5IN1A

Crystal structure of the mrg701 chromodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'SFKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWSKSWDEWVTNDRLLKLTDENIRKQQELEKSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRG701
molecule tags Transcription
source organism Oryza sativa
publication title Structural studies on MRG701 chromodomain reveal a novel dimerization interface of MRG proteins in green plants
pubmed doi rcsb
total genus 17
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5in1A01
2P0KA 3ZEHA 1OZ2A 5FRNA 1OZ3A 2DIQA 3META 3OB9A 2YRVA 3S3OA 1H3ZA 3NTKA 4OVAA 4QW2A 1KHCA 4IKFA 1WGSA 2O4XB 3OYMA 2O4XA 3S3NA 3ASKA 3BDLA 2RI2A 3PFSA 3NTHA 1OI1A 2X4YA 4BD3A 5IAYA 4E7LA 5C6SA 3OS0A 2RI3A 2CKKA 1WJQA 4EDUA 2D9TA 3QIIA 4IUVA 2LTOA 4QQ6A 1N27A 1WJRA 1SSFA 2EQUA 3MEUA 4ZTJA 1G5VA 2IG0A 2BIVA 2NLUA 2K3YA 2R58A 2RJEA 3OYNA 2BUDA 2L3RA 4IUTA 4HCZA 2MWPA 2E6NA 4FU6A 2WACA 5CIUA 2GFUA 3QKJA 2VYTA 3OYKA 3ME9A 1OYXA 3OMGA 3MP1A 4PLLA 3OYGA 4A4GA 3OYLA 4BDZA 3L2RA 3OYEA 2RHIA 2X4WA 3QBYA 3FEOA 5C0MA 3OA6A 3SD4A 3PMTA 4UC4A 3L2QA 4BACA 2RHYA 5KCHA 4C5GA 3OS1A 3O8VA 4E7HA 3GOXA 3DB3A 3LLRA 3C4SA 3M9QA 2EQJA 3OYHA 2HQEA 2RJDA 4N4IA 5J26A 5M9OA 2X4XA 3NTIA 4Z02A 5D6YA 3OMCA 4B9XA 2RI5A 3OYAA 1MHNA 1XNIA 2EFIA 2RHXA 5D6XA 5KE3A 2QQRA 2LDMA 4A4HA 2JTFA 2F5KA 5KE2A 5KCOA 4BE1A 4PL6A 4BDYA 4BE2A 2JZ2A 4QQDA 3FLGA 2EKOA 3OQ5A 3FC3A 2MWOA 3DB4A 4N4GA 2M1HA 3LYIA 4ZTFA 4E7JA 4L59A 3S3MA 2R57A 5FROA 3EAEA 2R5AA 4A4FA 3OYCA 4NS5A 3CEYA 4IUPA 4LD6A 4Q5WA 4N4HA 2B8AA 3QJ6A 4C5IA 3P8DA 4E7KA 2EQMA 3PNWC 2EQKA 3H6ZA 3UT1A 5IN1A 3LX7A 2RHZA 3H8ZA 4FL6A 2BKDN 3L42A 4PLIA 3UWNA 4IUUA 3OS2A 2M0OA 4BE0A 2RO0A 2XK0A 2M16A 2RHUA 2LVMA 4A4EA 3L2WA 3PMIA 4X34A 3OYFA 3OYBA 4C5EA 3P8HA 3L2UA 3LH0A 4CRIA 3OYJA 3LGFA 5J39A 2K3XA 4II1A 4QVZA 4RG2A 2DIGA 3FDRA 4IURA 3E9FA 4C5HA 4E7IA 2L8DA 2R5MA 2LCCA 2XDPA 3MEVA 4QQGA 3OYDA 3KUFA 3MO8A 2RJCA 3Q1JA 1RI0A 2HQXA 3MP6A 5KH6A 2DAQA 2E5QA 2GF7A 2FHDA 3DLMA 2PQWA 3MEAA 3S6WA 1WJSA 3OYIA 5FRMA 2LRQA 3L2VA 5D6WA 3F70A 3MEWA 2RJFA 2X35A 2L89A 2G3RA 4GY5A 2QQSA 3E9GA 3LGLA 2GFAA 4IUQA 4B9WA 3MP8A 3OY9A
chains in the Genus database with same CATH superfamily
2DIQA 3SWNA 3S3OA 3CCLT 2L3QA 2KRNA 2HMAA 2CH4A 1IB8A 2XICA 2MAMA 2E6ZA 4ELZC 1YI2A 1X43A 4M75A 2HAXA 1NBEB 1UJYA 3AHUA 3THKA 4M7AB 4HA8A 3EH2A 3VUBA 1I5OB 2GTOA 2E6NA 2FRYA 2NUPB 2YDLA 3UA6A 3ME9A 2NUTA 5GMKe 3QZ5B 2RF0A 5C0MA 5FU7B 4AG1C 2DE0X 5A0LA 2FVUA 1JJ2S 2FZCB 2DETA 2QAZA 3CCEA 3LLRA 5GAMh 2RQRA 4C8QA 3EG9B 3JB9F 2JJ9A 1K9MC 5KCOA 5D7UA 1SRLA 1NYGA 4PFOA 3A8LB 2DEUA 2CZ0B 1P92A 3CCLA 3LYIA 3OYYA 1A0NB 2R57A 1RADB 3EAEA 3CCMQ 1UFFA 2VXFA 2AT1B 1LJOA 2VC8A 1V29B 1AOJA 4PK4A 5GAN2 3BW1A 3LX7A 5GMKi 3EGUA 3EG1A 5HKCA 2KT1A 1WX6A 3M0SA 3JCMc 3EGXA 2FZGB 4X34A 1KHIA 1M1KR 3JV3A 3OYJA 2DRMA 2F69A 1MMGA 2KXDA 3FDRA 1YJNQ 3MPUB 4E7IA 4MZPA 3JCMX 1JRIA 2DX1A 2DM1A 1M90R 2ECZA 2ZPHB 3BDUA 3CBMA 3F70A 2GFAA 4LUDA 1VYVA 3VS1A 2KYMA 1VQ9T 3CC7A 3G6ET 1PG5B 2CH4W 2C0IA 4J8OA 2L5QA 1PM3A 4ANJA 2V8KA 5GAMg 4AMCA 2DERA 1JEGA 4M78F 4EPCA 2DBMA 4X9CA 1TSFA 1VQNA 2FB7A 2YUPA 2E12A 4HXJA 2OTLA 1YIJT 4BUGA 2X4WA 1QLYA 3M4GA 1QCFA 2K79A 1YJWQ 1KQSA 2V1QA 3C4SA 1JBMA 1NJIR 1M90U 5KYWB 3VUZA 4E47A 1WHJA 2HQEA 2X4XA 1VOMA 4ZGEB 4OB2B 1VQMT 4O6JA 5FLXE 1MNEA 2CP0A 4A4HA 1QVFS 2JTFA 1BKBA 2PU9B 1UGPB 5GAN4 3P8BB 1PHTA 1PSFA 5GAOq 1X2KA 2KMTA 4C92E 2DJQA 3VKIA 2CT4A 3A1PA 2E70A 3S3MA 1K4US 4M77G 1RACB 4KGXB 1D1AA 3H6ZA 3UT1A 2H8HA 4C8QG 3H8ZA 5GMKm 4DA4A 3UWNA 5CVIA 5KYUA 4J6YA 4LDWA 2Z0WA 3L2UA 2K3XA 2JS0A 4M7AE 2VGNA 4HCKA 3CCJA 2Y4XA 4RTUA 4XTXA 2CT3A 2QEXQ 2FG0A 3G71T 3CCQA 2L3SA 3V7RA 3MEWA 1TUCA 4M7DD 4C8QF 2A37A 1VQKT 5GANe 3META 5I11A 4QW2A 1N9RA 2DPPB 1QVGP 1ZBJA 1OEBA 3CMAQ 2DEQA 3M4YA 2F5TX 3QO3A 3MEUA 5HY6A 1M8VA 1ABQA 3A5ZB 2DL8A 1PKTA 2L3RA 5LJ3e 3CCRA 5FWBA 4R0KA 3HHTB 2A0FB 2E4HA 5GAMd 2EIFA 1EIFA 1AZEA 1K0XA 3EFRA 1QP2A 3CXCS 3CPWP 2ZCFB 3KFVA 2GTJA 4A63B 3GOXA 3NPFA 1KD1R 3FJ5A 3X20B 1WHHA 3M55A 2ROTA 3VJPA 1NM7A 1VQPQ 1D0ZA 2RM4A 4HVUA 2EKOA 1M1KC 1GCPA 2GNCA 2WSFE 2JTMA 4WTOB 2C0TA 1IGQA 3EG2A 3I55Q 2LQKA 2J6OA 4A4KA 4E7KA 3CMEA 4HVVA 3JB9H 2EWNA 4M7AA 3JCMQ 4M78G 1SSHA 1R77A 2K57A 1S72T 1C0MA 2VKNA 3CCVT 2CP3A 2X3WD 1BYMA 3PE0A 1Q86R 3RKYA 1VIFA 2O01E 2KBTA 2GF7A 4PJOD 4PFZA 2FHDA 1YJNT 2XU8A 2E1HA 3JSCA 4M78C 1I5LA 2K4YA 4PJJA 3CPWS 4CI0C 2X3XD 4JJNK 1Y96A 4OMFB 2LCLA 1X75C 1RAHB 3GBQA 1IZ6A 2HSPA 1YI2Q 4FSSA 1LNXA 1WIEA 4ELYC 5DLOA 3CC2T 2XIDA 2A08A 3REAB 4LDUA 1OQKA 1ZA2B 1R0CB 4BY6B 2WACA 4J7FA 3I9QA 4DBQA 3H0FA 2P4TA 3SD4A 2EVRA 2ZPBB 1N9SA 2DK3A 2RJDA 5J26A 4N0AC 4FW1A 3JB9G 1JJ2P 3A8OB 3GF5A 4BE1A 1VQPA 4JLIA 2OX7A 1KQSS 3UDCA 2CP2A 2O2OA 1BI3A 3RR6A 2YSQA 4M78A 3FJPA 4XU3A 4RMOA 5FWCA 1YWPA 1JO8A 2LQ8A 1I07A 2BTTA 3CC2Q 3HRTA 1FMWA 2QQAA 2M0OA 4QVDA 1G2BA 5GMKj 3TVTA 4QVCA 9ATCB 3EG3A 5CKDA 1VQNQ 2J6FA 2LJ1A 3SB2A 1QCOA 3LH0A 4EMGA 1YJNA 4II1A 4QVZA 5DM7R 4LDYA 4PJMA 3G1JA 4O5VA 3RMQA 2LRQA 1YJWA 2P84A 1VQ5A 4GBQA 5A0DA 1YITT 4EMKA 1I81A 2YLCA 4B9WA 3HTRA 2AK5A 5GAMf 3NMZC 4EMHA 5FROA 5FRNA 1YBYA 4JRKA 2YRCA 4M77E 4FYVB 1ZX6A 2O4XB 1K73R 2EYXA 3JCMh 3PFSA 2G6FX 1OI1A 2HQHA 5HCKA 4KGVB 4C8QE 1AVZC 1UUEA 4J6WA 3J81E 3CC4T 1RUWA 2QI2A 3TQ7P 1OOTA 1WHGA 1PNJA 4JRIA 2NLUA 3QWXX 2K3YA 3QJYA 5A2QE 1AZGB 2GFUA 3EGDB 1BI1A 3H9NA 4BI4A 1YIJA 4L6V5 1I8FA 3SWNC 1UHCA 3GNFB 2VWFA 4XTUA 4C5GA 3OS1A 3O8VA 1VQ7Q 3PGGA 2JMCA 3VRZA 3OYHA 2RH2A 4D6WA 4JS5A 1DJ7B 5FW9A 3CCJQ 2EPDA 1B7TA 3NTIA 3A8MB 1EX4A 4M7AD 3V8JA 2EW3A 1Q86U 3VV0A 2FEIA 1M2OA 1O75A 4J9IA 2FPDA 1W1FA 4CC7A 5LJ5d 1C6VX 5GANd 4E2FB 3JAME 4VUBA 4AFQC 4Y91A 2FRWA 4C8QD 2B8AA 1NJIC 1WPYA 3CCMT 4JPBW 2JW4A 3AT1B 4PLIA 3CC2A 4IUUA 1O9SA 2VXEA 2LVMA 1D0YA 2A7YA 3X25B 3OYFA 3CXCA 3ZL7C 1S72Q 2DZCA 4CRIA 1Y96B 1WFWA 2E3HA 3MEVA 3GPLA 3MO8A 2DVEA 5KH6A 3CCQQ 2E5KA 2DAQA 2E5QA 3CD6Q 1PCXA 3OYIA 1KIKA 1GRIA 2J05A 4DOWA 2K5IA 5LJ5f 4CC4B 3MP8A 1ZSZB 3D7SB 3OB9A 2SEMA 1UGVA 3VS2A 1TUGB 1VQPT 1TH7A 1WGSA 1EZZB 1KQ1A 1VQ9Q 4BD3A 2KVQG 6AT1B 4KULA 2F2WA 3FIFA 1KC8U 2D9TA 3VS4A 4ZTJA 2I2LA 2KYBA 4LD9K 1OPKA 4E7ZA 3VYHB 2X9HA 4AFUC 2DXCA 5KYYA 1UG1A 2BZXA 2QQ9A 5GAMe 5LJ3j 2GBQA 1OX8A 2LC4A 2DMOA 1TWBA 5LJ3f 1IHVA 1X6BA 4E7HA 1W70A 3M9QA 2QA4Q 2RMOA 4Z8AA 5DLQE 3CCUA 4M7AC 3CD6T 2RI5A 5KE3A 2YRDA 4WCIA 5KE2A 4J9CA 4BDYA 2LJ3A 2JZ2A 4E7SA 3EGXB 4M78B 2PVDB 4OMPA 3QDRB 2LJ0A 4FW2A 5IHNA 5CQYA 2AZSA 4FIBA 4C92B 2CZ6B 2HZYA 4OGCA 1E7OA 4YTLA 1FXXA 1WYXA 3JRZA 2QGGA 1VQOA 2KGTA 2YUNA 2PUOB 4RTVA 3L2WA 1VYTA 2B86A 1X6GA 5ECAA 2LCSA 1ZHIA 4ZN1A 1Q7YC 4KH1B 3CCVA 4IURA 3G71Q 