5IN1A

Crystal structure of the mrg701 chromodomain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
71
structure length
71
Chain Sequence
b'SFKEGERVLAYHGPLLYEAKVQKSENKEDEWRYHVHYLGWSKSWDEWVTNDRLLKLTDENIRKQQELEKSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MRG701
publication title Structural studies on MRG701 chromodomain reveal a novel dimerization interface of MRG proteins in green plants
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transcription
total genus 17
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5in1A01
2EKOA 3OYJA 2R58A 4PLIA 2DIGA 3S3MA 3L2VA 3ME9A 4IUTA 4BD3A 4C5GA 3M9QA 2LRQA 2E6NA 3OA6A 4Q5WA 3NTHA 2HQEA 4ZTFA 3MP6A 4IKFA 3PMTA 2RHIA 2X35A 3DB3A 2RHUA 3GOXA 2PQWA 3QBYA 5J39A 2JTFA 2EQKA 2RI3A 5D6WA 5KCOA 2GFAA 4IUPA 1OZ3A 4IUQA 3FDRA 5FRMA 2M0OA 3LGLA 2XDPA 3DLMA 3LYIA 4PL6A 3S6WA 1OYXA 4QVZA 2MWPA 2K3YA 3SD4A 4IURA 2GFUA 2RI2A 2XK0A 2IG0A 2RHYA 4GY5A 2E5QA 1OZ2A 3L42A 3L2UA 2WACA 3Q1JA 4C5EA 4E7HA 5M9OA 1WJQA 2EFIA 3CEYA 5C6SA 1N27A 2HQXA 2LCCA 3QIIA 3ZEHA 1OI1A 4E7IA 1WGSA 2DAQA 3OYAA 4II1A 2M16A 3PFSA 2QQSA 3C4SA 3OB9A 3F70A 2RJFA 3OYDA 4LD6A 2RI5A 3H8ZA 3P8HA 4Z02A 3S3NA 3QKJA 4C5IA 4E7KA 3MP8A 2BUDA 4E7LA 2VYTA 3NTKA 3OYNA 2O4XB 3L2WA 3MEUA 3UT1A 3L2RA 4FL6A 2QQRA 5KE2A 3LGFA 4A4EA 2BIVA 3QJ6A 1MHNA 3LLRA 5CIUA 3OS1A 3OS2A 3OYCA 3META 3OQ5A 4L59A 2GF7A 2MWOA 2X4XA 3OY9A 3NTIA 1RI0A 2D9TA 3OMCA 3MEWA 2RJDA 4RG2A 2F5KA 4C5HA 3OYIA 3S3OA 4BACA 3BDLA 3OYMA 2NLUA 2RJEA 4FU6A 4N4GA 3L2QA 2EQMA 2L3RA 4IUUA 4BDZA 4BDYA 3OYEA 1SSFA 2LVMA 3ASKA 2G3RA 3OYHA 5FRNA 3OYLA 1XNIA 4QQ6A 3E9GA 2P0KA 4N4HA 2BKDN 4IUVA 1WJSA 3LH0A 4PLLA 2DIQA 2L8DA 3OYFA 3EAEA 3OYGA 1WJRA 2JZ2A 3PMIA 4A4HA 5IAYA 5KH6A 4ZTJA 1G5VA 4B9WA 4BE0A 2O4XA 4QQGA 4NS5A 5IN1A 2LTOA 2R57A 4QQDA 5KCHA 1H3ZA 2RHXA 2X4WA 1KHCA 2LDMA 3MEVA 3PNWC 4UC4A 4A4GA 2EQJA 5D6YA 2EQUA 3H6ZA 2K3XA 2RHZA 2CKKA 2YRVA 2R5MA 4BE1A 3DB4A 4BE2A 2L89A 5J26A 4A4FA 4EDUA 3MO8A 4OVAA 3FLGA 4QW2A 2R5AA 3UWNA 3FC3A 5C0MA 3O8VA 3LX7A 4X34A 5D6XA 3OMGA 4E7JA 3MP1A 2RO0A 3MEAA 5KE3A 2M1HA 3E9FA 4B9XA 2RJCA 2X4YA 5FROA 3OS0A 3P8DA 2FHDA 3FEOA 4HCZA 4CRIA 2B8AA 3OYBA 3KUFA 3OYKA 4N4IA
chains in the Genus database with same CATH superfamily
2MK5A 1W2BS 2LJ1A 4BD3A 1AHJB 2LRQA 4J5YA 2HQEA 5CO7A 2LX7A 2RI3A 2EQKA 4KUDK 4BI4A 1NPRA 2HKNA 3V8JA 1K9MC 1Q82R 1UGPB 2E3IA 2JNGA 2E5QA 3GBQA 5L23A 1QVGA 4RUGA 2KVQG 4IIMA 3CCJT 4E7IA 3QIIA 3JCMf 2JTMA 2AHJB 1OI1A 5GANg 1X6GA 1M3BA 3M0QA 3MP8A 2KE9A 1TH7A 1YNZA 3H0HA 1YJNA 3QJ6A 1YITA 2EVRA 2P0PA 4J9BA 4J9GA 1YHQQ 1X2QA 3H9NA 2RD1A 1NYGA 1X01A 3I56Q 5LJ5h 1PKSA 2F2VA 1FXXA 2RF0A 3VS3A 3RBBB 4MMLA 1VQ5Q 3EGUA 1I4K1 1KHIA 2E10A 2EYWA 4N4HA 4C0ZA 2YRDA 4BY6C 2CREA 4R0KA 5LJ3h 2KK4A 2DIQA 2HEQA 2NUPB 2DZ9A 1M1KR 3EFOB 3M55A 2JZ2A 1YWOA 1TOVA 2DE0X 2MIOA 2R57A 4O6JA 2WSFE 1RAEB 5GANd 1S72T 2F2XA 3RKYA 2DTOA 4M78B 4BE1A 1WQWA 3BDUA 1VQ7T 5FWBA 1UUEA 4XTUA 1BYMA 7AT1B 1KJWA 1TUCA 1G2BA 1PCXA 5FROA 3QUIA 3GIBA 2BE7D 1HJDA 4OMFB 2E5KA 2NUPA 5GAN6 4IUTA 3V7SA 3EFOA 3X28B 4PJLA 1HYOA 4V2SA 2DM1A 3QWXX 1UHCA 3NTHA 1M1FA 2E70A 3C94A 3PMTA 2RHUA 2A7YA 2PQWA 1K73C 1M3CA 2YHTA 2AKLA 2LX9A 4M78A 2JM8A 3CMET 2CH4A 3SD4A 1R77A 3VS1A 4MZPA 1A0NB 1UE9A 1OZ2A 4Y92A 3U23A 2JJ9A 4C5EA 1IRXA 4QVDA 2QQAA 1M9SA 3FB9A 4II1A 1U5SA 2QASA 2DVJA 5GAN8 1J3TA 1VQOT 2QI2A 4NL3A 2FB7A 2VWFA 1UTIA 1JJ2S 4M77E 1AOJA 4OF1A 3L2RA 2YSQA 5KE2A 1T0HA 1YI2T 1C0MA 1E6HA 2VGNA 1KIKA 2D0NA 4BI8B 2C0OA 4M7DG 1NM7A 4BY6B 2PTKA 2NYSA 4LDUA 4IUUA 2DL3A 5GJWB 3PIOA 1XNIA 4EIKA 3JCMb 5GAOp 2BKDN 5I21A 2CYZB 2L8DA 2L3PA 2D0QB 5KH6A 1AWOA 2DILA 1KK7A 2RM4A 3R6NA 3KBGA 2M51A 2PU9B 2ZCFB 2X4WA 1K0SA 1NLOC 2DD5A 1BI3A 2W10A 3VS4A 3VV0A 3JCMW 3QSUA 3JCMV 1P92A 3FLGA 4FSSA 3EGXB 3CD6A 1G3SA 3HPWA 1UGQB 1S72Q 3X24B 1PD1A 2ZGWA 2KR3A 2K9GA 3OA6A 1K73U 2IIMA 1RABB 1YFNA 1M90C 3CBMA 1RAIB 1MNDA 1BCOA 1PSFA 2A36A 2OI3A 3VYGA 4QVZA 4KGVB 3M0TA 2HKQB 2RI2A 3EGXA 2FRWA 3HRTA 4KT0E 4PJOE 2DRKA 1VQMA 1WJQA 8ATCB 2LCCA 4XU1A 2V1QA 2ZPGB 2LQWA 3CCRT 1T0JA 2LJ3A 3CPWP 1CKAA 2BUDA 4RTVA 2ROTA 1VUBA 3NMZC 3CCLQ 1ZQ1A 4RTWA 1GL5A 4JRKA 2H3JA 1VQ4A 1VQOQ 3QDFA 2X4XA 3VUZA 1RI0A 1ARKA 4J9DA 2XI9A 2CZ7B 1DJ7B 3G6ET 3EGDB 1SSFA 1YI2Q 2G3RA 2HBWA 1W2BA 2BE9B 1YIJT 4QQ6A 1NJIR 3G4ST 2RNAA 4C8QG 3LH0A 2O9SA 2CUDA 2DK3A 2KYBA 3I35A 3RMQA 2OAUA 2OAWA 1H3ZA 1UB4A 1LOJA 3E1SA 1MV0B 3N5BB 3CC2A 3A8GB 2MOXA 3H41A 5AYFA 1JRIA 2XKOC 1C1AA 1WDXA 3M0RA 3DB4A 4RG8A 2R5AA 4ZGEB 3OSVA 2V8KA 1RAGB 1UHFA 3EGDA 4E7JA 3MEAA 4J6WA 1WHKA 3RERA 4C92B 1NG2A 1K0XA 2EWNA 2ZAEA 1Q7YR 5A2QE 2QTVA 1M90U 4Q5WA 5FW9A 4PFOA 4M7DD 2GBQA 2FZKB 4VUBA 3LYIA 2JS0A 2MWPA 1VOMA 1QVFP 1VQ9T 3A8LB 3PTAA 1QWFA 1OPKA 3HFNA 5GAMe 3V7CA 3G71Q 5CQXA 3JSCA 3HKSA 4M7AG 1HXDA 2KMTA 3F70A 3I5SA 5CAIA 3P8HA 3CXCS 2COWA 5GMKe 3TQ7P 4C8QC 4JLIA 4RTXA 2QA4T 4LDWA 4M75D 1MHNA 3CCUA 3OS1A 3CPWA 4JJNK 2JOYA 2PUKB 5LJ5g 2RQRA 4JS5A 3CCMA 1JO8A 4DBRA 1M90R 2DMOA 3BDLA 2E41A 1YJ9Q 3KFVA 2EIFA 2EKHA 2COYA 2E4HA 4M7DE 1TUDA 5LJ3g 2COZA 2K57A 1KC8C 3OYFA 3OYGA 1WJRA 4D6WA 1KG1A 3G6EQ 1Q86C 3CCVA 1MMGA 3EH1A 3M4GA 2KY9A 2QAZA 1YIJQ 2V1RA 3HTRA 2FPEA 5J26A 1W4SA 5GANj 6AT1B 3FJ5A 4J9EA 4OB1B 1D0XA 4J6YA 3CC7A 5C0MA 4AFQC 1VYVA 1YJWT 4F7UE 3DKMA 2GTJA 1Y96B 4DEXA 3PGGA 3LW5E 1JJ2A 2DJQA 4HVVA 4M75E 4FW1A 3KUFA 3JCMe 2X9HA 2RH2A 4J8OA 4DOWA 4A63B 4M7AC 2K3BA 1Q82C 4KH0B 2DPPB 2L3SA 2O2OA 2FPFA 1Y0MA 2PZ1A 2K2MA 3DB3A 4EMKC 5KCOA 2FZGB 2KBTA 5GMKl 2HL5C 2ENMA 3EG3A 4OB2B 2LNHB 3M59A 2DEQA 1FMWA 1HD3A 2PVDB 4AMCA 1XQHA 1ABQA 3CCJA 4C8QD 3QWYA 3CEYA 1BCMA 2K5IA 3PFSA 2EGEA 5GJVB 4FYWB 3TEEA 4M7DF 1TXQA 1VQ9Q 3FJPA 2O4XB 3I55Q 3UT1A 3KXTA 3RUXA 2DNUA 1VQ6Q 3CCET 5CIUA 4M78G 1XJWB 2VGMA 3OS2A 4XAXB 1BKBA 1AZEA 4CC4B 3BFMA 2GF7A 2GNCA 1M1KC 1PRLC 3VS2A 3A5ZB 2CP3A 3JCMQ 2X51A 1KC8U 2P0QA 2QA4Q 2LNVA 3URGA 5LL6S 1I0CA 1LCKA 3I56T 2EPDA 1Q86U 1WHGA 4WCIA 1NEBA 1O9SA 3OSSC 1VQ5T 1D0YA 4M75F 4BE0A 2GQIA 1VQPT 2O4XA 4FYXB 2ATCB 2KQWA 5GAOm 2A08A 4C8QE 2GTOA 2EQJA 3OW2P 3SEMA 4D8KA 4ZN3A 2AK5A 2PVGB 4AG2C 2GQVA 1VQ7A 2EGCA 2KRSA 3CC4Q 2AKKA 2J6KA 2OTJA 1G3TA 2M1HA 2X4YA 4JLGA 1G3WA 5FLXE 1Y07A 4HCZA 3WVEB 1Q82U 4N4IA 4AFZC 4PFZA 2DERA 1TG0A 5IHKA 1G3YA 1M4ZA 1YN8A 3C95A 4FSXA 2CS7A 2HL3A 1RAFB 1SRMA 3CPFA 1AWJA 3M0SA 3CCQT 5CQYA 1FMKA 3NFCA 4FYYB 3VRZA 3VS7A 3LGLA 3S6WA 3VS6A 3CMEA 1Q86R 1RACB 3CMAT 3EG2A 4M78C 2GFUA 1Y7XA 2YLCA 3JAME 2RQVA 4M7AA 2EAYA 2DXBA 3NHNA 1QCNA 4FM4B 1WZOA 2DAQA 2H8HA 2XDDA 4EMKA 5GAMh 3X20B 2RMOA 2QXFA 2DD4A 5GAN5 2JVVA 2QQBA 2ZPBB 2O9VA 1HSQA 2VKNA 2I2LA 1QQJA 1VQ8T 2FL7A 5GMKh 4A4EA 1BB9A 1ZHIA 2VASA 1M1KU 