVL 1NUGA 1K2DB 2DQIH 2D7OA 5JW5A 1QZ1A 1XGRB 4F7MA 1A64A 5F72S 4P2OA 5HI4C 3OKMB 1I7ZB 1IT9H 12E8L 5CJ8A 1EK3A 5B8CB 5TQ2H 2NY1C 4YDVA 1BX2A 5C6TH 2BC4A 1G1YA 2XQYK 3RWDB 5BOZG 1QSFB 3GB7A 3MYJB 2QKIA 3ZSSA 1NCNA 1BQLH 2P5ED 4NGHH 1QFOA 3FQRA 4YHKL 3HZYB 5F7EL 2KL6A 2WUCL 4R3SA 4JKMA 1PLGH 4CU6A 1NGZA 2AERT 1I9EA 5EU6E 3E0GA 3MRHB 3QDJA 3VFWA 4GXUN 3DRTA 4HC1L 4LU5L 2ZWLT 4Z77A 3HG1A 5LGJB 2F53A 4JO3L 1DBAL 1Z0NA 5LKNA 2E9IA 4OKVB 4WO4A 4YPJA 2OI9C 2APVA 2F74B 3I6LE 1EHNA 3BIBX 4JCLA 4I3SH 4XNZB 3TJHC 5IB1B 1E0OB 4JFFA 3OXSB 3TN0A 4RMSA 2YR3A 5T3ZL 3CSYB 3GI8L 5DLMH 5CEYB 5D72H 3EDFA 5J13C 1W2KT 5ERWB 1S7XA 3CXHK 4QO1A 3MV8A 5ICZB 3IYLW 1WC7A 2X70A 4GSDL 4BFEA 3CZFB 4XC3L 4OM0H 1X4ZA 1A9EA 3QAZB 5DEGB 5CGTA 4UUJA 2CKNA 3O8XA 4JR9L 3HR6A 3HI6H 3QFDB 3AC0A 4QY8B 4FOMA 5B3NA 5HVHB 1BD2B 3QDGB 4QGTA 1AE6L 2X44D 4L1HA 2XN9A 2YUVA 4NQDD 4L8CA 4M5ZH 4Q9RH 1Z9SA 1C5BH 4IRJC 4NZJA 2HFEB 1KC5L 2Q86B 3SDYL 1K2DA 5JW5B 1YN6B 3U0PA 3FFCB 3GEWB 3WIFA 3LN5A 3BKCL 4NDMA 3QCVH 3G08A 4FTVD 1NBVL 2X40A 2B1HL 1UM5H 5HI5C 4KQ4L 1KLFA 1J05B 4I18A 4E42B 2BVTA 3STZB 3WFHB 1T5XA 2O5ZL 1LP9A 4DGVL 2DQUL 1IMHC 2P5WD 3RVTD 3D85D 5DJZA 3SKNA 2F19L 4OCMC 1F58H 1UYWL 1D6EB 2P4AB 4G9DA 2VLRB 5GS1B 4CJ1A 2D4DA 3S37H 5HHME 4D3CH 2LU7A 2CJUL 4PJEA 2WW8A 5KVDL 3WS3B 4KXZH 2GJZB 1D5ZB 5A2LH 2IMNA 1IAOB 2X4NA 1KN2L 4HSQA 3FRPA 5J3HC 4NQCD 1N6UA 3KPPB 4Z7VB 2AEPH 5H2BA 2C5DC 3HZKB 2BMKB 1A9BB 4MAYC 4H0IA 5FO7B 4R90H 1T04A 4LARH 1YJDC 3MUJA 2E7LC 1ZWIA 4DUWA 4PBXA 2VN4A 4QT5A 3HAEH 3P77B 2M1KA 3DMMC 4WIQA 4Y5VA 4WNQA 1CGVA 1GGYA 1LDPH 4N1CA 5E95B 4YXHH 3MNVB 4ORGB 3MROB 1UZ6F 4QCIB 5A1AA 2V17L 1N2RA 4MA8H 1RJCA 4P5TC 5HYSA 3PQYB 4LKCA 3W9DA 1S8DB 2J8UF 4HC1H 4LU5H 5MEPB 1QFUH 5MEOA 3IDGB 1MCPH 5ALBH 3R8QA 3RWEB 4JZNA 4CMHC 3ZKSD 2D9QB 5DRNA 3DX7A 5DMJB 3MBEB 2FLBT 4MA7L 3G6JF 1ZGLP 2AKRA 1TFHA 2Q86A 4UILH 3UYRL 2IANB 2X05A 2PO6C 4M5YL 4Y19B 5HDLA 3RU8L 3HR5B 2Q8BH 4LVEA 5E7BA 4R26L 1ZEAH 4NDMB 3MNZB 2VDPH 3QHFL 4ZD3L 3BPNC 5GS2H 3VH8B 5DYOA 4ETQB 2J3SA 2V9TA 2YBRA 4GSDH 1ZLSL 1EO7A 2NX5E 2HJKB 4G9FB 4XI5C 3CH1A 1W0VA 1U8MA 1ZEAL 1OP5H 1ZTXH 3QSKB 5HI5D 5DVKA 4JO1L 2IAMC 4X5XB 3VFSA 4BK4A 4QLRA 4GG6B 1INDH 1HILA 2NXZC 2ADJB 