4ESRA 1G83A 2DTIA 1X01A 2CS7A 1XOVA 2RQUA 1WJSA 3HKSA 2HD0A 1TG0A 2K2VA 2ZPIB 3CCSA 1YHQQ 2RJFA 2EYZA 3CCLQ 3LGLA 4F7UA 1U1SA 1SKUB 2V26A 3X26B 2CDTA 1OU8A 4C8QB 1M30A 3RKXA 3BFMA 3PTAA 1SRMA 4M7DC 5GANh 4RTWA 4GLKA 1I1JA 2YLBA 4LDXA 3TREA 4J9HA 2H3EB 1G8XA 3MP1A 2KT8A 4IIOA 1LCKA 2DXTA 4RTZA 3WVEB 1C1AA 4RTXA 3CXCP 4BY6C 1Y0MA 1B3QA 3JB9D 3EFSA 2QK0A 3DLLA 2YUQA 4M7AG 2CYZB 1WXBA 2XHCA 3PVQA 3C0CA 2DKGA 3H0IA 2XDBA 1VQ8A 1M2VB 4LNPA 1KQ2A 1UTIA 1Q82U 2ATCB 4IUPA 1W4SA 2EYWA 5LJ5g 3ER0A 4M7DA 1VQ4T 4F14A 4BI8B 2K9GA 2F2VA 2HDAA 2PUKB 2D0QB 3RUXA 1WXTA 4JLGA 1Z9ZA 1VQ6Q 1WLPB 2DIGA 1K8AC 2YUOA 2DZ9A 1D1BA 4PJLA 2DXBA 2LQNA 3NGPA 1W2BA 5LL6S 2PNIA 3CCEQ 2L89A 3CCSQ 5L8RE 1JU5C 1CKAA 1OZ2A 1YHQA 2CUDA 1D3BB 1BBZA 3JCMg 4C92D 5EG2A 3ASKA 3BDLA 3HRSA 1RL2A 4TVRA 5C6SA 4F7UG 2CKKA 3EHQA 3TEEA 4HCBA 1WJQA 3CMAA 1MUZA 2AHJB 2MCNA 1N27A 1G5VA 2DLPA 1M5Q1 1K8AU 1AEYA 2LZ6B 2RK2A 2KE9A 2YXYA 1YIJQ 3QYHB 1MMNA 3JCMf 4FT2A 4M7AF 4DEXA 5HK0A 2A3LA 3QWYA 4J83A 2QDLA 2LT1A 4A54A 3L1AA 2RHYA 2KY9A 2X51A 2FYKA 3SEMA 1ACMB 1KJWA 3RDVA 2ZPFB 3GIBA 4ME7A 4J9DA 2L2PA 1ZUYA 2FL7A 4BE2A 4MMKA 1YCYA 1X69A 1MNDA 3CCST 1GBQA 2EJFA 3CC7T 3VS3A 1E6GA 1VA7A 2F2XA 4JRPA 1WQWA 4C0DC 1AWXA 1YFNA 2RPNA 1HD3A 1CSKA 2LQWA 4FM4B 1KC8R 2Y4YA 1W6XA 2V8IA 4PJOC 4PJNA 1RLPC 2ZPGB 3PMIA 2KRMA 2HCKA 3TSZA 2OTLT 2JS2A 2M0YA 3QXEB 3VS5A 1OULA 3Q1JA 3M5AA 4J7IA 2KK4A 1JQQA 3QDFA 3S6WA 2RB6A 1D1CA 5FRMA 3SDZA 5GAN5 3REBB 4FSXA 4GY5A 5IHIA 1M8MA 4M4ZA 1YITQ 2OJ2A 1H3ZA 1K76A 1VQ9A 3RNJA 5IXBA 3CMEQ 1TOVA 2RA2A 2RI2A 3TSWA 2P0PA 2LNVA 2JTEA 3QIIA 2YHTA 2OTJQ 1SSFA 3VYGA 3QYGB 2D8JA 4OMMA 5AT1B 4OF1A 2VVKA 3T9NA 4IUTA 1WDXA 1M4ZA 1MGQA 4PJOB 1TTHB 4M77F 1UDLA 2VASA 4M7DF 3GNGA 3NHNA 1KK7A 1N6AA 3M0QA 1VQ7T 3LW5E 4OGEA 2BE7D 1VQMA 4XU2A 1B34B 1VQLA 1U5SA 2W10A 4N4IA 2OI3A 1M27C 4Z02A 4FYWB 1D0XA 1YJ9T 3OMCA 2DO3A 4B9XA 2JT4A 1GFCA 2L3PA 4QQDA 1I0CA 3OQ5A 3FC3A 2PVGB 1SF9A 4KGZB 2MI6A 2QG9B 2LNHB 5KYXB 2RN8A 4AFZC 2E41A 2DA9A 3EFOB 3MCAB 4M7DB 1VQOQ 2DL7A 4LDVA 4XAXB 2Y90A 4M75C 2RHUA 4JUVA 4X1VA 4Z89A 4A53A 1Y57A 1ZLMA 1N5ZA 4F04B 1HYOA 3QUIA 1UGSB 1MV0B 2L8DA 2R5MA 2VV5A 1WXUA 1YWOA 1SHFA 4ZN3A 4JJBA 3QG1A 1G3SA 1H92A 2KSSA 1RAIB 4MZTA 1HXDA 3CCQT 4M75G 4RCCA 3NFCA 4RCBA 3PT9A 2KXCA 4RTTA 4NL2A 3OY9A 1OZ3A 1VIEA 2CSQA 3A8HB 1KQSP 4JDSA 1ABOA 1KFZA 2X4YA 1WHMA 2KEAA 2ENMA 2RI3A 2X4JA 1GCQA 5KYUB 4IUVA 1Q81C 4QQ6A 5GAN3 1GL5A 3FRNA 1VQNT 4JS4A 1AWWA 2GCXA 4M75B 3QKJA 3OSVA 3C94A 2ROLA 3L2RA 3OYEA 4C0DB 1UGQB 2RHIA 4BI3A 2PTKA 4M78D 1KSWA 2QTVA 5LJ5e 3PMTA 4UC4A 1QMCA 2NUPA 5KCHA 1NG2A 4DQ2A 2K2MA 1AD5A 2ZAEA 2DVJA 4MDXA 3OS5A 3HFNA 3OW2P 1BCMA 1VQLQ 2EYYA 5D6YA 2KRSA 3N5BB 1GBRA 4QT7A 5FU6C 3OYAA 1AWOA 2F5KA 1SEMA 2VGMA 5GAOm 4MZMA 4N4GA 5LJ5h 2M1HA 5LJ3g 2IIMA 3G4ST 1UE9A 1MMDA 4WF2A 5GAOp 2LX9A 4Q5WA 2HL3A 3P8DA 2EJGA 3M53A 5IN1A 2RHZA 4DEYA 1NLOC 2XK0A 4XQ3A 1H3HA 2EGAA 1QVGA 4C0GA 4C5EA 3P8HA 5LJ3d 3LWIA 4RG2A 1Q81R 4OB3B 4C5HA 5I2MA 2XDPA 2OAUA 4QQGA 3CCJT 3KUFA 3HSBA 1BB9A 1M3AA 2LX7A 3CD6A 4KUDK 1IREB 2VB6A 1YJ9A 4PNOA 3HRUA 2QDYB 2RQVA 3M57A 4C92G 3V8KA 1K73U 1RI9A 5GMKh 3VU3C 3CPWA 3CCMA 3I56Q 2I0NA 1K8AR 1ZBXA 1X6OA 2NUZA 2RK1A 2O9SA 2NUTB 4ZGDB 2IG0A 2F1LA 1BCOA 1AHJB 3OYNA 2BUDA 2JUFA 5I22A 2XMFA 5GJWB 2E64A 2CZ7B 3OYGA 1U3OA 4PLLA 1Q7YR 1Q82C 2EQIA 2BZYA 1N8RC 3INZA 3QBYA 5I2SA 4XTWA 1GXIE 5KYXA 4XU1A 5CKBA 1X2QA 2P4RA 3SHWA 1M9SA 1SPKA 3MHXA 5CKFA 3HP9A 4J9FA 1TXQA 2JVVA 4V2SA 5D6XA 1MHNA 1QQJA 2EFIA 1TUDA 5GJVB 2QQRA 2HEQA 2LDMA 5CQXA 2QEXT 4HT9A 1RAGB 4LN2A 1H8KA 1VQKQ 3PIPA 1YITA 1Y7XA 4A4FA 3OYCA 3CCRT 1XTDA 1K9MU 2EYQA 1G3YA 2JXBA 1IO6A 3J80E 1VQ4Q 1RLQC 2EQKA 4M77A 3GP8A 1BU1A 1PC0A 2BKDN 3L42A 4KT0E 1JB0E 2JN0A 3WXMB 1WA7A 5GAOl 3VS0A 4F7UB 2MPXC 1Q7YU 4GLMA 2KDSA 5CR2A 2DJZA 8ATCB 3UF4A 4N0AA 1G3WA 1PD0A 1IHWA 2AIRB 1PSEA 2HQXA 3MP6A 1VQ5Q 3G71A 1ARKA 2K5LA 3KBGA 3RBBB 2DD5A 2KR3A 3OW2A 2EJ9A 1K73C 1K9AA 4KUIA 1KC8C 1Q95G 2ZPEB 1YJ9Q 2DD4A 3ZEHA 3M54A 2BE9B 1T0JA 1K1ZA 3OBYA 4EIKA 3VS7A 5IXFA 3C95A 3MKDA 5GAN6 3G6EQ 2CGHA 5L23A 3E19A 1PRMC 1T0HA 2LTOA 3EGDA 4M78E 1JJ2A 1FWZA 4M75E 3JB9I 1YNZA 1V76A 4F7UF 2RJEA 2KI7A 2M9UA 2XG8D 1N8RU 2VYTA 1CKBA 2JMAA 2CREA 2RQWA 2WSCE 4A4GA 1FMVA 4C92A 3RERA 1VQ7A 2D8HA 2H3JA 2MOXA 2AZVA 2RD1A 4EMKC 2ED1A 1SHGA 2QASA 4M7DG 4RG8A 5GANg 1UECA 3X28B 1VQ5T 2ABLA 2K5FA 3ZFJA 1QWEA 1E6HA 3CPFA 2CUBA 3RESA 4XTVA 3JCMb 1M90C 3EG0A 5LJ3h 4FT4A 1AT1B 2J06A 4Y92A 1RAAB 5GAMj 2O88A 3CC7Q 1YI2T 4NS5A 3PIOA 3RIRA 2KNBB 4LXCA 2CP7A 5EC7A 1AWJA 2FPFA 4FL6A 3O5ZA 3I5RA 3FB9A 1Y07A 1ZSZA 4A4EA 2A36A 1T3LA 2GQVA 5CKHA 3A98A 3LGFA 3M0RA 1NEGA 1W2BS 4JJCA 2D6FA 2OTLQ 3E9FA 2LCCA 3JCMW 4M75D 3M59A 1YJWT 4OMOA 3WVDB 2HL5C 3L2VA 3M0PA 3JCMV 1VQKA 2G3RA 2GQIA 2QQSA 1YCSB 3CMET 2P0KA 2GGRA 5AYFA 2CSIA 1N8RR 8AT1B 3A8GB 2C06A 1G3TA 2EKHA 1PD1A 4C0FA 3NTHA 2K7AA 5IAYA 4E7LA 3I56T 2O31A 4B6MA 1IXDA 4JZ4A 3JCMP 3JCMe 1T3SA 1TS9A 4PJOE 2EQUA 3J7AF 2BIVA 3G7ZA 4MDWA 3V7CA 1VQ6A 5CIUA 2KQWA 2DRKA 1RAEB 4J9GA 2RNAA 1FMKA 1WHLA 1WZOA 3FEOA 2DBKA 4KBMB 3CCUT 4MMLA 1UB4A 1TU0B 4D8DA 5GANj 2EGEA 3M0TA 2QYZA 3EFOA 5KYWA 3CCET 5M9OA 5GAN7 4M77B 4J6XA 4RKUE 2WSEE 1XNIA 4OMQA 2RHXA 3G4SA 3QPHA 2P0QA 3G6EA 4PL6A 3FLGA 2LT4A 4K11A 2CP5A 2SRCA 1OX9A 2AKKA 2HSEB 4E7JA 4F17A 1FX7A 2R5AA 1M1FA 4C5IA 3E2UA 3PNWC 3DKMA 3I55T 3URGA 1ZUKA 3HPWA 4CC3A 2ZGWA 1VQOT 3X24B 1QKWA 5CO7A 1VUBA 2K3BA 1NYFA 3CCVQ 4ATOA 5J39A 1QCNA 2FPEA 1BK2A 1HJDA 1S1NA 1WNLA 4PKCC 5CCAA 2VUBA 5A0GA 1K0SA 4PJOF 4AT1B 4R55A 3KXTA 3UATA 1JXMA 3BY7A 4DBHA 3VS6A 2YRVA 2M02A 1KHCA 4LUEA 2L0AA 1OPLA 3IQLA 3UPUA 2NYSA 2XKOC 2JM8A 3CQTA 4EDUA 1ZUUA 1D09B 2EGCA 1XQHA 3CCRQ 2R58A 5IT9E 3I5SA 2QTXA 1K9MR 3HL8A 3OYKA 5KYNA 2HKNA 3U23A 2ED0A 1M2VA 3JB9J 1WQ7A 5GAOr 1M1KU 5IH2A 3C12A 3L2QA 4BACA 2BZ8A 4QKUA 3H41A 2DXUA 1HK9A 2D0NA 2COZA 1LVKA 2NWMA 4Y28E 5DY9A 2COYA 1GCQC 2DILA 1VQMQ 4C92C 4FYXB 1XJWB 4OP0A 3OW2S 3R6NA 5I21A 1WHKA 4NL3A 1VYUA 4HVWA 1FYNA 2ESWA 3G4SQ 2MF2A 3DB4A 3SWNB 2OTJA 1OU9A 1R8OB 4ZTFA 2QGFB 3RKWA 2EBPA 1VQ4A 4XU0A 1Y71A 4LD6A 2HNIA 4RUGA 5GANf 4HT8A 2E65A 1M1GA 1ZSGA 4C92F 2PZ1A 4D8KA 4XK8E 2M51A 2RO0A 1BIBA 2DL5A 2YT6A 4HKEA 3OSSC 5IHKA 1U8RA 3LWHA 2MMPA 3QZ9B 3TU4K 4M7DE 2HBWA 1X27A 2CZ1B 4RTYA 3UA7A 3JCMd 4X9DA 4F7UE 2JOYA 1D3BA 1HSQA 4OMLA 4M75F 2QA4T 1KD1C 2KROA 5D6WA 1PKSA 2LMJA 4IUQA 5CK9A 1F1BB 1R0BG 4OMNA 4OVAA 4IKFA 4J9EA 2DNUA 2OTJT 4DBRA 1QVGS 1I4K1 1V1CA 1QVFP 1LPLA 1WJRA 1KG1A 5GAN8 2IPOB 2J6KA 3CC4Q 1QWFA 4L5GA 3PVLA 1VQ6T 3OYLA 4C8QC 4BDZA 2C0OA 2CP6A 2LP5A 3L2ZA 2E10A 2D1XA 5FU7C 2YWWA 4CC2A 5LJ5j 3DB3A 2AKLA 3QHSA 1GFDA 2DFUA 3V8LA 