3OYCA 2AZSA 3TREA 1Q81R 1VQLT 3OQ5A 4L59A 4E7ZA 1OPLA 3RR6A 1QCFA 3X25B 3OYIA 4J83A 4C8QF 3QPHA 2EQMA 1IO6A 1EZZB 1X69A 2LVMA 3OYHA 1YWPA 3CCEQ 2KT1A 4DOVA 4ORZA 1B3QA 2M9UA 1ZLMA 1G5VA 4ZTJA 3NPFA 3LH5A 2QK0A 1F1BB 3D7SB 4QQDA 2J7IA 1YCYA 2LDMA 1K76A 2M0YA 2HQHA 2RHZA 5IHIA 1RI9A 5CKFA 2VB6A 1KFZA 1UGRB 4E7SA 2FVUA 4PFPA 1VQPQ 1ZUKA 2CP0A 2V8IA 1WHHA 3M54A 3CCST 2HNIA 8AT1B 4N0AC 3CXCA 2YUQA 1TWBA 1RL2A 2NWMA 3OYJA 5CK9A 4JRQA 1B34B 2EJGA 3JCMh 1TU0B 4M78D 1OX8A 2CT4A 2X35A 3AT1B 2JTFA 2YRCA 3FDRA 3CPWS 3G7ZA 1GBQA 4B6MA 4JZ4A 1R0CB 1GFDA 2LQNA 4D8DA 1OQKA 4OGEA 2AIRB 2EJ9A 2OTLT 1N6AA 3QZ9B 3CCQQ 1NPPA 4JDSA 3JCMP 3ZEHA 2EYZA 1WGSA 3CCRA 2KROA 4HVUA 3OYAA 3C4SA 2RQWA 1W70A 4M77B 2CH4W 3CMAQ 3TVTA 4JZ3A 1B34A 2EJFA 4X9DA 4HCKA 4E7LA 2IVWA 2K5LA 4LE9A 3LWIA 4A54A 1RAHB 2DFUA 1VQKQ 1KD1U 1G83A 1M3AA 3GF5A 3H0IA 1NJIC 4DEYA 2QEXA 4XTXA 5A0GA 3HL8A 1IXDA 1VQNA 4EMGA 4ZN1A 1OU8A 3CCLT 2Z0WA 4N4GA 1VQ8Q 5HK3A 4LDVA 1BIBA 1WPYA 4C92G 2C0IA 3QXEB 3G4SA 1VQLQ 1UG1A 1UDLA 4M77A 4GLKA 4PLLA 2RK2A 2EYXA 3HRUA 2RK1A 1IREB 4JRPA 1K8AC 2DX1A 3CBPA 4TVRA 4NS5A 2QGFB 5CKDA 2XG8D 1AD5A 3PVLA 1YCSB 3JV3A 4CC2A 1Q7YC 2ESWA 4ELYC 3FC3A 3TSWA 4FW2A 3UWNA 2JM9A 4MZTA 3A8MB 4LN2A 1N5ZA 3MP1A 1QP3A 2A0FB 1M8VA 1KD1R 1SKUB 1QVFS 2YXYA 1WLPB 3BY7A 3S3MA 3ME9A 1AWWA 5LJ5j 3CCSQ 2E65A 2BZYA 2CP6A 4N0AA 1D1CA 1QCOA 5LJ3j 4MMKA 2YUNA 4PJOB 2J06A 2SRCA 1WXUA 2DBKA 3L2UA 2LJ0A 1KQSP 4J7FA 1I81A 3EG1A 5KYWB 4M78F 4C92C 2XMFA 4DBQA 1T3LA 4E7KA 3G71T 4XQ3A 2OTLQ 2ZPHB 3EHQA 3EFRA 1NJIU 3WXMB 3THKA 3M0PA 5CKBA 2BIVA 4KULA 1M27C 3LLRA 3QYGB 4MDWA 2KNBB 4RTZA 3JRZA 1MGQA 4PJOA 2RN8A 2XICA 2HD0A 2KT8A 2K7AA 5GANf 3OYEA 5KYNA 1WIEA 5IHNA 5FRNA 3CQTA 1SRLA 1K8AU 1YJ9T 1SHGA 4A4HA 4HA8A 1X43A 2LT1A 3UF4A 1NEGA 2LTOA 1MV3A 2J6OA 1Q7YU 2HMAA 1B07A 2CDTA 1I07A 3I9QA 5D6YA 1D0ZA 1U1SA 4BE2A 4CC7A 2DKGA 1ZBXA 4ESRA 5I2MA 3HHTB 3LX7A 3O8VA 4QKUA 1YJWA 4IIOA 5EC7A 3A98A 2DTIA 5A0LA 3M58A 1GCPA 2I0NA 3L2ZA 2Y4XA 3RKXA 1N8RU 3M9QA 5HCKA 1ZSZC 2ZPEB 3OBYA 4PNOA 4ELZC 2P4RA 5D6WA 1H641 1JEGA 2M0OA 5I2SA 1K8AR 5GMKm 5KYUB 1I8FA 4PJJA 4C92D 2IG0A 2RHYA 3BW1A 2KDSA 3L42A 3Q1JA 4NL2A 3REBB 2KGTA 2DL7A 1ZA2B 5C6SA 5GAMg 1ZUYA 1Y57A 2LCLA 2HBPA 1PD0A 1KQ1A 2DXUA 3VS0A 2LC4A 4OP0A 1YJNQ 2JN0A 3MCAB 2CZ0B 1YITQ 4JUVA 1PHTA 5FWCA 5GAN4 4KH1B 2Y4YA 3UA7A 3DLLA 2F1LA 4FL6A 4BB7A 2KSSA 1LPLA 3SDZA 3PE0A 2M02A 3VKIA 3I55T 5KYUA 2C06A 1N8RR 2RJDA 4RG2A 4A53A 4C92A 3P8BB 1M30A 1I5OB 1VQ6T 3GNFB 2FZCB 3OW2S 1YHQA 3J7AF 3RMSA 3TCJA 4BUGA 4F16A 3I56A 1R0BG 1C6VX 3CD6T 2DYBA 1V29B 1VQ5A 3JB9J 3JCMX 1FMVA 3E2UA 1SEMA 3OYYA 1YBYA 4QQGA 2F2WA 1W6XA 3SFMA 5J3BA 4L5GA 3OS5A 2Y90A 1H8KA 2K3XA 2R5MA 3VJPA 4OVAA 4QW2A 9ATCB 4E2FB 2YDLA 4F7UB 2CSQA 1XOVA 1ZSZB 4HT8A 1WXTA 1QWEA 2OJ2A 1YP5A 3CC4T 5IN1A 2EKOA 3JCMg 1RLQC 2GCXA 2R58A 4RMOA 4XU3A 2C0TA 4F17A 5GMKi 3H0FA 5DLOA 4KGZB 1EIFA 2CSIA 4F7UA 2BTTA 4GY5A 2LMJA 1ZSZA 5LJ5d 1ACMB 2ED0A 2DTHA 4J9CA 2A37A 1Q81C 2NUTB 5GAOr 4AFUC 5DM7R 3OB9A 4GBQA 2EQIA 1AVZC 5LJ3d 3JB9I 3GLXA 5CVIA 4CC3A 4FYVB 3OYNA 2ZZDA 2QYZA 1WNLA 2LZ6B 1UJYA 3UA6A 1JQQA 1PWTA 1IHVA 3CC2T 2D9TA 4WTOB 2F5KA 4NOYA 4KGXB 2ED1A 1Y96A 3VRYA 1QVFA 2MI6A 1GXIE 3ASKA 4ZGDB 2WSEE 3ZFJA 2NUTA 1IGQA 4IUVA 2V26A 2DF6A 3UPUA 2B86A 3PMIA 5IAYA 4LUDA 3SB2A 2PUOB 4RTYA 4XU2A 1BI2A 1KHCA 1IHWA 2V8JA 1WHLA 2EYYA 2MF2A 3CD6Q 2L89A 4EDUA 3MO8A 2MCNA 2RPNA 3V8LA 1QVGP 2DO3A 4PJMA 1SHFA 3M0UA 4Y28E 4CI0C 3QHSA 2LP5A 1E7OA 4AG1C 4ME7A 3MPUB 3NGPA 3FEOA 4LUEA 4M77G 2FRYA 2CP7A 3L2VA 4WF2A 1S72A 3C12A 4OMPA 2QDLA 1WYXA 3MP6A 4EPCA 1U8RA 2RHIA 4XTVA 4DQ2A 1QLYA 5D7UA 4LXCA 3HP9A 2LQKA 4IUQA 5IXFA 5FRMA 1D1BA 1NE8A 4PL6A 3UDCA 2L3QA 1NYFA 3M57A 4M7AD 1VQMQ 4A4KA 3CCUT 2X3XD 3JB9H 1Q81U 2DL5A 2EFIA 4HT9A 1GBRA 1MUZA 4DA4A 5IT9E 4JS4A 4C0DB 2KRNA 1QP2A 2ABLA 3HRSA 3H8ZA 3IQLA 2XDBA 3QKJA 1I1JA 1TUGB 1VQ4Q 4LDXA 1U3OA 5I22A 1XTDA 4L6V5 2K2VA 3LGFA 2E12A 2ECZA 2DETA 5HK0A 3META 4XK8E 1RAAB 2CP5A 4OMOA 3CCLA 4C5HA 2A3LA 1VQKT 2AZVA 2IPOB 1H3HA 1VQOA 1UECA 2DXTA 3T9NA 3CC7T 1WJSA 3CC2Q 3G1JA 4M7AE 1YI2A 4M77C 3QZ5B 4B9WA 2FPDA 1AWXA 1X2KA 2X3WD 1KD1C 2HZYA 3MKDA 3M53A 3PNWC 5LJ5f 4AT1B 1VYUA 3UATA 2CKKA 3RKWA 3WVDB 4PJOG 2YUPA 4OB3B 1MMDA 1SSHA 4JPBW 1T3SA 5LJ3f 3OS0A 2K6DA 3P8DA 1K9AA 4FCYA 3C0CA 4C5GA 1KQSS 1AEYA 2E3HA 4FT4A 3GOXA 1WX6A 2ZPFB 2GFAA 1OZ3A 5KYXB 2XDPA 1WHJA 1OYXA 1OU9A 3BE3A 3OW2A 1VIEA 1MMNA 2D8JA 3X26B 2JUFA 3RNJA 2X4JA 2HAXA 4E7HA 1UEBA 5GANe 1G8XA 2QQSA 1M2VB 2MMPA 3A8OB 4OMNA 1LNXA 2EYQA 2VXEA 3G71A 1LJOA 3CCUQ 1RLPC 1BI0A 3MEUA 4M7AF 3CCMQ 5KYXA 1O75A 5GAOl 1IZ6A 2DRMA 1WXBA 4KUIA 3OMCA 2L2PA 1K4US 1SG5A 2NLUA 3EHRA 1U1TA 4K11A 4BDYA 4PJOC 4M77D 4HCCA 4KBMB 5HY6A 3E9GA 3JB9G 2P0KA 5HKCA 3CCVQ 1M2VA 1YJ9A 2OTJT 3AHUA 1V1CA 1PKTA 2JS2A 4HKEA 2MPXC 1AZGB 1ZA1B 1IB8A 1S1NA 2J6FA 3CC7Q 3G6EA 1X27A 2XHCA 3INZA 4FT2A 3OBWA 5GAMj 5GAN7 4M78E 1RADB 1AT1B 1YIJA 1ZBJA 1K9MU 5D6XA 1WA7A 4Y91A 5KE3A 1RUWA 3TU4K 1ABOA 4B9XA 5GMKj 2VXFA 4Z88A 2B8AA 1QKXA 5EG2A 2QDYB 5FU6C 4HVWA 3M5AA 2KXCA 3CBOA 4RTUA 2K5FA 2FG0A 2DXCA 4C0FA 2MAMA 3CCJQ 4IURA 2XK0A 1ZUUA 2P4TA 1BU1A 3RESA 1W2BP 4X9CA 2K4YA 2F5TX 2PVOB 2HDAA 2HQXA 4J9IA 2RJFA 3HFOA 1N8RC 5IH2A 1D1AA 1K9MR 2O88A 2EW3A 1YJNT 1YITT 4Z89A 4PJOD 1QMCA 1VQ9A 3REAB 1TSFA 2P84A 4E47A 3I55A 1TS9A 3NTIA 3RDVA 1V76A 2JT4A 2CT3A 1VQ6A 4F7UG 3S3OA 4BACA 2HSEB 2EGAA 4M75G 4OB0B 2H3EB 3QDRB 1Z9ZA 3I5RA 2DYIA 2DL8A 2LCSA 5GAOq 2QA4A 1FX7A 3EAEA 3MHXA 1B7TA 1M5Q1 2O31A 2YT6A 2LT4A 2YLBA 1CSKA 2RHXA 1VQ7Q 4UC4A 4LDYA 3TSZA 2EQUA 2O01E 1OULA 2GGRA 2VUBA 2DEUA 2OTJQ 2QTXA 2DZCA 4M77F 2QG9B 4OMMA 2KRMA 5FU6B 5GAN3 5A0DA 3EH2A 3OMGA 2BZXA 3M56A 1Z9QA 3EG9B 1NZ9A 5KYWA 2DJZA 3CC4A 1X6BA 2FEIA 2ROLA 4CRIA 4M7DC 1Y71A 2KYMA 3V7RA 3FIFA 3M4YA 1JU5C 2JW4A 1KQ2A 3JCMJ 2YUOA 3HSBA 2RB6A 3CMEQ 4OGCA 1BI1A 5J39A 1HK9A 3VU3C 1N9RA 2BZ8A 1FYNA 2DA9A 5DLQE 2QEXT 2WACA 4DBHA 3JB9D 2WSCE 3EG9A 1VQNT 1K73R 1N27A 2QQ9A 3VS5A 1NLPC 4M75C 2M16A 1UFFA 2D6FA 5GANh 4Z02A 4OMQA 2KXDA 1PRMC 2CZ1B 4P5NA 2RQUA 1ZX6A 1IGUA 1GCQC 2CP2A 2CZ6B 2VVKA 4YTLA 4DBFA 2MWOA 3MEWA 4JJCA 4ATOA 2MYSA 3MJXA 4OMLA 3VYHB 2L3RA 1JXMA 4HXJA 1JJ2P 1R8OB 1X6OA 3PT9A 1CKBA 2VV5A 4MDXA 2KAFA 3OYLA 2XIDA 4JRIA 4KRTA 1KQSA 1QVGS 1QVPA 1SPKA 4R56A 3SHWA 3JCMc 2DVEA 4LD9K 1EFNA 2L5QA 3CCEA 1WHMA 4PJOF 1GRIA 4J9FA 1PNJA 4X1VA 5KCHA 4PK4A 5FU7C 4RCCA 2VC8A 3H6ZA 1W1FA 1WQ7A 4M7DB 2JMCA 3ZL7C 1D09B 4RTTA 2D1XA 4PKCC 3ER0A 4X34A 3SWNC 1MMAA 2JMAA 2XU8A 2PNIA 3A1PA 1OX9A 3ZBDA 4C0GA 3OYKA 1VQPA 4C92E 4J7IA 1QW1A 4PLIA 1NBEB 5GAMd 5GAOn 1M1GA 2E6NA 2RA2A 4F14A 4XTZA 4ZTFA 1VA7A 4IKFA 5L8RE 3PIPA 5KYYB 3A8HB 