2Q3ZA 2HT4D 4HLZG 2ED8A 2GK2A 2V7NB 4OZFG 3GNML 3ZSTA 4NRZA 3BDXA 2AJSH 2BVEA 2G60L 3MR9A 4RMQA 2HTKD 3DV6B 1FE8H 1SY6L 1DQMH 1C12B 2LVEA 1J5OH 3I85A 3Q6FB 4OB5H 3IFPB 2DAVA 3DECA 4XI5D 1G9EA 4YO0A 5CEZD 2X4RB 3EDDA 3MV9D 1DFBH 2DQTH 1A1OA 2NNAB 3KYOB 2ADGA 4M9OA 1IC1A 5D1ZD 3C5ZD 4JM2B 5AYQA 3QUYD 4O2FA 1KEGH 3RWDA 2E8YA 1PSKL 3V4PL 1U8OA 1JF1B 1C7SA 3HC3H 2QQLL 3MRKB 5IFHH 1S7QB 1TZHB 5H94A 5EDXA 1YPZF 3QWQB 3NACL 1IGML 2CLRB 4PRPD 3P9LB 4U7MA 5LXGH 5HJ3A 2E5EA 3DRTB 1WTGT 3LMJH 3ULUL 1NCTA 2PR4L 2Q8BL 1XF2A 4YFLF 1Y18B 3M07A 5E1HB 4KVCH 4XPAH 1FJ1A 4WHYG 3FQRB 3IKCA 5LGHL 1E4JA 1PBYA 4CGTA 4BZ1L 5T33L 1JV5B 3U1SH 4AEFA 1JYNA 4EBQL 2KKQA 3CD4A 2ZUQB 2CR3A 4PB0H 1SYSA 1CLOH 2DOCA 3VXMB 1V7NH 2Z8RA 4I77H 1KG0B 1C08A 4KRPC 2NMSA 2GAZA 1TQBB 4NYLA 5ITBH 2FX9H 4L29B 2AEIT 4R8WL 4X4YA 1EBPA 3HC4L 3CMGA 4KXZI 2FGWH 3QNXA 3T4AB 4NNXB 2DYPB 3AY4A 2WBWB 4DKEL 3B3IB 1CE6A 1DL7L 3QIWD 2R4SH 2WLYA 3JWNC 1XCQB 1URLA 3MA7B 3TNNA 3GSQB 4WTWA 1TLKA 3TBVB 5GRJL 1VFMA 2E7LA 1WEJH 2X9WA 3S88L 4J8RB 1XIWC 4PJCF 3K8KA 5IW1B 4MNGA 3SKMB 4FQCH 3ARSA 1R5IB 4WU7A 3VXRE 1KGCE 2ICWA 5JXED 3WN5B 1NEZG 3DHJA 3VXTA 1R24A 3PWPA 3F7YB 3D87B 2EE3A 2A73A 4RDQF 4F7PB 4N0FA 2EECA 1L6ZA 3GJFB 1N4XH 1WT5A 3NFPB 1LMKA 5GS1C 4JZJB 5L7XH 3OKOA 1MRCH 3MCLL 2IANE 4ZUSA 3HPJA 1NDMB 1BWWA 1P4BL 3BKYL 3CDGA 2NYYC 2Z4QA 4IMLB 2F58L 5CGYD 2ICWB 2XZAL 5EU4B 4ODWB 4S1DD 5H35B 4KHTL 2D3VA 3DSFH 4G6FD 3QULA 3IKKA 2DQJH 2X1QA 5L88H 2XFXA 1HXYA 2P5WB 1D9KB 4HS6A 5C7XL 1FL6B 1DQJA 2OP4H 1CICD 3TIEA 4LVHB 3C6LD 5F6IB 4LARL 2VZ1A 2OJEB 4HXAL 1KB9K 2GSIA 4TN9A 1D5ZA 4DCQB 5EZLA 2WIMA 4HQQL 3VXSA 1JNJA 1RVFL 1U95A 2IAMA 5IBTL 2F53D 1FRGH 5F3HB 4EVNA 1S7VB 3FFDB 1GL4B 4QRRE 3S3SA 3ULUE 4F9LC 1OAXH 1FC2D 1I8LA 1WFUA 3TNMB 5D1QD 4AG4L 5B39B 4XHJC 2VWEE 3RA7H 3EHBD 1DQJB 5IVZB 4NO2B 3ECBB 3TEUA 3GI8H 1H3XA 1CFVH 1A22B 1U8NA 5L9DL 4IIQC 4M62L 3RNQB 1CLCA 1YEDA 3B8YA 3LEXB 4UQ3B 4S1SH 4WU5A 4FQHB 4JR9H 4JDZB 3GSQA 4JFDE 4LLMB 1EEYB 2GY7B 1UJ3B 4J12A 5E6ZA 4OQTL 4F57L 3O41A 2ARJQ 1BJ1J 3TH3T 1E27B 4DKEH 4M7KL 4W6WB 1UA6H 2VITB 4DZBB 3CVIH 2KQMA 3K7UA 3DROB 5EU3A 1JHKH 3EOBA 4XVJL 1L6XA 1A0QL 5HHQA 4EI5A 4HUKB 4XP1H 2CLVB 4MNHB 1T2QH 5D7SH 1NGQL