1U1TA 1RABB 1QVPA 3OA6A 2XD0A 1B34A 4EMKB 3V7SA 2HKQB 1YHQT 4J5YA 1NPRA 4BB7A 1J3TA 2KAFA 2A28A 4E6RA 2MYSA 5GMKl 3MJXA 4L59A 4FYYB 2V1RA 3EG9A 3QJ6A 4Z88A 2EQMA 2OAWA 2E3IA 4OB1B 1Q82R 2DTHA 3OBWA 3OS2A 2EAYA 4XTYA 2O9VA 1YP5A 2IVWA 2M16A 2DYIA 3ULRB 3CBOA 3GLXA 3BE3A 3OYBA 2QA4A 1PWTA 1NZ9A 2DL4A 3CCUQ 3OYDA 2DL3A 2RJCA 1RI0A 1KD1U 1B07A 3DLMA 3MEAA 1IGUA 5HK3A 4M77C 2V8JA 3HFOA 1SG5A 1ZA1B 2X35A 4J9BA 2DF6A 4JJDA 1QW1A 1VQ8T 1LOJA 4IIMA 3NTKA 1IRXA 1YN8A 2XI9A 5GAOn 4JRQA 3OYMA 3S3NA 2COWA 2O4XA 1PRLC 5J3BA 3QSUA 3OS0A 1M3CA 4KRTA 4C0ZA 3H0HA 4R56A 4ORZA 4PJOA 2PVOB 3M58A 2MIOA 4DOVA 4OB0B 3LH5A 3CBPA 1U06A 1W2BP 4HCZA 2MWPA 4FU6A 5CKEA 1BI0A 1OYXA 3OMGA 2ZZDA 1Q81U 2QQBA 2HBPA 3SFMA 2QEXA 3E1SA 2J7IA 3EH1A 1UJ0A 1VQLT 2EQJA 2DTOA 2JM9A 2FZKB 2MK5A 3I56A 1ZQ1A 1NLPC 1MV3A 4AG2C 4XTZA 1BIAA 1RAFB 3CMAT 1Q86C 3RMSA 2MWOA 1VQ8Q 1UHFA 1BI2A 3ZBDA 2JNGA 3R6OA 1NE8A 3CC4A 2QXFA 5FU6B 3TCJA 1MMAA 3CEYA 4ZGJB 7AT1B 1QVFA 4N4HA 3I55A 4M77D 1NEBA 3I35A 3M56A 4JZ3A 2XDDA 1NJIU 4BE0A 1WI7A 4F16A 1NPPA 4ZNXA 5KYYB 1ZSZC 1S72A 4FCYA 1Z9QA 4AFSC 2W0ZA 1QKXA 2FO0A 1OV3A 1EFNA 1UEBA 4NOYA 1UGRB 3M0UA 4PFPA 3JCMJ 1QP3A 2K6DA 3EHRA 4LE9A 2PQWA 4DBFA 4P5NA 1H641 2RQTA 4HCCA 4PJOG 1M3BA 3VRYA 1JXOA 2DYBA 5CAIA 3E9GA 4KH0B
chains in the Genus database with same CATH topology
2P0KA 5FRNA 2DIQA 3SWNA 3S3OA 1H3ZA 1YBYA 4JRKA 5AYFA 4M77E 3CCLT 1VQ9A 2O4XB 3A8GB 2C06A 2RA2A 1G3TA 2RI2A 2XICA 2MAMA 3NTHA 1OI1A 2P0PA 3PFSA 3JCMh 2E6ZA 5IAYA 4E7LA 3I56T 4ELZC 1YI2A 4C8QE 2LNVA 4J6WA 3J81E 3CC4T 3JCMP 3QIIA 2YHTA 3JCMe 4M75A 4PJOE 2EQUA 2QI2A 1SSFA 2HAXA 4JRIA 3J7AF 3VYGA 3QYGB 2BIVA 2NLUA 2K3YA 3G7ZA 3AHUA 3QJYA 5A2QE 4OF1A 4MDWA 4HA8A 4M7AB 4IUTA 3T9NA 3V7CA 3VUBA 2E6NA 1M4ZA 1MGQA 1VQ6A 5CIUA 2GFUA 2KQWA 4PJOB 1BI1A 4M77F 3ME9A 4BI4A 1YIJA 5GMKe 3QZ5B 4L6V5 4M7DF 3GNGA 1I8FA 1N6AA 3FEOA 4KBMB 3SWNC 5FU7B 4MMLA 5C0MA 1UB4A 3LW5E 3CCUT 1VQ7T 3GNFB 4OGEA 5A0LA 4XTUA 4C5GA 3OS1A 2FVUA 3O8VA 1JJ2S 1VQMA 3PGGA 5GANj 3CCEA 3LLRA 4XU2A 3OYHA 1B34B 2RH2A 5GAMh 4C8QA 4D6WA 4JS5A 1VQLA 3CCET 5M9OA 4N4IA 1DJ7B 5GAN7 3JB9F 3NTIA 4Z02A 3A8MB 1YJ9T 4M77B 3OMCA 4J6XA 2DO3A 4RKUE 3V8JA 4B9XA 4M7AD 2WSEE 1XNIA 1Q86U 2RHXA 3VV0A 3G4SA 1K9MC 3QPHA 5KCOA 3CD6A 2P0QA 3G6EA 4PL6A 1O75A 4QQDA 3FLGA 2LT4A 3A8LB 3OQ5A 5LJ5d 2PVGB 3FC3A 2CZ0B 1P92A 3CCLA 2MI6A 3LYIA 3OYYA 5GANd 4E7JA 3JAME 4VUBA 2R57A 3EAEA 1FX7A 2R5AA 4Y91A 2VXFA 1M1FA 4C5IA 2E41A 1LJOA 2VC8A 1V29B 2B8AA 4C8QD 1NJIC 3PNWC 3DKMA 1WPYA 3I55T 5GAN2 3BW1A 3MCAB 3LX7A 5GMKi 3CCMT 3URGA 5HKCA 4M7DB 3HPWA 4LDVA 4PLIA 4XAXB 3CC2A 4IUUA 1O9SA 2ZGWA 2Y90A 4M75C 2RHUA 2VXEA 2LVMA 4JUVA 1VQOT 3JCMc 3X24B 2A7YA 4A53A 4X34A 3X25B 1KHIA 5CO7A 3OYFA 1VUBA 3CXCA 2DZCA 3QUIA 4CRIA 3OYJA 5J39A 2F69A 4ATOA 1Y96B 3FDRA 1UGSB 4E7IA 2L8DA 2R5MA 2VV5A 3MEVA 1JRIA 4MZPA 3JCMX 3MO8A 3GPLA 2DVEA 5KH6A 2DAQA 2E5QA 4ZN3A 1WNLA 4PKCC 3QG1A 3OYIA 1G3SA 5CCAA 2VUBA 2KSSA 2ZPHB 5A0GA 4MZTA 4PJOF 1HXDA 4R55A 3CCQT 4M75G 4RCCA 3KXTA 3BDUA 3CBMA 3F70A 2K5IA 3NFCA 3PT9A 4RCBA 3BY7A 4DOWA 5LJ5f 4NL2A 2GFAA 3MP8A 3OY9A 1OZ3A 3OB9A 1VIEA 2YRVA 3A8HB 1VQ9T 3CC7A 3G6ET 1VQPT 1KHCA 1TH7A 2L5QA 1WGSA 4J8OA 4JDSA 3UPUA 1KQ1A 4BD3A 2V8KA 2X4YA 2KVQG 2RI3A 2X4JA 5GAMg 4KULA 2XKOC 3FIFA 4EDUA 1KC8U 2D9TA 4IUVA 1Q81C 4M78F 4EPCA 4QQ6A 5GAN3 4ZTJA 2OTJA 4X9CA 2I2LA 4LD9K 1XQHA 2R58A 5IT9E 1VQNA 3FRNA 3VYHB 2DXCA 2QTXA 1VQNT 2FB7A 4JS4A 2GCXA 3HL8A 4M75B 3QKJA 2QQ9A 3OSVA 5GAMe 3OYKA 2E12A 3C94A 5LJ3j 2OTLA 1YIJT 3L2RA 4BUGA 4C0DB 1UGQB 2RHIA 4BI3A 3OYEA 2LC4A 2X4WA 1WQ7A 4M78D 5GAOr 3JB9J 1M1KU 3C12A 3PMTA 3M4GA 4UC4A 5LJ5e 3L2QA 5LJ3f 5KCHA 4BACA 2DXUA 1HK9A 1KQSA 4DQ2A 4E7HA 4Y28E 3C4SA 1M90U 1JBMA 3M9QA 5DY9A 4MDXA 3OS5A 3VUZA 4C92C 4E47A 2HQEA 4OP0A 5DLQE 3OW2S 3HFNA 2X4XA 5D6YA 3CCUA 4ZGEB 4OB2B 3N5BB 1VQMT 3CD6T 4M7AC 5I21A 4O6JA 2RI5A 5FU6C 3OYAA 5KE3A 5FLXE 4NL3A 1QVFS 4A4HA 2F5KA 2JTFA 1BKBA 2PU9B 5KE2A 4BDYA 2JZ2A 1UGPB 5GAN4 2MF2A 2VGMA 3P8BB 3DB4A 1PSFA 3SWNB 5GAOm 4M78B 5GAOq 4MZMA 1R8OB 2PVDB 4N4GA 2M1HA 5LJ5h 2KMTA 4C92E 5LJ3g 4ZTFA 3G4ST 3QDRB 3RKWA 3VKIA 4WF2A 2E70A 4XU0A 1Y71A 5GAOp 4M77G 3S3MA 1VQ4A 2LX9A 4LD6A 4Q5WA 5CQYA 2HNIA 2EJGA 3P8DA 4FIBA 4C92B 3H6ZA 2CZ6B 2E65A 3M53A 3UT1A 5IN1A 5GANf 4HT8A 1M1GA 4C8QG 2RHZA 3H8ZA 4OGCA 4YTLA 4C92F 5GMKm 4DA4A 1FXXA 3UWNA 3JRZA 4XK8E 2RO0A 1VQOA 5CVIA 2XK0A 4XQ3A 4J6YA 4LDWA 1BIBA 2PUOB 3L2WA 4HKEA 3OSSC 1U8RA 1QVGA 4C0GA 3LWHA 4C5EA 3P8HA 2MMPA 5LJ3d 1ZHIA 4ZN1A 3QZ9B 3LWIA 3L2UA 2K3XA 3TU4K 4M7DE 4RG2A 1Q7YC 4M7AE 3CCVA 2CZ1B 2VGNA 3CCJA 4OB3B 4IURA 4C5HA 5I2MA 2XDPA 2OAUA 2Y4XA 4QQGA 3CCJT 3KUFA 3JCMd 3HSBA 2DTIA 4XTXA 1X01A 2CS7A 4X9DA 4F7UE 1XOVA 1WJSA 2JOYA 1D3BA 3G71T 3CCQA 3HKSA 3V7RA 2HD0A 2ZPIB 2K2VA 4M75F 5D6WA 3CCSA 2QA4T 1IREB 1YJ9A 1KD1C 4KUDK 4PNOA 3MEWA 2RJFA 4M7DD 3HRUA 4C8QF 2QDYB 3LGLA 4IUQA 3M57A 4F7UA 4C92G 1U1SA 3V8KA 1VQKT 5CK9A 3X26B 1K73U 5GANe 3META 4C8QB 5GMKh 4OVAA 4QW2A 1N9RA 3RKXA 3VU3C 3CPWA 3CCMA 4IKFA 2DPPB 3BFMA 3PTAA 4M7DC 5GANh 2OTJT 2DEQA 1QVGS 1I4K1 1ZBXA 1X6OA 4GLKA 3M4YA 2F5TX 2RK1A 3QO3A 1WJRA 2YLBA 1KG1A 3MEUA 4ZGDB 4LDXA 5HY6A 3TREA 2IG0A 1M8VA 5GAN8 3A5ZB 1AHJB 3OYNA 2BUDA 2L3RA 2JUFA 4L5GA 5LJ3e 3CCRA 3HHTB 2E64A 1S72T 2CZ7B 3OYGA 4PLLA 3MP1A 1Q82C 1VQ6T 5GAMd 3OYLA 4C8QC 4BDZA 1N8RC 3INZA 2EIFA 2DXTA 3QBYA 1EIFA 3L2ZA 2E10A 3WVEB 5FU7C 3EFRA 1QP2A 5I2SA 4BY6C 3CXCS 4XTWA 2ZCFB 1GXIE 4XU1A 5CKBA 5LJ5j 3DB3A 3GOXA 3JB9D 3EFSA 3QHSA 1M9SA 3DLLA 3V8LA 3MHXA 5CKFA 4M7AG 3X20B 2CYZB 1U1TA 3HP9A 2XHCA 3M55A 1QVPA 3VJPA 2JVVA 2DKGA 4V2SA 1MHNA 2EFIA 5CQXA 5D6XA 3OA6A 1B34A 2QQRA 2LDMA 3V7SA 2RM4A 4EMKB 2XDBA 2XD0A 4HT9A 2EKOA 4J5YA 1YHQT 1NPRA 1VQ8A 4BB7A 1KQ2A 1M1KC 2WSFE 2KAFA 2JTMA 3PIPA 5GMKl 4L59A 1YITA 1Q82U 2LQKA 1Y7XA 4A4FA 3OYCA 3CCRT 4A4KA 1XTDA 1K9MU 2EYQA 4IUPA 4E7KA 1G3YA 3QJ6A 3J80E 3CMEA 1W4SA 2EQMA 3JB9H 2EQKA 4M77A 2EWNA 3GP8A 4M7AA 5LJ5g 3ER0A 4OB1B 3JCMQ 4M7DA 1VQ4T 2BKDN 2DTHA 3L42A 3OBWA 4KT0E 3OS2A 4M78G 4BI8B 2K57A 1JB0E 2JN0A 2EAYA 4XTYA 3WXMB 4C0FA 2PUKB 2IVWA 2D0QB 2M16A 5GAOl 3CCVT 3CBOA 3GLXA 3RUXA 4JLGA 4F7UB 1Q7YU 1BYMA 2KDSA 5CR2A 2DJZA 3OYBA 3RKYA 2QA4A 4N0AA 1G3WA 2DIGA 1K8AC 1NZ9A 2DZ9A 3OYDA 1VIFA 1PSEA 2O01E 2RJCA 1RI0A 2HQXA 3MP6A 1KD1U 2GF7A 4PJOD 2FHDA 3DLMA 3G71A 2XU8A 2DXBA 3MEAA 1YJNT 1W2BA 2K5LA 2E1HA 3JSCA 4M78C 5HK3A 3KBGA 1I5LA 2K4YA 2DD5A 4M77C 2V8JA 5LL6S 3OW2A 2EJ9A 3CPWS 3HFOA 4CI0C 1K73C 2L89A 2X35A 4JJNK 1Y96A 4KUIA 4OMFB 1KC8C 2LCLA 1X75C 2ZPEB 2DD4A 5L8RE 1QW1A 1OZ2A 3M54A 3ZEHA 1YHQA 1VQ8T 1IZ6A 1D3BB 1LOJA 3NTKA 3OBYA 2XI9A 3JCMg 5GAOn 4C92D 4JRQA 3OYMA 3C95A 2O4XA 