1TTHB 4IUPA 3DLMA 3O5ZA 2W0ZA 4M75B 1PC0A 1BIAA 4M7DA 4E6RA 3CCRQ 4M4ZA 2KEAA 1OV3A 1VQMT 2CUBA 5ECAA 4AFSC 1M8MA 3CCQA 3OYDA 2RI5A 3S3NA 4C5IA 2DBMA 2VYTA 2QEXQ 4MZMA 3CMAA 2KI7A 1VQNQ 1M2OA 5KYYA 2FO0A 5CKHA 4ZGJB 5LJ5e 1VQ4T 3JB9F 4M75A 1UGSB 1VQKA 4EMHA 2A28A 2LQ8A 3G4SQ 4FIBA 1SF9A 3QG1A 2E1HA 4O5VA 5LJ3e 1PSEA 2RQTA 5FU7B 4LNPA 1VQ8A 2XD0A 4ZNXA 1I5LA 2NUZA 1GCQA 3QJYA 3V8KA 4C0DC 1VIFA 4C92F 3JCMd 1VQLA 1PM3A 3SWNB 1QKWA 5GAN2 3QYHB 4A4GA 2K79A 3J80E 5CKEA 4A4FA 1FWZA 1GFCA 4J9HA 4XU0A 3VUBA 1PG5B 5AT1B 2RO0A 3E9FA 1VYTA 3L1AA 3RIRA 1H92A 4PJNA 4XTYA 2DL4A 3ULRB 3R6OA 4GLMA 3L2WA 4C8QB 1OEBA 2DIGA 5CR2A 4F04B 2E64A 1Q95G 2L0AA 3SWNA 3QBYA 1E6GA 4BI3A 1OOTA 2CGHA 2ZPIB 3CCSA 2K3YA 1BBZA 1LVKA 5I11A 4QT7A 5M9OA 1D3BB 4RKUE 1N9SA 1YHQT 4C8QA 1BK2A 4LD6A 2OX7A 2JTEA 4Z8AA 2SEMA 3GNGA 3NTKA 4F7UF 2AT1B 2QQRA 2QGGA 2D8HA 2JXBA 1ZSGA 2OTLA 2HCKA 3OY9A 2J05A 3LWHA 2EBPA 3CCMT 4HCBA 3J81E 4QVCA 2HSPA 3OYMA 4FU6A 2RJEA 3FRNA 5GAMf 3L2QA 3CXCP 1U06A 4BDZA 4R55A 1JB0E 1D3BA 1MNEA 4M7AB 3QO3A 4XTWA 1UJ0A 1EX4A 4JJDA 4ANJA 5CCAA 2YWWA 4J6XA 1WI7A 3GP8A 4RCBA 5DY9A 4EMKB 1JBMA 2G6FX 3E19A 3CCVT 1JXOA 3EG0A 3MEVA 3EFSA 2FYKA 1YJWQ 1UGVA 2YRVA 3PVQA 1KC8R 1WFWA 2E6ZA 2F69A 1KSWA 3GPLA 1K1ZA 2RJCA 5IXBA 2FHDA 1X75C 2DLPA 3OYBA 4JJBA
chains in the Genus database with same CATH topology
3L2ZA 2QDYB 4J8OA 5EG2A 5FU6C 2Y4XA 1W2BS 3RKXA 4DOWA 4BD3A 4M7AC 1N8RU 1Q82C 1AHJB 3M9QA 2LRQA 2DPPB 4J5YA 3M5AA 2ZPEB 3OBYA 4PNOA 2HQEA 3CBOA 3DB3A 5CO7A 4ELZC 2K5FA 4EMKC 2RI3A 2EQKA 5KCOA 5D6WA 1H641 2DXCA 4C0FA 4KUDK 2M0OA 5GMKl 5I2SA 4BI4A 1NPRA 5GMKm 2MAMA 1I8FA 4OB2B 3V8JA 3M59A 4IURA 1K9MC 2DEQA 4C92D 1UGPB 2XK0A 2IG0A 2JNGA 2P4TA 2RHYA 2PVDB 1XQHA 2E5QA 2KDSA 3BW1A 3L42A 3RESA 3Q1JA 4NL2A 4X9CA 2K4YA 3CCJA 1QVGA 2KVQG 4C8QD 3CEYA 2F5TX 5C6SA 3CCJT 2PVOB 5GAMg 2HQXA 3QIIA 2JTMA 2AHJB 1OI1A 3JCMf 4E7IA 2LCLA 5GANg 2K5IA 2HBPA 3PFSA 2DXUA 1KQ1A 2RJFA 2LC4A 3HFOA 4OP0A 1N8RC 2JN0A 3MCAB 2CZ0B 3TEEA 4JUVA 3MP8A 4M7DF 5GAN4 3FJPA 2O4XB 2Y4YA 3DLLA 3UT1A 4FL6A 3RUXA 4BB7A 3KXTA 2KSSA 1YJNA 1TH7A 3QJ6A 1YITA 3SDZA 1YJNT 2P0PA 1YITT 5CIUA 3CCET 4M78G 3OS2A 2VGMA 1VQ9A 4PJOD 4XAXB 3VKIA 4E47A 3I55A 1BKBA 3I55T 3BFMA 2GF7A 2C06A 3NTIA 1M1KC 2RJDA 4RG2A 4A53A 2RD1A 4C92A 3P8BB 4F7UG 1X01A 3A5ZB 4BACA 3S3OA 1VQ6T 1VQ6A 5LJ5h 3JCMQ 3GNFB 1FXXA 1YHQA 3OW2S 4M75G 1KC8U 4OB0B 2P0QA 3J7AF 4MMLA 3QDRB 3RMSA 3TCJA 4BUGA 2LNVA 1I4K1 1KHIA 3URGA 2E10A 3I56A 5LL6S 4N4HA 4C0ZA 3I56T 3CD6T 4BY6C 5GAOq 1V29B 5LJ3h 1Q86U 2KK4A 2DIQA 1VQ5A 2DZ9A 2QA4A 3JCMX 1O9SA 3JB9J 1FX7A 3EAEA 3M55A 2JZ2A 3MHXA 3OSSC 1VQ5T 4M75F 1M5Q1 3OYYA 4BE0A 1VQPT 1YBYA 2O4XA 4QQGA 2R57A 2KQWA 2LT4A 2YLBA 2RHXA 4O6JA 2WSFE 5J3BA 3SFMA 5GANd 5GAOm 1S72T 4L5GA 3RKYA 4C8QE 2DTOA 4UC4A 4LDYA 2EQJA 3OS5A 4M78B 2Y90A 2EQUA 2O01E 2K3XA 2VUBA 4BE1A 4ZN3A 2R5MA 3VJPA 2PVGB 1WQWA 2QTXA 3BDUA 2GQVA 1VQ7A 4OVAA 2DZCA 4M77F 4QW2A 1VQ7T 5FU6B 4XTUA 5GAN3 1BYMA 4F7UB 5A0DA 3OMGA 1XOVA 3M56A 2OTJA 1G3TA 4HT8A 1NZ9A 2M1HA 2DJZA 2X4YA 5FROA 4JLGA 3QUIA 1G3WA 5FLXE 3CC4A 1Y07A 4HCZA 3GIBA 4M7DC 4CRIA 3WVEB 1Y71A 3CC4T 4N4IA 5IN1A 1Q82U 4OMFB 2EKOA 3JCMg 2GCXA 2R58A 3FIFA 3M4YA 3V7RA 4RMOA 1G3YA 1M4ZA 5GAN6 4IUTA 3C95A 3V7SA 4FSXA 4XU3A 3JCMJ 2CS7A 3X28B 1KQ2A 4V2SA 3HSBA 3CPFA 2RB6A 3NTHA 3CCQT 1M1FA 1BI1A 2E70A 3C94A 4OGCA 5CQYA 3PMTA 2RHUA 3NFCA 5GMKi 2A7YA 2PQWA 1K73C 2YHTA 1HK9A 5J39A 2LX9A 4M78A 3VU3C 3LGLA 3S6WA 5DLOA 3CMEA 1N9RA 3CMET 1EIFA 3CMAT 4M78C 3SD4A 2GFUA 1Y7XA 2YLCA 4F7UA 4MZPA 3JAME 4GY5A 1OZ2A 5DLQE 2QEXT 2WACA 3JB9D 2EAYA 4M7AA 2WSCE 2DXBA 5LJ5d 4C5EA 1VQNT 4QVDA 2DTHA 1N27A 4FM4B 2QQAA 2QQ9A 2DAQA 1M9SA 3FB9A 2M16A 4II1A 4M75C 1Q81C 5GAN8 2XDDA 5GAOr 4EMKA 5GAMh 5DM7R 3X20B 2QI2A 3OB9A 4NL3A 2QXFA 1VQOT 2FB7A 2DD4A 5GANh 5GAN5 4Z02A 2JVVA 2QQBA 2ZPBB 2D6FA 1JJ2S 5LJ3d 4M77E 3JB9I 2I2LA 3GLXA 5CVIA 3OYNA 2ZZDA 4OF1A 1VQ8T 2FL7A 3L2RA 2CZ1B 4P5NA 5KE2A 5GMKh 1YI2T 4A4EA 1WNLA 1ZHIA 1M1KU 3OYCA 2VGNA 3TREA 2CZ6B 1VQLT 4YTLA 3CCLA 3OQ5A 4L59A 4BI8B 2MWOA 3CC2T 2D9TA 4M7DG 3X25B 3MEWA 3OYIA 4J83A 2F5KA 4C8QF 4NOYA 4BY6B 4ATOA 3QPHA 4MDXA 4LDUA 1Y96A 3VYHB 2EQMA 2L3RA 2MI6A 4IUUA 1QVFA 1R8OB 1X6OA 3PT9A 1GXIE 2LVMA 2VV5A 3ASKA 2WSEE 4ZGDB 2KAFA 3PIOA 3OYLA 1XNIA 3OYHA 2XIDA 4JRIA 3ZFJA 1KQSA 4DOVA 3JCMb 5GAOp 2BKDN 4IUVA 1QVPA 5I21A 1QVGS 2CYZB 4R56A 2L8DA 3JCMc 2DVEA 4LD9K 2D0QB 3UPUA 2M9UA 1G5VA 2L5QA 3PMIA 5KH6A 5IAYA 3CCEA 4ZTJA 3SB2A 2PUOB 4PJOF 2RM4A 3KBGA 4XU2A 1BI2A 5KCHA 4QQDA 2PU9B 2ZCFB 2X4WA 5FU7C 1KHCA 1YCYA 4RCCA 2LDMA 2DD5A 2V8JA 1BI3A 2VC8A 2MF2A 3VV0A 3JCMW 3H6ZA 2RHZA 3QSUA 3JCMV 1WQ7A 5CKFA 2L89A 4EDUA 4M7DB 1P92A 3MO8A 1UGRB 3FLGA 3V8LA 2FVUA 4PKCC 2DO3A 3ER0A 4X34A 3SWNC 3CD6A 2V8IA 1G3SA 4Y28E 3HPWA 3M54A 3CCST 4CI0C 3QHSA 2HNIA 1UGQB 2XU8A 4ME7A 4N0AC 3CXCA 3ZBDA 3FEOA 4C0GA 1RL2A 3OYKA 1VQPA 4C92E 4J7IA 4M77G 3OYJA 1QW1A 4PLIA 3X24B 5CK9A 5GAMd 3L2VA 4WF2A 1S72A 2ZGWA 4JRQA 1B34B 2EJGA 3JCMh 5GAOn 1M1GA 2E6NA 2RA2A 3C12A 4XTZA 3OA6A 1K73U 4M78D 4ZTFA 3MP6A 4EPCA 1U8RA 4IKFA 2RHIA 2X35A 4XTVA 4DQ2A 1M90C 5L8RE 3CBMA 3PIPA 2JTFA 3A8HB 3HP9A 2LQKA 4IUPA 4IUQA 3FDRA 5FRMA 1PSFA 3CPWS 1NE8A 3DLMA 4PL6A 3UDCA 3VYGA 4QVZA 3G7ZA 3M57A 4M7AD 4M7DA 4M75B 4A4KA 1BIAA 2RI2A 3CCUT 4OGEA 3HRTA 2EJ9A 2OTLT 1N6AA 4KT0E 3QZ9B 3JB9H 1NPPA 4PJOE 1Q81U 4JDSA 1VQMA 1WJQA 2EFIA 1VQMT 3JCMP 2LCCA 4XU1A 3ZEHA 4HT9A 2ZPGB 4DA4A 1WGSA 3CCRA 3OYAA 4JS4A 5IT9E 4C0DB 3CCRT 3C4SA 4M77B 1QP2A 3CCQA 3OYDA 2RI5A 3H8ZA 3HRSA 2XDBA 3S3NA 3QKJA 4C5IA 1B34A 2EJFA 2BUDA 4X9DA 4E7LA 2VYTA 2IVWA 2K5LA 3LWIA 4LDXA 4MZMA 1VUBA 1XTDA 4A54A 4L6V5 3CMAA 2K2VA 3LGFA 1ZQ1A 1KD1U 2E12A 5HK0A 3GF5A 4JRKA 3META 4XK8E 5CKHA 2H3JA 4ZGJB 1NJIC 2QEXA 1VQ4A 4XTXA 5A0GA 3HL8A 5LJ5e 1VQ4T 2X4XA 3VUZA 3JB9F 1RI0A 1VQNA 4M75A 1UGSB 4EMGA 1VQKA 2XI9A 2CZ7B 4C5HA 4ZN1A 3CCLT 1DJ7B 2A3LA 1VQKT 4EMHA 3G6ET 2LQ8A 4FIBA 4N4GA 1VQOA 3QG1A 5HK3A 4LDVA 1BIBA 2E1HA 4O5VA 1WPYA 1SSFA 4C92G 2G3RA 2DXTA 3T9NA 5LJ3e 1W2BA 1YIJT 1PSEA 3CC7T 3QXEB 4QQ6A 3G4SA 5FU7B 1VQ8A 3G4ST 4M77A 2XD0A 4C8QG 1WJSA 4GLKA 3LH0A 4PLLA 1I5LA 2RK2A 4M7AE 3QJYA 1YI2A 3V8KA 4C0DC 3HRUA 2RK1A 1IREB 4M77C 2DK3A 3QZ5B 4B9WA 4JRPA 1K8AC 3CBPA 1VIFA 3RMQA 2OAUA 4NS5A 4TVRA 4C92F 3JCMd 1VQLA 1H3ZA 1UB4A 1LOJA 3E1SA 3N5BB 1KD1C 5CKDA 3CC2A 3A8GB 3SWNB 5GAN2 2XG8D 3QYHB 3M53A 3PNWC 4A4GA 5AYFA 5LJ5f 1JRIA 3J80E 1Q7YC 2CKKA 2XKOC 5CKEA 3RKWA 3DB4A 3WVDB 4ELYC 4A4FA 1FWZA 3FC3A 4RG8A 2R5AA 3UWNA 4ZGEB 4PJOG 3OSVA 3A8MB 4MZTA 2V8KA 4OB3B 4XU0A 3VUBA 4E7JA 3MP1A 2RO0A 3MEAA 4J6WA 5LJ3f 3RERA 3E9FA 1QP3A 1M8VA 3L1AA 3RIRA 3OS0A 4C92B 3P8DA 4XTYA 1QVFS 3R6OA 3L2WA 2EWNA 4C8QB 3BY7A 2DIGA 3S3MA 3ME9A 5CR2A 4C5GA 5A2QE 1KQSS 1M90U 4Q5WA 5LJ5j 2E64A 4FT4A 3GOXA 3SWNA 4M7DD 3QBYA 2ZPFB 2E65A 2GFAA 1OZ3A 4BI3A 4VUBA 3LYIA 2XDPA 1OYXA 2CGHA 4N0AA 2MWPA 2ZPIB 3CCSA 5LJ3j 3OW2A 2K3YA 4MMKA 1VIEA 4PJOB 3X26B 1VQ9T 3A8LB 3PTAA 3L2UA 2JUFA 2X4JA 3HFNA 2HAXA 5GAMe 5M9OA 1UEBA 4E7HA 4J7FA 1D3BB 3V7CA 4RKUE 5GANe 5CQXA 1I81A 3JSCA 1N9SA 3HKSA 4M7AG 2QQSA 1HXDA 2KMTA 2MMPA 3A8OB 4M78F 4C92C 1YHQT 3F70A 4C8QA 1LNXA 4LD6A 2EYQA 2VXEA 3P8HA 5CAIA 3CXCS 3G71A 1LJOA 4E7KA 5GMKe 3G71T 3GNGA 4XQ3A 4C8QC 3NTKA 2ZPHB 4JLIA 4F7UF 1BI0A 3MEUA 1NJIU 2QQRA 3EFRA 3WXMB 4M7AF 5CKBA 2QA4T 2BIVA 4LDWA 4M75D 4KULA 1MHNA 3LLRA 3CCUA 3OS1A 3QYGB 4MDWA 1O75A 5GAOl 3CPWA 2OTLA 4JJNK 2JOYA 1IZ6A 2PUKB 3OY9A 4KUIA 3JRZA 3OMCA 5LJ5g 3LWHA 4JS5A 1MGQA 3CCMA 4PJOA 3CCMT 4HCBA 3J81E 3BDLA 4QVCA 2XICA 2NLUA 2RJEA 2HD0A 1U1TA 3FRNA 4FU6A 2E41A 5GAMf 3OYMA 3L2QA 4BDYA 4BDZA 2EIFA 5GANf 4M77D 4R55A 3OYEA 1JB0E 4HCCA 4PJOC 4KBMB 5FRNA 1D3BA 4M7DE 5HY6A 5LJ3g 4M7AB 2K57A 3E9GA 2P0KA 3QO3A 4XTWA 5HKCA 3JB9G 1KC8C 1YJ9A 2OTJT 1K8AU 3AHUA 1YJ9T 5CCAA 3OYFA 3OYGA 1WJRA 4J6XA 4A4HA 4D6WA 3GP8A 1KG1A 4RCBA 4HA8A 5DY9A 4HKEA 4EMKB 1JBMA 2LT1A 1Q86C 3CCVA 2LTOA 3E19A 3CCVT 3M4GA 2KY9A 1Q7YU 3MEVA 3EFSA 3G6EA 5D6YA 2FYKA 2XHCA 2YRVA 3INZA 4FT2A 3OBWA 5GAMj 2E6ZA 2F69A 1U1SA 5J26A 1W4SA 5GAN7 4M78E 4BE2A 5GANj 2DKGA 1ZBXA 4OB1B 5I2MA 4J6YA 3GPLA 5C0MA 3CC7A 1YIJA 1K9MU 3HHTB 3LX7A 3O8VA 5D6XA 1YJWA 4Y91A 5KE3A 1YJWT 3TU4K 4B9XA 4F7UE 3DKMA 2RJCA 3OYBA 5GMKj 2VXFA 1Y96B 2DTIA 5A0LA 2FHDA 3LW5E 3PGGA 1X75C 4M75E 1JJ2A 2B8AA 3M58A 3KUFA 3JCMe 2RH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKO A;  3OYJ A;  2R58 A;  4PLI A;  2DIG A;  3S3M A;  3L2V A;  3ME9 A;  4IUT A;  4BD3 A;  4C5G A;  3M9Q A;  2LRQ A;  2E6N A;  3OA6 A;  4Q5W A;  3NTH A;  2HQE A;  4ZTF A;  3MP6 A;  4IKF A;  3PMT A;  2RHI A;  2X35 A;  3DB3 A;  2RHU A;  3GOX A;  2PQW A;  3QBY A;  5J39 A;  2JTF A;  2EQK A;  2RI3 A;  5D6W A;  5KCO A;  2GFA A;  4IUP A;  1OZ3 A;  4IUQ A;  3FDR A;  5FRM A;  2M0O A;  3LGL A;  2XDP A;  3DLM A;  3LYI A;  4PL6 A;  3S6W A;  1OYX A;  4QVZ A;  2MWP A;  2K3Y A;  3SD4 A;  4IUR A;  2GFU A;  2RI2 A;  2XK0 A;  2IG0 A;  2RHY A;  4GY5 A;  2E5Q A;  1OZ2 A;  3L42 A;  3L2U A;  2WAC A;  3Q1J A;  4C5E A;  4E7H A;  5M9O A;  1WJQ A;  2EFI A;  3CEY A;  5C6S A;  1N27 A;  2HQX A;  2LCC A;  3QII A;  3ZEH A;  1OI1 A;  4E7I A;  1WGS A;  2DAQ A;  3OYA A;  4II1 A;  2M16 A;  3PFS A;  2QQS A;  3C4S A;  3OB9 A;  3F70 A;  2RJF A;  3OYD A;  4LD6 A;  2RI5 A;  3H8Z A;  3P8H A;  4Z02 A;  3S3N A;  3QKJ A;  4C5I A;  4E7K A;  3MP8 A;  2BUD A;  4E7L A;  2VYT A;  3NTK A;  3OYN A;  2O4X B;  3L2W A;  3MEU A;  3UT1 A;  3L2R A;  4FL6 A;  2QQR A;  5KE2 A;  3LGF A;  4A4E A;  2BIV A;  3QJ6 A;  1MHN A;  3LLR A;  5CIU A;  3OS1 A;  3OS2 A;  3OYC A;  3MET A;  3OQ5 A;  4L59 A;  2GF7 A;  2MWO A;  2X4X A;  3OY9 A;  3NTI A;  1RI0 A;  2D9T A;  3OMC A;  3MEW A;  2RJD A;  4RG2 A;  2F5K A;  4C5H A;  3OYI A;  3S3O A;  4BAC A;  3BDL A;  3OYM A;  2NLU A;  2RJE A;  4FU6 A;  4N4G A;  3L2Q A;  2EQM A;  2L3R A;  4IUU A;  4BDZ A;  4BDY A;  3OYE A;  1SSF A;  2LVM A;  3ASK A;  2G3R A;  3OYH A;  5FRN A;  3OYL A;  1XNI A;  4QQ6 A;  3E9G A;  2P0K A;  4N4H A;  2BKD N;  4IUV A;  1WJS A;  3LH0 A;  4PLL A;  2DIQ A;  2L8D A;  3OYF A;  3EAE A;  3OYG A;  1WJR A;  2JZ2 A;  3PMI A;  4A4H A;  5IAY A;  5KH6 A;  4ZTJ A;  1G5V A;  4B9W A;  4BE0 A;  2O4X A;  4QQG A;  4NS5 A;  5IN1 A;  2LTO A;  2R57 A;  4QQD A;  5KCH A;  1H3Z A;  2RHX A;  2X4W A;  1KHC A;  2LDM A;  3MEV A;  3PNW C;  4UC4 A;  4A4G A;  2EQJ A;  5D6Y A;  2EQU A;  3H6Z A;  2K3X A;  2RHZ A;  2CKK A;  2YRV A;  2R5M A;  4BE1 A;  3DB4 A;  4BE2 A;  2L89 A;  5J26 A;  4A4F A;  4EDU A;  3MO8 A;  4OVA A;  3FLG A;  4QW2 A;  2R5A A;  3UWN A;  3FC3 A;  5C0M A;  3O8V A;  3LX7 A;  4X34 A;  5D6X A;  3OMG A;  4E7J A;  3MP1 A;  2RO0 A;  3MEA A;  5KE3 A;  2M1H A;  3E9F A;  4B9X A;  2RJC A;  2X4Y A;  5FRO A;  3OS0 A;  3P8D A;  2FHD A;  3FEO A;  4HCZ A;  4CRI A;  2B8A A;  3OYB A;  3KUF A;  3OYK A;  4N4I A; 
#chains in the Genus database with same CATH topology
 2MK5 A;  1W2B S;  2LJ1 A;  4BD3 A;  1AHJ B;  2LRQ A;  4J5Y A;  2HQE A;  5CO7 A;  2LX7 A;  2RI3 A;  2EQK A;  4KUD K;  4BI4 A;  1NPR A;  2HKN A;  3V8J A;  1K9M C;  1Q82 R;  1UGP B;  2E3I A;  2JNG A;  2E5Q A;  3GBQ A;  5L23 A;  1QVG A;  4RUG A;  2KVQ G;  4IIM A;  3CCJ T;  4E7I A;  3QII A;  3JCM f;  2JTM A;  2AHJ B;  1OI1 A;  5GAN g;  1X6G A;  1M3B A;  3M0Q A;  3MP8 A;  2KE9 A;  1TH7 A;  1YNZ A;  3H0H A;  1YJN A;  3QJ6 A;  1YIT A;  2EVR A;  2P0P A;  4J9B A;  4J9G A;  1YHQ Q;  1X2Q A;  3H9N A;  2RD1 A;  1NYG A;  1X01 A;  3I56 Q;  5LJ5 h;  1PKS A;  2F2V A;  1FXX A;  2RF0 A;  3VS3 A;  3RBB B;  4MML A;  1VQ5 Q;  3EGU A;  1I4K 1;  1KHI A;  2E10 A;  2EYW A;  4N4H A;  4C0Z A;  2YRD A;  4BY6 C;  2CRE A;  4R0K A;  5LJ3 h;  2KK4 A;  2DIQ A;  2HEQ A;  2NUP B;  2DZ9 A;  1M1K R;  3EFO B;  3M55 A;  2JZ2 A;  1YWO A;  1TOV A;  2DE0 X;  2MIO A;  2R57 A;  4O6J A;  2WSF E;  1RAE B;  5GAN d;  1S72 T;  2F2X A;  3RKY A;  2DTO A;  4M78 B;  4BE1 A;  1WQW A;  3BDU A;  1VQ7 T;  5FWB A;  1UUE A;  4XTU A;  1BYM A;  7AT1 B;  1KJW A;  1TUC A;  1G2B A;  1PCX A;  5FRO A;  3QUI A;  3GIB A;  2BE7 D;  1HJD A;  4OMF B;  2E5K A;  2NUP A;  5GAN 6;  4IUT A;  3V7S A;  3EFO A;  3X28 B;  4PJL A;  1HYO A;  4V2S A;  2DM1 A;  3QWX X;  1UHC A;  3NTH A;  1M1F A;  2E70 A;  3C94 A;  3PMT A;  2RHU A;  2A7Y A;  2PQW A;  1K73 C;  1M3C A;  2YHT A;  2AKL A;  2LX9 A;  4M78 A;  2JM8 A;  3CME T;  2CH4 A;  3SD4 A;  1R77 A;  3VS1 A;  4MZP A;  1A0N B;  1UE9 A;  1OZ2 A;  4Y92 A;  3U23 A;  2JJ9 A;  4C5E A;  1IRX A;  4QVD A;  2QQA A;  1M9S A;  3FB9 A;  4II1 A;  1U5S A;  2QAS A;  2DVJ A;  5GAN 8;  1J3T A;  1VQO T;  2QI2 A;  4NL3 A;  2FB7 A;  2VWF A;  1UTI A;  1JJ2 S;  4M77 E;  1AOJ A;  4OF1 A;  3L2R A;  2YSQ A;  5KE2 A;  1T0H A;  1YI2 T;  1C0M A;  1E6H A;  2VGN A;  1KIK A;  2D0N A;  4BI8 B;  2C0O A;  4M7D G;  1NM7 A;  4BY6 B;  2PTK A;  2NYS A;  4LDU A;  4IUU A;  2DL3 A;  5GJW B;  3PIO A;  1XNI A;  4EIK A;  3JCM b;  5GAO p;  2BKD N;  5I21 A;  2CYZ B;  2L8D A;  2L3P A;  2D0Q B;  5KH6 A;  1AWO A;  2DIL A;  1KK7 A;  2RM4 A;  3R6N A;  3KBG A;  2M51 A;  2PU9 B;  2ZCF B;  2X4W A;  1K0S A;  1NLO C;  2DD5 A;  1BI3 A;  2W10 A;  3VS4 A;  3VV0 A;  3JCM W;  3QSU A;  3JCM V;  1P92 A;  3FLG A;  4FSS A;  3EGX B;  3CD6 A;  1G3S A;  3HPW A;  1UGQ B;  1S72 Q;  3X24 B;  1PD1 A;  2ZGW A;  2KR3 A;  2K9G A;  3OA6 A;  1K73 U;  2IIM A;  1RAB B;  1YFN A;  1M90 C;  3CBM