5EG2A 3S3NA 3ASKA 3BDLA 3HRSA 1RL2A 1LNXA 4TVRA 5J3BA 5GAN6 5C6SA 3OS0A 4F7UG 3QSUA 4C0ZA 4ELYC 2CGHA 2CKKA 5DLOA 3TEEA 4HCBA 3CC2T 1WJQA 3CMAA 2AHJB 2XIDA 3E19A 4R56A 4LDUA 2LTOA 4PJOA 4M78E 1JJ2A 1FWZA 1N27A 4M75E 2PVOB 1G5VA 3M58A 3JB9I 4DOVA 1M5Q1 1K8AU 4OB0B 2RK2A 4F7UF 2RJEA 3CBPA 4BY6B 2QEXT 4HCZA 2M9UA 2MWPA 4FU6A 2XG8D 1N8RU 2WACA 3QYHB 5CKEA 2VYTA 3JCMf 4FT2A 4M7AF 1BI0A 1OYXA 3OMGA 4J7FA 4A4GA 2WSCE 2ZZDA 1Q81U 5HK0A 4C92A 2A3LA 2QQBA 4J83A 2P4TA 3SD4A 3RERA 1VQ7A 2LT1A 2HBPA 4A54A 3SFMA 3L1AA 2RHYA 2H3JA 3E1SA 2QEXA 2ZPBB 1N9SA 2KY9A 2DK3A 2RD1A 4EMKC 1VQLT 2EQJA 2DTOA 2FYKA 4M7DG 4RG8A 2RJDA 5J26A 4N0AC 5GANg 3JB9G 2ZPFB 3GIBA 3A8OB 3X28B 4ME7A 3I56A 1VQ5T 1ZQ1A 3GF5A 2K5FA 3ZFJA 3CPFA 4XTZA 3RESA 1BIAA 4BE1A 2FL7A 4BE2A 4MMKA 4XTVA 1VQPA 4JLIA 3JCMb 1KQSS 1YCYA 3UDCA 1M90C 1Q86C 3RMSA 3CMAT 2MWOA 3CCST 1BI3A 4FT4A 5LJ3h 4M78A 2EJFA 3CC7T 3FJPA 4XU3A 4RMOA 1BI2A 3ZBDA 2JNGA 3R6OA 1NE8A 5GAMj 2QXFA 3CC4A 5FU6B 3TCJA 1YI2T 4NS5A 2LQ8A 3CEYA 4ZGJB 1QVFA 4N4HA 3I55A 4JRPA 3PIOA 3RIRA 1WQWA 4M77D 4C0DC 3M56A 3HRTA 2XDDA 1NJIU 4FL6A 2QQAA 4FM4B 2M0OA 4QVDA 5GMKj 2Y4YA 4BE0A 1NPPA 3FB9A 2V8IA 4PJOC 1Y07A 4QVCA 1S72A 4A4EA 5CKDA 2ZPGB 3PMIA 2GQVA 3SB2A 2OTLT 3LH0A 5CKHA 3LGFA 1UEBA 4II1A 4EMGA 1YJNA 4NOYA 4QVZA 3QXEB 1UGRB 5DM7R 1W2BS 3JCMJ 4LDYA 2D6FA 1QP3A 3E9FA 2LCCA 3JCMW 4O5VA 3Q1JA 3RMQA 3M5AA 4J7IA 2KK4A 4M75D 3M59A 1YJWT 2PQWA 3S6WA 2RB6A 3WVDB 5FRMA 2LRQA 1H641 4P5NA 3L2VA 1YJWA 1VQ5A 3SDZA 5A0DA 5GAN5 4PJOG 4HCCA 1YITT 4EMKA 4FSXA 3JCMV 1I81A 1VQKA 5CAIA 2G3RA 2YLCA 4GY5A 4B9WA 2QQSA 3E9GA 5GAMf 4EMHA 5FROA 3CMET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P0K A;  3ZEH A;  1OZ2 A;  5FRN A;  1OZ3 A;  2DIQ A;  3MET A;  3OB9 A;  2YRV A;  3S3O A;  1H3Z A;  3NTK A;  4OVA A;  4QW2 A;  1KHC A;  4IKF A;  1WGS A;  2O4X B;  3OYM A;  2O4X A;  3S3N A;  3ASK A;  3BDL A;  2RI2 A;  3PFS A;  3NTH A;  1OI1 A;  2X4Y A;  4BD3 A;  5IAY A;  4E7L A;  5C6S A;  3OS0 A;  2RI3 A;  2CKK A;  1WJQ A;  4EDU A;  2D9T A;  3QII A;  4IUV A;  2LTO A;  4QQ6 A;  1N27 A;  1WJR A;  1SSF A;  2EQU A;  3MEU A;  4ZTJ A;  1G5V A;  2IG0 A;  2BIV A;  2NLU A;  2K3Y A;  2R58 A;  2RJE A;  3OYN A;  2BUD A;  2L3R A;  4IUT A;  4HCZ A;  2MWP A;  2E6N A;  4FU6 A;  2WAC A;  5CIU A;  2GFU A;  3QKJ A;  2VYT A;  3OYK A;  3ME9 A;  1OYX A;  3OMG A;  3MP1 A;  4PLL A;  3OYG A;  4A4G A;  3OYL A;  4BDZ A;  3L2R A;  3OYE A;  2RHI A;  2X4W A;  3QBY A;  3FEO A;  5C0M A;  3OA6 A;  3SD4 A;  3PMT A;  4UC4 A;  3L2Q A;  4BAC A;  2RHY A;  5KCH A;  4C5G A;  3OS1 A;  3O8V A;  4E7H A;  3GOX A;  3DB3 A;  3LLR A;  3C4S A;  3M9Q A;  2EQJ A;  3OYH A;  2HQE A;  2RJD A;  4N4I A;  5J26 A;  5M9O A;  2X4X A;  3NTI A;  4Z02 A;  5D6Y A;  3OMC A;  4B9X A;  2RI5 A;  3OYA A;  1MHN A;  1XNI A;  2EFI A;  2RHX A;  5D6X A;  5KE3 A;  2QQR A;  2LDM A;  4A4H A;  2JTF A;  2F5K A;  5KE2 A;  5KCO A;  4BE1 A;  4PL6 A;  4BDY A;  4BE2 A;  2JZ2 A;  4QQD A;  3FLG A;  2EKO A;  3OQ5 A;  3FC3 A;  2MWO A;  3DB4 A;  4N4G A;  2M1H A;  3LYI A;  4ZTF A;  4E7J A;  4L59 A;  3S3M A;  2R57 A;  5FRO A;  3EAE A;  2R5A A;  4A4F A;  3OYC A;  4NS5 A;  3CEY A;  4IUP A;  4LD6 A;  4Q5W A;  4N4H A;  2B8A A;  3QJ6 A;  4C5I A;  3P8D A;  4E7K A;  2EQM A;  3PNW C;  2EQK A;  3H6Z A;  3UT1 A;  5IN1 A;  3LX7 A;  2RHZ A;  3H8Z A;  4FL6 A;  2BKD N;  3L42 A;  4PLI A;  3UWN A;  4IUU A;  3OS2 A;  2M0O A;  4BE0 A;  2RO0 A;  2XK0 A;  2M16 A;  2RHU A;  2LVM A;  4A4E A;  3L2W A;  3PMI A;  4X34 A;  3OYF A;  3OYB A;  4C5E A;  3P8H A;  3L2U A;  3LH0 A;  4CRI A;  3OYJ A;  3LGF A;  5J39 A;  2K3X A;  4II1 A;  4QVZ A;  4RG2 A;  2DIG A;  3FDR A;  4IUR A;  3E9F A;  4C5H A;  4E7I A;  2L8D A;  2R5M A;  2LCC A;  2XDP A;  3MEV A;  4QQG A;  3OYD A;  3KUF A;  3MO8 A;  2RJC A;  3Q1J A;  1RI0 A;  2HQX A;  3MP6 A;  5KH6 A;  2DAQ A;  2E5Q A;  2GF7 A;  2FHD A;  3DLM A;  2PQW A;  3MEA A;  3S6W A;  1WJS A;  3OYI A;  5FRM A;  2LRQ A;  3L2V A;  5D6W A;  3F70 A;  3MEW A;  2RJF A;  2X35 A;  2L89 A;  2G3R A;  4GY5 A;  2QQS A;  3E9G A;  3LGL A;  2GFA A;  4IUQ A;  4B9W A;  3MP8 A;  3OY9 A; 
#chains in the Genus database with same CATH topology
 2DIQ A;  3SWN A;  3S3O A;  3CCL T;  2L3Q A;  2KRN A;  2HMA A;  2CH4 A;  1IB8 A;  2XIC A;  2MAM A;  2E6Z A;  4ELZ C;  1YI2 A;  1X43 A;  4M75 A;  2HAX A;  1NBE B;  1UJY A;  3AHU A;  3THK A;  4M7A B;  4HA8 A;  3EH2 A;  3VUB A;  1I5O B;  2GTO A;  2E6N A;  2FRY A;  2NUP B;  2YDL A;  3UA6 A;  3ME9 A;  2NUT A;  5GMK e;  3QZ5 B;  2RF0 A;  5C0M A;  5FU7 B;  4AG1 C;  2DE0 X;  5A0L A;  2FVU A;  1JJ2 S;  2FZC B;  2DET A;  2QAZ A;  3CCE A;  3LLR A;  5GAM h;  2RQR A;  4C8Q A;  3EG9 B;  3JB9 F;  2JJ9 A;  1K9M C;  5KCO A;  5D7U A;  1SRL A;  1NYG A;  4PFO A;  3A8L B;  2DEU A;  2CZ0 B;  1P92 A;  3CCL A;  3LYI A;  3OYY A;  1A0N B;  2R57 A;  1RAD B;  3EAE A;  3CCM Q;  1UFF A;  2VXF A;  2AT1 B;  1LJO A;  2VC8 A;  1V29 B;  1AOJ A;  4PK4 A;  5GAN 2;  3BW1 A;  3LX7 A;  5GMK i;  3EGU A;  3EG1 A;  5HKC A;  2KT1 A;  1WX6 A;  3M0S A;  3JCM c;  3EGX A;  2FZG B;  4X34 A;  1KHI A;  1M1K R;  3JV3 A;  3OYJ A;  2DRM A;  2F69 A;  1MMG A;  2KXD A;  3FDR A;  1YJN Q;  3MPU B;  4E7I A;  4MZP A;  3JCM X;  1JRI A;  2DX1 A;  2DM1 A;  1M90 R;  2ECZ A;  2ZPH B;  3BDU A;  3CBM A;  3F70 A;  2GFA A;  4LUD A;  1VYV A;  3VS1 A;  2KYM A;  1VQ9 T;  3CC7 A;  3G6E T;  1PG5 B;  2CH4 W;  2C0I A;  4J8O A;  2L5Q A;  1PM3 A;  4ANJ A;  2V8K A;  5GAM g;  4AMC A;  2DER A;  1JEG A;  4M78 F;  4EPC A;  2DBM A;  4X9C A;  1TSF A;  1VQN A;  2FB7 A;  2YUP A;  2E12 A;  4HXJ A;  2OTL A;  1YIJ T;  4BUG A;  2X4W A;  1QLY A;  3M4G A;  1QCF A;  2K79 A;  1YJW Q;  1KQS A;  2V1Q A;  3C4S A;  1JBM A;  1NJI R;  1M90 U;  5KYW B;  3VUZ A;  4E47 A;  1WHJ A;  2HQE A;  2X4X A;  1VOM A;  4ZGE B;  4OB2 B;  1VQM T;  4O6J A;  5FLX E;  1MNE A;  2CP0 A;  4A4H A;  1QVF S;  2JTF A;  1BKB A;  2PU9 B;  1UGP B;  5GAN 4;  3P8B B;  1PHT A;  1PSF A;  5GAO q;  1X2K A;  2KMT A;  4C92 E;  2DJQ A;  3VKI A;  2CT4 A;  3A1P A;  2E70 A;  3S3M A;  1K4U S;  4M77 G;  1RAC B;  4KGX B;  1D1A A;  3H6Z A;  3UT1 A;  2H8H A;  4C8Q G;  3H8Z A;  5GMK m;  4DA4 A;  3UWN A;  5CVI A;  5KYU A;  4J6Y A;  4LDW A;  2Z0W A;  3L2U A;  2K3X A;  2JS0 A;  4M7A E;  2VGN A;  4HCK A;  3CCJ A;  2Y4X A;  4RTU A;  4XTX A;  2CT3 A;  2QEX Q;  2FG0 A;  3G71 T;  3CCQ A;  2L3S A;  3V7R A;  3MEW A;  1TUC A;  4M7D D;  4C8Q F;  2A37 A;  1VQK T;  5GAN e;  3MET A;  5I11 A;  4QW2 A;  1N9R A;  2DPP B;  1QVG P;  1ZBJ A;  1OEB A;  3CMA Q;  2DEQ A;  3M4Y A;  2F5T X;  3QO3 A;  3MEU A;  5HY6 A;  1M8V A;  1ABQ A;  3A5Z B;  2DL8 A;  1PKT A;  