A;  1RAI B;  1MND A;  1BCO A;  1PSF A;  2A36 A;  2OI3 A;  3VYG A;  4QVZ A;  4KGV B;  3M0T A;  2HKQ B;  2RI2 A;  3EGX A;  2FRW A;  3HRT A;  4KT0 E;  4PJO E;  2DRK A;  1VQM A;  1WJQ A;  8ATC B;  2LCC A;  4XU1 A;  2V1Q A;  2ZPG B;  2LQW A;  3CCR T;  1T0J A;  2LJ3 A;  3CPW P;  1CKA A;  2BUD A;  4RTV A;  2ROT A;  1VUB A;  3NMZ C;  3CCL Q;  1ZQ1 A;  4RTW A;  1GL5 A;  4JRK A;  2H3J A;  1VQ4 A;  1VQO Q;  3QDF A;  2X4X A;  3VUZ A;  1RI0 A;  1ARK A;  4J9D A;  2XI9 A;  2CZ7 B;  1DJ7 B;  3G6E T;  3EGD B;  1SSF A;  1YI2 Q;  2G3R A;  2HBW A;  1W2B A;  2BE9 B;  1YIJ T;  4QQ6 A;  1NJI R;  3G4S T;  2RNA A;  4C8Q G;  3LH0 A;  2O9S A;  2CUD A;  2DK3 A;  2KYB A;  3I35 A;  3RMQ A;  2OAU A;  2OAW A;  1H3Z A;  1UB4 A;  1LOJ A;  3E1S A;  1MV0 B;  3N5B B;  3CC2 A;  3A8G B;  2MOX A;  3H41 A;  5AYF A;  1JRI A;  2XKO C;  1C1A A;  1WDX A;  3M0R A;  3DB4 A;  4RG8 A;  2R5A A;  4ZGE B;  3OSV A;  2V8K A;  1RAG B;  1UHF A;  3EGD A;  4E7J A;  3MEA A;  4J6W A;  1WHK A;  3RER A;  4C92 B;  1NG2 A;  1K0X A;  2EWN A;  2ZAE A;  1Q7Y R;  5A2Q E;  2QTV A;  1M90 U;  4Q5W A;  5FW9 A;  4PFO A;  4M7D D;  2GBQ A;  2FZK B;  4VUB A;  3LYI A;  2JS0 A;  2MWP A;  1VOM A;  1QVF P;  1VQ9 T;  3A8L B;  3PTA A;  1QWF A;  1OPK A;  3HFN A;  5GAM e;  3V7C A;  3G71 Q;  5CQX A;  3JSC A;  3HKS A;  4M7A G;  1HXD A;  2KMT A;  3F70 A;  3I5S A;  5CAI A;  3P8H A;  3CXC S;  2COW A;  5GMK e;  3TQ7 P;  4C8Q C;  4JLI A;  4RTX A;  2QA4 T;  4LDW A;  4M75 D;  1MHN A;  3CCU A;  3OS1 A;  3CPW A;  4JJN K;  2JOY A;  2PUK B;  5LJ5 g;  2RQR A;  4JS5 A;  3CCM A;  1JO8 A;  4DBR A;  1M90 R;  2DMO A;  3BDL A;  2E41 A;  1YJ9 Q;  3KFV A;  2EIF A;  2EKH A;  2COY A;  2E4H A;  4M7D E;  1TUD A;  5LJ3 g;  2COZ A;  2K57 A;  1KC8 C;  3OYF A;  3OYG A;  1WJR A;  4D6W A;  1KG1 A;  3G6E Q;  1Q86 C;  3CCV A;  1MMG A;  3EH1 A;  3M4G A;  2KY9 A;  2QAZ A;  1YIJ Q;  2V1R A;  3HTR A;  2FPE A;  5J26 A;  1W4S A;  5GAN j;  6AT1 B;  3FJ5 A;  4J9E A;  4OB1 B;  1D0X A;  4J6Y A;  3CC7 A;  5C0M A;  4AFQ C;  1VYV A;  1YJW T;  4F7U E;  3DKM A;  2GTJ A;  1Y96 B;  4DEX A;  3PGG A;  3LW5 E;  1JJ2 A;  2DJQ A;  4HVV A;  4M75 E;  4FW1 A;  3KUF A;  3JCM e;  2X9H A;  2RH2 A;  4J8O A;  4DOW A;  4A63 B;  4M7A C;  2K3B A;  1Q82 C;  4KH0 B;  2DPP B;  2L3S A;  2O2O A;  2FPF A;  1Y0M A;  2PZ1 A;  2K2M A;  3DB3 A;  4EMK C;  5KCO A;  2FZG B;  2KBT A;  5GMK l;  2HL5 C;  2ENM A;  3EG3 A;  4OB2 B;  2LNH B;  3M59 A;  2DEQ A;  1FMW A;  1HD3 A;  2PVD B;  4AMC A;  1XQH A;  1ABQ A;  3CCJ A;  4C8Q D;  3QWY A;  3CEY A;  1BCM A;  2K5I A;  3PFS A;  2EGE A;  5GJV B;  4FYW B;  3TEE A;  4M7D F;  1TXQ A;  1VQ9 Q;  3FJP A;  2O4X B;  3I55 Q;  3UT1 A;  3KXT A;  3RUX A;  2DNU A;  1VQ6 Q;  3CCE T;  5CIU A;  4M78 G;  1XJW B;  2VGM A;  3OS2 A;  4XAX B;  1BKB A;  1AZE A;  4CC4 B;  3BFM A;  2GF7 A;  2GNC A;  1M1K C;  1PRL C;  3VS2 A;  3A5Z B;  2CP3 A;  3JCM Q;  2X51 A;  1KC8 U;  2P0Q A;  2QA4 Q;  2LNV A;  3URG A;  5LL6 S;  1I0C A;  1LCK A;  3I56 T;  2EPD A;  1Q86 U;  1WHG A;  4WCI A;  1NEB A;  1O9S A;  3OSS C;  1VQ5 T;  1D0Y A;  4M75 F;  4BE0 A;  2GQI A;  1VQP T;  2O4X A;  4FYX B;  2ATC B;  2KQW A;  5GAO m;  2A08 A;  4C8Q E;  2GTO A;  2EQJ A;  3OW2 P;  3SEM A;  4D8K A;  4ZN3 A;  2AK5 A;  2PVG B;  4AG2 C;  2GQV A;  1VQ7 A;  2EGC A;  2KRS A;  3CC4 Q;  2AKK A;  2J6K A;  2OTJ A;  1G3T A;  2M1H A;  2X4Y A;  4JLG A;  1G3W A;  5FLX E;  1Y07 A;  4HCZ A;  3WVE B;  1Q82 U;  4N4I A;  4AFZ C;  4PFZ A;  2DER A;  1TG0 A;  5IHK A;  1G3Y A;  1M4Z A;  1YN8 A;  3C95 A;  4FSX A;  2CS7 A;  2HL3 A;  1RAF B;  1SRM A;  3CPF A;  1AWJ A;  3M0S A;  3CCQ T;  5CQY A;  1FMK A;  3NFC A;  4FYY B;  3VRZ A;  3VS7 A;  3LGL A;  3S6W A;  3VS6 A;  3CME A;  1Q86 R;  1RAC B;  3CMA T;  3EG2 A;  4M78 C;  2GFU A;  1Y7X A;  2YLC A;  3JAM E;  2RQV A;  4M7A A;  2EAY A;  2DXB A;  3NHN A;  1QCN A;  4FM4 B;  1WZO A;  2DAQ A;  2H8H A;  2XDD A;  4EMK A;  5GAM h;  3X20 B;  2RMO A;  2QXF A;  2DD4 A;  5GAN 5;  2JVV A;  2QQB A;  2ZPB B;  2O9V A;  1HSQ A;  2VKN A;  2I2L A;  1QQJ A;  1VQ8 T;  2FL7 A;  5GMK h;  4A4E A;  1BB9 A;  1ZHI A;  2VAS A;  1M1K U;  3OYC A;  2AZS A;  3TRE A;  1Q81 R;  1VQL T;  3OQ5 A;  4L59 A;  4E7Z A;  1OPL A;  3RR6 A;  1QCF A;  3X25 B;  3OYI A;  4J83 A;  4C8Q F;  3QPH A;  2EQM A;  1IO6 A;  1EZZ B;  1X69 A;  2LVM A;  3OYH A;  1YWP A;  3CCE Q;  2KT1 A;  4DOV A;  4ORZ A;  1B3Q A;  2M9U A;  1ZLM A;  1G5V A;  4ZTJ A;  3NPF A;  3LH5 A;  2QK0 A;  1F1B B;  3D7S B;  4QQD A;  2J7I A;  1YCY A;  2LDM A;  1K76 A;  2M0Y A;  2HQH A;  2RHZ A;  5IHI A;  1RI9 A;  5CKF A;  2VB6 A;  1KFZ A;  1UGR B;  4E7S A;  2FVU A;  4PFP A;  1VQP Q;  1ZUK A;  2CP0 A;  2V8I A;  1WHH A;  3M54 A;  3CCS T;  2HNI A;  8AT1 B;  4N0A C;  3CXC A;  2YUQ A;  1TWB A;  1RL2 A;  2NWM A;  3OYJ A;  5CK9 A;  4JRQ A;  1B34 B;  2EJG A;  3JCM h;  1TU0 B;  4M78 D;  1OX8 A;  2CT4 A;  2X35 A;  3AT1 B;  2JTF A;  2YRC A;  3FDR A;  3CPW S;  3G7Z A;  1GBQ A;  4B6M A;  4JZ4 A;  1R0C B;  1GFD A;  2LQN A;  4D8D A;  1OQK A;  4OGE A;  2AIR B;  2EJ9 A;  2OTL T;  1N6A A;  3QZ9 B;  3CCQ Q;  1NPP A;  4JDS A;  3JCM P;  3ZEH A;  2EYZ A;  1WGS A;  3CCR A;  2KRO A;  4HVU A;  3OYA A;  3C4S A;  2RQW A;  1W70 A;  4M77 B;  2CH4 W;  3CMA Q;  3TVT A;  4JZ3 A;  1B34 A;  2EJF A;  4X9D A;  4HCK A;  4E7L A;  2IVW A;  2K5L A;  4LE9 A;  3LWI A;  4A54 A;  1RAH B;  2DFU A;  1VQK Q;  1KD1 U;  1G83 A;  1M3A A;  3GF5 A;  3H0I A;  1NJI C;  4DEY A;  2QEX A;  4XTX A;  5A0G A;  3HL8 A;  1IXD A;  1VQN A;  4EMG A;  4ZN1 A;  1OU8 A;  3CCL T;  2Z0W A;  4N4G A;  1VQ8 Q;  5HK3 A;  4LDV A;  1BIB A;  1WPY A;  4C92 G;  2C0I A;  3QXE B;  3G4S A;  1VQL Q;  1UG1 A;  1UDL A;  4M77 A;  4GLK A;  4PLL A;  2RK2 A;  2EYX A;  3HRU A;  2RK1 A;  1IRE B;  4JRP A;  1K8A C;  2DX1 A;  3CBP A;  4TVR A;  4NS5 A;  2QGF B;  5CKD A;  2XG8 D;  1AD5 A;  3PVL A;  1YCS B;  3JV3 A;  4CC2 A;  1Q7Y C;  2ESW A;  4ELY C;  3FC3 A;  3TSW A;  4FW2 A;  3UWN A;  2JM9 A;  4MZT A;  3A8M B;  4LN2 A;  1N5Z A;  3MP1 A;  1QP3 A;  2A0F B;  1M8V A;  1KD1 R;  1SKU B;  1QVF S;  2YXY A;  1WLP B;  3BY7 A;  3S3M A;  3ME9 A;  1AWW A;  5LJ5 j;  3CCS Q;  2E65 A;  2BZY A;  2CP6 A;  4N0A A;  1D1C A;  1QCO A;  5LJ3 j;  4MMK A;  2YUN A;  4PJO B;  2J06 A;  2SRC A;  1WXU A;  2DBK A;  3L2U A;  2LJ0 A;  1KQS P;  4J7F A;  1I81 A;  3EG1 A;  5KYW B;  4M78 F;  4C92 C;  2XMF A;  4DBQ A;  1T3L A;  4E7K A;  3G71 T;  4XQ3 A;  2OTL Q;  2ZPH B;  3EHQ A;  3EFR A;  1NJI U;  3WXM B;  3THK A;  3M0P A;  5CKB A;  2BIV A;  4KUL A;  1M27 C;  3LLR A;  3QYG B;  4MDW A;  2KNB B;  4RTZ A;  3JRZ A;  1MGQ A;  4PJO A;  2RN8 A;  2XIC A;  2HD0 A;  2KT8 A;  2K7A A;  5GAN f;  3OYE A;  5KYN A;  1WIE A;  5IHN A;  5FRN A;  3CQT A;  1SRL A;  1K8A U;  1YJ9 T;  1SHG A;  4A4H A;  4HA8 A;  1X43 A;  2LT1 A;  3UF4 A;  1NEG A;  2LTO A;  1MV3 A;  2J6O A;  1Q7Y U;  2HMA A;  1B07 A;  2CDT A;  1I07 A;  3I9Q A;  5D6Y A;  1D0Z A;  1U1S A;  4BE2 A;  4CC7 A;  2DKG A;  1ZBX A;  4ESR A;  5I2M A;  3HHT B;  3LX7 A;  3O8V A;  4QKU A;  1YJW A;  4IIO A;  5EC7 A;  3A98 A;  2DTI A;  5A0L A;  3M58 A;  1GCP A;  2I0N A;  3L2Z A;  2Y4X A;  3RKX A;  1N8R U;  3M9Q A;  5HCK A;  1ZSZ C;  2ZPE B;  3OBY A;  4PNO A;  4ELZ C;  2P4R A;  5D6W A;  1H64 1;  1JEG A;  2M0O A;  5I2S A;  1K8A R;  5GMK m;  5KYU B;  1I8F A;  4PJJ A;  4C92 D;  2IG0 A;  2RHY A;  3BW1 A;  2KDS A;  3L42 A;  3Q1J A;  4NL2 A;  3REB B;  2KGT A;  2DL7 A;  1ZA2 B;  5C6S A;  5GAM g;  1ZUY A;  1Y57 A;  2LCL A;  2HBP A;  1PD0 A;  1KQ1 A;  2DXU A;  3VS0 A;  2LC4 A;  4OP0 A;  1YJN Q;  2JN0 A;  3MCA B;  2CZ0 B;  1YIT Q;  4JUV A;  1PHT A;  5FWC A;  5GAN 4;  4KH1 B;  2Y4Y A;  3UA7 A;  3DLL A;  2F1L A;  4FL6 A;  4BB7 A;  2KSS A;  1LPL A;  3SDZ A;  3PE0 A;  2M02 A;  3VKI A;  3I55 T;  5KYU A;  2C06 A;  1N8R R;  2RJD A;  4RG2 A;  4A53 A;  4C92 A;  3P8B B;  1M30 A;  1I5O B;  1VQ6 T;  3GNF B;  2FZC B;  3OW2 S;  1YHQ A;  3J7A F;  3RMS A;  3TCJ A;  4BUG A;  4F16 A;  3I56 A;  1R0B G;  1C6V X;  3CD6 T;  2DYB A;  1V29 B;  1VQ5 A;  3JB9 J;  3JCM X;  1FMV A;  3E2U A;  1SEM A;  3OYY A;  1YBY A;  4QQG A;  2F2W A;  1W6X A;  3SFM A;  5J3B A;  4L5G A;  3OS5 A;  2Y90 A;  1H8K A;  2K3X A;  2R5M A;  3VJP A;  4OVA A;  4QW2 A;  9ATC B;  4E2F B;  2YDL A;  4F7U B;  2CSQ A;  1XOV A;  1ZSZ B;  4HT8 A;  1WXT A;  1QWE A;  2OJ2 A;  1YP5 A;  3CC4 T;  5IN1 A;  2EKO A;  3JCM g;  1RLQ C;  2GCX A;  2R58 A;  4RMO A;  4XU3 A;  2C0T A;  4F17 A;  5GMK i;  3H0F A;  5DLO A;  4KGZ B;  1EIF A;  2CSI A;  4F7U A;  2BTT A;  4GY5 A;  2LMJ A;  1ZSZ A;  5LJ5 d;  1ACM B;  2ED0 A;  2DTH A;  4J9C A;  2A37 A;  1Q81 C;  2NUT B;  5GAO r;  4AFU C;  5DM7 R;  3OB9 A;  4GBQ A;  2EQI A;  1AVZ C;  5LJ3 d;  3JB9 I;  3GLX A;  5CVI A;  4CC3 A;  4FYV B;  3OYN A;  2ZZD A;  2QYZ A;  1WNL A;  2LZ6 B;  1UJY A;  3UA6 A;  1JQQ A;  1PWT A;  1IHV A;  3CC2 T;  2D9T A;  4WTO B;  2F5K A;  4NOY A;  4KGX B;  2ED1 A;  1Y96 A;  3VRY A;  1QVF A;  2MI6 A;  1GXI E;  3ASK A;  4ZGD B;  2WSE E;  3ZFJ A;  2NUT A;  1IGQ A;  4IUV A;  2V26 A;  2DF6 A;  3UPU A;  2B86 A;  3PMI A;  5IAY A;  4LUD A;  3SB2 A;  2PUO B;  4RTY A;  4XU2 A;  1BI2 A;  1KHC A;  1IHW A;  2V8J A;  1WHL A;  2EYY A;  2MF2 A;  3CD6 Q;  2L89 A;  4EDU A;  3MO8 A;  2MCN A;  2RPN A;  3V8L A;  1QVG P;  2DO3 A;  4PJM A;  1SHF A;  3M0U A;  4Y28 E;  4CI0 C;  3QHS A;  2LP5 A;  1E7O A;  4AG1 C;  4ME7 A;  3MPU B;  3NGP A;  3FEO A;  4LUE A;  4M77 G;  2FRY A;  2CP7 A;  3L2V A;  4WF2 A;  1S72 A;  3C12 A;  4OMP A;  2QDL A;  1WYX A;  3MP6 A;  4EPC A;  1U8R A;  2RHI A;  4XTV A;  4DQ2 A;  1QLY A;  5D7U A;  4LXC A;  3HP9 A;  2LQK A;  4IUQ A;  5IXF A;  5FRM A;  1D1B A;  1NE8 A;  4PL6 A;  3UDC A;  2L3Q A;  1NYF A;  3M57 A;  4M7A D;  1VQM Q;  4A4K A;  3CCU T;  2X3X D;  3JB9 H;  1Q81 U;  2DL5 A;  2EFI A;  4HT9 A;  1GBR A;  1MUZ A;  4DA4 A;  5IT9 E;  4JS4 A;  4C0D B;  2KRN A;  1QP2 A;  2ABL A;  3HRS A;  3H8Z A;  3IQL A;  2XDB A;  3QKJ A;  1I1J A;  1TUG B;  1VQ4 Q;  4LDX A;  1U3O A;  5I22 A;  1XTD A;  4L6V 5;  2K2V A;  3LGF A;  2E12 A;  2ECZ A;  2DET A;  5HK0 A;  3MET A;  4XK8 E;  1RAA B;  2CP5 A;  4OMO A;  3CCL A;  4C5H A;  2A3L A;  1VQK T;  2AZV A;  2IPO B;  1H3H A;  1VQO A;  1UEC A;  2DXT A;  3T9N A;  3CC7 T;  1WJS A;  3CC2 Q;  3G1J A;  4M7A E;  1YI2 A;  4M77 C;  3QZ5 B;  4B9W A;  2FPD A;  1AWX A;  1X2K A;  2X3W D;  1KD1 C;  2HZY A;  3MKD A;  3M53 A;  3PNW C;  5LJ5 f;  4AT1 B;  1VYU A;  3UAT A;  2CKK A;  3RKW A;  3WVD B;  4PJO G;  2YUP A;  4OB3 B;  1MMD A;  1SSH A;  4JPB W;  1T3S A;  5LJ3 f;  3OS0 A;  2K6D A;  3P8D A;  1K9A A;  4FCY A;  3C0C A;  4C5G A;  1KQS S;  1AEY A;  2E3H A;  4FT4 A;  3GOX A;  1WX6 A;  2ZPF B;  2GFA A;  1OZ3 A;  5KYX B;  2XDP A;  1WHJ A;  1OYX A;  1OU9 A;  3BE3 A;  3OW2 A;  1VIE A;  1MMN A;  2D8J A;  3X26 B;  2JUF A;  3RNJ A;  2X4J A;  2HAX A;  4E7H A;  1UEB A;  5GAN e;  1G8X A;  2QQS A;  1M2V B;  2MMP A;  3A8O B;  4OMN A;  1LNX A;  2EYQ A;  2VXE A;  3G71 A;  1LJO A;  3CCU Q;  1RLP C;  1BI0 A;  3MEU A;  4M7A F;  3CCM Q;  5KYX A;  1O75 A;  5GAO l;  1IZ6 A;  2DRM A;  1WXB A;  4KUI A;  3OMC A;  2L2P A;  1K4U S;  1SG5 A;  2NLU A;  3EHR A;  1U1T A;  4K11 A;  4BDY A;  4PJO C;  4M77 D;  4HCC A;  4KBM B;  5HY6 A;  3E9G A;  3JB9 G;  2P0K A;  5HKC A;  3CCV Q;  1M2V A;  1YJ9 A;  2OTJ T;  3AHU A;  1V1C A;  1PKT A;  2JS2 A;  4HKE A;  2MPX C;  1AZG B;  1ZA1 B;  1IB8 A;  1S1N A;  2J6F A;  3CC7 Q;  3G6E A;  1X27 A;  2XHC A;  3INZ A;  4FT2 A;  3OBW A;  5GAM j;  5GAN 7;  4M78 E;  1RAD B;  1AT1 B;  1YIJ A;  1ZBJ A;  1K9M U;  5D6X A;  1WA7 A;  4Y91 A;  5KE3 A;  1RUW A;  3TU4 K;  1ABO A;  4B9X A;  5GMK j;  2VXF A;  4Z88 A;  2B8A A;  1QKX A;  5EG2 A;  2QDY B;  5FU6 C;  4HVW A;  3M5A A;  2KXC A;  3CBO A;  4RTU A;  2K5F A;  2FG0 A;  2DXC A;  4C0F A;  2MAM A;  3CCJ Q;  4IUR A;  2XK0 A;  1ZUU A;  2P4T A;  1BU1 A;  3RES A;  1W2B P;  4X9C A;  2K4Y A;  2F5T X;  2PVO B;  2HDA A;  2HQX A;  4J9I A;  2RJF A;  3HFO A;  1N8R C;  5IH2 A;  1D1A A;  1K9M R;  2O88 A;  2EW3 A;  1YJN T;  1YIT T;  4Z89 A;  4PJO D;  1QMC A;  1VQ9 A;  3REA B;  1TSF A;  2P84 A;  4E47 A;  3I55 A;  1TS9 A;  3NTI A;  3RDV A;  1V76 A;  2JT4 A;  2CT3 A;  1VQ6 A;  4F7U G;  3S3O A;  4BAC A;  2HSE B;  2EGA A;  4M75 G;  4OB0 B;  2H3E B;  3QDR B;  1Z9Z A;  3I5R A;  2DYI A;  2DL8 A;  2LCS A;  5GAO q;  2QA4 A;  1FX7 A;  3EAE A;  3MHX A;  1B7T A;  1M5Q 1;  2O31 A;  2YT6 A;  2LT4 A;  2YLB A;  1CSK A;  2RHX A;  1VQ7 Q;  4UC4 A;  4LDY A;  3TSZ A;  2EQU A;  2O01 E;  1OUL A;  2GGR A;  2VUB A;  2DEU A;  2OTJ Q;  2QTX A;  2DZC A;  4M77 F;  2QG9 B;  4OMM A;  2KRM A;  5FU6 B;  5GAN 3;  5A0D A;  3EH2 A;  3OMG A;  2BZX A;  3M56 A;  1Z9Q A;  3EG9 B;  1NZ9 A;  5KYW A;  2DJZ A;  3CC4 A;  1X6B A;  2FEI A;  2ROL A;  4CRI A;  4M7D C;  1Y71 A;  2KYM A;  3V7R A;  3FIF A;  3M4Y A;  1JU5 C;  2JW4 A;  1KQ2 A;  3JCM J;  2YUO A;  3HSB A;  2RB6 A;  3CME Q;  4OGC A;  1BI1 A;  5J39 A;  1HK9 A;  3VU3 C;  1N9R A;  2BZ8 A;  1FYN A;  2DA9 A;  5DLQ E;  2QEX T;  2WAC A;  4DBH A;  3JB9 D;  2WSC E;  3EG9 A;  1VQN T;  1K73 R;  1N27 A;  2QQ9 A;  3VS5 A;  1NLP C;  4M75 C;  2M16 A;  1UFF A;  2D6F A;  5GAN h;  4Z02 A;  4OMQ A;  2KXD A;  1PRM C;  2CZ1 B;  4P5N A;  2RQU A;  1ZX6 A;  1IGU A;  1GCQ C;  2CP2 A;  2CZ6 B;  2VVK A;  4YTL A;  4DBF A;  2MWO A;  3MEW A;  