2L3R A;  5LJ3 e;  3CCR A;  5FWB A;  4R0K A;  3HHT B;  2A0F B;  2E4H A;  5GAM d;  2EIF A;  1EIF A;  1AZE A;  1K0X A;  3EFR A;  1QP2 A;  3CXC S;  3CPW P;  2ZCF B;  3KFV A;  2GTJ A;  4A63 B;  3GOX A;  3NPF A;  1KD1 R;  3FJ5 A;  3X20 B;  1WHH A;  3M55 A;  2ROT A;  3VJP A;  1NM7 A;  1VQP Q;  1D0Z A;  2RM4 A;  4HVU A;  2EKO A;  1M1K C;  1GCP A;  2GNC A;  2WSF E;  2JTM A;  4WTO B;  2C0T A;  1IGQ A;  3EG2 A;  3I55 Q;  2LQK A;  2J6O A;  4A4K A;  4E7K A;  3CME A;  4HVV A;  3JB9 H;  2EWN A;  4M7A A;  3JCM Q;  4M78 G;  1SSH A;  1R77 A;  2K57 A;  1S72 T;  1C0M A;  2VKN A;  3CCV T;  2CP3 A;  2X3W D;  1BYM A;  3PE0 A;  1Q86 R;  3RKY A;  1VIF A;  2O01 E;  2KBT A;  2GF7 A;  4PJO D;  4PFZ A;  2FHD A;  1YJN T;  2XU8 A;  2E1H A;  3JSC A;  4M78 C;  1I5L A;  2K4Y A;  4PJJ A;  3CPW S;  4CI0 C;  2X3X D;  4JJN K;  1Y96 A;  4OMF B;  2LCL A;  1X75 C;  1RAH B;  3GBQ A;  1IZ6 A;  2HSP A;  1YI2 Q;  4FSS A;  1LNX A;  1WIE A;  4ELY C;  5DLO A;  3CC2 T;  2XID A;  2A08 A;  3REA B;  4LDU A;  1OQK A;  1ZA2 B;  1R0C B;  4BY6 B;  2WAC A;  4J7F A;  3I9Q A;  4DBQ A;  3H0F A;  2P4T A;  3SD4 A;  2EVR A;  2ZPB B;  1N9S A;  2DK3 A;  2RJD A;  5J26 A;  4N0A C;  4FW1 A;  3JB9 G;  1JJ2 P;  3A8O B;  3GF5 A;  4BE1 A;  1VQP A;  4JLI A;  2OX7 A;  1KQS S;  3UDC A;  2CP2 A;  2O2O A;  1BI3 A;  3RR6 A;  2YSQ A;  4M78 A;  3FJP A;  4XU3 A;  4RMO A;  5FWC A;  1YWP A;  1JO8 A;  2LQ8 A;  1I07 A;  2BTT A;  3CC2 Q;  3HRT A;  1FMW A;  2QQA A;  2M0O A;  4QVD A;  1G2B A;  5GMK j;  3TVT A;  4QVC A;  9ATC B;  3EG3 A;  5CKD A;  1VQN Q;  2J6F A;  2LJ1 A;  3SB2 A;  1QCO A;  3LH0 A;  4EMG A;  1YJN A;  4II1 A;  4QVZ A;  5DM7 R;  4LDY A;  4PJM A;  3G1J A;  4O5V A;  3RMQ A;  2LRQ A;  1YJW A;  2P84 A;  1VQ5 A;  4GBQ A;  5A0D A;  1YIT T;  4EMK A;  1I81 A;  2YLC A;  4B9W A;  3HTR A;  2AK5 A;  5GAM f;  3NMZ C;  4EMH A;  5FRO A;  5FRN A;  1YBY A;  4JRK A;  2YRC A;  4M77 E;  4FYV B;  1ZX6 A;  2O4X B;  1K73 R;  2EYX A;  3JCM h;  3PFS A;  2G6F X;  1OI1 A;  2HQH A;  5HCK A;  4KGV B;  4C8Q E;  1AVZ C;  1UUE A;  4J6W A;  3J81 E;  3CC4 T;  1RUW A;  2QI2 A;  3TQ7 P;  1OOT A;  1WHG A;  1PNJ A;  4JRI A;  2NLU A;  3QWX X;  2K3Y A;  3QJY A;  5A2Q E;  1AZG B;  2GFU A;  3EGD B;  1BI1 A;  3H9N A;  4BI4 A;  1YIJ A;  4L6V 5;  1I8F A;  3SWN C;  1UHC A;  3GNF B;  2VWF A;  4XTU A;  4C5G A;  3OS1 A;  3O8V A;  1VQ7 Q;  3PGG A;  2JMC A;  3VRZ A;  3OYH A;  2RH2 A;  4D6W A;  4JS5 A;  1DJ7 B;  5FW9 A;  3CCJ Q;  2EPD A;  1B7T A;  3NTI A;  3A8M B;  1EX4 A;  4M7A D;  3V8J A;  2EW3 A;  1Q86 U;  3VV0 A;  2FEI A;  1M2O A;  1O75 A;  4J9I A;  2FPD A;  1W1F A;  4CC7 A;  5LJ5 d;  1C6V X;  5GAN d;  4E2F B;  3JAM E;  4VUB A;  4AFQ C;  4Y91 A;  2FRW A;  4C8Q D;  2B8A A;  1NJI C;  1WPY A;  3CCM T;  4JPB W;  2JW4 A;  3AT1 B;  4PLI A;  3CC2 A;  4IUU A;  1O9S A;  2VXE A;  2LVM A;  1D0Y A;  2A7Y A;  3X25 B;  3OYF A;  3CXC A;  3ZL7 C;  1S72 Q;  2DZC A;  4CRI A;  1Y96 B;  1WFW A;  2E3H A;  3MEV A;  3GPL A;  3MO8 A;  2DVE A;  5KH6 A;  3CCQ Q;  2E5K A;  2DAQ A;  2E5Q A;  3CD6 Q;  1PCX A;  3OYI A;  1KIK A;  1GRI A;  2J05 A;  4DOW A;  2K5I A;  5LJ5 f;  4CC4 B;  3MP8 A;  1ZSZ B;  3D7S B;  3OB9 A;  2SEM A;  1UGV A;  3VS2 A;  1TUG B;  1VQP T;  1TH7 A;  1WGS A;  1EZZ B;  1KQ1 A;  1VQ9 Q;  4BD3 A;  2KVQ G;  6AT1 B;  4KUL A;  2F2W A;  3FIF A;  1KC8 U;  2D9T A;  3VS4 A;  4ZTJ A;  2I2L A;  2KYB A;  4LD9 K;  1OPK A;  4E7Z A;  3VYH B;  2X9H A;  4AFU C;  2DXC A;  5KYY A;  1UG1 A;  2BZX A;  2QQ9 A;  5GAM e;  5LJ3 j;  2GBQ A;  1OX8 A;  2LC4 A;  2DMO A;  1TWB A;  5LJ3 f;  1IHV A;  1X6B A;  4E7H A;  1W70 A;  3M9Q A;  2QA4 Q;  2RMO A;  4Z8A A;  5DLQ E;  3CCU A;  4M7A C;  3CD6 T;  2RI5 A;  5KE3 A;  2YRD A;  4WCI A;  5KE2 A;  4J9C A;  4BDY A;  2LJ3 A;  2JZ2 A;  4E7S A;  3EGX B;  4M78 B;  2PVD B;  4OMP A;  3QDR B;  2LJ0 A;  4FW2 A;  5IHN A;  5CQY A;  2AZS A;  4FIB A;  4C92 B;  2CZ6 B;  2HZY A;  4OGC A;  1E7O A;  4YTL A;  1FXX A;  1WYX A;  3JRZ A;  2QGG A;  1VQO A;  2KGT A;  2YUN A;  2PUO B;  4RTV A;  3L2W A;  1VYT A;  2B86 A;  1X6G A;  5ECA A;  2LCS A;  1ZHI A;  4ZN1 A;  1Q7Y C;  4KH1 B;  3CCV A;  4IUR A;  3G71 Q;  4ESR A;  1G83 A;  2DTI A;  1X01 A;  2CS7 A;  1XOV A;  2RQU A;  1WJS A;  3HKS A;  2HD0 A;  1TG0 A;  2K2V A;  2ZPI B;  3CCS A;  1YHQ Q;  2RJF A;  2EYZ A;  3CCL Q;  3LGL A;  4F7U A;  1U1S A;  1SKU B;  2V26 A;  3X26 B;  2CDT A;  1OU8 A;  4C8Q B;  1M30 A;  3RKX A;  3BFM A;  3PTA A;  1SRM A;  4M7D C;  5GAN h;  4RTW A;  4GLK A;  1I1J A;  2YLB A;  4LDX A;  3TRE A;  4J9H A;  2H3E B;  1G8X A;  3MP1 A;  2KT8 A;  4IIO A;  1LCK A;  2DXT A;  4RTZ A;  3WVE B;  1C1A A;  4RTX A;  3CXC P;  4BY6 C;  1Y0M A;  1B3Q A;  3JB9 D;  3EFS A;  2QK0 A;  3DLL A;  2YUQ A;  4M7A G;  2CYZ B;  1WXB A;  2XHC A;  3PVQ A;  3C0C A;  2DKG A;  3H0I A;  2XDB A;  1VQ8 A;  1M2V B;  4LNP A;  1KQ2 A;  1UTI A;  1Q82 U;  2ATC B;  4IUP A;  1W4S A;  2EYW A;  5LJ5 g;  3ER0 A;  4M7D A;  1VQ4 T;  4F14 A;  4BI8 B;  2K9G A;  2F2V A;  2HDA A;  2PUK B;  2D0Q B;  3RUX A;  1WXT A;  4JLG A;  1Z9Z A;  1VQ6 Q;  1WLP B;  2DIG A;  1K8A C;  2YUO A;  2DZ9 A;  1D1B A;  4PJL A;  2DXB A;  2LQN A;  3NGP A;  1W2B A;  5LL6 S;  2PNI A;  3CCE Q;  2L89 A;  3CCS Q;  5L8R E;  1JU5 C;  1CKA A;  1OZ2 A;  1YHQ A;  2CUD A;  1D3B B;  1BBZ A;  3JCM g;  4C92 D;  5EG2 A;  3ASK A;  3BDL A;  3HRS A;  1RL2 A;  4TVR A;  5C6S A;  4F7U G;  2CKK A;  3EHQ A;  3TEE A;  4HCB A;  1WJQ A;  3CMA A;  1MUZ A;  2AHJ B;  2MCN A;  1N27 A;  1G5V A;  2DLP A;  1M5Q 1;  1K8A U;  1AEY A;  2LZ6 B;  2RK2 A;  2KE9 A;  2YXY A;  1YIJ Q;  3QYH B;  1MMN A;  3JCM f;  4FT2 A;  4M7A F;  4DEX A;  5HK0 A;  2A3L A;  3QWY A;  4J83 A;  2QDL A;  2LT1 A;  4A54 A;  3L1A A;  2RHY A;  2KY9 A;  2X51 A;  2FYK A;  3SEM A;  1ACM B;  1KJW A;  3RDV A;  2ZPF B;  3GIB A;  4ME7 A;  4J9D A;  2L2P A;  1ZUY A;  2FL7 A;  4BE2 A;  4MMK A;  1YCY A;  1X69 A;  1MND A;  3CCS T;  1GBQ A;  2EJF A;  3CC7 T;  3VS3 A;  1E6G A;  1VA7 A;  2F2X A;  4JRP A;  1WQW A;  4C0D C;  1AWX A;  1YFN A;  2RPN A;  1HD3 A;  1CSK A;  2LQW A;  4FM4 B;  1KC8 R;  2Y4Y A;  1W6X A;  2V8I A;  4PJO C;  4PJN A;  1RLP C;  2ZPG B;  3PMI A;  2KRM A;  2HCK A;  3TSZ A;  2OTL T;  2JS2 A;  2M0Y A;  3QXE B;  3VS5 A;  1OUL A;  3Q1J A;  3M5A A;  4J7I A;  2KK4 A;  1JQQ A;  3QDF A;  3S6W A;  2RB6 A;  1D1C A;  5FRM A;  3SDZ A;  5GAN 5;  3REB B;  4FSX A;  4GY5 A;  5IHI A;  1M8M A;  4M4Z A;  1YIT Q;  2OJ2 A;  1H3Z A;  1K76 A;  1VQ9 A;  3RNJ A;  5IXB A;  3CME Q;  1TOV A;  2RA2 A;  2RI2 A;  3TSW A;  2P0P A;  2LNV A;  2JTE A;  3QII A;  2YHT A;  2OTJ Q;  1SSF A;  3VYG A;  3QYG B;  2D8J A;  4OMM A;  5AT1 B;  4OF1 