4JJC A;  4ATO A;  2MYS A;  3MJX A;  4OML A;  3VYH B;  2L3R A;  1JXM A;  4HXJ A;  1JJ2 P;  1R8O B;  1X6O A;  3PT9 A;  1CKB A;  2VV5 A;  4MDX A;  2KAF A;  3OYL A;  2XID A;  4JRI A;  4KRT A;  1KQS A;  1QVG S;  1QVP A;  1SPK A;  4R56 A;  3SHW A;  3JCM c;  2DVE A;  4LD9 K;  1EFN A;  2L5Q A;  3CCE A;  1WHM A;  4PJO F;  1GRI A;  4J9F A;  1PNJ A;  4X1V A;  5KCH A;  4PK4 A;  5FU7 C;  4RCC A;  2VC8 A;  3H6Z A;  1W1F A;  1WQ7 A;  4M7D B;  2JMC A;  3ZL7 C;  1D09 B;  4RTT A;  2D1X A;  4PKC C;  3ER0 A;  4X34 A;  3SWN C;  1MMA A;  2JMA A;  2XU8 A;  2PNI A;  3A1P A;  1OX9 A;  3ZBD A;  4C0G A;  3OYK A;  1VQP A;  4C92 E;  4J7I A;  1QW1 A;  4PLI A;  1NBE B;  5GAM d;  5GAO n;  1M1G A;  2E6N A;  2RA2 A;  4F14 A;  4XTZ A;  4ZTF A;  1VA7 A;  4IKF A;  5L8R E;  3PIP A;  5KYY B;  3A8H B;  1TTH B;  4IUP A;  3DLM A;  3O5Z A;  2W0Z A;  4M75 B;  1PC0 A;  1BIA A;  4M7D A;  4E6R A;  3CCR Q;  4M4Z A;  2KEA A;  1OV3 A;  1VQM T;  2CUB A;  5ECA A;  4AFS C;  1M8M A;  3CCQ A;  3OYD A;  2RI5 A;  3S3N A;  4C5I A;  2DBM A;  2VYT A;  2QEX Q;  4MZM A;  3CMA A;  2KI7 A;  1VQN Q;  1M2O A;  5KYY A;  2FO0 A;  5CKH A;  4ZGJ B;  5LJ5 e;  1VQ4 T;  3JB9 F;  4M75 A;  1UGS B;  1VQK A;  4EMH A;  2A28 A;  2LQ8 A;  3G4S Q;  4FIB A;  1SF9 A;  3QG1 A;  2E1H A;  4O5V A;  5LJ3 e;  1PSE A;  2RQT A;  5FU7 B;  4LNP A;  1VQ8 A;  2XD0 A;  4ZNX A;  1I5L A;  2NUZ A;  1GCQ A;  3QJY A;  3V8K A;  4C0D C;  1VIF A;  4C92 F;  3JCM d;  1VQL A;  1PM3 A;  3SWN B;  1QKW A;  5GAN 2;  3QYH B;  4A4G A;  2K79 A;  3J80 E;  5CKE A;  4A4F A;  1FWZ A;  1GFC A;  4J9H A;  4XU0 A;  3VUB A;  1PG5 B;  5AT1 B;  2RO0 A;  3E9F A;  1VYT A;  3L1A A;  3RIR A;  1H92 A;  4PJN A;  4XTY A;  2DL4 A;  3ULR B;  3R6O A;  4GLM A;  3L2W A;  4C8Q B;  1OEB A;  2DIG A;  5CR2 A;  4F04 B;  2E64 A;  1Q95 G;  2L0A A;  3SWN A;  3QBY A;  1E6G A;  4BI3 A;  1OOT A;  2CGH A;  2ZPI B;  3CCS A;  2K3Y A;  1BBZ A;  1LVK A;  5I11 A;  4QT7 A;  5M9O A;  1D3B B;  4RKU E;  1N9S A;  1YHQ T;  4C8Q A;  1BK2 A;  4LD6 A;  2OX7 A;  2JTE A;  4Z8A A;  2SEM A;  3GNG A;  3NTK A;  4F7U F;  2AT1 B;  2QQR A;  2QGG A;  2D8H A;  2JXB A;  1ZSG A;  2OTL A;  2HCK A;  3OY9 A;  2J05 A;  3LWH A;  2EBP A;  3CCM T;  4HCB A;  3J81 E;  4QVC A;  2HSP A;  3OYM A;  4FU6 A;  2RJE A;  3FRN A;  5GAM f;  3L2Q A;  3CXC P;  1U06 A;  4BDZ A;  4R55 A;  1JB0 E;  1D3B A;  1MNE A;  4M7A B;  3QO3 A;  4XTW A;  1UJ0 A;  1EX4 A;  4JJD A;  4ANJ A;  5CCA A;  2YWW A;  4J6X A;  1WI7 A;  3GP8 A;  4RCB A;  5DY9 A;  4EMK B;  1JBM A;  2G6F X;  3E19 A;  3CCV T;  1JXO A;  3EG0 A;  3MEV A;  3EFS A;  2FYK A;  1YJW Q;  1UGV A;  2YRV A;  3PVQ A;  1KC8 R;  1WFW A;  2E6Z A;  2F69 A;  1KSW A;  3GPL A;  1K1Z A;  2RJC A;  5IXB A;  2FHD A;  1X75 C;  2DLP A;  3OYB A;  4JJB A; 
#chains in the Genus database with same CATH homology
 3L2Z A;  2QDY B;  4J8O A;  5EG2 A;  5FU6 C;  2Y4X A;  1W2B S;  3RKX A;  4DOW A;  4BD3 A;  4M7A C;  1N8R U;  1Q82 C;  1AHJ B;  3M9Q A;  2LRQ A;  2DPP B;  4J5Y A;  3M5A A;  2ZPE B;  3OBY A;  4PNO A;  2HQE A;  3CBO A;  3DB3 A;  5CO7 A;  4ELZ C;  2K5F A;  4EMK C;  2RI3 A;  2EQK A;  5KCO A;  5D6W A;  1H64 1;  2DXC A;  4C0F A;  4KUD K;  2M0O A;  5GMK l;  5I2S A;  4BI4 A;  1NPR A;  5GMK m;  2MAM A;  1I8F A;  4OB2 B;  3V8J A;  3M59 A;  4IUR A;  1K9M C;  2DEQ A;  4C92 D;  1UGP B;  2XK0 A;  2IG0 A;  2JNG A;  2P4T A;  2RHY A;  2PVD B;  1XQH A;  2E5Q A;  2KDS A;  3BW1 A;  3L42 A;  3RES A;  3Q1J A;  4NL2 A;  4X9C A;  2K4Y A;  3CCJ A;  1QVG A;  2KVQ G;  4C8Q D;  3CEY A;  2F5T X;  5C6S A;  3CCJ T;  2PVO B;  5GAM g;  2HQX A;  3QII A;  2JTM A;  2AHJ B;  1OI1 A;  3JCM f;  4E7I A;  2LCL A;  5GAN g;  2K5I A;  2HBP A;  3PFS A;  2DXU A;  1KQ1 A;  2RJF A;  2LC4 A;  3HFO A;  4OP0 A;  1N8R C;  2JN0 A;  3MCA B;  2CZ0 B;  3TEE A;  4JUV A;  3MP8 A;  4M7D F;  5GAN 4;  3FJP A;  2O4X B;  2Y4Y A;  3DLL A;  3UT1 A;  4FL6 A;  3RUX A;  4BB7 A;  3KXT A;  2KSS A;  1YJN A;  1TH7 A;  3QJ6 A;  1YIT A;  3SDZ A;  1YJN T;  2P0P A;  1YIT T;  5CIU A;  3CCE T;  4M78 G;  3OS2 A;  2VGM A;  1VQ9 A;  4PJO D;  4XAX B;  3VKI A;  4E47 A;  3I55 A;  1BKB A;  3I55 T;  3BFM A;  2GF7 A;  2C06 A;  3NTI A;  1M1K C;  2RJD A;  4RG2 A;  4A53 A;  2RD1 A;  4C92 A;  3P8B B;  4F7U G;  1X01 A;  3A5Z B;  4BAC A;  3S3O A;  1VQ6 T;  1VQ6 A;  5LJ5 h;  3JCM Q;  3GNF B;  1FXX A;  1YHQ A;  3OW2 S;  4M75 G;  1KC8 U;  4OB0 B;  2P0Q A;  3J7A F;  4MML A;  3QDR B;  3RMS A;  3TCJ A;  4BUG A;  2LNV A;  1I4K 1;  1KHI A;  3URG A;  2E10 A;  3I56 A;  5LL6 S;  4N4H A;  4C0Z A;  3I56 T;  3CD6 T;  4BY6 C;  5GAO q;  1V29 B;  5LJ3 h;  1Q86 U;  2KK4 A;  2DIQ A;  1VQ5 A;  2DZ9 A;  2QA4 A;  3JCM X;  1O9S A;  3JB9 J;  1FX7 A;  3EAE A;  3M55 A;  2JZ2 A;  3MHX A;  3OSS C;  1VQ5 T;  4M75 F;  1M5Q 1;  3OYY A;  4BE0 A;  1VQP T;  1YBY A;  2O4X A;  4QQG A;  2R57 A;  2KQW A;  2LT4 A;  2YLB A;  2RHX A;  4O6J A;  2WSF E;  5J3B A;  3SFM A;  5GAN d;  5GAO m;  1S72 T;  4L5G A;  3RKY A;  4C8Q E;  2DTO A;  4UC4 A;  4LDY A;  2EQJ A;  3OS5 A;  4M78 B;  2Y90 A;  2EQU A;  2O01 E;  2K3X A;  2VUB A;  4BE1 A;  4ZN3 A;  2R5M A;  3VJP A;  2PVG B;  1WQW A;  2QTX A;  3BDU A;  2GQV A;  1VQ7 A;  4OVA A;  2DZC A;  4M77 F;  4QW2 A;  1VQ7 T;  5FU6 B;  4XTU A;  5GAN 3;  1BYM A;  4F7U B;  5A0D A;  3OMG A;  1XOV A;  3M56 A;  2OTJ A;  1G3T A;  4HT8 A;  1NZ9 A;  2M1H A;  2DJZ A;  2X4Y A;  5FRO A;  4JLG A;  3QUI A;  1G3W A;  5FLX E;  3CC4 A;  1Y07 A;  4HCZ A;  3GIB A;  4M7D C;  4CRI A;  3WVE B;  1Y71 A;  3CC4 T;  4N4I A;  5IN1 A;  1Q82 U;  4OMF B;  2EKO A;  3JCM g;  2GCX A;  2R58 A;  3FIF A;  3M4Y A;  3V7R A;  4RMO A;  1G3Y A;  1M4Z A;  5GAN 6;  4IUT A;  3C95 A;  3V7S A;  4FSX A;  4XU3 A;  3JCM J;  2CS7 A;  3X28 B;  1KQ2 A;  4V2S A;  3HSB A;  3CPF A;  2RB6 A;  3NTH A;  3CCQ T;  1M1F A;  1BI1 A;  2E70 A;  3C94 A;  4OGC A;  5CQY A;  3PMT A;  2RHU A;  3NFC A;  5GMK i;  2A7Y A;  2PQW A;  1K73 C;  2YHT A;  1HK9 A;  5J39 A;  2LX9 A;  4M78 A;  3VU3 C;  3LGL A;  3S6W A;  5DLO A;  3CME A;  1N9R A;  3CME T;  1EIF A;  3CMA T;  4M78 C;  3SD4 A;  2GFU A;  1Y7X A;  2YLC A;  4F7U A;  4MZP A;  3JAM E;  4GY5 A;  1OZ2 A;  5DLQ E;  2QEX T;  2WAC A;  3JB9 D;  2EAY A;  4M7A A;  2WSC E;  2DXB A;  5LJ5 d;  4C5E A;  1VQN T;  4QVD A;  2DTH A;  1N27 A;  4FM4 B;  2QQA A;  2QQ9 A;  2DAQ A;  1M9S A;  3FB9 A;  2M16 A;  4II1 A;  4M75 C;  1Q81 C;  5GAN 8;  2XDD A;  5GAO r;  4EMK A;  5GAM h;  5DM7 R;  3X20 B;  2QI2 A;  3OB9 A;  4NL3 A;  2QXF A;  1VQO T;  2FB7 A;  2DD4 A;  5GAN h;  5GAN 5;  4Z02 A;  2JVV A;  2QQB A;  2ZPB B;  2D6F A;  1JJ2 S;  5LJ3 d;  4M77 E;  3JB9 I;  2I2L A;  3GLX A;  5CVI A;  3OYN A;  2ZZD A;  