A;  2VVK A;  3T9N A;  4IUT A;  1WDX A;  1M4Z A;  1MGQ A;  4PJO B;  1TTH B;  4M77 F;  1UDL A;  2VAS A;  4M7D F;  3GNG A;  3NHN A;  1KK7 A;  1N6A A;  3M0Q A;  1VQ7 T;  3LW5 E;  4OGE A;  2BE7 D;  1VQM A;  4XU2 A;  1B34 B;  1VQL A;  1U5S A;  2W10 A;  4N4I A;  2OI3 A;  1M27 C;  4Z02 A;  4FYW B;  1D0X A;  1YJ9 T;  3OMC A;  2DO3 A;  4B9X A;  2JT4 A;  1GFC A;  2L3P A;  4QQD A;  1I0C A;  3OQ5 A;  3FC3 A;  2PVG B;  1SF9 A;  4KGZ B;  2MI6 A;  2QG9 B;  2LNH B;  5KYX B;  2RN8 A;  4AFZ C;  2E41 A;  2DA9 A;  3EFO B;  3MCA B;  4M7D B;  1VQO Q;  2DL7 A;  4LDV A;  4XAX B;  2Y90 A;  4M75 C;  2RHU A;  4JUV A;  4X1V A;  4Z89 A;  4A53 A;  1Y57 A;  1ZLM A;  1N5Z A;  4F04 B;  1HYO A;  3QUI A;  1UGS B;  1MV0 B;  2L8D A;  2R5M A;  2VV5 A;  1WXU A;  1YWO A;  1SHF A;  4ZN3 A;  4JJB A;  3QG1 A;  1G3S A;  1H92 A;  2KSS A;  1RAI B;  4MZT A;  1HXD A;  3CCQ T;  4M75 G;  4RCC A;  3NFC A;  4RCB A;  3PT9 A;  2KXC A;  4RTT A;  4NL2 A;  3OY9 A;  1OZ3 A;  1VIE A;  2CSQ A;  3A8H B;  1KQS P;  4JDS A;  1ABO A;  1KFZ A;  2X4Y A;  1WHM A;  2KEA A;  2ENM A;  2RI3 A;  2X4J A;  1GCQ A;  5KYU B;  4IUV A;  1Q81 C;  4QQ6 A;  5GAN 3;  1GL5 A;  3FRN A;  1VQN T;  4JS4 A;  1AWW A;  2GCX A;  4M75 B;  3QKJ A;  3OSV A;  3C94 A;  2ROL A;  3L2R A;  3OYE A;  4C0D B;  1UGQ B;  2RHI A;  4BI3 A;  2PTK A;  4M78 D;  1KSW A;  2QTV A;  5LJ5 e;  3PMT A;  4UC4 A;  1QMC A;  2NUP A;  5KCH A;  1NG2 A;  4DQ2 A;  2K2M A;  1AD5 A;  2ZAE A;  2DVJ A;  4MDX A;  3OS5 A;  3HFN A;  3OW2 P;  1BCM A;  1VQL Q;  2EYY A;  5D6Y A;  2KRS A;  3N5B B;  1GBR A;  4QT7 A;  5FU6 C;  3OYA A;  1AWO A;  2F5K A;  1SEM A;  2VGM A;  5GAO m;  4MZM A;  4N4G A;  5LJ5 h;  2M1H A;  5LJ3 g;  2IIM A;  3G4S T;  1UE9 A;  1MMD A;  4WF2 A;  5GAO p;  2LX9 A;  4Q5W A;  2HL3 A;  3P8D A;  2EJG A;  3M53 A;  5IN1 A;  2RHZ A;  4DEY A;  1NLO C;  2XK0 A;  4XQ3 A;  1H3H A;  2EGA A;  1QVG A;  4C0G A;  4C5E A;  3P8H A;  5LJ3 d;  3LWI A;  4RG2 A;  1Q81 R;  4OB3 B;  4C5H A;  5I2M A;  2XDP A;  2OAU A;  4QQG A;  3CCJ T;  3KUF A;  3HSB A;  1BB9 A;  1M3A A;  2LX7 A;  3CD6 A;  4KUD K;  1IRE B;  2VB6 A;  1YJ9 A;  4PNO A;  3HRU A;  2QDY B;  2RQV A;  3M57 A;  4C92 G;  3V8K A;  1K73 U;  1RI9 A;  5GMK h;  3VU3 C;  3CPW A;  3CCM A;  3I56 Q;  2I0N A;  1K8A R;  1ZBX A;  1X6O A;  2NUZ A;  2RK1 A;  2O9S A;  2NUT B;  4ZGD B;  2IG0 A;  2F1L A;  1BCO A;  1AHJ B;  3OYN A;  2BUD A;  2JUF A;  5I22 A;  2XMF A;  5GJW B;  2E64 A;  2CZ7 B;  3OYG A;  1U3O A;  4PLL A;  1Q7Y R;  1Q82 C;  2EQI A;  2BZY A;  1N8R C;  3INZ A;  3QBY A;  5I2S A;  4XTW A;  1GXI E;  5KYX A;  4XU1 A;  5CKB A;  1X2Q A;  2P4R A;  3SHW A;  1M9S A;  1SPK A;  3MHX A;  5CKF A;  3HP9 A;  4J9F A;  1TXQ A;  2JVV A;  4V2S A;  5D6X A;  1MHN A;  1QQJ A;  2EFI A;  1TUD A;  5GJV B;  2QQR A;  2HEQ A;  2LDM A;  5CQX A;  2QEX T;  4HT9 A;  1RAG B;  4LN2 A;  1H8K A;  1VQK Q;  3PIP A;  1YIT A;  1Y7X A;  4A4F A;  3OYC A;  3CCR T;  1XTD A;  1K9M U;  2EYQ A;  1G3Y A;  2JXB A;  1IO6 A;  3J80 E;  1VQ4 Q;  1RLQ C;  2EQK A;  4M77 A;  3GP8 A;  1BU1 A;  1PC0 A;  2BKD N;  3L42 A;  4KT0 E;  1JB0 E;  2JN0 A;  3WXM B;  1WA7 A;  5GAO l;  3VS0 A;  4F7U B;  2MPX C;  1Q7Y U;  4GLM A;  2KDS A;  5CR2 A;  2DJZ A;  8ATC B;  3UF4 A;  4N0A A;  1G3W A;  1PD0 A;  1IHW A;  2AIR B;  1PSE A;  2HQX A;  3MP6 A;  1VQ5 Q;  3G71 A;  1ARK A;  2K5L A;  3KBG A;  3RBB B;  2DD5 A;  2KR3 A;  3OW2 A;  2EJ9 A;  1K73 C;  1K9A A;  4KUI A;  1KC8 C;  1Q95 G;  2ZPE B;  1YJ9 Q;  2DD4 A;  3ZEH A;  3M54 A;  2BE9 B;  1T0J A;  1K1Z A;  3OBY A;  4EIK A;  3VS7 A;  5IXF A;  3C95 A;  3MKD A;  5GAN 6;  3G6E Q;  2CGH A;  5L23 A;  3E19 A;  1PRM C;  1T0H A;  2LTO A;  3EGD A;  4M78 E;  1JJ2 A;  1FWZ A;  4M75 E;  3JB9 I;  1YNZ A;  1V76 A;  4F7U F;  2RJE A;  2KI7 A;  2M9U A;  2XG8 D;  1N8R U;  2VYT A;  1CKB A;  2JMA A;  2CRE A;  2RQW A;  2WSC E;  4A4G A;  1FMV A;  4C92 A;  3RER A;  1VQ7 A;  2D8H A;  2H3J A;  2MOX A;  2AZV A;  2RD1 A;  4EMK C;  2ED1 A;  1SHG A;  2QAS A;  4M7D G;  4RG8 A;  5GAN g;  1UEC A;  3X28 B;  1VQ5 T;  2ABL A;  2K5F A;  3ZFJ A;  1QWE A;  1E6H A;  3CPF A;  2CUB A;  3RES A;  4XTV A;  3JCM b;  1M90 C;  3EG0 A;  5LJ3 h;  4FT4 A;  1AT1 B;  2J06 A;  4Y92 A;  1RAA B;  5GAM j;  2O88 A;  3CC7 Q;  1YI2 T;  4NS5 A;  3PIO A;  3RIR A;  2KNB B;  4LXC A;  2CP7 A;  5EC7 A;  1AWJ A;  2FPF A;  4FL6 A;  3O5Z A;  3I5R A;  3FB9 A;  1Y07 A;  1ZSZ A;  4A4E A;  2A36 A;  1T3L A;  2GQV A;  5CKH A;  3A98 A;  3LGF A;  3M0R A;  1NEG A;  1W2B S;  4JJC A;  2D6F A;  2OTL Q;  3E9F A;  2LCC A;  3JCM W;  4M75 D;  3M59 A;  1YJW T;  4OMO A;  3WVD B;  2HL5 C;  3L2V A;  3M0P A;  3JCM V;  1VQK A;  2G3R A;  2GQI A;  2QQS A;  1YCS B;  3CME T;  2P0K A;  2GGR A;  5AYF A;  2CSI A;  1N8R R;  8AT1 B;  3A8G B;  2C06 A;  1G3T A;  2EKH A;  1PD1 A;  4C0F A;  3NTH A;  2K7A A;  5IAY A;  4E7L A;  3I56 T;  2O31 A;  4B6M A;  1IXD A;  4JZ4 A;  3JCM P;  3JCM e;  1T3S A;  1TS9 A;  4PJO E;  2EQU A;  3J7A F;  2BIV A;  3G7Z A;  4MDW A;  3V7C A;  1VQ6 A;  5CIU A;  2KQW A;  2DRK A;  1RAE B;  4J9G A;  2RNA A;  1FMK A;  1WHL A;  1WZO A;  3FEO A;  2DBK A;  4KBM B;  3CCU T;  4MML A;  1UB4 A;  1TU0 B;  4D8D A;  5GAN j;  2EGE A;  3M0T A;  2QYZ A;  3EFO A;  5KYW A;  3CCE T;  5M9O A;  5GAN 7;  4M77 B;  4J6X A;  4RKU E;  2WSE E;  1XNI A;  4OMQ A;  2RHX A;  3G4S A;  3QPH A;  2P0Q A;  3G6E A;  4PL6 A;  3FLG A;  2LT4 A;  4K11 A;  2CP5 A;  2SRC A;  1OX9 A;  2AKK A;  2HSE B;  4E7J A;  4F17 A;  1FX7 A;  2R5A A;  1M1F A;  4C5I A;  3E2U A;  3PNW C;  3DKM A;  3I55 T;  3URG A;  1ZUK A;  3HPW A;  4CC3 A;  2ZGW A;  1VQO T;  3X24 B;  1QKW A;  5CO7 A;  1VUB A;  2K3B A;  1NYF A;  3CCV Q;  4ATO A;  5J39 A;  1QCN A;  2FPE A;  1BK2 A;  1HJD A;  1S1N A;  1WNL A;  4PKC C;  5CCA A;  2VUB A;  5A0G A;  1K0S A;  4PJO F;  4AT1 B;  4R55 A;  3KXT A;  3UAT A;  1JXM A;  3BY7 A;  4DBH A;  3VS6 A;  2YRV A;  2M02 A;  1KHC A;  4LUE A;  2L0A A;  1OPL A;  3IQL A;  3UPU A;  2NYS A;  2XKO C;  2JM8 A;  3CQT A;  4EDU A;  1ZUU A;  1D09 B;  2EGC A;  1XQH A;  3CCR Q;  2R58 A;  5IT9 E;  3I5S A;  2QTX A;  1K9M R;  3HL8 A;  3OYK A;  5KYN A;  2HKN A;  3U23 A;  2ED0 A;  1M2V A;  3JB9 J;  1WQ7 A;  5GAO r;  1M1K U;  5IH2 A;  3C12 A;  3L2Q A;  4BAC A;  2BZ8 A;  4QKU A;  3H41 A;  2DXU A;  1HK9 A;  2D0N A;  2COZ A;  1LVK A;  2NWM A;  4Y28 E;  5DY9 A;  2COY A;  1GCQ C;  2DIL A;  1VQM Q;  4C92 C;  4FYX B;  1XJW B;  4OP0 A;  3OW2 S;  3R6N A;  5I21 A;  1WHK A;  4NL3 A;  1VYU A;  4HVW A;  1FYN A;  2ESW A;  3G4S Q;  2MF2 A;  3DB4 A;  3SWN B;  2OTJ A;  1OU9 A;  1R8O B;  4ZTF A;  2QGF B;  3RKW A;  2EBP A;  1VQ4 A;  4XU0 A;  1Y71 A;  4LD6 A;  2HNI A;  