4OF1 A;  1VQ8 T;  2FL7 A;  3L2R A;  2CZ1 B;  4P5N A;  5KE2 A;  5GMK h;  1YI2 T;  4A4E A;  1WNL A;  1ZHI A;  1M1K U;  3OYC A;  2VGN A;  3TRE A;  2CZ6 B;  1VQL T;  4YTL A;  3CCL A;  3OQ5 A;  4L59 A;  4BI8 B;  2MWO A;  3CC2 T;  2D9T A;  4M7D G;  3X25 B;  3MEW A;  3OYI A;  4J83 A;  2F5K A;  4C8Q F;  4NOY A;  4BY6 B;  4ATO A;  3QPH A;  4MDX A;  4LDU A;  1Y96 A;  3VYH B;  2EQM A;  2L3R A;  2MI6 A;  4IUU A;  1QVF A;  1R8O B;  1X6O A;  3PT9 A;  1GXI E;  2LVM A;  2VV5 A;  3ASK A;  2WSE E;  4ZGD B;  2KAF A;  3PIO A;  3OYL A;  1XNI A;  3OYH A;  2XID A;  4JRI A;  3ZFJ A;  1KQS A;  4DOV A;  3JCM b;  5GAO p;  2BKD N;  4IUV A;  1QVP A;  5I21 A;  1QVG S;  2CYZ B;  4R56 A;  2L8D A;  3JCM c;  2DVE A;  4LD9 K;  2D0Q B;  3UPU A;  2M9U A;  1G5V A;  2L5Q A;  3PMI A;  5KH6 A;  5IAY A;  3CCE A;  4ZTJ A;  3SB2 A;  2PUO B;  4PJO F;  2RM4 A;  3KBG A;  4XU2 A;  1BI2 A;  5KCH A;  4QQD A;  2PU9 B;  2ZCF B;  2X4W A;  5FU7 C;  1KHC A;  1YCY A;  4RCC A;  2LDM A;  2DD5 A;  2V8J A;  1BI3 A;  2VC8 A;  2MF2 A;  3VV0 A;  3JCM W;  3H6Z A;  2RHZ A;  3QSU A;  3JCM V;  1WQ7 A;  5CKF A;  2L89 A;  4EDU A;  4M7D B;  1P92 A;  3MO8 A;  1UGR B;  3FLG A;  3V8L A;  2FVU A;  4PKC C;  2DO3 A;  3ER0 A;  4X34 A;  3SWN C;  3CD6 A;  2V8I A;  1G3S A;  4Y28 E;  3HPW A;  3M54 A;  3CCS T;  4CI0 C;  3QHS A;  2HNI A;  1UGQ B;  2XU8 A;  4ME7 A;  4N0A C;  3CXC A;  3ZBD A;  3FEO A;  4C0G A;  1RL2 A;  3OYK A;  1VQP A;  4C92 E;  4J7I A;  4M77 G;  3OYJ A;  1QW1 A;  4PLI A;  3X24 B;  5CK9 A;  5GAM d;  3L2V A;  4WF2 A;  1S72 A;  2ZGW A;  4JRQ A;  1B34 B;  2EJG A;  3JCM h;  5GAO n;  1M1G A;  2E6N A;  2RA2 A;  3C12 A;  4XTZ A;  3OA6 A;  1K73 U;  4M78 D;  4ZTF A;  3MP6 A;  4EPC A;  1U8R A;  4IKF A;  2RHI A;  2X35 A;  4XTV A;  4DQ2 A;  1M90 C;  5L8R E;  3CBM A;  3PIP A;  2JTF A;  3A8H B;  3HP9 A;  2LQK A;  4IUP A;  4IUQ A;  3FDR A;  5FRM A;  1PSF A;  3CPW S;  1NE8 A;  3DLM A;  4PL6 A;  3UDC A;  3VYG A;  4QVZ A;  3G7Z A;  3M57 A;  4M7A D;  4M7D A;  4M75 B;  4A4K A;  1BIA A;  2RI2 A;  3CCU T;  4OGE A;  3HRT A;  2EJ9 A;  2OTL T;  1N6A A;  4KT0 E;  3QZ9 B;  3JB9 H;  1NPP A;  4PJO E;  1Q81 U;  4JDS A;  1VQM A;  1WJQ A;  2EFI A;  1VQM T;  3JCM P;  2LCC A;  4XU1 A;  3ZEH A;  4HT9 A;  2ZPG B;  4DA4 A;  1WGS A;  3CCR A;  3OYA A;  4JS4 A;  5IT9 E;  4C0D B;  3CCR T;  3C4S A;  4M77 B;  1QP2 A;  3CCQ A;  3OYD A;  2RI5 A;  3H8Z A;  3HRS A;  2XDB A;  3S3N A;  3QKJ A;  4C5I A;  1B34 A;  2EJF A;  2BUD A;  4X9D A;  4E7L A;  2VYT A;  2IVW A;  2K5L A;  3LWI A;  4LDX A;  4MZM A;  1VUB A;  1XTD A;  4A54 A;  4L6V 5;  3CMA A;  2K2V A;  3LGF A;  1ZQ1 A;  1KD1 U;  2E12 A;  5HK0 A;  3GF5 A;  4JRK A;  3MET A;  4XK8 E;  5CKH A;  2H3J A;  4ZGJ B;  1NJI C;  2QEX A;  1VQ4 A;  4XTX A;  5A0G A;  3HL8 A;  5LJ5 e;  1VQ4 T;  2X4X A;  3VUZ A;  3JB9 F;  1RI0 A;  1VQN A;  4M75 A;  1UGS B;  4EMG A;  1VQK A;  2XI9 A;  2CZ7 B;  4C5H A;  4ZN1 A;  3CCL T;  1DJ7 B;  2A3L A;  1VQK T;  4EMH A;  3G6E T;  2LQ8 A;  4FIB A;  4N4G A;  1VQO A;  3QG1 A;  5HK3 A;  4LDV A;  1BIB A;  2E1H A;  4O5V A;  1WPY A;  1SSF A;  4C92 G;  2G3R A;  2DXT A;  3T9N A;  5LJ3 e;  1W2B A;  1YIJ T;  1PSE A;  3CC7 T;  3QXE B;  4QQ6 A;  3G4S A;  5FU7 B;  1VQ8 A;  3G4S T;  4M77 A;  2XD0 A;  4C8Q G;  1WJS A;  4GLK A;  3LH0 A;  4PLL A;  1I5L A;  2RK2 A;  4M7A E;  3QJY A;  1YI2 A;  3V8K A;  4C0D C;  3HRU A;  2RK1 A;  1IRE B;  4M77 C;  2DK3 A;  3QZ5 B;  4B9W A;  4JRP A;  1K8A C;  3CBP A;  1VIF A;  3RMQ A;  2OAU A;  4NS5 A;  4TVR A;  4C92 F;  3JCM d;  1VQL A;  1H3Z A;  1UB4 A;  1LOJ A;  3E1S A;  3N5B B;  1KD1 C;  5CKD A;  3CC2 A;  3A8G B;  3SWN B;  5GAN 2;  2XG8 D;  3QYH B;  3M53 A;  3PNW C;  4A4G A;  5AYF A;  5LJ5 f;  1JRI A;  3J80 E;  1Q7Y C;  2CKK A;  2XKO C;  5CKE A;  3RKW A;  3DB4 A;  3WVD B;  4ELY C;  4A4F A;  1FWZ A;  3FC3 A;  4RG8 A;  2R5A A;  3UWN A;  4ZGE B;  4PJO G;  3OSV A;  3A8M B;  4MZT A;  2V8K A;  4OB3 B;  4XU0 A;  3VUB A;  4E7J A;  3MP1 A;  2RO0 A;  3MEA A;  4J6W A;  5LJ3 f;  3RER A;  3E9F A;  1QP3 A;  1M8V A;  3L1A A;  3RIR A;  3OS0 A;  4C92 B;  3P8D A;  4XTY A;  1QVF S;  3R6O A;  3L2W A;  2EWN A;  4C8Q B;  3BY7 A;  2DIG A;  3S3M A;  3ME9 A;  5CR2 A;  4C5G A;  5A2Q E;  1KQS S;  1M90 U;  4Q5W A;  5LJ5 j;  2E64 A;  4FT4 A;  3GOX A;  3SWN A;  4M7D D;  3QBY A;  2ZPF B;  2E65 A;  2GFA A;  1OZ3 A;  4BI3 A;  4VUB A;  3LYI A;  2XDP A;  1OYX A;  2CGH A;  4N0A A;  2MWP A;  2ZPI B;  3CCS A;  5LJ3 j;  3OW2 A;  2K3Y A;  4MMK A;  1VIE A;  4PJO B;  3X26 B;  1VQ9 T;  3A8L B;  3PTA A;  3L2U A;  2JUF A;  2X4J A;  3HFN A;  2HAX A;  5GAM e;  5M9O A;  1UEB A;  4E7H A;  4J7F A;  1D3B B;  3V7C A;  4RKU E;  5GAN e;  5CQX A;  1I81 A;  3JSC A;  1N9S A;  3HKS A;  4M7A G;  2QQS A;  1HXD A;  2KMT A;  2MMP A;  3A8O B;  4M78 F;  4C92 C;  1YHQ T;  3F70 A;  4C8Q A;  1LNX A;  4LD6 A;  2EYQ A;  2VXE A;  3P8H A;  5CAI A;  3CXC S;  3G71 A;  1LJO A;  4E7K A;  5GMK e;  3G71 T;  3GNG A;  4XQ3 A;  4C8Q C;  3NTK A;  2ZPH B;  4JLI A;  4F7U F;  1BI0 A;  3MEU A;  1NJI U;  2QQR A;  3EFR A;  3WXM B;  4M7A F;  5CKB A;  2QA4 T;  2BIV A;  4LDW A;  4M75 D;  4KUL A;  1MHN A;  3LLR A;  3CCU A;  3OS1 A;  3QYG B;  4MDW A;  1O75 A;  5GAO l;  3CPW A;  2OTL A;  4JJN K;  2JOY A;  1IZ6 A;  2PUK B;  3OY9 A;  4KUI A;  3JRZ A;  3OMC A;  5LJ5 g;  3LWH A;  4JS5 A;  1MGQ A;  3CCM A;  4PJO A;  3CCM T;  4HCB A;  3J81 E;  3BDL A;  4QVC A;  2XIC A;  2NLU A;  2RJE A;  2HD0 A;  1U1T A;  3FRN A;  4FU6 A;  2E41 A;  5GAM f;  3OYM A;  3L2Q A;  4BDY A;  4BDZ A;  2EIF A;  5GAN f;  4M77 D;  4R55 A;  3OYE A;  1JB0 E;  4HCC A;  4PJO C;  4KBM B;  5FRN A;  1D3B A;  4M7D E;  5HY6 A;  5LJ3 g;  4M7A B;  2K57 A;  3E9G A;  2P0K A;  3QO3 A;  4XTW A;  5HKC A;  3JB9 G;  1KC8 C;  1YJ9 A;  2OTJ T;  1K8A U;  3AHU A;  1YJ9 T;  5CCA A;  3OYF A;  3OYG A;  1WJR A;  4J6X A;  4A4H A;  4D6W A;  3GP8 A;  1KG1 A;  4RCB A;  4HA8 A;  5DY9 A;  4HKE A;  4EMK B;  1JBM A;  2LT1 A;  1Q86 C;  3CCV A;  2LTO A;  3E19 A;  3CCV T;  3M4G A;  2KY9 A;  1Q7Y U;  3MEV A;  3EFS A;  3G6E A;  5D6Y A;  2FYK A;  2XHC A;  2YRV A;  3INZ A;  4FT2 A;  3OBW A;  5GAM j;  2E6Z A;  2F69 A;  1U1S A;  5J26 A;  1W4S A;  5GAN 7;  4M78 E;  4BE2 A;  5GAN j;  2DKG A;  1ZBX A;  4OB1 B;  5I2M A;  4J6Y A;  3GPL A;  5C0M A;  3CC7 A;  1YIJ A;  1K9M U;  3HHT B;  3LX7 A;  3O8V A;  5D6X A;  1YJW A;  4Y91 A;  5KE3 A;  1YJW T;  3TU4 K;  4B9X A;  4F7U E;  3DKM A;  2RJC A;  3OYB A;  5GMK j;  2VXF A;  1Y96 B;  2DTI A;  5A0L A;  2FHD A;  3LW5 E;  3PGG A;  1X75 C;  4M75 E;  1JJ2 A;  2B8A A;  3M58 A;  3KUF A;  3JCM e;  2RH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...