4RUG A;  5GAN f;  4HT8 A;  2E65 A;  1M1G A;  1ZSG A;  4C92 F;  2PZ1 A;  4D8K A;  4XK8 E;  2M51 A;  2RO0 A;  1BIB A;  2DL5 A;  2YT6 A;  4HKE A;  3OSS C;  5IHK A;  1U8R A;  3LWH A;  2MMP A;  3QZ9 B;  3TU4 K;  4M7D E;  2HBW A;  1X27 A;  2CZ1 B;  4RTY A;  3UA7 A;  3JCM d;  4X9D A;  4F7U E;  2JOY A;  1D3B A;  1HSQ A;  4OML A;  4M75 F;  2QA4 T;  1KD1 C;  2KRO A;  5D6W A;  1PKS A;  2LMJ A;  4IUQ A;  5CK9 A;  1F1B B;  1R0B G;  4OMN A;  4OVA A;  4IKF A;  4J9E A;  2DNU A;  2OTJ T;  4DBR A;  1QVG S;  1I4K 1;  1V1C A;  1QVF P;  1LPL A;  1WJR A;  1KG1 A;  5GAN 8;  2IPO B;  2J6K A;  3CC4 Q;  1QWF A;  4L5G A;  3PVL A;  1VQ6 T;  3OYL A;  4C8Q C;  4BDZ A;  2C0O A;  2CP6 A;  2LP5 A;  3L2Z A;  2E10 A;  2D1X A;  5FU7 C;  2YWW A;  4CC2 A;  5LJ5 j;  3DB3 A;  2AKL A;  3QHS A;  1GFD A;  2DFU A;  3V8L A;  1U1T A;  1RAB B;  1QVP A;  3OA6 A;  2XD0 A;  1B34 A;  4EMK B;  3V7S A;  2HKQ B;  1YHQ T;  4J5Y A;  1NPR A;  4BB7 A;  1J3T A;  2KAF A;  2A28 A;  4E6R A;  2MYS A;  5GMK l;  3MJX A;  4L59 A;  4FYY B;  2V1R A;  3EG9 A;  3QJ6 A;  4Z88 A;  2EQM A;  2OAW A;  2E3I A;  4OB1 B;  1Q82 R;  2DTH A;  3OBW A;  3OS2 A;  2EAY A;  4XTY A;  2O9V A;  1YP5 A;  2IVW A;  2M16 A;  2DYI A;  3ULR B;  3CBO A;  3GLX A;  3BE3 A;  3OYB A;  2QA4 A;  1PWT A;  1NZ9 A;  2DL4 A;  3CCU Q;  3OYD A;  2DL3 A;  2RJC A;  1RI0 A;  1KD1 U;  1B07 A;  3DLM A;  3MEA A;  1IGU A;  5HK3 A;  4M77 C;  2V8J A;  3HFO A;  1SG5 A;  1ZA1 B;  2X35 A;  4J9B A;  2DF6 A;  4JJD A;  1QW1 A;  1VQ8 T;  1LOJ A;  4IIM A;  3NTK A;  1IRX A;  1YN8 A;  2XI9 A;  5GAO n;  4JRQ A;  3OYM A;  3S3N A;  2COW A;  2O4X A;  1PRL C;  5J3B A;  3QSU A;  3OS0 A;  1M3C A;  4KRT A;  4C0Z A;  3H0H A;  4R56 A;  4ORZ A;  4PJO A;  2PVO B;  3M58 A;  2MIO A;  4DOV A;  4OB0 B;  3LH5 A;  3CBP A;  1U06 A;  1W2B P;  4HCZ A;  2MWP A;  4FU6 A;  5CKE A;  1BI0 A;  1OYX A;  3OMG A;  2ZZD A;  1Q81 U;  2QQB A;  2HBP A;  3SFM A;  2QEX A;  3E1S A;  2J7I A;  3EH1 A;  1UJ0 A;  1VQL T;  2EQJ A;  2DTO A;  2JM9 A;  2FZK B;  2MK5 A;  3I56 A;  1ZQ1 A;  1NLP C;  1MV3 A;  4AG2 C;  4XTZ A;  1BIA A;  1RAF B;  3CMA T;  1Q86 C;  3RMS A;  2MWO A;  1VQ8 Q;  1UHF A;  1BI2 A;  3ZBD A;  2JNG A;  3R6O A;  1NE8 A;  3CC4 A;  2QXF A;  5FU6 B;  3TCJ A;  1MMA A;  3CEY A;  4ZGJ B;  7AT1 B;  1QVF A;  4N4H A;  3I55 A;  4M77 D;  1NEB A;  3I35 A;  3M56 A;  4JZ3 A;  2XDD A;  1NJI U;  4BE0 A;  1WI7 A;  4F16 A;  1NPP A;  4ZNX A;  5KYY B;  1ZSZ C;  1S72 A;  4FCY A;  1Z9Q A;  4AFS C;  2W0Z A;  1QKX A;  2FO0 A;  1OV3 A;  1EFN A;  1UEB A;  4NOY A;  1UGR B;  3M0U A;  4PFP A;  3JCM J;  1QP3 A;  2K6D A;  3EHR A;  4LE9 A;  2PQW A;  4DBF A;  4P5N A;  1H64 1;  2RQT A;  4HCC A;  4PJO G;  1M3B A;  3VRY A;  1JXO A;  2DYB A;  5CAI A;  3E9G A;  4KH0 B; 
#chains in the Genus database with same CATH homology
 2P0K A;  5FRN A;  2DIQ A;  3SWN A;  3S3O A;  1H3Z A;  1YBY A;  4JRK A;  5AYF A;  4M77 E;  3CCL T;  1VQ9 A;  2O4X B;  3A8G B;  2C06 A;  2RA2 A;  1G3T A;  2RI2 A;  2XIC A;  2MAM A;  3NTH A;  1OI1 A;  2P0P A;  3PFS A;  3JCM h;  2E6Z A;  5IAY A;  4E7L A;  3I56 T;  4ELZ C;  1YI2 A;  4C8Q E;  2LNV A;  4J6W A;  3J81 E;  3CC4 T;  3JCM P;  3QII A;  2YHT A;  3JCM e;  4M75 A;  4PJO E;  2EQU A;  2QI2 A;  1SSF A;  2HAX A;  4JRI A;  3J7A F;  3VYG A;  3QYG B;  2BIV A;  2NLU A;  2K3Y A;  3G7Z A;  3AHU A;  3QJY A;  5A2Q E;  4OF1 A;  4MDW A;  4HA8 A;  4M7A B;  4IUT A;  3T9N A;  3V7C A;  3VUB A;  2E6N A;  1M4Z A;  1MGQ A;  1VQ6 A;  5CIU A;  2GFU A;  2KQW A;  4PJO B;  1BI1 A;  4M77 F;  3ME9 A;  4BI4 A;  1YIJ A;  5GMK e;  3QZ5 B;  4L6V 5;  4M7D F;  3GNG A;  1I8F A;  1N6A A;  3FEO A;  4KBM B;  3SWN C;  5FU7 B;  4MML A;  5C0M A;  1UB4 A;  3LW5 E;  3CCU T;  1VQ7 T;  3GNF B;  4OGE A;  5A0L A;  4XTU A;  4C5G A;  3OS1 A;  2FVU A;  3O8V A;  1JJ2 S;  1VQM A;  3PGG A;  5GAN j;  3CCE A;  3LLR A;  4XU2 A;  3OYH A;  1B34 B;  2RH2 A;  5GAM h;  4C8Q A;  4D6W A;  4JS5 A;  1VQL A;  3CCE T;  5M9O A;  4N4I A;  1DJ7 B;  5GAN 7;  3JB9 F;  3NTI A;  4Z02 A;  3A8M B;  1YJ9 T;  4M77 B;  3OMC A;  4J6X A;  2DO3 A;  4RKU E;  3V8J A;  4B9X A;  4M7A D;  2WSE E;  1XNI A;  1Q86 U;  2RHX A;  3VV0 A;  3G4S A;  1K9M C;  3QPH A;  5KCO A;  3CD6 A;  2P0Q A;  3G6E A;  4PL6 A;  1O75 A;  4QQD A;  3FLG A;  2LT4 A;  3A8L B;  3OQ5 A;  5LJ5 d;  2PVG B;  3FC3 A;  2CZ0 B;  1P92 A;  3CCL A;  2MI6 A;  3LYI A;  3OYY A;  5GAN d;  4E7J A;  3JAM E;  4VUB A;  2R57 A;  3EAE A;  1FX7 A;  2R5A A;  4Y91 A;  2VXF A;  1M1F A;  4C5I A;  2E41 A;  1LJO A;  2VC8 A;  1V29 B;  2B8A A;  4C8Q D;  1NJI C;  3PNW C;  3DKM A;  1WPY A;  3I55 T;  5GAN 2;  3BW1 A;  3MCA B;  3LX7 A;  5GMK i;  3CCM T;  3URG A;  5HKC A;  4M7D B;  3HPW A;  4LDV A;  4PLI A;  4XAX B;  3CC2 A;  4IUU A;  1O9S A;  2ZGW A;  2Y90 A;  4M75 C;  2RHU A;  2VXE A;  2LVM A;  4JUV A;  1VQO T;  3JCM c;  3X24 B;  2A7Y A;  4A53 A;  4X34 A;  3X25 B;  1KHI A;  5CO7 A;  3OYF A;  1VUB A;  3CXC A;  2DZC A;  3QUI A;  4CRI A;  3OYJ A;  5J39 A;  2F69 A;  4ATO A;  1Y96 B;  3FDR A;  1UGS B;  4E7I A;  2L8D A;  2R5M A;  2VV5 A;  3MEV A;  1JRI A;  4MZP A;  3JCM X;  3MO8 A;  3GPL A;  2DVE A;  5KH6 A;  2DAQ A;  2E5Q A;  4ZN3 A;  1WNL A;  4PKC C;  3QG1 A;  3OYI A;  1G3S A;  5CCA A;  2VUB A;  2KSS A;  2ZPH B;  5A0G A;  4MZT A;  4PJO F;  1HXD A;  4R55 A;  3CCQ T;  4M75 G;  4RCC A;  3KXT A;  3BDU A;  3CBM A;  3F70 A;  2K5I A;  3NFC A;  3PT9 A;  4RCB A;  3BY7 A;  4DOW A;  5LJ5 f;  4NL2 A;  2GFA A;  3MP8 A;  3OY9 A;  1OZ3 A;  3OB9 A;  1VIE A;  2YRV A;  3A8H B;  1VQ9 T;  3CC7 A;  3G6E T;  1VQP T;  1KHC A;  1TH7 A;  2L5Q A;  1WGS A;  4J8O A;  4JDS A;  3UPU A;  1KQ1 A;  4BD3 A;  2V8K A;  2X4Y A;  2KVQ G;  2RI3 A;  2X4J A;  5GAM g;  4KUL A;  2XKO C;  3FIF A;  4EDU A;  1KC8 U;  2D9T A;  4IUV A;  1Q81 C;  4M78 F;  4EPC A;  4QQ6 A;  5GAN 3;  4ZTJ A;  2OTJ A;  4X9C A;  2I2L A;  4LD9 K;  1XQH A;  2R58 A;  5IT9 E;  1VQN A;  3FRN A;  3VYH B;  2DXC A;  2QTX A;  1VQN T;  2FB7 A;  4JS4 A;  2GCX A;  3HL8 A;  4M75 B;  3QKJ A;  2QQ9 A;  3OSV A;  5GAM e;  3OYK A;  2E12 A;  3C94 A;  5LJ3 j;  2OTL A;  1YIJ T;  3L2R A;  4BUG A;  4C0D B;  1UGQ B;  2RHI A;  4BI3 A;  3OYE A;  2LC4 A;  2X4W A;  1WQ7 A;  4M78 D;  5GAO r;  3JB9 J;  1M1K U;  3C12 A;  3PMT A;  3M4G A;  4UC4 A;  5LJ5 e;  3L2Q A;  5LJ3 f;  5KCH A;  4BAC A;  2DXU A;  1HK9 A;  1KQS A;  4DQ2 A;  4E7H A;  4Y28 E;  3C4S A;  1M90 U;  1JBM A;  3M9Q A;  5DY9 A;  4MDX A;  3OS5 A;  3VUZ A;  4C92 C;  4E47 A;  2HQE A;  4OP0 A;  5DLQ E;  3OW2 S;  3HFN A;  2X4X A;  5D6Y A;  3CCU A;  4ZGE B;  4OB2 B;  3N5B B;  1VQM T;  3CD6 T;  4M7A C;  5I21 A;  4O6J A;  2RI5 A;  5FU6 C;  3OYA A;  5KE3 A;  5FLX E;  4NL3 A;  1QVF S;  4A4H A;  2F5K A;  2JTF A;  1BKB A;  2PU9 B;  5KE2 A;  4BDY A;  2JZ2 A;  1UGP B;  5GAN 4;  2MF2 A;  2VGM A;  3P8B B;  3DB4 A;  1PSF A;  3SWN B;  5GAO m;  4M78 B;  5GAO q;  4MZM A;  1R8O B;  2PVD B;  4N4G A;  2M1H A;  5LJ5 h;  2KMT A;  4C92 E;  5LJ3 g;  4ZTF A;  3G4S T;  3QDR B;  3RKW A;  3VKI A;  4WF2 A;  2E70 A;  4XU0 A;  1Y71 A;  5GAO p;  4M77 G;  3S3M A;  1VQ4 A;  2LX9 A;  4LD6 A;  4Q5W A;  5CQY A;  2HNI A;  2EJG A;  3P8D A;  4FIB A;  4C92 B;  3H6Z A;  2CZ6 B;  2E65 A;  3M53 A;  3UT1 A;  5IN1 A;  5GAN f;  4HT8 A;  1M1G A;  4C8Q G;  2RHZ A;  3H8Z A;  4OGC A;  4YTL A;  4C92 F;  5GMK m;  4DA4 A;  1FXX A;  3UWN A;  3JRZ A;  4XK8 E;  2RO0 A;  1VQO A;  5CVI A;  2XK0 A;  4XQ3 A;  4J6Y A;  4LDW A;  1BIB A;  2PUO B;  3L2W A;  4HKE A;  3OSS C;  1U8R A;  1QVG A;  4C0G A;  3LWH A;  4C5E A;  3P8H A;  2MMP A;  5LJ3 d;  1ZHI A;  4ZN1 A;  3QZ9 B;  3LWI A;  3L2U A;  2K3X A;  3TU4 K;  4M7D E;  4RG2 A;  1Q7Y C;  4M7A E;  3CCV A;  2CZ1 B;  2VGN A;  3CCJ A;  4OB3 B;  4IUR A;  4C5H A;  5I2M A;  2XDP A;  2OAU A;  2Y4X A;  4QQG A;  3CCJ T;  3KUF A;  3JCM d;  3HSB A;  2DTI A;  4XTX A;  1X01 A;  2CS7 A;  4X9D A;  4F7U E;  1XOV A;  1WJS A;  2JOY A;  1D3B A;  3G71 T;  3CCQ A;  3HKS A;  3V7R A;  2HD0 A;  2ZPI B;  2K2V A;  4M75 F;  5D6W A;  3CCS A;  2QA4 T;  1IRE B;  1YJ9 A;  1KD1 C;  4KUD K;  4PNO A;  3MEW A;  2RJF A;  4M7D D;  3HRU A;  4C8Q F;  2QDY B;  3LGL A;  4IUQ A;  3M57 A;  4F7U A;  4C92 G;  1U1S A;  3V8K A;  1VQK T;  5CK9 A;  3X26 B;  1K73 U;  5GAN e;  3MET A;  4C8Q B;  5GMK h;  4OVA A;  4QW2 A;  1N9R A;  3RKX A;  3VU3 C;  3CPW A;  3CCM A;  4IKF A;  2DPP B;  3BFM A;  3PTA A;  4M7D C;  5GAN h;  2OTJ T;  2DEQ A;  1QVG S;  1I4K 1;  1ZBX A;  1X6O A;  4GLK A;  3M4Y A;  2F5T X;  2RK1 A;  3QO3 A;  1WJR A;  2YLB A;  1KG1 A;  3MEU A;  4ZGD B;  4LDX A;  5HY6 A;  3TRE A;  2IG0 A;  1M8V A;  5GAN 8;  3A5Z B;  1AHJ B;  3OYN A;  2BUD A;  2L3R A;  2JUF A;  4L5G A;  5LJ3 e;  3CCR A;  3HHT B;  2E64 A;  1S72 T;  2CZ7 B;  3OYG A;  4PLL A;  3MP1 A;  1Q82 C;  1VQ6 T;  5GAM d;  3OYL A;  4C8Q C;  4BDZ A;  1N8R C;  3INZ A;  2EIF A;  2DXT A;  3QBY A;  1EIF A;  3L2Z A;  2E10 A;  3WVE B;  5FU7 C;  3EFR A;  1QP2 A;  5I2S A;  4BY6 C;  3CXC S;  4XTW A;  2ZCF B;  1GXI E;  4XU1 A;  5CKB A;  5LJ5 j;  3DB3 A;  3GOX A;  3JB9 D;  3EFS A;  3QHS A;  1M9S A;  3DLL A;  3V8L A;  3MHX A;  5CKF A;  4M7A G;  3X20 B;  2CYZ B;  1U1T A;  3HP9 A;  2XHC A;  3M55 A;  1QVP A;  3VJP A;  2JVV A;  2DKG A;  4V2S A;  1MHN A;  2EFI A;  5CQX A;  5D6X A;  3OA6 A;  1B34 A;  2QQR A;  2LDM A;  3V7S A;  2RM4 A;  4EMK B;  2XDB A;  2XD0 A;  4HT9 A;  2EKO A;  4J5Y A;  1YHQ T;  1NPR A;  1VQ8 A;  4BB7 A;  1KQ2 A;  1M1K C;  2WSF E;  2KAF A;  2JTM A;  3PIP A;  5GMK l;  4L59 A;  1YIT A;  1Q82 U;  2LQK A;  1Y7X A;  4A4F A;  3OYC A;  3CCR T;  4A4K A;  1XTD A;  1K9M U;  2EYQ A;  4IUP A;  4E7K A;  1G3Y A;  3QJ6 A;  3J80 E;  3CME A;  1W4S A;  2EQM A;  3JB9 H;  2EQK A;  4M77 A;  2EWN A;  3GP8 A;  4M7A A;  5LJ5 g;  3ER0 A;  4OB1 B;  3JCM Q;  4M7D A;  1VQ4 T;  2BKD N;  2DTH A;  3L42 A;  3OBW A;  4KT0 E;  3OS2 A;  4M78 G;  4BI8 B;  2K57 A;  1JB0 E;  2JN0 A;  2EAY A;  4XTY A;  3WXM B;  4C0F A;  2PUK B;  2IVW A;  2D0Q B;  2M16 A;  5GAO l;  3CCV T;  3CBO A;  3GLX A;  3RUX A;  4JLG A;  4F7U B;  1Q7Y U;  1BYM A;  2KDS A;  5CR2 A;  2DJZ A;  3OYB A;  3RKY A;  2QA4 A;  4N0A A;  1G3W A;  2DIG A;  1K8A C;  1NZ9 A;  2DZ9 A;  3OYD A;  1VIF A;  1PSE A;  2O01 E;  2RJC A;  1RI0 A;  2HQX A;  3MP6 A;  1KD1 U;  2GF7 A;  4PJO D;  2FHD A;  3DLM A;  3G71 A;  2XU8 A;  2DXB A;  3MEA A;  1YJN T;  1W2B A;  2K5L A;  2E1H A;  3JSC A;  4M78 C;  5HK3 A;  3KBG A;  1I5L A;  2K4Y A;  2DD5 A;  4M77 C;  2V8J A;  5LL6 S;  3OW2 A;  2EJ9 A;  3CPW S;  3HFO A;  4CI0 C;  1K73 C;  2L89 A;  2X35 A;  4JJN K;  1Y96 A;  4KUI A;  4OMF B;  1KC8 C;  2LCL A;  1X75 C;  2ZPE B;  2DD4 A;  5L8R E;  1QW1 A;  1OZ2 A;  3M54 A;  3ZEH A;  1YHQ A;  1VQ8 T;  1IZ6 A;  1D3B B;  1LOJ A;  3NTK A;  3OBY A;  2XI9 A;  3JCM g;  5GAO n;  4C92 D;  4JRQ A;  3OYM A;  3C95 A;  2O4X A;  5EG2 A;  3S3N A;  3ASK A;  3BDL A;  3HRS A;  1RL2 A;  1LNX A;  4TVR A;  5J3B A;  5GAN 6;  5C6S A;  3OS0 A;  4F7U G;  3QSU A;  4C0Z A;  4ELY C;  2CGH A;  2CKK A;  5DLO A;  3TEE A;  4HCB A;  3CC2 T;  1WJQ A;  3CMA A;  2AHJ B;  2XID A;  3E19 A;  4R56 A;  4LDU A;  2LTO A;  4PJO A;  4M78 E;  1JJ2 A;  1FWZ A;  1N27 A;  4M75 E;  2PVO B;  1G5V A;  3M58 A;  3JB9 I;  4DOV A;  1M5Q 1;  1K8A U;  4OB0 B;  2RK2 A;  4F7U F;  2RJE A;  3CBP A;  4BY6 B;  2QEX T;  4HCZ A;  2M9U A;  2MWP A;  4FU6 A;  2XG8 D;  1N8R U;  2WAC A;  3QYH B;  5CKE A;  2VYT A;  3JCM f;  4FT2 A;  4M7A F;  1BI0 A;  1OYX A;  3OMG A;  4J7F A;  4A4G A;  2WSC E;  2ZZD A;  1Q81 U;  5HK0 A;  4C92 A;  2A3L A;  2QQB A;  4J83 A;  2P4T A;  3SD4 A;  3RER A;  1VQ7 A;  2LT1 A;  2HBP A;  4A54 A;  3SFM A;  3L1A A;  2RHY A;  2H3J A;  3E1S A;  2QEX A;  2ZPB B;  1N9S A;  2KY9 A;  2DK3 A;  2RD1 A;  4EMK C;  1VQL T;  2EQJ A;  2DTO A;  2FYK A;  4M7D G;  4RG8 A;  2RJD A;  5J26 A;  4N0A C;  5GAN g;  3JB9 G;  2ZPF B;  3GIB A;  3A8O B;  3X28 B;  4ME7 A;  3I56 A;  1VQ5 T;  1ZQ1 A;  3GF5 A;  2K5F A;  3ZFJ A;  3CPF A;  4XTZ A;  3RES A;  1BIA A;  4BE1 A;  2FL7 A;  4BE2 A;  4MMK A;  4XTV A;  1VQP A;  4JLI A;  3JCM b;  1KQS S;  1YCY A;  3UDC A;  1M90 C;  1Q86 C;  3RMS A;  3CMA T;  2MWO A;  3CCS T;  1BI3 A;  4FT4 A;  5LJ3 h;  4M78 A;  2EJF A;  3CC7 T;  3FJP A;  4XU3 A;  4RMO A;  1BI2 A;  3ZBD A;  2JNG A;  3R6O A;  1NE8 A;  5GAM j;  2QXF A;  3CC4 A;  5FU6 B;  3TCJ A;  1YI2 T;  4NS5 A;  2LQ8 A;  3CEY A;  4ZGJ B;  1QVF A;  4N4H A;  3I55 A;  4JRP A;  3PIO A;  3RIR A;  1WQW A;  4M77 D;  4C0D C;  3M56 A;  3HRT A;  2XDD A;  1NJI U;  4FL6 A;  2QQA A;  4FM4 B;  2M0O A;  4QVD A;  5GMK j;  2Y4Y A;  4BE0 A;  1NPP A;  3FB9 A;  2V8I A;  4PJO C;  1Y07 A;  4QVC A;  1S72 A;  4A4E A;  5CKD A;  2ZPG B;  3PMI A;  2GQV A;  3SB2 A;  2OTL T;  3LH0 A;  5CKH A;  3LGF A;  1UEB A;  4II1 A;  4EMG A;  1YJN A;  4NOY A;  4QVZ A;  3QXE B;  1UGR B;  5DM7 R;  1W2B S;  3JCM J;  4LDY A;  2D6F A;  1QP3 A;  3E9F A;  2LCC A;  3JCM W;  4O5V A;  3Q1J A;  3RMQ A;  3M5A A;  4J7I A;  2KK4 A;  4M75 D;  3M59 A;  1YJW T;  2PQW A;  3S6W A;  2RB6 A;  3WVD B;  5FRM A;  2LRQ A;  1H64 1;  4P5N A;  3L2V A;  1YJW A;  1VQ5 A;  3SDZ A;  5A0D A;  5GAN 5;  4PJO G;  4HCC A;  1YIT T;  4EMK A;  4FSX A;  3JCM V;  1I81 A;  1VQK A;  5CAI A;  2G3R A;  2YLC A;  4GY5 A;  4B9W A;  2QQS A;  3E9G A;  5GAM f;  4EMH A;  5FRO A;  3CME T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...